BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20735_g2_i1 len=996 path=[2143:0-473 556:474-504 4175:505-550
2693:551-605 1999:606-664 2058:665-995]

Length=996
                                                                      Score     E

ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    384   4e-128   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           383   8e-128   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           381   6e-127   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           377   3e-125   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           377   4e-125   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   376   7e-125   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           375   1e-124   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           375   1e-124   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           375   2e-124   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           374   3e-124   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              374   5e-124   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           373   8e-124   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           373   8e-124   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           372   2e-123   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    371   3e-123   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           370   9e-123   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           368   6e-122   
gb|ABQ95989.1|  phospholipase A1                                        368   7e-122   Capsicum annuum
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           368   7e-122   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              366   6e-121   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    365   9e-121   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           365   1e-120   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              363   6e-120   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    363   8e-120   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           362   1e-119   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           362   2e-119   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           362   2e-119   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                357   1e-117   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                356   3e-117   
ref|XP_002522554.1|  triacylglycerol lipase, putative                   357   4e-117   Ricinus communis
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           357   5e-117   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           357   5e-117   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             353   7e-116   
ref|XP_002316835.2|  lipase class 3 family protein                      352   2e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                350   2e-114   
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                350   2e-114   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         349   2e-114   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   349   2e-114   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              346   5e-113   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              346   5e-113   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           343   4e-112   
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     340   5e-112   
ref|XP_002305750.2|  lipase class 3 family protein                      343   6e-112   Populus trichocarpa [western balsam poplar]
emb|CDO96757.1|  unnamed protein product                                341   9e-112   
emb|CBI30665.3|  unnamed protein product                                339   5e-111   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           340   9e-111   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     340   1e-110   Vitis vinifera
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     339   3e-110   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           340   4e-110   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           339   4e-110   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           338   5e-110   
ref|XP_003593747.1|  Lipase                                             338   5e-110   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              338   1e-109   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   337   1e-109   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              337   2e-109   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   336   3e-109   
emb|CDO96758.1|  unnamed protein product                                336   3e-109   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           335   4e-109   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    335   7e-109   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           336   9e-109   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           335   1e-108   
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                333   1e-108   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              335   2e-108   
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             332   2e-107   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           331   3e-107   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           331   4e-107   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          331   4e-107   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                331   6e-107   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           330   7e-107   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           330   7e-107   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           329   2e-106   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           328   3e-106   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           329   4e-106   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   328   6e-106   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                328   1e-105   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             326   1e-105   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           326   5e-105   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       326   9e-105   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    325   1e-104   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                323   5e-104   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   322   9e-104   Ricinus communis
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           322   9e-104   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                323   1e-103   
emb|CDP11819.1|  unnamed protein product                                320   5e-103   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           320   9e-103   
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            318   2e-102   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           319   4e-102   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             318   9e-102   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              317   2e-101   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             317   4e-101   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                316   5e-101   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              315   5e-101   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    316   5e-101   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           315   1e-100   
ref|XP_002867985.1|  lipase class 3 family protein                      313   6e-100   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             311   7e-100   Oryza sativa Indica Group [Indian rice]
emb|CDY01554.1|  BnaC07g35440D                                          312   1e-99    
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              311   2e-99    
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             311   2e-99    
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    312   3e-99    
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      310   3e-99    
emb|CDY53993.1|  BnaA03g58180D                                          308   3e-99    
ref|XP_002525129.1|  triacylglycerol lipase, putative                   310   3e-99    Ricinus communis
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     308   4e-99    
emb|CDM83551.1|  unnamed protein product                                310   4e-99    
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           310   6e-99    
emb|CDM85400.1|  unnamed protein product                                310   7e-99    
gb|EMT21704.1|  Putative lipase                                         310   8e-99    
gb|EMT15519.1|  Lipase                                                  308   1e-98    
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    308   1e-98    
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       308   2e-98    
ref|NP_001151242.1|  triacylglycerol lipase                             308   2e-98    Zea mays [maize]
ref|NP_001149813.1|  triacylglycerol lipase                             308   3e-98    Zea mays [maize]
dbj|BAJ96485.1|  predicted protein                                      307   3e-98    
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   307   3e-98    
ref|NP_001152663.1|  triacylglycerol lipase precursor                   308   3e-98    Zea mays [maize]
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   307   7e-98    
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    306   1e-97    
ref|NP_193590.1|  phospholipase A1-IIgamma                              306   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          305   2e-97    Sorghum bicolor [broomcorn]
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    305   3e-97    
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                306   1e-96    
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           303   1e-96    
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    303   1e-96    
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    305   2e-96    
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    303   2e-96    
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             303   3e-96    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90094.1|  predicted protein                                      301   3e-96    
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              303   4e-96    
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    303   5e-96    Oryza sativa Indica Group [Indian rice]
gb|EPS70940.1|  hypothetical protein M569_03817                         301   6e-96    
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          301   7e-96    
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           300   2e-95    
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              301   2e-95    
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           301   3e-95    
gb|EMS63185.1|  Phospholipase A1-II 1                                   311   3e-95    
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          301   3e-95    Sorghum bicolor [broomcorn]
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                300   5e-95    
dbj|BAJ95995.1|  predicted protein                                      300   6e-95    
ref|NP_001043734.1|  Os01g0651800                                       300   9e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           299   1e-94    
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              300   1e-94    
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          298   3e-94    Sorghum bicolor [broomcorn]
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              299   4e-94    
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       311   2e-93    
gb|ABK96341.1|  unknown                                                 295   2e-93    Populus trichocarpa x Populus deltoides
gb|EEE64775.1|  hypothetical protein OsJ_19631                          294   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608142.1|  Lipase                                             292   6e-93    
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           295   7e-93    
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             294   7e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              294   1e-92    
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           292   2e-92    
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             293   2e-92    
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             292   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          291   4e-92    Sorghum bicolor [broomcorn]
gb|EMS51987.1|  Phospholipase A1-II 3                                   293   4e-92    
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    306   5e-92    
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              292   5e-92    
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              292   6e-92    
gb|AFK47098.1|  unknown                                                 291   7e-92    
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             291   7e-92    
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             291   8e-92    
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           291   1e-91    
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              291   1e-91    
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              291   2e-91    
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          291   2e-91    Sorghum bicolor [broomcorn]
gb|EMS68153.1|  Phospholipase A1-II 7                                   290   2e-91    
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           290   4e-91    
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              290   5e-91    
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         287   1e-90    
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              288   2e-90    
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           288   2e-90    
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           288   2e-90    
gb|EEE64776.1|  hypothetical protein OsJ_19632                          283   5e-90    Oryza sativa Japonica Group [Japonica rice]
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         286   1e-89    
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    285   2e-89    
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           285   2e-89    
ref|NP_001056387.1|  Os05g0574100                                       285   2e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608120.1|  Lipase                                             284   8e-89    
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              284   1e-88    
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          283   2e-88    Sorghum bicolor [broomcorn]
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    281   5e-88    
gb|EMT11182.1|  hypothetical protein F775_27795                         283   6e-88    
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           281   1e-87    
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           281   1e-87    
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              281   1e-87    
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              281   1e-87    
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             280   2e-87    Oryza sativa Indica Group [Indian rice]
ref|NP_001043730.2|  Os01g0651200                                       280   3e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             279   5e-87    
gb|AAB07724.1|  Pn47p                                                   278   7e-87    Ipomoea nil [qian niu]
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           280   7e-87    
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          276   3e-86    
gb|EMT15520.1|  Feruloyl esterase A                                     284   3e-86    
gb|ABK23399.1|  unknown                                                 277   4e-86    Picea sitchensis
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    276   4e-86    
emb|CBI21954.3|  unnamed protein product                                276   7e-86    
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     276   9e-86    Zea mays [maize]
gb|ABR18391.1|  unknown                                                 276   1e-85    Picea sitchensis
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              275   2e-85    
ref|XP_007014120.1|  Alpha/beta-Hydrolases superfamily protein          274   8e-85    
gb|EMT05578.1|  hypothetical protein F775_13080                         273   9e-85    
gb|EAY99121.1|  hypothetical protein OsI_21080                          272   2e-84    Oryza sativa Indica Group [Indian rice]
gb|EMS63790.1|  Phospholipase A1-II 7                                   276   2e-84    
ref|XP_003608122.1|  Lipase                                             271   2e-84    
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              271   7e-84    
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            271   1e-83    
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    271   1e-83    
gb|KDP46903.1|  hypothetical protein JCGZ_24112                         270   1e-83    
ref|XP_006655614.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    270   1e-83    
emb|CDX76515.1|  BnaA08g08850D                                          270   2e-83    
dbj|BAD68802.1|  lipase-like protein                                    270   3e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75192.1|  hypothetical protein OsI_03084                          270   3e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            269   6e-83    
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             268   9e-83    
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             268   1e-82    
gb|KDP46901.1|  hypothetical protein JCGZ_24110                         267   2e-82    
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          267   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|EMS48809.1|  Phospholipase A1-II 6                                   268   3e-82    
ref|XP_002522552.1|  triacylglycerol lipase, putative                   266   4e-82    Ricinus communis
ref|NP_172115.1|  phospholipase A1-IIalpha                              267   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   268   5e-82    
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             266   5e-82    
emb|CDX84801.1|  BnaA03g14290D                                          266   5e-82    
gb|AAM61647.1|  lipase-like protein                                     266   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                267   6e-82    
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  265   7e-82    
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            266   7e-82    
emb|CDY10187.1|  BnaC05g04300D                                          265   9e-82    
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             264   1e-81    
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 265   1e-81    
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              266   2e-81    
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              265   2e-81    
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    265   2e-81    
gb|KDP21071.1|  hypothetical protein JCGZ_21542                         264   3e-81    
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                264   4e-81    
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           262   7e-81    
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           263   8e-81    
emb|CDY23963.1|  BnaC03g17280D                                          263   8e-81    
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             263   1e-80    
emb|CDY57813.1|  BnaA10g28020D                                          267   1e-80    
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                261   2e-80    
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              263   3e-80    
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           261   7e-80    
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           261   8e-80    
gb|EMS52156.1|  Phospholipase A1-II 2                                   259   1e-79    
ref|XP_002522553.1|  triacylglycerol lipase, putative                   259   8e-79    Ricinus communis
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              258   2e-78    
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          256   2e-78    Sorghum bicolor [broomcorn]
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          257   3e-78    Sorghum bicolor [broomcorn]
emb|CDY34061.1|  BnaC03g62710D                                          255   9e-78    
emb|CDX99456.1|  BnaC01g10960D                                          255   1e-77    
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   256   1e-77    
ref|XP_002881156.1|  hypothetical protein ARALYDRAFT_320861             253   1e-77    
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        254   1e-77    Sorghum bicolor [broomcorn]
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           253   4e-77    
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    253   5e-77    
gb|AAC63840.1|  putative lipase                                         251   7e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              253   9e-77    
emb|CDX86530.1|  BnaC08g01730D                                          253   9e-77    
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           252   2e-76    
gb|KDP21072.1|  hypothetical protein JCGZ_21543                         250   7e-76    
dbj|BAA89335.1|  EEF53                                                  243   7e-76    Solanum melongena [aubergine]
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    248   2e-75    
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg             248   3e-75    
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              249   4e-75    
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like           248   4e-75    
ref|XP_007025428.1|  Alpha/beta-Hydrolases superfamily protein          247   7e-75    
gb|EAY75191.1|  hypothetical protein OsI_03083                          246   1e-74    Oryza sativa Indica Group [Indian rice]
gb|KDP46905.1|  hypothetical protein JCGZ_24114                         247   1e-74    
gb|ABK24664.1|  unknown                                                 247   2e-74    Picea sitchensis
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             248   4e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein          244   1e-73    
ref|NP_001044041.1|  Os01g0710700                                       246   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like           243   3e-73    
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           242   8e-73    
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              244   9e-73    
gb|EMT04701.1|  Lipase                                                  239   4e-72    
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like           238   1e-71    
gb|EEE55280.1|  hypothetical protein OsJ_03214                          245   1e-71    
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              236   7e-71    
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           235   4e-70    
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          234   1e-69    
emb|CDM83808.1|  unnamed protein product                                235   1e-69    
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           234   2e-69    
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    233   2e-69    
ref|XP_001781080.1|  predicted protein                                  233   3e-69    
gb|EMS63050.1|  Phospholipase A1-II 5                                   236   3e-69    
gb|EMS50696.1|  Phospholipase A1-II 7                                   230   4e-69    
dbj|BAJ85084.1|  predicted protein                                      234   4e-69    
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          234   5e-69    
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              232   3e-68    
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   232   5e-68    
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             232   7e-68    
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           230   7e-68    
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    232   8e-68    
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   231   8e-68    
emb|CDY24728.1|  BnaC04g13330D                                          228   2e-67    
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           231   4e-67    
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           228   5e-67    
ref|XP_010058983.1|  PREDICTED: phospholipase A1-IIgamma-like           225   8e-67    
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    229   8e-67    
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                226   1e-66    
emb|CDM86668.1|  unnamed protein product                                229   2e-66    
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            226   2e-66    
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    228   2e-66    
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    228   2e-66    
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             228   4e-66    
ref|NP_001168256.1|  hypothetical protein                               224   6e-66    
gb|KCW74056.1|  hypothetical protein EUGRSUZ_E02682                     224   7e-66    
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    227   7e-66    
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             224   8e-66    
dbj|BAJ99811.1|  predicted protein                                      227   1e-65    
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                227   1e-65    
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           225   1e-65    
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    226   2e-65    
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                223   2e-65    
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           223   2e-65    
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                     222   2e-65    
ref|XP_010087133.1|  Phospholipase A1-Igamma1                           225   4e-65    
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    225   4e-65    
dbj|BAJ85876.1|  predicted protein                                      224   4e-65    
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    225   5e-65    
dbj|BAJ88202.1|  predicted protein                                      223   6e-65    
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             223   6e-65    
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    219   6e-65    
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             224   6e-65    
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         224   7e-65    
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           222   7e-65    
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   222   8e-65    
ref|XP_010673678.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    224   9e-65    
emb|CDP03693.1|  unnamed protein product                                221   9e-65    
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    224   1e-64    
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like           222   1e-64    
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           221   1e-64    
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    224   1e-64    
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    223   2e-64    
ref|XP_002303465.1|  lipase family protein                              221   2e-64    
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    223   2e-64    
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             223   2e-64    
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          219   2e-64    
gb|ACZ57769.1|  phospholipase A3                                        212   3e-64    
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           220   3e-64    
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    223   3e-64    
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    222   4e-64    
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              218   4e-64    
gb|EPS68355.1|  hypothetical protein M569_06415                         213   6e-64    
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           221   7e-64    
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   8e-64    
ref|XP_002892328.1|  predicted protein                                  217   8e-64    
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         221   8e-64    
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           218   8e-64    
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             221   9e-64    
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           218   1e-63    
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    221   1e-63    
gb|EPS65213.1|  hypothetical protein M569_09566                         218   1e-63    
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          221   1e-63    
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             220   1e-63    
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    221   1e-63    
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          221   2e-63    
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    220   2e-63    
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    222   2e-63    
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like           218   3e-63    
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    220   3e-63    
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         220   4e-63    
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      214   4e-63    
gb|ABR16123.1|  unknown                                                 220   5e-63    
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                218   6e-63    
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    219   6e-63    
gb|KEH23856.1|  phospholipase A1                                        219   8e-63    
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             219   8e-63    
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    219   9e-63    
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    218   1e-62    
emb|CAN74039.1|  hypothetical protein VITISV_012945                     218   1e-62    
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    219   1e-62    
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          216   2e-62    
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   2e-62    
ref|NP_564590.1|  DAD1-like lipase 2                                    218   2e-62    
emb|CDY50817.1|  BnaC04g52540D                                          215   2e-62    
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                216   2e-62    
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    218   3e-62    
emb|CDM86669.1|  unnamed protein product                                218   3e-62    
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             215   3e-62    
gb|ACJ85535.1|  unknown                                                 215   4e-62    
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             214   4e-62    
emb|CDY47985.1|  BnaA04g24630D                                          214   4e-62    
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                214   6e-62    
ref|XP_004968489.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    218   7e-62    
ref|XP_002891639.1|  lipase class 3 family protein                      217   7e-62    
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   7e-62    
emb|CDY49813.1|  BnaC06g04560D                                          216   1e-61    
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          213   1e-61    
ref|XP_008235325.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   1e-61    
gb|EMT05279.1|  Lipase                                                  210   1e-61    
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                     216   1e-61    
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         213   1e-61    
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890    224   1e-61    
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   2e-61    
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    216   2e-61    
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     215   2e-61    
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    216   2e-61    
gb|EMT07769.1|  hypothetical protein F775_18307                         207   2e-61    
emb|CBI21996.3|  unnamed protein product                                214   2e-61    
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             216   2e-61    
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    215   3e-61    
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    215   3e-61    
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          215   3e-61    
ref|XP_003607601.1|  Feruloyl esterase A                                213   4e-61    
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg             213   4e-61    
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             212   5e-61    
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    214   5e-61    
emb|CDY22842.1|  BnaA06g02350D                                          214   5e-61    
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                213   6e-61    
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             213   9e-61    
emb|CDO98286.1|  unnamed protein product                                211   1e-60    
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    214   1e-60    
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    221   1e-60    
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein          213   1e-60    
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   211   1e-60    
emb|CDP15943.1|  unnamed protein product                                211   1e-60    
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           211   1e-60    
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    213   2e-60    
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    213   2e-60    
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             213   2e-60    
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    213   2e-60    
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    211   2e-60    
ref|XP_008355592.1|  PREDICTED: phospholipase A1-IIgamma-like           205   2e-60    
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    211   3e-60    
tpg|DAA53109.1|  TPA: hypothetical protein ZEAMMB73_566262              212   3e-60    
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             210   3e-60    
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    212   3e-60    
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    212   3e-60    
ref|NP_181797.1|  phospholipase A1-IIdelta                              209   3e-60    
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           209   4e-60    
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             213   4e-60    
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    213   4e-60    
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                209   4e-60    
ref|XP_002879267.1|  lipase class 3 family protein                      212   4e-60    
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    213   5e-60    
dbj|BAJ85518.1|  predicted protein                                      212   5e-60    
emb|CDY14851.1|  BnaC04g48480D                                          208   5e-60    
ref|XP_002518706.1|  triacylglycerol lipase, putative                   209   6e-60    
ref|XP_008355590.1|  PREDICTED: phospholipase A1-IIgamma-like           204   7e-60    
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    211   9e-60    
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             211   9e-60    
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    211   1e-59    
gb|AAD01804.1|  lipase                                                  209   1e-59    
ref|XP_003607369.1|  Lipase                                             211   1e-59    
gb|ACJ76846.1|  chloroplast lipase protein                              211   1e-59    
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           208   1e-59    
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             208   1e-59    
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    210   2e-59    
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    211   2e-59    
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    210   2e-59    
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    209   2e-59    
emb|CDY29665.1|  BnaA04g17620D                                          210   2e-59    
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                208   2e-59    
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          210   2e-59    
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    210   2e-59    
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    210   2e-59    
emb|CDX97819.1|  BnaC04g41200D                                          209   3e-59    
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             207   3e-59    
emb|CDY10228.1|  BnaC05g04710D                                          209   3e-59    
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    208   3e-59    
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like              206   3e-59    
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    209   4e-59    
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840          210   4e-59    
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    209   4e-59    
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    209   4e-59    
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    209   5e-59    
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             209   5e-59    
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                206   6e-59    
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    209   6e-59    
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             209   6e-59    
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    209   6e-59    
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          209   7e-59    
ref|NP_001056386.2|  Os05g0574000                                       200   7e-59    
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     206   7e-59    
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       209   7e-59    
ref|NP_849603.1|  phospholipase A1-Igamma1                              209   7e-59    
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    209   9e-59    
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    207   1e-58    
ref|XP_010269807.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    207   1e-58    
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    207   2e-58    
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             208   2e-58    
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    205   2e-58    
ref|XP_010246745.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    207   3e-58    
gb|EPS65211.1|  hypothetical protein M569_09564                         204   3e-58    
ref|XP_002513514.1|  triacylglycerol lipase, putative                   206   3e-58    
ref|XP_002892359.1|  lipase class 3 family protein                      207   3e-58    
emb|CDP09265.1|  unnamed protein product                                206   3e-58    
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    207   4e-58    
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    206   4e-58    
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    204   4e-58    
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    206   5e-58    
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    206   5e-58    
gb|KGN44761.1|  hypothetical protein Csa_7G378500                       206   6e-58    
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           204   6e-58    
gb|KEH23857.1|  phospholipase A1                                        205   7e-58    
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                     204   9e-58    



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   384 bits (986),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/289 (65%), Positives = 222/289 (77%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y++E+P S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTEDPRSQFNQVSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF   +    NLH+LRI NV DIVP+
Sbjct  230  NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  ++ +WH LE YLHG+AGT+G G+L GF L
Sbjct  290  YPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+EY IPG WW +K+ GMVQQ DGSW L++ EE
Sbjct  346  EVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  394



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   383 bits (984),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 221/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGNGGLVPLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFY++Y++ENP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYSIYTTENPRSKFNQYSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS GK FPVT FV+ASP+ GD NF+  +     LH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQMAFSKLKTLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DVG EL ID +KS Y+K   D+  WHNLE Y+HG+AGT+G G+L GF L
Sbjct  290  YPP----LGYIDVGEELIIDTTKSPYLKLPGDVLTWHNLECYMHGVAGTQGLGLLTGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRD++L NKS   LK+EY IP NWW EK+ GM+QQ+DG+W L++ E+
Sbjct  346  EVNRDLALANKSSGALKDEYCIPANWWTEKHKGMIQQEDGTWLLLDRED  394



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 222/289 (77%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+D +FLLVPAP++FG G       P
Sbjct  110  FMGYIAVATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN    RDQV+ EVKRLVE YKNE+VSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DI  NG N T++GK FPVT FV+ASP+ GD+NF   +    NLH+LRI N+ DIVP+
Sbjct  230  NAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  DI +WH LE YLHG+AGT+G G+L GF L
Sbjct  290  YPP----IGYIDVGKELMIDTTKSPYVKPPGDIASWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+E+ IPG+WWVEK+ GMVQQ DG+W L++ EE
Sbjct  346  EVNRDISLVNKMGDTLKDEHCIPGHWWVEKHKGMVQQQDGTWLLLDREE  394



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   377 bits (968),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 222/290 (77%), Gaps = 10/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+P S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSEDPRSKFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS GK FPVT FV+ASP+ GD NF+  +    NLH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQKTFSKLKNLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPST-DIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
             PP    +GY DVG E+ ID +KS Y+K +  D    HNLEGYLHGI GT+G G+L GF 
Sbjct  290  YPP----VGYIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGILAGFK  345

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L VNRD++LVN+  D LK+EY IP  WW EK+ GMVQQ+DG+W L++ E+
Sbjct  346  LEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRED  395



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   377 bits (967),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/290 (64%), Positives = 222/290 (77%), Gaps = 10/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI++ WRGTI+TLEWV+DLEFLL+P P++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVIAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+P S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSEDPRSMFNQASARDQVLEEVKRLVEEYKNEEVSITVAGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS GK FPVT FV+ASP+ GD NF+  +    NLH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNGFNKTSSGKEFPVTAFVFASPKVGDLNFQKAFSKLKNLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPST-DIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
             PP    IG+ DVG E+ ID +KS Y+K +  D    HNLEGYLHGI GT+G GVL GF 
Sbjct  290  YPP----IGFIDVGEEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGVLAGFK  345

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L VNRD++LVN+  D LK+EY IP  WW EK+ GMVQQ+DG+W L++ E+
Sbjct  346  LEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLDRED  395



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   376 bits (965),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 219/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+P P++FG G       P
Sbjct  110  FMGYIAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN KSARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNVYTSESARSNFNKKSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA DIA N  N TS+GK FPVT FV+ASP+ GD NF N ++   +LH++RI NV DIVP+
Sbjct  230  NAFDIAYNKINKTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLHVMRIHNVLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DVG E+ ID +KS Y+    DI  WHNLE YLHG+AGT+G G+L GF L
Sbjct  290  YPP----LGYFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYLHGVAGTQGIGLLAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V+RDI+LVNKS   LK EY +P NWW  KN GMVQQ+DG W L + EE
Sbjct  346  EVDRDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQEDGKWVLNDREE  394



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 220/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGYVAVATDEGK +LGRRDI+V WRGT + LEWV+DL+FLLVPAP +FG G       P
Sbjct  110  FMGYVAVATDEGKVSLGRRDIVVAWRGTKQALEWVNDLQFLLVPAPNVFGNGGLLPLFQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSESARSQFNQTSVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF N +    +LH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDINFLNKFSKLKHLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG E+ ID +KS YVKP  +I +WH LE YLHG+AGT+G G+L GF L
Sbjct  290  YPP----IGYFDVGQEIMIDTTKSPYVKPPGEIVSWHLLEPYLHGVAGTQGLGLLAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK EY +P  WW EK+ GMVQQ++GSW LM+ +E
Sbjct  346  EVNRDISLVNKEWDILKNEYCVPAFWWTEKHKGMVQQENGSWLLMDRDE  394



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   375 bits (963),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/289 (64%), Positives = 221/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  831
            +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG         P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLPLLKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y++E+  S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTEDLRSQFNQASARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF   +    NLH+LRI NV DIVP+
Sbjct  230  NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DVG EL ID +KS YVKP  ++ +WH LE YLHG+AGT+G G+L GF L
Sbjct  290  YPP----VGYIDVGEELIIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D +K+EY IPG WWV+K+ GMVQQ DGSW L++ EE
Sbjct  346  EVNRDISLVNKQWDIIKDEYCIPGLWWVDKHKGMVQQQDGSWLLLDREE  394



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/286 (64%), Positives = 221/286 (77%), Gaps = 6/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQVH  822
            +MGY+AVATDEGK +LGRRDI++ WRG+++TLEWV+DL+F+LVPAPE+FG G    P VH
Sbjct  111  FMGYIAVATDEGKVSLGRRDIVINWRGSMQTLEWVNDLQFVLVPAPEVFGDGGLLQPLVH  170

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            +GFYN+Y++ +  S FN+ SARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATLNA+
Sbjct  171  QGFYNVYTASSSRSQFNVTSARDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATLNAV  230

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DIA N  N  S+GK FPVT F +A P+ GD  FK  +D    L +LRI N+ DI P+ PP
Sbjct  231  DIAFNKINKASNGKEFPVTAFPFACPKVGDLQFKAAFDKIIGLRILRIDNLLDIAPKYPP  290

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                IGY DVG EL ID +KS YVKP     NWH+LE YLHGIAGT+G G+L GF+L VN
Sbjct  291  ----IGYFDVGQELMIDTTKSPYVKPPGQPVNWHSLESYLHGIAGTQGTGLLAGFNLEVN  346

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDISL+NK  D LK+EY IP NWWVEKN GMVQQ+DGSW L++ ++
Sbjct  347  RDISLINKQLDGLKDEYCIPVNWWVEKNKGMVQQEDGSWLLLDRDD  392



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   374 bits (960),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 221/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  107  FMGYIAVATDEGKVSLGRRDIVIAWRGTMQKLEWVNDLQFLLVPAPQVFGDGGLLPLFQP  166

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN Y+S +  S FN+ SARDQV+ EVKRLVE YK+EEVSITV GHSLGASLATL
Sbjct  167  LVHHGFYNAYTSSSSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATL  226

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT F +ASP+ GD  FK  +D    L +L+I N+ DIVP+
Sbjct  227  NAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKGLRVLKIHNLLDIVPK  286

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  +  +WH LE YLHG+AGT+G G+L GF L
Sbjct  287  YPP----IGYFDVGQELMIDTTKSPYVKPPGEPVSWHLLEPYLHGVAGTQGLGLLAGFKL  342

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+EY IPG WWVEKN GMVQQ+DGSW +++ +E
Sbjct  343  EVNRDISLVNKQWDVLKDEYCIPGLWWVEKNKGMVQQEDGSWLMLDRDE  391



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   374 bits (959),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/295 (63%), Positives = 223/295 (76%), Gaps = 15/295 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  834
            +MG+VAVATD+GK  LGRRDI++ WRGTIRTLEWV+DL+FLLVPAP++FGAG S      
Sbjct  110  FMGFVAVATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGAGNSILPLLK  169

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P VH+G+ ++Y+S++P S FN  SARDQVL EVKRLVE YKNE+VSITV GHSLGA+LAT
Sbjct  170  PLVHQGWNSVYTSDDPRSPFNKASARDQVLEEVKRLVEKYKNEKVSITVTGHSLGAALAT  229

Query  653  LNAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            LNA+DI  NG N  S+GK FPVT FV+ASP  GD NF+  +    NLH+LRI N+ DIVP
Sbjct  230  LNAVDIVYNGINKKSNGKEFPVTAFVFASPNVGDLNFRAAFSKLKNLHILRIDNLLDIVP  289

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG--  300
            + PP    IGY DVG  L ID +KS YVK   +I  WHNLE Y+HG+AGT+G G+L G  
Sbjct  290  KYPP----IGYIDVGQVLVIDTAKSDYVKSPGNILTWHNLEAYMHGVAGTQGVGILPGEL  345

Query  299  ---FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
               F L VNRDI+LVNKS D LKEEY +P NWWVEKN GMVQ+ D SW LM+ E+
Sbjct  346  LGEFKLEVNRDIALVNKSMDALKEEYGVPANWWVEKNNGMVQRADRSWVLMDRED  400



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   373 bits (958),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 219/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGYVAVATDEGK +LGRRDI++ WRGT++ LEWV+D +FLLVPAP++FG G       P
Sbjct  110  FMGYVAVATDEGKVSLGRRDIVINWRGTMQNLEWVNDFQFLLVPAPKVFGDGGLLPLFQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN    RDQV+ EVKRLVE YKNE+VSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSESSRSQFNKTCVRDQVIEEVKRLVEEYKNEDVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DI  NG N T++GK FPVT FV+ASP+ GD+NF   +    NLH+LRI NV DIVP+
Sbjct  230  NAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLHILRIHNVLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  DI +WH LE YLHG+AGT+G  +L GF L
Sbjct  290  YPP----IGYIDVGKELMIDTTKSPYVKPPGDIVSWHLLEPYLHGVAGTQGISILAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNR+ISLVNK  + LK+E+ IPG WWVEK+ GMVQQ DG+W  ++ EE
Sbjct  346  EVNRNISLVNKMGNILKDEHCIPGLWWVEKHKGMVQQQDGTWLFLDREE  394



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   373 bits (958),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 185/290 (64%), Positives = 226/290 (78%), Gaps = 10/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+PAPE+FG G       P
Sbjct  110  FMGYIAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLLIPAPEVFGKGGLLPLTQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN  SARDQVL EVKRLVE YK++EVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTSESERSKFNKTSARDQVLEEVKRLVEEYKDDEVSITVAGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF N ++   NLH++RI N+ DIVP+
Sbjct  230  NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDVNFVNTFNKLKNLHIMRIDNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPST-DIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
             PP    IGY DVG E+ ID +KS Y+K +  D    HNLEGYLHGI GT+G G LDGF 
Sbjct  290  YPP----IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFK  345

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L VNRD++LVN+  D LK+E+ +PG WWVEK+ GMVQQ++G W LM++EE
Sbjct  346  LEVNRDLALVNRIWDILKDEHLVPGAWWVEKHNGMVQQENGKWILMDHEE  395



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   372 bits (955),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 220/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI+V WRGTI+ +EWV+DL+FLL+PAP+IFGAG       P
Sbjct  110  FMGYIAVATDEGKASLGRRDIVVNWRGTIQKMEWVNDLQFLLIPAPKIFGAGGLLPLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+S +  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGASLAT+
Sbjct  170  LVHHGFYNVYTSASSRSQFNKTSVRDQVIKEVKRLVEEYKDEEVSITVTGHSLGASLATM  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA N  N  S+GK FPVT F +ASP+ GD  FK  +D   +LH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNKINKASNGKEFPVTAFAFASPKVGDIQFKATFDKLKHLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  +  +WH LE YLHG+AGT+G G+  GF L
Sbjct  290  YPP----IGYFDVGKELMIDTTKSPYVKPPGENVSWHLLEPYLHGVAGTQGLGLFAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  + LK+EY IPG WWVEKN GMVQQ+DGSW +++ +E
Sbjct  346  EVNRDISLVNKQWNILKDEYCIPGMWWVEKNKGMVQQEDGSWLMLDRDE  394



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 218/289 (75%), Gaps = 15/289 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI+V WRGT++ LEWV+DL+FL VP P++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVVNWRGTMQKLEWVNDLQFLAVPGPKVFGDGGLLSLLQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y++E+P S FN      QV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTEDPRSQFN------QVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  223

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT FV+ASP+ GD NF   +    NLH+LRI NV DIVP+
Sbjct  224  NAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLHILRIHNVLDIVPK  283

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  ++ +WH LE YLHG+AGT+G G+L GF L
Sbjct  284  YPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGTQGIGILAGFKL  339

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+EY IPG WW +K+ GMVQQ DGSW L++ EE
Sbjct  340  EVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  388



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   370 bits (951),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 219/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AV+TDEGK +LGRRDI++ WRGTI+ +EWV+DL+FLL+PAP+IFG G       P
Sbjct  110  FMGYIAVSTDEGKASLGRRDIVINWRGTIQKMEWVNDLQFLLIPAPKIFGDGGLLHLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+S +  S FN  S RDQV+ EVKRLVE YK+EEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNVYTSASSRSQFNQTSVRDQVIKEVKRLVEEYKHEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DI  NG N TS+GK FPVT F +ASP+ GD  FK  +D   +LH+LRI N+ DIVP+
Sbjct  230  NAVDITFNGINKTSEGKEFPVTAFAFASPKVGDLQFKAAFDKLKHLHVLRIHNLMDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID +KS YVKP  +  +WH LE YLHG+AGT+G G+  GF L
Sbjct  290  YPP----IGYFDVGKELMIDTTKSPYVKPPGEPLSWHLLEPYLHGVAGTQGLGIFAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  + LK+EY IPG WWVEK  GMVQQ+DGSW +++ +E
Sbjct  346  EVNRDISLVNKQWNILKDEYCIPGRWWVEKCKGMVQQEDGSWLMLDRDE  394



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   368 bits (945),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 215/289 (74%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGYVAVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FL +P P++FG G       P
Sbjct  107  FMGYVAVATDEGKVSLGRRDIVIAWRGTIQTLEWVNDLQFLPIPGPKVFGDGGLLPLFKP  166

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S FN  SARDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  167  LVHHGFYNVYTSESARSKFNKTSARDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  226

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA N  N +S GK FPVT FV+ASP+ GD NF N ++    LH++RI N+ DIVP+
Sbjct  227  NAVDIAYNKINKSSHGKEFPVTAFVFASPKVGDLNFLNAFNKLKYLHVMRIHNILDIVPK  286

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG E+ ID +KS Y+    DI  WHNLE Y+HG+AGT+G G+L GF L
Sbjct  287  YPP----IGYLDVGQEIIIDTTKSPYLNLPGDILTWHNLECYMHGVAGTQGIGLLTGFKL  342

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V+RDI+LVNKS   LK EY +P NWW  KN GM QQ+DG W L + EE
Sbjct  343  EVDRDIALVNKSSGALKSEYLVPANWWTVKNKGMFQQEDGKWVLNDREE  391



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   368 bits (945),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/289 (63%), Positives = 218/289 (75%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK ALGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  110  FMGYIAVATDEGKVALGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N +S+GK FPVT FV+ASP+ GD NF   +    +LH+LRI N+ DIVP+
Sbjct  230  NAVDIAFNGINKSSNGKEFPVTAFVFASPKVGDLNFHKAFSKLKHLHILRIHNLLDIVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DVG EL ID +KS YVKP  ++ +WH LE YLHGIAGT+G G+  GF L
Sbjct  290  YPP----VGYFDVGQELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGIGMTAGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK    LK+EY IP  WW EK+ GMVQQ DGSW L + ++
Sbjct  346  EVNRDISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDD  394



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   368 bits (945),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 221/288 (77%), Gaps = 9/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGT++ +EWV+DL+FL VPAP++FG G       P
Sbjct  107  FMGYIAVATDEGKVSLGRRDIVINWRGTLQKMEWVNDLQFLPVPAPKVFGDGGLLPLFKP  166

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+S +  S FN+ SARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  167  LVHHGFYNVYTSASSRSQFNLTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  226

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK FPVT F +ASP+ GD  FK  +D   +L +L+I N+ DIVP+
Sbjct  227  NAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKLKSLRILKIHNLLDIVPK  286

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG EL ID ++S YVKP  D  +WH LE YLHG+AGT+G G+L GF L
Sbjct  287  YPP----IGYFDVGKELMIDTARSPYVKPPGDPASWHLLEPYLHGVAGTQGLGLLAGFKL  342

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             VNRDISLVNK  + LK+EY IPG WWVEKN GMVQQ+DGSW  ++++
Sbjct  343  EVNRDISLVNKQWNVLKDEYCIPGFWWVEKNKGMVQQEDGSWLQLDHD  390



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   366 bits (939),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 221/295 (75%), Gaps = 15/295 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  834
            +MGYVAVATD+GK  LGRRDI++ WRGTIRTLEWV+DL+FLLVPAP++FG G S      
Sbjct  110  FMGYVAVATDKGKAVLGRRDIVIAWRGTIRTLEWVNDLQFLLVPAPKVFGGGNSILPLFK  169

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P VH+G+ ++Y+S++P S FN  SARDQVL EVK+LVE YKNEEVSITV GHSLGA++AT
Sbjct  170  PLVHQGWKSIYTSDDPKSPFNKASARDQVLEEVKKLVEKYKNEEVSITVTGHSLGAAVAT  229

Query  653  LNAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            LNA+DI  NG N TS+GK FPVT  V+ASP  GD NF+  +    NLH+LR+ N+ DIVP
Sbjct  230  LNAVDIVYNGFNKTSNGKEFPVTACVFASPNVGDLNFRVAFSKLKNLHILRVDNIVDIVP  289

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG--  300
            + PP    IGY DVG  L ID +KS Y+K   ++  WHNLE YLHG+AGT+G G+L G  
Sbjct  290  KYPP----IGYIDVGEVLVIDTAKSDYLKSPGNLQTWHNLEAYLHGVAGTQGVGILIGEF  345

Query  299  ---FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
               F L V+RDI+LVNKS D LK EY +P NWWVEKN GMVQ+ D +W LM+ EE
Sbjct  346  FGDFKLEVDRDIALVNKSTDALKGEYGVPANWWVEKNKGMVQKKDKTWVLMDREE  400



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   365 bits (937),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 214/289 (74%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  831
            +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110  FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+++NP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK F VT F +ASP+ GD  FK  +D   +L  LRI N+ D+VP+
Sbjct  230  NAVDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            VPP    IGY DVG EL ID +KS YVKP  ++ +WH LE YLHGIAGT+G   L GF L
Sbjct  290  VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQGLIGLIGFKL  345

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+EY IPG WWVEKN GMVQQ DGSW LM+ EE
Sbjct  346  EVNRDISLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREE  394



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   365 bits (937),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 219/289 (76%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  111  FMGYIAVATDEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPQVFGDGGLLPLFHP  170

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YK+EEVSITV GHSLGASLATL
Sbjct  171  LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKDEEVSITVTGHSLGASLATL  230

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA N  N  S+GK FPVT FV+ASP+ GD NF N +    +LH+LRI NV DIVP+
Sbjct  231  NAVDIAFNKINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNVLDIVPK  290

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG E+ ID +KS YVKP  +  +WH LE YLHGIAGT+G G+L GF L
Sbjct  291  YPP----IGYFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMLAGFKL  346

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  + LK+E+ IP  WW EK+ GMVQQ+DG+W L + +E
Sbjct  347  EVNRDISLVNKQWNVLKDEHCIPPLWWSEKHKGMVQQEDGTWLLQDRDE  395



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   363 bits (931),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 221/286 (77%), Gaps = 9/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQVH  822
            +MGY+AVATDEGK +LGRRDI++ WRGT + LE+++DL+FLLVPAP++FG G    P VH
Sbjct  108  FMGYIAVATDEGKVSLGRRDIVINWRGTQQKLEFINDLQFLLVPAPKVFGDGGLLQPLVH  167

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             GFYN+Y+S +  S FN+ SARDQV+ EVKRLVE YK+EEVSITV GHSLGASLATLNA+
Sbjct  168  NGFYNVYTSASSRSQFNLTSARDQVIEEVKRLVEEYKHEEVSITVTGHSLGASLATLNAV  227

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DIA NG N TS+GK FPVT F +ASP+ GD  FK  +D   +L +L+I N+ DI P+ PP
Sbjct  228  DIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKSLRILKIHNLLDIFPKYPP  287

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                IGY DVG EL ID +KS YV+P  + ++WH LE YLHG+AGT+G   L GF L VN
Sbjct  288  ----IGYFDVGQELMIDTTKSPYVRPPGEPFSWHLLEPYLHGVAGTQG---LAGFKLEVN  340

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDISLVNK  D LK+EY IPG WWVEKN GMVQQ+DGSW L++++E
Sbjct  341  RDISLVNKQWDVLKDEYCIPGFWWVEKNKGMVQQEDGSWLLLDHDE  386



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   363 bits (931),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 214/289 (74%), Gaps = 12/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  831
            +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110  FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDGGLLPLLQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+++NP S FN  S RDQVL EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTDNPRSQFNQTSVRDQVLEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+GK F VT F +ASP+ GD  FK  +D   +L  LRI N+ D+VP+
Sbjct  230  NAVDIAFNGVNKTSEGKEFQVTAFAFASPKVGDLKFKAAFDKLKSLRTLRIHNLWDVVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            VPP    IGY DVG EL ID +KS YVKP  ++ +WH LE YLHGIAGT+G   L GF L
Sbjct  290  VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQG---LIGFKL  342

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  D LK+EY IPG WWVEKN GMVQQ DGSW LM+ EE
Sbjct  343  EVNRDISLVNKQWDILKDEYGIPGLWWVEKNKGMVQQQDGSWILMDREE  391



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   362 bits (930),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/290 (62%), Positives = 221/290 (76%), Gaps = 10/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGTI+TLEWV+DL+FLL+P P++FG G       P
Sbjct  110  FMGYIAVATDEGKASLGRRDILIAWRGTIQTLEWVNDLQFLLIPGPKVFGDGGLLPLFKP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y+SE+  S +N  SARDQV+ EVKRLVE YK++EVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNVYTSESARSKYNQASARDQVIEEVKRLVEEYKDDEVSITVAGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS GK FPVT FV+ASP+ GD NF N  +   +LH++RI N+ DIV +
Sbjct  230  NAVDIAYNGINKTSSGKEFPVTAFVFASPKVGDLNFVNAVNKLEHLHIMRIHNLLDIVSK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPST-DIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
             PP    IGY DVG E+ ID +KS Y+K +  D    HNLEGYLHGI GT+G G LDGF 
Sbjct  290  YPP----IGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGIDGTQGIGPLDGFK  345

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L VNRD+SLVN+  D LK+EY +PG WWVEK+ GMVQQ+DG W LM+ E+
Sbjct  346  LEVNRDLSLVNRIWDILKDEYLVPGAWWVEKHNGMVQQEDGKWILMDRED  395



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/289 (63%), Positives = 214/289 (74%), Gaps = 12/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGYVAVATDEGK  LGRRDI++ WRGT+  LEWV++ +F  VPAP++FG         P
Sbjct  110  FMGYVAVATDEGKVELGRRDIVIAWRGTMEKLEWVNNFQFAAVPAPKVFGDRGLLHLLQP  169

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GFYN+Y++ NP S FN  SARDQV+ EVKRLVE YKNEEVSITV GHSLGASLATL
Sbjct  170  LVHHGFYNIYTTNNPRSQFNHTSARDQVIEEVKRLVEEYKNEEVSITVTGHSLGASLATL  229

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA NG N TS+G+ FPVT F +ASP+ GD  FK  +D   ++  LRI N+ D+VP+
Sbjct  230  NAVDIAFNGINKTSEGREFPVTAFAFASPKVGDLKFKAAFDKLKSVRTLRIHNLWDVVPK  289

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            VPP    IGY DVG EL ID +KS YVKP  ++ +WH LE YLHGIAGT+G   L GF L
Sbjct  290  VPP----IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGTQG---LRGFKL  342

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V+RDISLVNK  D LK+EY IPG W VEKN GMVQQ DGSW LM+ EE
Sbjct  343  EVDRDISLVNKQWDILKDEYGIPGRWLVEKNKGMVQQKDGSWLLMDREE  391



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/289 (62%), Positives = 217/289 (75%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-----SP  831
            +MGY+AVATDEGK +LGRRDI++ WRGT++ LEWV+DL+FLLVPAP++FG G       P
Sbjct  111  FMGYIAVATDEGKASLGRRDIVINWRGTLQVLEWVNDLQFLLVPAPKVFGDGGLLPLFHP  170

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
             VH GF+N+Y++ENP S FN    RDQV+ EVKRLVE YK+EEVSITV GHSLGASLATL
Sbjct  171  LVHHGFHNIYTTENPRSQFNKTCVRDQVMEEVKRLVEEYKHEEVSITVTGHSLGASLATL  230

Query  650  NAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            NA+DIA N  N  S+GK FPVT FV+ASP+ GD NF N +    +LH+LRI N+ DIVP+
Sbjct  231  NAVDIAFNKINKASNGKEFPVTAFVFASPKVGDVNFLNAFSKLKHLHILRIHNLLDIVPK  290

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    IGY DVG E+ ID +KS YVKP  +  +WH LE YLHGIAGT+G G+  GF L
Sbjct  291  YPP----IGYFDVGQEIMIDTTKSPYVKPPGEPVSWHLLEPYLHGIAGTQGIGMFAGFKL  346

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK  + LK+E+ IP  WW EK+ GMVQQ+DG W L + +E
Sbjct  347  EVNRDISLVNKQWNILKDEHCIPPLWWSEKHKGMVQQEDGCWLLQDRDE  395



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 222/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  114  WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  174  WYSIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  233

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
             TNG N  +D   K+ PVT  V+ASPR GD NF+ V+    +L  +RIRN  DIVP    
Sbjct  234  VTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  KS Y+K   +  +WHNLE YLHG+AGT+G+    GF+L V+
Sbjct  292  --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSK--GGFNLEVH  347

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK+ D LK+E  +P +W +EKN GM QQ+DGSWKLM++EE
Sbjct  348  RDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  393



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   356 bits (914),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 221/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  114  WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  174  WYSIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  233

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
             TNG N  SD   K+ PVT  V+ASPR GD NF+ V+    +L  +RIRN  DIVP    
Sbjct  234  VTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  KS Y+K   +  +WHNLE YLHG+AGT+ +    GF L V+
Sbjct  292  --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSK--GGFKLEVH  347

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK+ D LK+E+ +P +W  EKN GMVQQ+DGSWKLM++E+
Sbjct  348  RDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  393



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 219/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D +F LVPAP+IFG     +VH+G
Sbjct  137  WMGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFQFTLVPAPKIFGESNDRKVHQG  196

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++P S +N  SARDQVL EV+RLVE YK+EE+SITVCGHSLGA++ATLNA DI
Sbjct  197  WYSVYTSDDPRSPYNKSSARDQVLNEVRRLVEQYKDEEISITVCGHSLGAAVATLNAADI  256

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N +     K  PVT  V+ASPR GD +FK V+    +L +LR+ N+ D+VP    
Sbjct  257  VANGFNKSKSWPNKPCPVTAIVFASPRVGDSDFKKVFSGYKDLRVLRVHNLLDVVPNY--  314

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PLIGY DVG ELTID +KS Y+K   ++ +WHNLEGYLHG+AGT+G+    GF L VN
Sbjct  315  --PLIGYADVGEELTIDTTKSKYLKSPGNVSSWHNLEGYLHGVAGTQGS--TGGFKLEVN  370

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNKS D LK+EY +P +W ++KN GM+QQ DGSWKLM++EE
Sbjct  371  RDIALVNKSLDGLKDEYLVPTSWRIQKNKGMIQQADGSWKLMDHEE  416



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   357 bits (915),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 221/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  141  WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  200

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  201  WYSIYTSEDPRSPFNKTSARTQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  260

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
             TNG N  SD   K+ PVT  V+ASPR GD NF+ V+    +L  +RIRN  DIVP    
Sbjct  261  VTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  318

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  KS Y+K   +  +WHNLE YLHG+AGT+ +    GF L V+
Sbjct  319  --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQRSK--GGFKLEVH  374

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK+ D LK+E+ +P +W  EKN GMVQQ+DGSWKLM++E+
Sbjct  375  RDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  420



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   357 bits (915),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/286 (61%), Positives = 222/286 (78%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DL+FLLVPAP++FG    P+VH+G
Sbjct  139  WIGYVAVATDEGKAALGRRDIVIVWRGTVQTLEWVNDLQFLLVPAPKVFGKNTDPKVHQG  198

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  SAR QVL EV+RLVELYKNEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  199  WYSIYTSEDPRSPFNQTSARSQVLSEVRRLVELYKNEEISITITGHSLGAAIATLNAVDI  258

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
             TNG N  +D   K+ PVT  V+ASPR GD NF+ V+    +L  +RIRN  DIVP    
Sbjct  259  VTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKDLTTIRIRNELDIVPNY--  316

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  KS Y+K   +  +WHNLE YLHG+AGT+G+    GF+L V+
Sbjct  317  --PLVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVAGTQGSK--GGFNLEVH  372

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK+ D LK+E  +P +W +EKN GM QQ+DGSWKLM++EE
Sbjct  373  RDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  418



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   353 bits (907),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 172/286 (60%), Positives = 220/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI++ WRGT++TLEWV+DLEF+LV AP++FG    P+VH+G
Sbjct  142  WIGYVAVATDEGKAALGRRDIVIAWRGTVQTLEWVNDLEFVLVSAPKVFGKNTDPKVHQG  201

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  SAR QVL EVKRLVELYKNEE+SI++ GHSLGA++ATL+A+DI
Sbjct  202  WYSIYTSEDPLSPFNKSSARSQVLSEVKRLVELYKNEEISISITGHSLGAAIATLSAVDI  261

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N  SD   K+ PVT  V+A PR GD NF+ V+    +L  +RIRN  DIVP    
Sbjct  262  VANGYNKPSDPSLKASPVTAIVFACPRVGDTNFRKVFSGYKDLKTIRIRNELDIVPNY--  319

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  KS Y+K   +  +WHNLEGYLHG+AGT+G+    GF L VN
Sbjct  320  --PLVGYSDVGEELKIDTRKSMYLKSPGNPLSWHNLEGYLHGVAGTQGSK--GGFKLEVN  375

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+L+NK+ D LK+E  +P +W +EKN GMVQQ+DGSWKLM++E+
Sbjct  376  RDIALLNKTLDALKDELLVPVSWRIEKNKGMVQQNDGSWKLMDHED  421



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/288 (59%), Positives = 214/288 (74%), Gaps = 6/288 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEGKT LGRRDI++ WRGTIRTLEWV+D EF  V A +I G    P+VH+G
Sbjct  131  WIGFVAVATDEGKTTLGRRDIVIAWRGTIRTLEWVNDFEFNFVSASKILGESGDPKVHQG  190

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S +N  SARDQVL EV+RLV+ Y NEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  191  WYSIYTSDDSRSQYNKNSARDQVLNEVRRLVDKYTNEEISITIVGHSLGAAVATLNAVDI  250

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N +   K  PVT  ++ASPR GD NFK V+    +L  LRI NV D+VP      
Sbjct  251  VANGFNQSQKNKRCPVTAMLFASPRVGDSNFKRVFSGYKDLRALRIHNVRDVVPNY----  306

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PLIGY DVG EL ID +KS Y+K   ++ +WHNLEGYLHG+AGT+G     GF L VNRD
Sbjct  307  PLIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPK--GGFKLEVNRD  364

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
            I+L+NK+ D LK+EY +P +W V++N GMVQQ DGSWKLM+ EE +IP
Sbjct  365  IALLNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDLEEDFIP  412



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 214/286 (75%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK+ALGRRDI++ WRGTIRTLEW++D EF  V APEIFG    P VH G
Sbjct  137  WIGYVAVATDEGKSALGRRDILIAWRGTIRTLEWMNDFEFATVSAPEIFGGNDEPNVHLG  196

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++P S FN  SAR+QVL EV+RLVE YKNEE+S+TV GHSLGA+++TLNAIDI
Sbjct  197  WYSIYTSDDPRSPFNKTSARNQVLTEVRRLVEEYKNEEISMTVTGHSLGAAVSTLNAIDI  256

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+ PVT F++ASPR GDY F+       NLH+LR+ N  DIVP    
Sbjct  257  VVNGYNRPRDMPDKACPVTAFLFASPRVGDYKFRKFLSTLQNLHILRVTNARDIVPTY--  314

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              P + Y +VG EL ID  KS+Y+K   ++ +WHNLE YLHG+AGT+G+    GF L VN
Sbjct  315  --PFVNYAEVGQELPIDTDKSNYLKSPGNLNSWHNLEAYLHGVAGTQGS--RGGFKLEVN  370

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK  D LK+EY +P +WW EK+ GMVQQ+DGSWKLM++E+
Sbjct  371  RDIALVNKHLDGLKDEYCVPVSWWCEKHKGMVQQEDGSWKLMDHED  416



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 215/288 (75%), Gaps = 6/288 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEGKT LGRRDI++ WRGTI+TLEWV+D EF  V A +I G    P+VH+G
Sbjct  131  WIGFVAVATDEGKTTLGRRDIVIAWRGTIQTLEWVNDFEFNFVSASKILGESGDPKVHQG  190

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S +N  SARDQVL E++RLV+ Y NEE+SIT+ GHSLGA++ATLNA+DI
Sbjct  191  WYSIYTSDDSRSPYNKNSARDQVLNEIRRLVDKYTNEEISITIVGHSLGAAVATLNAVDI  250

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N +   K  PVT  ++ASPR GD NFK V+    +L  LRI NV D+V    P+ 
Sbjct  251  VANGFNQSQKNKRCPVTAILFASPRVGDSNFKKVFSGYKDLRALRIHNVLDVV----PSY  306

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PLIGY DVG EL ID +KS Y+K   ++ +WHNLEGYLHG+AGT+G     GF L VNRD
Sbjct  307  PLIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGTQGPK--GGFKLEVNRD  364

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
            I+LVNK+ D LK+EY +P +W V++N GMVQQ DGSWKLM+ EE +IP
Sbjct  365  IALVNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDVEEDFIP  412



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 217/287 (76%), Gaps = 9/287 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  819
            WMGY+AVATDEG   LGRRDI++ WRGT+RTLEWV DLEF+LV A ++ G +G  P+VH+
Sbjct  115  WMGYIAVATDEGTAVLGRRDIVIAWRGTVRTLEWVDDLEFVLVSASDLLGESGNDPKVHQ  174

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G++++Y+S++P S FN  SARDQVL EV+RLVE YKNEE+SITVCGHSLGA+LATLNA+D
Sbjct  175  GWHSVYTSDDPLSPFNKSSARDQVLNEVRRLVEKYKNEEISITVCGHSLGAALATLNAVD  234

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   T   K+ PVT  V+ASPR GD  FK V+     L  LRI N  DIVP   
Sbjct  235  IIANGFNKSKTFPNKACPVTAIVFASPRVGDSGFKKVFSGYKELRALRIHNNLDIVPNY-  293

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               PLIGY +VG EL ID +KS+Y+K   ++ +WHNLEGYLHG+AGT+G+    GF L +
Sbjct  294  ---PLIGYAEVGEELVIDTTKSNYLKSPGNVSSWHNLEGYLHGVAGTQGSK--GGFKLEI  348

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            NRDI+LVNKS D LK+EY +P +W ++KN GMVQQ DGSWKLM++EE
Sbjct  349  NRDIALVNKSLDGLKDEYLVPPSWRIQKNKGMVQQSDGSWKLMDHEE  395



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/288 (59%), Positives = 215/288 (75%), Gaps = 10/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMGYVAVATDEGK  LGRRD++V WRGT++ LEW++DL+F LV A  I G G+S  PQVH
Sbjct  114  WMGYVAVATDEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASAILGKGSSGNPQVH  173

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RG+ ++Y+S +P S +N  SARDQVL E+ RL+E YK+EE SIT+ GHSLGA+LATLNA 
Sbjct  174  RGWLSIYTSNDPRSPYNKDSARDQVLSEIGRLMEEYKDEETSITITGHSLGAALATLNAA  233

Query  641  DIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DIA+NG N ++    K+ PVT FV+ASPR GD +F+  +   P L LLRIRNVPD+VP  
Sbjct  234  DIASNGLNKSNAHPNKNSPVTAFVFASPRVGDSDFREAFSKIPELRLLRIRNVPDLVPNY  293

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
                PL+GY DVGVELTID  KS Y+K   ++ +WHNLE YLHG+AGT G     GF L 
Sbjct  294  ----PLLGYDDVGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTRGGK--KGFKLE  347

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            V+RD++LVNKS D LK+EY +P +W VEKN GMV+  DG W+LM++EE
Sbjct  348  VDRDVALVNKSMDALKDEYLVPASWRVEKNKGMVKGADGHWRLMDHEE  395



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/285 (61%), Positives = 212/285 (74%), Gaps = 9/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK+ALGRRDI++ WRGTIR LEWV+D EF LVPAPEIFG    P+VH G
Sbjct  130  WMGYVAVATDEGKSALGRRDILIAWRGTIRNLEWVNDFEFGLVPAPEIFGGNDDPKVHFG  189

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            ++++Y+S++P S F+  SAR QVLGEV+RLVE YKNEE+SITV GHSLGA+++T+NA+DI
Sbjct  190  WHSIYTSDDPKSPFSKNSARHQVLGEVRRLVERYKNEEISITVTGHSLGAAVSTINAVDI  249

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N       K  PVT FV+A PR GD NF++      NLH+LR+RN  DIVP+   
Sbjct  250  VVNGYNRPQGMLHKHCPVTAFVFACPRVGDNNFRDFVLNLQNLHILRVRNARDIVPKY--  307

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              P I Y DVG EL ID  KSSY+K   ++ +WHNLE YLHG+AGT G+    GF L VN
Sbjct  308  --PFIDYVDVGEELAIDTDKSSYLKEG-NLSSWHNLEAYLHGVAGTRGSE--GGFKLEVN  362

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDI+LVNK  D LK+E+ +P +WW EKN GMVQQ DGSW LM++E
Sbjct  363  RDIALVNKHMDALKDEFCVPVSWWCEKNKGMVQQADGSWVLMDHE  407



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 214/284 (75%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEGK ALGRRDI++ WRG+++T+EW +D +F+ V APEIFG  + P+VH G
Sbjct  139  WVGFVAVATDEGKMALGRRDIVIAWRGSVQTMEWFNDFDFIQVSAPEIFGQKSIPKVHHG  198

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S +  S FN  SARDQVLGEV+RLVE YKNEE++ITV GHS+GA++ATLNA+DI
Sbjct  199  WYSVYTSSDSRSPFNKASARDQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVDI  258

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              N  N     K FPVT F++ASPR GD NFK  +    NL  LR+RN PDIVP      
Sbjct  259  VFNEFN-----KGFPVTAFLFASPRVGDENFKKTFSKLVNLRALRVRNAPDIVPNY----  309

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PL+GY+DVGV+L ID +KS+Y+K   D  +WHN++ YLHG+AGT+G+    GF L V  D
Sbjct  310  PLLGYSDVGVQLDIDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSK--GGFKLEVQHD  367

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            IS+VNK  D LK+EY +P +WWVEKN GMVQQ DGSW LM++E+
Sbjct  368  ISVVNKYLDALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHED  411



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 209/285 (73%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEG+ ALGRRDI++ WR T+  +EW +D EF+ V AP IFG  + P+VH G
Sbjct  117  WIGFVAVATDEGEVALGRRDIVIAWRSTVVPMEWFNDFEFIRVSAPTIFGENSDPKVHHG  176

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S +P S FN  SARDQVLGEV+RL+E YK EEVSITV GHS+GAS+ATLNA+D+
Sbjct  177  WYSMYTSNDPRSLFNKASARDQVLGEVERLMEQYKTEEVSITVTGHSMGASIATLNAVDM  236

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPN-LHLLRIRNVPDIVPQVPPA  459
              NG N     K FPVT F++ASPR GD NF   +    N L  LR+RN+PDI+P     
Sbjct  237  VFNGIN-----KGFPVTAFLFASPRVGDENFNKTFSELENQLRALRVRNIPDIIPHY---  288

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             P IGY+DVGVEL +D  KS Y+K   D W WHNLE YLHG+AGT+G+   +GF L V R
Sbjct  289  -PFIGYSDVGVELIMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSK--EGFKLEVER  345

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DISLVNK  D LK+EY +P +WWV +N GMVQQ +GSW LM++E+
Sbjct  346  DISLVNKHMDTLKDEYGVPVSWWVVENKGMVQQQNGSWILMDHED  390



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score =   340 bits (872),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 215/285 (75%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  819
            WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  43   WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  102

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGA++ATLNA+D
Sbjct  103  GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  162

Query  638  IATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            I  NG N     +  PVT  V+ASPR GD NF  ++ A  NL +LR+RN  DI+P     
Sbjct  163  IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  214

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             PL+GY+DVG EL +D  KS Y+K   ++  WHNLE +LHG+AGT+G+    GF L VNR
Sbjct  215  -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  271

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+LVNKS D L +EY +P +W  EKN GMVQQ DGSWKLM++EE
Sbjct  272  DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  316



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   343 bits (879),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 214/284 (75%), Gaps = 6/284 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMG+VAV+TDEGK ALGRRDI++ WRGTI+ LEWV+D EF LV A +I G   +P+VH+G
Sbjct  114  WMGFVAVSTDEGKVALGRRDIVIAWRGTIQILEWVNDFEFNLVSASKILGESGNPKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S +N  SARDQVL EV RLV+ +KNEE+SIT+ GHSLGA+LATLNA+DI
Sbjct  174  WYSIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDI  233

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N + + K  PVT  ++ASPR GD NFK V+    +L  LR+ NV D+VP+     
Sbjct  234  VANGFNKSHENKGCPVTAMLFASPRVGDSNFKKVFSRYMDLKALRVHNVLDVVPKY----  289

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            P IGY DVG EL ID +KS Y+K   ++ +WHNLE YLHG+AGT+G+    GF LV NRD
Sbjct  290  PFIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQGSK--GGFELVANRD  347

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            I+L+NK+ D LK+EY +P +W +++N GMVQQ DGSWKL+++EE
Sbjct  348  IALINKTTDGLKDEYLVPASWRIQENKGMVQQADGSWKLVDHEE  391



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   341 bits (875),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 219/286 (77%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK ALGRRDI++ WRGT+R+LEWV+DLEF+LV AP+IFG    P+VH+G
Sbjct  90   WMGYVAVATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVLVSAPKIFGENDDPKVHQG  149

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y++++  S FN  SARDQVL EV+RLVE +K+EE+SITV GHSLGA++ATLNA+DI
Sbjct  150  WYSIYTTDDSRSPFNKTSARDQVLDEVRRLVEEFKDEEISITVTGHSLGAAVATLNAVDI  209

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N + +  GK+ PVT FVYASPR G   FK V+    NL +LRI+N  D+VP    
Sbjct  210  VANGFNKSLENPGKACPVTAFVYASPRVGGQGFKKVFSQQQNLRVLRIQNSLDVVPNY--  267

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY DVG EL ID +KS Y+K   ++ +WH+LE Y+HG+AG +  G+ +GF LVVN
Sbjct  268  --PLLGYADVGEELRIDTTKSKYLKNPGNLSSWHSLECYMHGVAGKQ--GLQEGFKLVVN  323

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RD++L+NK  D LK+E+ +P +WW  +N GMVQQ DGSW+L ++E+
Sbjct  324  RDVALLNKYMDVLKDEHCVPVSWWCIQNKGMVQQADGSWELEDHED  369



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   339 bits (870),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 215/285 (75%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  819
            WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  90   WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  149

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGA++ATLNA+D
Sbjct  150  GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  209

Query  638  IATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            I  NG N     +  PVT  V+ASPR GD NF  ++ A  NL +LR+RN  DI+P     
Sbjct  210  IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  261

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             PL+GY+DVG EL +D  KS Y+K   ++  WHNLE +LHG+AGT+G+    GF L VNR
Sbjct  262  -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  318

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+LVNKS D L +EY +P +W  EKN GMVQQ DGSWKLM++EE
Sbjct  319  DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  363



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   340 bits (871),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 167/288 (58%), Positives = 210/288 (73%), Gaps = 8/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK  LGRRDI+V WRGT+  LEWV D  F LV A EI G    P+VH+G
Sbjct  114  WMGYVAVATDEGKAVLGRRDIVVAWRGTVEDLEWVDDFSFNLVSASEILGGTNDPKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++P S FN  SARDQVL EV+RLVEL+K+EE+SIT+ GHSLGA+L TLNA DI
Sbjct  174  WLSIYTSDDPRSPFNKASARDQVLSEVRRLVELFKDEEISITITGHSLGAALGTLNAADI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              +G N   +   ++  VT  ++ASPR GD NF+ V+    NL LLR+RN  D+VP    
Sbjct  234  VAHGLNKPRNHPHRACLVTAILFASPRVGDDNFQEVFSGLENLRLLRVRNALDVVPNY--  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL IDF KS ++K S +   WHNLE YLHG+AGT+GA    GF L V 
Sbjct  292  --PLLGYSDVGEELAIDFRKSKFIKASANPSLWHNLECYLHGVAGTQGAK--GGFKLEVG  347

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
            RDI+LVNK+ D LK+E+ +P +WW EKN GMVQ+DDG+WKLM++EE Y
Sbjct  348  RDIALVNKTTDALKDEHLVPVSWWCEKNKGMVQRDDGTWKLMDHEEDY  395



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 215/285 (75%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-AGASPQVHR  819
            WMGYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G AG  P+VH+
Sbjct  128  WMGYVAVATDEGKAVLGRRDIVIAWRGTVKTLEWVNDFEFNLVSASKILGEAGGEPKVHQ  187

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S++P S+F+  SARDQVLGEV+RLVE +KNEE+SI++ GHSLGA++ATLNA+D
Sbjct  188  GWYSIYTSDDPLSSFSKTSARDQVLGEVRRLVEEFKNEEISISLTGHSLGAAVATLNAVD  247

Query  638  IATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            I  NG N     +  PVT  V+ASPR GD NF  ++ A  NL +LR+RN  DI+P     
Sbjct  248  IVANGLN-----QGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVRNASDIIPNY---  299

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             PL+GY+DVG EL +D  KS Y+K   ++  WHNLE +LHG+AGT+G+    GF L VNR
Sbjct  300  -PLLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGS--RGGFRLEVNR  356

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+LVNKS D L +EY +P +W  EKN GMVQQ DGSWKLM++EE
Sbjct  357  DIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEE  401



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 211/286 (74%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G    P+VH+G
Sbjct  130  WIGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQG  189

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SARDQVL EVKRLVELYKNEE+SITV GHSLGA++ATLNA+DI
Sbjct  190  WYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDI  249

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D  G+  PVT  V+ASP+ GD NF   +    +L  LRIRN  DIV    P
Sbjct  250  VANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV----P  305

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
            + P++ YT+VGVEL I+  KS Y+K      +WHNLE YLHG+AGT+G+    GF L +N
Sbjct  306  SYPILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSK--GGFKLEIN  363

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RD+SLVNK  D LK+EY +P +W  EKN GMVQQ+DGSWKLM++EE
Sbjct  364  RDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  409



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   340 bits (873),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 211/286 (74%), Gaps = 8/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK  LGRRDI++ WRGT++TLEWV+D EF LV A +I G    P+VH+G
Sbjct  170  WIGYVAVATDEGKAVLGRRDIVIAWRGTVQTLEWVNDFEFDLVSASKILGEKGDPRVHQG  229

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SARDQVL EVKRLVELYKNEE+SITV GHSLGA++ATLNA+DI
Sbjct  230  WYSIYTSDDSRSPFNRISARDQVLQEVKRLVELYKNEEISITVTGHSLGAAIATLNAVDI  289

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D  G+  PVT  V+ASP+ GD NF   +    +L  LRIRN  DIV    P
Sbjct  290  VANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQDLRALRIRNAFDIV----P  345

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
            + P++ YT+VGVEL I+  KS Y+K      +WHNLE YLHG+AGT+G+    GF L +N
Sbjct  346  SYPILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVAGTQGSK--GGFKLEIN  403

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RD+SLVNK  D LK+EY +P +W  EKN GMVQQ+DGSWKLM++EE
Sbjct  404  RDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  449



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   339 bits (869),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 171/288 (59%), Positives = 217/288 (75%), Gaps = 9/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  819
            W+GYV V++DEGK  LGRRDI++ WRGTIR+LEWV+DL F+LV AP++FG     P+VH+
Sbjct  132  WIGYVGVSSDEGKDVLGRRDIVIAWRGTIRSLEWVNDLNFVLVSAPKLFGNNIIDPKVHQ  191

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+SE+P S FN  SAR+QVL EV+RLVE YKNEE+SIT+ GHSLGA++ATLNA+D
Sbjct  192  GWYSIYTSEDPRSPFNKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNAVD  251

Query  638  IATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I TNG N  +D   K+ PVT  V+ASPR GD NF+ V+    +L  LRIRN  DIVP   
Sbjct  252  IVTNGYNKPNDSSIKASPVTAIVFASPRVGDTNFQKVFSDQKDLSTLRIRNELDIVPNY-  310

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P IGY+DVG EL ID +KS Y+K   +  +WHNLE YLHG+AGT+G+    GF L V
Sbjct  311  ---PFIGYSDVGEELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVAGTQGSK--RGFKLEV  365

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            NRDISLVNK+ D LK+EY +P +W V +N GMVQQ DGSWKL++ E+G
Sbjct  366  NRDISLVNKTLDVLKDEYLVPISWRVVENKGMVQQPDGSWKLVDPEDG  413



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   338 bits (866),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 213/284 (75%), Gaps = 6/284 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMG+VAV+TDEGK ALGRRDI++ WRGT++TLEWV+D EF LV A +I G   +P+VH+G
Sbjct  114  WMGFVAVSTDEGKVALGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKILGESGNPKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S +N  SARDQVL EV RLV+ +KNEE+SIT+ GHSLGA+LATLNA+DI
Sbjct  174  WYSIYTSDDSRSPYNKNSARDQVLNEVGRLVDQFKNEEISITITGHSLGAALATLNAVDI  233

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N + + K  PVT  ++ASPR GD NFK V+    +L  +RI N  D+VP+     
Sbjct  234  VANGFNMSHENKGCPVTAMLFASPRVGDSNFKKVFSGYMDLKAIRIHNFLDVVPKY----  289

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            P IGY DVG EL ID +KS Y+K   ++ +WHNLE YLHG+AGT+  G   GF LVVNRD
Sbjct  290  PFIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGTQ--GFKGGFELVVNRD  347

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            I+L+NK+ D LK+EY +P +W +++N GMVQ+ DGSWKL ++EE
Sbjct  348  IALINKTIDGLKDEYLVPVSWRIQENKGMVQEADGSWKLEDHEE  391



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 220/289 (76%), Gaps = 11/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            W+G+VAVA DEGK  LGRRDI++ WRGTI+TLEWV+DL+FLLV AP++FG   +   P+V
Sbjct  129  WIGFVAVANDEGKDVLGRRDIVIAWRGTIQTLEWVNDLQFLLVSAPKVFGNSNNINDPKV  188

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            H+G+Y++Y+SE+P S F+  SAR+QVL EV+RLVE YKNEE+SIT+ GHSLGA++ATLNA
Sbjct  189  HQGWYSIYTSEDPRSPFSKTSARNQVLSEVRRLVEKYKNEEISITITGHSLGAAIATLNA  248

Query  644  IDIATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            +DI TNG N  SD   K+ PVT  V+ASPR GD NF+ ++ +  +L  LRIRN  DIVP 
Sbjct  249  VDIVTNGFNKPSDPSLKASPVTAIVFASPRVGDTNFQKLFSSYKDLSTLRIRNELDIVPN  308

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                 P IGY+DVG EL ID  KS Y+K   +I +WHNLE YLHG+AGT+G+  +  F L
Sbjct  309  Y----PFIGYSDVGEELKIDTRKSMYLKSPGNILSWHNLEAYLHGVAGTQGSKRV--FKL  362

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDI+LVNK+ D LK+EY +P +W V +N GMVQQ DGSWKL+++E+
Sbjct  363  EVNRDIALVNKTLDGLKDEYLVPVSWRVVENKGMVQQLDGSWKLIDHED  411



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/284 (58%), Positives = 211/284 (74%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W G+VAVATD+GK ALGRRDI++ WRG+++TLEW +D +F+ V A +IFG  + P+VH G
Sbjct  154  WAGFVAVATDKGKIALGRRDIVIVWRGSVQTLEWFNDFDFIQVSATKIFGEKSDPKVHHG  213

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN +SARDQVLGEVKRL+E YK EEVSITV GHS+GAS+ATLNA DI
Sbjct  214  WYSIYTSDDSRSLFNKESARDQVLGEVKRLMEQYKTEEVSITVTGHSMGASMATLNAGDI  273

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N     K FPVT F++ASPR GD NFK  +    NL  LRIRN PD+V    P+ 
Sbjct  274  VFNGIN-----KGFPVTAFLFASPRVGDENFKRTFSKLENLRALRIRNAPDLV----PSY  324

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PL GY+DVGVEL ID  KS Y+K   D  ++HN + YLHGIAGT+G+    GF L V RD
Sbjct  325  PLFGYSDVGVELAIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSK--GGFKLEVERD  382

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            ISL+NK  D LK+EY +P +WWVEKN GMVQQ +G+W L+++E+
Sbjct  383  ISLINKYLDALKDEYGVPTSWWVEKNNGMVQQQNGTWILVDHED  426



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/288 (58%), Positives = 211/288 (73%), Gaps = 10/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMGYVAVATDEGK  LGRRD++V WRGT++ LEW++DL+F LV A  I G G S  PQVH
Sbjct  114  WMGYVAVATDEGKKVLGRRDVVVAWRGTVQALEWINDLDFTLVSASGILGKGYSGDPQVH  173

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RG+ ++Y+S++P S +N  SAR+QVL E+ RL++ Y  EE SITV GHSLGA+LATLNA 
Sbjct  174  RGWLSIYTSDDPRSPYNKDSARNQVLREIGRLMDEYNKEETSITVTGHSLGAALATLNAA  233

Query  641  DIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DIA+NG N ++    KS PV  FV+ASPR GD +F+  +   P L LLRIRNVPD+VP  
Sbjct  234  DIASNGLNKSNARPNKSSPVAAFVFASPRVGDSDFREAFSNIPELRLLRIRNVPDLVPNY  293

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
                PL+GY D+GVELTID  KS Y+K   ++ +WHNLE YLHG+AGT G      F L 
Sbjct  294  ----PLLGYDDIGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVAGTNGGK--GRFKLE  347

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            V+RD++LVNK  D LK+EY +P +WWVEKN GMV+  DG W+LM++EE
Sbjct  348  VDRDVALVNKGLDALKDEYLVPASWWVEKNKGMVKGADGHWRLMDHEE  395



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 213/285 (75%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  819
            W+G+VAVATDEGK ALGRRDI++ WRG+++T+EW +D +F+ V APEIFG   S P+VH 
Sbjct  150  WVGFVAVATDEGKVALGRRDIVISWRGSVQTMEWFNDFDFIQVSAPEIFGHQKSIPKVHH  209

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S +  S F+  SAR+QVLGEV+RLVE YKNEE++ITV GHS+GA++ATLNA+D
Sbjct  210  GWYSVYTSNDSRSPFSKASARNQVLGEVQRLVEQYKNEEITITVTGHSMGAAVATLNAVD  269

Query  638  IATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            +  NG N     K FPVT F++ASPR GD N K  +    NL  LR+RN PDIVP     
Sbjct  270  MVFNGFN-----KGFPVTAFLFASPRVGDENLKKTFSKLENLRTLRVRNAPDIVPNY---  321

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             PL+GY+DVGV+L ID +KS+Y+K   D  +WHN++ YLHG+AGT+G+    GF L V  
Sbjct  322  -PLLGYSDVGVQLDIDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSK--GGFKLQVQH  378

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DIS+VNK    LK+EY +P +WWVEKN GMVQQ DGSW LM++E+
Sbjct  379  DISVVNKYLGALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHED  423



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 212/286 (74%), Gaps = 9/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEG   LGRRD++V WRGT+  LEW++DL+F +VPAPE+ G+ +SP VHRG
Sbjct  114  WMGYVAVATDEGAAQLGRRDVLVAWRGTLLPLEWINDLDFTMVPAPEVLGS-SSPLVHRG  172

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+SE+P S ++  SAR+QVL EV RL+E YK+EE SIT+ GHSLGA++ATLNA+DI
Sbjct  173  WLSIYTSEDPKSPYSKSSARNQVLKEVGRLIEEYKDEETSITITGHSLGAAVATLNAVDI  232

Query  635  ATNGANTTSDGKS--FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N +S+  S   PVT FV+ASPR GD+ F+ ++  TP+L LLR+RN PD+VP    
Sbjct  233  VANSFNRSSNPSSTGCPVTAFVFASPRVGDFEFQKLFSGTPDLRLLRVRNAPDLVPNY--  290

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              P+I Y DVGVEL ID  KS Y+K   D+  WHNLE YLHG AG +G     GF L ++
Sbjct  291  --PIIPYVDVGVELAIDTRKSEYLKAPGDLTTWHNLECYLHGTAGAQGR--RGGFKLAID  346

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RD++LVNKS D LK+EY +P +WWVEKN GM++  DG +KL ++EE
Sbjct  347  RDVALVNKSTDALKDEYLVPDSWWVEKNKGMMKGADGHYKLEDHEE  392



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 216/287 (75%), Gaps = 9/287 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  819
            WMGYVAVATDEGK ALGRRDI++ WRGT+R+LEWV+DLEF+ V AP+IF      P+VH+
Sbjct  113  WMGYVAVATDEGKVALGRRDIVIAWRGTVRSLEWVNDLEFVSVSAPKIFTENDDDPKVHQ  172

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y++++  S FN  SARDQVL E++RLVE +K EE+SITV GHSLGA++ATLNA+D
Sbjct  173  GWYSIYTTDDSRSPFNKISARDQVLDEIRRLVEEFKGEEISITVTGHSLGAAVATLNAVD  232

Query  638  IATNGANTT--SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N +  + GK+ PVT FVYASPR GD  F+ V+    NL +LRIRN  D+VP   
Sbjct  233  IVANGFNKSVQNPGKACPVTAFVYASPRVGDQGFEKVFSQQQNLKVLRIRNSLDVVPNY-  291

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               PL+GY DVG +L ID +KS Y+K   ++ +WH+LE Y+HGIAGT+  G+  GF LV 
Sbjct  292  ---PLLGYADVGEQLGIDTTKSKYLKSPGNLSSWHSLECYMHGIAGTQ--GLQGGFKLVA  346

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            NRD++LVNK  D LK+E+ +P +WW  +N GMVQQ DGSWKL ++E+
Sbjct  347  NRDVALVNKHMDALKDEHCVPVSWWCIQNKGMVQQSDGSWKLEDHED  393



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/285 (58%), Positives = 207/285 (73%), Gaps = 8/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW++D  F+LV A  I G    P VH+G
Sbjct  114  WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWINDFNFILVSASGILGTKNDPNVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++P SA+N  SAR QVL EVKRLVE +K+EE+SITV GHSLGA+L TLNA+DI
Sbjct  174  WLSIYTSDDPRSAYNTTSARQQVLEEVKRLVEEFKDEEISITVTGHSLGAALGTLNAVDI  233

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+  VT F++  PR GD NF+ V  +  NL LLR+RN  D+VP    
Sbjct  234  VANGVNKPKDHPEKACLVTAFLFGCPRVGDANFQKVVSSLENLRLLRVRNSLDLVPNY--  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL ID  +SS++K S D  NWHN+EGYLHG+AGT+G     GF L V 
Sbjct  292  --PLVGYSDVGQELVIDTRQSSFLKSSVDPGNWHNMEGYLHGVAGTQGTK--GGFKLEVG  347

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDISLVNKS D LK+EY +P  WW EKN GM+Q +DGSWKL+++E
Sbjct  348  RDISLVNKSTDALKDEYLVPMMWWCEKNKGMIQGEDGSWKLVDHE  392



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 217/300 (72%), Gaps = 9/300 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV TDEG   LGRRDI+V WRG+I+TLEW++D  F+LV A  IFG  +   QVH+
Sbjct  115  WMGYVAVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQ  174

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S +  S FN  SARDQVL EV+RLVE YK+EE+SITVCGHSLGA+LATLNA D
Sbjct  175  GWYSIYTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAAD  234

Query  638  IATNGANTTSDGKSFP--VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N T +    P  VT FV+ASPR G+ +FK ++    +L  LR+RN+PDIVP  P
Sbjct  235  IVANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP  294

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY+DVG ELTID  KS Y+K   D+ ++HNLE  LHG+AGT+G    + F L V
Sbjct  295  P----LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQGTTTKE-FKLQV  349

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE-EGYIPRPP*LLFL  108
             RDISL+NKS D LK+EY +PG+W V KN GMVQQDDGSWKLM++E +G     P L F+
Sbjct  350  KRDISLINKSIDALKDEYMVPGSWRVLKNKGMVQQDDGSWKLMDHEMDGEDVHEPCLYFV  409



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   336 bits (861),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/289 (57%), Positives = 211/289 (73%), Gaps = 10/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK  LGRRDI++ WRGT+R+LEWV+DL F +V A  I G  A  +VH+G
Sbjct  150  WIGYVAVATDEGKALLGRRDIVIAWRGTVRSLEWVNDLHFSMVSASNILGEEADAKVHQG  209

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SAR+QVL EV RLVE YK+EE+SIT+ GHSLGA++ATL+A+DI
Sbjct  210  WYSIYTSDDSHSPFNKTSARNQVLAEVSRLVEQYKDEEISITITGHSLGAAIATLSAVDI  269

Query  635  ATNGANTTSDG-----KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
              NG N   D       S PVT FV+A PR GD NFK ++ +  NL +LR+ N  DIVP 
Sbjct  270  VANGINKPKDQTANKLSSCPVTAFVFACPRVGDSNFKKLFSSYNNLRVLRVSNALDIVPN  329

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             P    L+GY++VG EL ID  KSSY+K    + +WHNLEGYLHG+AGT+G+    GF L
Sbjct  330  YP---FLVGYSEVGEELGIDSRKSSYLKSPGSVLSWHNLEGYLHGVAGTQGSK--GGFKL  384

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V RDI+LVNKS D LKEEY +P +W  EK+ GMVQ +DGSW+LM++EE
Sbjct  385  EVKRDIALVNKSHDALKEEYLVPVSWRCEKDKGMVQMEDGSWQLMDHEE  433



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 215/287 (75%), Gaps = 9/287 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  819
            WMGYVAVATDEGK  LGRRDI++ WRGT+RTLEW++D EF LV A +I G  A  P+VH+
Sbjct  144  WMGYVAVATDEGKAELGRRDIVIAWRGTVRTLEWINDFEFRLVSASKILGDKAGDPKVHQ  203

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+SE+  S FN  SAR QVL E++RLVE YK+EE+SIT+ GHSLGA++ATLNA+D
Sbjct  204  GWYSIYTSEDQRSRFNKTSARQQVLSEIERLVEQYKDEEISITITGHSLGAAIATLNAVD  263

Query  638  IATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I +N  N       K  PVT  ++ASPR GD +F+N++ +  +L  LR+RN  DIVP   
Sbjct  264  IVSNRYNKPKHHPHKPCPVTAIIFASPRVGDSDFRNLFSSYKDLRALRVRNALDIVPNY-  322

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P+I Y+DVG EL ID SKSSY+K   +I +WHNLEGYLHG+AGT+G+    GF L V
Sbjct  323  ---PIIEYSDVGEELKIDTSKSSYLKSPGNISSWHNLEGYLHGLAGTQGSK--GGFKLEV  377

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +RDI+LVNK+ D LK+EY +P +W  EKN GMVQ +DGSWKL+++EE
Sbjct  378  HRDIALVNKTMDGLKDEYLVPESWRCEKNKGMVQLEDGSWKLIDHEE  424



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/289 (56%), Positives = 214/289 (74%), Gaps = 12/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMG+VAVATDEG+ ALGRRDI++ WRGTI+ LEWV+DL+F LV APEIFG     G  P+
Sbjct  77   WMGFVAVATDEGRLALGRRDILISWRGTIQNLEWVNDLQFELVSAPEIFGETNNEGDEPK  136

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH G+ ++Y+S++P S FN  SAR QVL EV+RLVE YKNEE SIT+ GHS+GA+++TLN
Sbjct  137  VHLGWRSIYTSDDPKSPFNKTSARHQVLDEVRRLVEEYKNEETSITITGHSMGAAVSTLN  196

Query  647  AIDIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            A+DI   G N   D   K+ PVT FV+ASPR G+ +F+  + +  NL +LR+RN  D+V 
Sbjct  197  AVDIVAQGYNKPKDMPNKACPVTAFVFASPRVGNGSFQKFFSSLQNLRILRVRNARDVV-  255

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
               P  PLIGY++VG EL ID  +SSY+K   +  +WH LEGYLHG+AGT+G+    GF 
Sbjct  256  ---PLYPLIGYSEVGEELVIDTEESSYLKKPGNFSSWHTLEGYLHGVAGTQGSK--GGFK  310

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            L V+RDI+LVNK  + LK+EY +P +WW E+N GMVQ++DGSW LM++E
Sbjct  311  LEVDRDIALVNKHMNLLKDEYCVPESWWCERNKGMVQKEDGSWLLMDHE  359



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 211/284 (74%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATD+GK ALGRRDI++ WRG+++T+EW +D +F+ V +P+IFG  + P+VH G
Sbjct  156  WVGFVAVATDKGKIALGRRDIVIVWRGSVQTMEWFNDFDFIQVSSPKIFGEKSDPKVHHG  215

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SARDQVLGEV+RL+E YK +EV+ITV GHS+GA++ATLNA DI
Sbjct  216  WYSIYTSDDSRSPFNKGSARDQVLGEVQRLLEQYKKDEVTITVTGHSMGAAMATLNAGDI  275

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N     K FPVT F++ASPR GD NFK  +    NL  LRIRN PDIVP      
Sbjct  276  VFNGIN-----KGFPVTAFLFASPRVGDENFKKTFSKLENLRALRIRNDPDIVPNY----  326

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PL GY+DVGVEL ID  KS Y+K   D  ++HN + YLHGIAGT+G+    GF L V RD
Sbjct  327  PLFGYSDVGVELVIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSK--GGFKLEVERD  384

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            ISL+NK  D LK+EY +P +WWVEKN GMVQQ +GSW L+++E+
Sbjct  385  ISLINKYLDALKDEYGVPTSWWVEKNKGMVQQQNGSWILVDHED  428



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 214/289 (74%), Gaps = 11/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMGYVAVATDEGK  LGRRDI++ WRG+++TLEWV+DLEF  V A +IFG   +  P+VH
Sbjct  132  WMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVH  191

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            +G+Y++Y+S++  S FN  SARDQV+ E++RLV+ YKNEE+SITV GHSLGA+LATLNA+
Sbjct  192  QGWYSIYTSDDQRSPFNKTSARDQVIREIRRLVDQYKNEEISITVTGHSLGAALATLNAV  251

Query  641  DIATNGANTT--SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DIA NG N       K+ PVT  + ASPR GD  FK V     +L +LRIRN  D+VP+ 
Sbjct  252  DIAANGFNKPGGQPNKACPVTAIILASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKY  311

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPST-DIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                PLIGY DVG ELTID +KS Y+K  T +   WHNLE YLHG+AGT+G     GF L
Sbjct  312  ----PLIGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGVAGTQGRK--GGFQL  365

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK+ D+LK++Y +P +W + KN GMVQQ DGSWKLM++E+
Sbjct  366  EVNRDISLVNKTMDNLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEK  414



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 209/284 (74%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G++AV TDEGK ALGRR+I++ WRGT++TL+WV+DL+F  V APEIF     PQ+HRG
Sbjct  122  WIGFIAVCTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTDPQIHRG  181

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+SE+P S FN  S RDQV+ EVKRLVE YK+E++SIT+ GHS+GA++ TLNAIDI
Sbjct  182  WYSIYTSEDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDI  241

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N     K   VT  ++ASPR GD +F N +    NL +LR+ N  DI+P      
Sbjct  242  VVNGFN-----KGCLVTAILFASPRVGDSSFVNAFSKLENLRILRVTNCLDIIPNY----  292

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PLI Y+++GVEL ID +KS Y+K   DI +WH+LE ++HG+AG +GA    GF L V RD
Sbjct  293  PLIDYSEIGVELAIDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGAN--GGFKLEVRRD  350

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            ISLVNK  + LK+EY +P  WWVEKN GMVQQDDGSWKLM++E+
Sbjct  351  ISLVNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGSWKLMDHED  394



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/285 (57%), Positives = 206/285 (72%), Gaps = 8/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGKTALGRRDI+V WRGT +TLEW+ D EF LV A ++ G    P+VH+G
Sbjct  126  WIGYVAVATDEGKTALGRRDIVVAWRGTKQTLEWIDDFEFNLVSASKVLGEANDPKVHQG  185

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S +P S FN KSAR QVL E++RLV+LYKNEE+SITV GHSLGA++ATLNA+DI
Sbjct  186  WYSIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDI  245

Query  635  ATNGANTTSDGKS--FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N     ++   PVT   +ASPR GD NF+ V+    +L  LR+RN  DIVP    
Sbjct  246  TANAFNKPIGHQTNGCPVTAITFASPRVGDSNFRKVFSELADLRALRVRNALDIVPNY--  303

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PLIGY+DVG EL +D  KS Y+K   ++ +WH LE YLH +AGT+G    DGF L+V+
Sbjct  304  --PLIGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVAGTQGTN--DGFELMVD  359

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             D +L+NK+ D LK+EY +P +WW  KN GMVQQ DGSWKLM+ E
Sbjct  360  HDATLINKALDALKDEYLVPASWWCPKNKGMVQQADGSWKLMDYE  404



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 213/286 (74%), Gaps = 9/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            W+GYVAVATDEGK  LGRRDI++ WRGT++TLEW++D+EF LV   +IFG      +VH 
Sbjct  131  WIGYVAVATDEGKDVLGRRDIVIAWRGTVQTLEWINDIEFNLVSPEKIFGHERRDIKVHE  190

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+SE+  S +N  SARDQVL EV+RLV+ +KNEE+SITV GHSLGA+LATLNAID
Sbjct  191  GWYSIYTSEDSRSPYNKSSARDQVLNEVRRLVDQFKNEEISITVTGHSLGAALATLNAID  250

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   K+ PVT F++ASPR GD +FK  +    +L  LR+ N  D+VP   
Sbjct  251  IVANGYNRPKSQSRKASPVTAFLFASPRVGDSDFKKAFTGFKDLRALRVGNALDVVPNY-  309

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               PL+GY+DVG EL ID  KS Y+    ++ +WHNLE YLHG+AGT+G+    GF+LVV
Sbjct  310  ---PLVGYSDVGEELAIDTRKSKYLNSPGNLSSWHNLEAYLHGVAGTQGSK--GGFALVV  364

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            NRDI+LVNKS D LK+EY +P +W +EKN GMVQQ+DGSWKLM++E
Sbjct  365  NRDIALVNKSIDGLKDEYLVPVSWRIEKNKGMVQQEDGSWKLMDHE  410



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   331 bits (848),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 168/293 (57%), Positives = 214/293 (73%), Gaps = 15/293 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA----SPQ  828
            W+GYVAVATDEGK ALGRRDI++ WRGT+RTLEW++D EF LV AP IFGA       P+
Sbjct  136  WIGYVAVATDEGKLALGRRDILIAWRGTVRTLEWINDFEFSLVDAPLIFGAANDGDDQPR  195

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH G+Y++Y+S++P S FN  SAR+QVL EVKRLVE YKNEE SITV GHSLGA++ TLN
Sbjct  196  VHLGWYSIYTSDDPRSPFNKTSARNQVLEEVKRLVEEYKNEETSITVTGHSLGAAVCTLN  255

Query  647  AIDIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATP---NLHLLRIRNVPD  483
            A DI  N  N  +D   KS PVT F +ASPR GD  F+ +  +     NL++LR+RN  D
Sbjct  256  ASDIVVNKYNKPNDMPDKSCPVTVFAFASPRVGDDKFRKILSSLKTNNNLNILRVRNAKD  315

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            IVP+     P I Y++VGVEL ID  KSSY+K   ++ +WH+LEGYLHG+AGT+G+    
Sbjct  316  IVPKY----PFIDYSEVGVELVIDTDKSSYLKSPGNLSSWHSLEGYLHGVAGTQGS--RG  369

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            GF L VNR ++LVNK  D LK+EY +P +WW E+N  MVQ DDGSW+L+++E+
Sbjct  370  GFKLEVNRSLALVNKHMDGLKDEYCVPVSWWCERNKSMVQSDDGSWELIDHED  422



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 163/290 (56%), Positives = 209/290 (72%), Gaps = 8/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK ALGRRDI++ WRG+++ LEW+ D  F++V A +I G    P VH+G
Sbjct  113  WMGYVAVATDEGKAALGRRDIVIAWRGSLQALEWIDDFSFIMVSASQILGRTIDPFVHQG  172

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++P + FN  SARDQVL EV+RLVE YK+EE+SIT+ GHSLGA+L TLNA+DI
Sbjct  173  WLSIYTSDDPRAPFNRTSARDQVLSEVRRLVEEYKDEEISITITGHSLGAALGTLNAVDI  232

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+  VT F++ASPR GD  F+ +  +  NL LLR+RN  DIVP    
Sbjct  233  VANGFNRPKDRPDKACLVTAFLFASPRVGDDKFQKLLSSLENLRLLRVRNALDIVPNY--  290

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PLIGY+DVG EL ID  KS+++K   ++   HNLEGYLHG+AGT+G+    GF L V 
Sbjct  291  --PLIGYSDVGQELVIDTQKSTFLKSPANLSVSHNLEGYLHGVAGTQGSK--GGFKLEVE  346

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
            RDI+LVNKS D L++EY +  +W  EKN GMVQ  DGSWKLM++EE Y P
Sbjct  347  RDIALVNKSIDGLRDEYLVLASWRCEKNKGMVQGADGSWKLMDHEEDYYP  396



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   330 bits (846),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/285 (56%), Positives = 207/285 (73%), Gaps = 8/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRD++V WRGT +TLEWV D EF+LV A ++ G    P+V +G
Sbjct  126  WIGYVAVATDEGKAALGRRDVVVAWRGTKQTLEWVDDFEFILVSASKVLGKANDPKVQKG  185

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S +P S FN KSAR QVL E++RLV+LYKNEE+SITV GHSLGA++ATLNA+DI
Sbjct  186  WYSIYNSSDPRSPFNKKSARHQVLEEIRRLVDLYKNEEISITVTGHSLGAAIATLNAVDI  245

Query  635  ATNGANTTSDGKS--FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N     ++   PVT F +ASPR GD NF+ ++    +L +LR+RN  DIVP    
Sbjct  246  VANAFNKPIGHQTNGCPVTAFAFASPRVGDSNFRKLFSELADLRVLRVRNALDIVPNY--  303

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL+GY+DVG EL +D  KS Y+K   ++ +WH LE YLH  AGT+G     GF L+V+
Sbjct  304  --PLLGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAAGTQGTN--GGFELMVD  359

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RD++L+NKS D LK EY +P +WW  KN GMVQQ DGSWKLM++E
Sbjct  360  RDVALINKSLDALKVEYLVPASWWCPKNKGMVQQADGSWKLMDHE  404



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 213/289 (74%), Gaps = 11/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMGYVAVATDEGK  LGRRDI++ WRG+++TLEWV+DLEF  V A +IFG   +  P+VH
Sbjct  132  WMGYVAVATDEGKAVLGRRDIVIAWRGSLQTLEWVNDLEFNFVSAEKIFGGDRTDDPKVH  191

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            +G+Y++Y+S++  S FN  SARDQV+ E++RLV+ YKNEE+SITV GHSLGA+LATLNA+
Sbjct  192  QGWYSIYTSDDQRSPFNKTSARDQVIHEIRRLVDQYKNEEISITVTGHSLGAALATLNAV  251

Query  641  DIATNGANTT--SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DIA NG N       K+ PVT  ++ASPR GD  FK V     +L +LRIRN  D+VP+ 
Sbjct  252  DIAANGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQDLRVLRIRNELDVVPKY  311

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKP-STDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                PLIGY DVG ELTID + S Y+K  + +   WHNLE YLHG+AGT+G     GF L
Sbjct  312  ----PLIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGVAGTQGRK--GGFQL  365

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             VNRDISLVNK+ D LK++Y +P +W + KN GMVQQ DGSWKLM++E+
Sbjct  366  EVNRDISLVNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHEK  414



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 203/286 (71%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATD GK ALGRRDI+V WRGTI+  EWV D  F L  APEIFG  +S QVH G
Sbjct  114  WIGYVAVATDAGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDLAPEIFGGDSSAQVHHG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            FY+LY+S NP S F   SAR+QVLGEV RLVE Y  KNEE+SI+V GHSLGA+LATLNA+
Sbjct  174  FYSLYTSSNPGSKFTDTSARNQVLGEVGRLVEEYTSKNEEISISVTGHSLGAALATLNAV  233

Query  641  DIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DIA  G N   +   K+FPVT F YA PR GD +F+  ++   +L  LRIRNV DIV   
Sbjct  234  DIAAQGLNIPKNQPQKAFPVTAFAYACPRVGDSSFEETFNGYKDLRSLRIRNVTDIV---  290

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
             P TP +G++DVG EL ID  KS Y+K        HNLE YLHG+AGT+G     GF+L 
Sbjct  291  -PITPFLGFSDVGEELVIDTRKSKYLKSGVSA---HNLEAYLHGVAGTQGEK--GGFNLE  344

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNN  150
            VNRDI+LVNKS D LK+EY +P  W V++N GMVQQ DGSWK+++ 
Sbjct  345  VNRDIALVNKSMDALKDEYLVPVAWRVQENKGMVQQSDGSWKIVDQ  390



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 206/287 (72%), Gaps = 7/287 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WM YVAVATDEGK ALGRRDI++ WRGT+++LEWVSDL+F LV A  I      P+VH+G
Sbjct  154  WMAYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVSDLQFNLVSASNILSEEGDPKVHQG  213

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S +  S FN  SAR QV+ EV+RLVE YK+EE+SIT+ GHSLGA++ATL+AIDI
Sbjct  214  WYSIYTSNDSHSPFNKTSARHQVIEEVRRLVEQYKDEEISITITGHSLGAAIATLSAIDI  273

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+ PVT  ++ASPR G+ NF+ V+    +L  LR+RN  D+VP  P 
Sbjct  274  VANGLNRPKDLPNKACPVTAILFASPRVGNSNFEKVFSGYKDLRALRVRNALDVVPNYP-  332

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                 GY+DVG ELTID  KS Y+K    + +WHN+EGYLHG+AGT+G+    GF L V 
Sbjct  333  --IFFGYSDVGEELTIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSK--RGFKLEVK  388

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            RDI+LVNKS D LKEEY IP +W  EKN  M Q +DGSW LM++E+G
Sbjct  389  RDIALVNKSTDALKEEYLIPASWRCEKNKCMTQLEDGSWVLMDHEDG  435



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   328 bits (840),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 208/284 (73%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G++AV TDEGK ALGRR+I++ WRGT++TL+WV+DL+F  V APEIF     PQ+HRG
Sbjct  131  WIGFIAVCTDEGKIALGRREILISWRGTVQTLDWVNDLDFFQVSAPEIFRGNTEPQIHRG  190

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++P S FN  S RDQV+ EVKRLVE YK+E++SIT+ GHS+GA++ TLNAIDI
Sbjct  191  WYSIYTSDDPRSPFNNTSVRDQVVEEVKRLVEEYKSEKMSITITGHSMGAAVGTLNAIDI  250

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N     K   VT  ++ASPR GD NF N +    NL +LR+ N  DI+P      
Sbjct  251  VVNGFN-----KGCLVTAILFASPRVGDSNFVNAFSKLENLRILRVTNCLDIIPNY----  301

Query  455  PLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRD  276
            PLI Y+++GVEL ID +KS Y+K   DI +WH+LE Y+HG+AG +GA    GF L V RD
Sbjct  302  PLIDYSEIGVELGIDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGAN--GGFKLEVGRD  359

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            ISL+NK  + LK+EY +P  WWVEKN GMVQQDDG WKLM++E+
Sbjct  360  ISLLNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGYWKLMDHED  403



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 207/285 (73%), Gaps = 5/285 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV+TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  157  WIGYVAVSTDEGAAELGRRDVVIAWRGTVRSLEWIDDFEFGLVSAPQIFGESSDVKIHQG  216

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGA+LATLNA+DI
Sbjct  217  WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAVDI  276

Query  635  ATNGAN-TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A N  N   + G+++PVT FV+A PR GD  FK  +    ++H+LR++N  D+VP  P  
Sbjct  277  AANKLNIAAATGQAYPVTSFVFACPRVGDSEFKRAFSEYKDVHVLRVKNAMDVVPNYP--  334

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
               IGY++VG EL ID  KS Y+K    + +WHNLEGYLHG+AGT+G     GF L + R
Sbjct  335  -MFIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEGYLHGVAGTQGKNK-GGFRLEIER  392

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+L+NKS D LK+EY +P  W   +N GMVQQ DGSWKLM++EE
Sbjct  393  DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQTDGSWKLMDHEE  437



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 207/289 (72%), Gaps = 12/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI+V WRGTI+  EWV D  F L PAPEIFG  AS ++H G
Sbjct  113  WIGYVAVATDEGKEALGRRDIVVAWRGTIQAAEWVKDFHFHLDPAPEIFGDAASAELHHG  172

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+S+NP S F   SAR+QVL EV RLVE YKNEE+SI+V GHSLGA+LATLNA+DI
Sbjct  173  FYSLYTSKNPGSKFTNTSARNQVLEEVGRLVEEYKNEEISISVTGHSLGAALATLNAVDI  232

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            A  G N       K+ PVT F YASPR GD +F++ ++   +L  LRIRN  DIV    P
Sbjct  233  AAQGLNKPKGQPQKACPVTAFAYASPRVGDSSFEDAFNGYKDLRALRIRNETDIV----P  288

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
             + L+G++DVG EL ID  KS ++K        HNLE YLHG+AGT+G     GF+L VN
Sbjct  289  VSLLLGFSDVGEELLIDTRKSKFLKEGVSA---HNLEAYLHGVAGTQGKK--GGFNLEVN  343

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLM-NNEEGY  138
            RDI+L+NK  D LK+EY +P  W V++N GMVQQ DG+WKL+  NE+G+
Sbjct  344  RDIALLNKGMDALKDEYLVPVEWRVQENKGMVQQLDGTWKLIEKNEDGF  392



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 207/285 (73%), Gaps = 6/285 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  151  WIGYVAVGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQG  210

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGA+LATLNA D+
Sbjct  211  WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDM  270

Query  635  ATNGAN-TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A N  N   + G+++PVT FV+ASPR GD +FK  +    ++H+LR++N  D+VP     
Sbjct  271  AANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNY---  327

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             P+IGY++VG EL ID  KS Y+K    + +WHNLE YLHG+AGT+G     GF L + R
Sbjct  328  -PIIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNK-GGFRLEIER  385

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+L+NKS D LK+EY +P  W   +N GMVQQ DGSWKLM++EE
Sbjct  386  DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEE  430



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   326 bits (835),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 207/285 (73%), Gaps = 6/285 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG   LGRRD+++ WRGT+R+LEW+ D EF LV AP+IFG  +  ++H+G
Sbjct  157  WIGYVAVGTDEGAAELGRRDVVIAWRGTVRSLEWMDDFEFGLVSAPKIFGESSDVKIHQG  216

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S F   S R+QV+GEVKRLVE YKNEE+SI   GHSLGA+LATLNA D+
Sbjct  217  WYSIYTSDDRRSPFTNNSVRNQVIGEVKRLVEEYKNEEISIVTTGHSLGAALATLNAFDM  276

Query  635  ATNGAN-TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A N  N   + G+++PVT FV+ASPR GD +FK  +    ++H+LR++N  D+VP     
Sbjct  277  AANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKDVHVLRVKNAMDVVPNY---  333

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             P+IGY++VG EL ID  KS Y+K    + +WHNLE YLHG+AGT+G     GF L + R
Sbjct  334  -PIIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVAGTQGKNK-GGFRLEIER  391

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            DI+L+NKS D LK+EY +P  W   +N GMVQQ DGSWKLM++EE
Sbjct  392  DIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHEE  436



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 207/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  127  WMGYVAVTDDQGTAVLGRRDIVVSWRGSVQPLEWVNDFEFGLVDAKKIFGEKNDKVQIHQ  186

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK+EEVSI+VCGHSLGA+LATLNA D
Sbjct  187  GWYSIYMSDDQRSPFNKANARDQVLREIGRLLEKYKDEEVSISVCGHSLGAALATLNAAD  246

Query  638  IATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +FK ++    +L +LRIRN+PD+VP  P
Sbjct  247  IVANGYNRPKNRPDKSCPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRIRNLPDVVPIYP  306

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY++VG EL ID  KS Y+K   ++  +HNLEGYLHG+AGT+G    D F L V
Sbjct  307  P----LGYSEVGDELQIDNRKSPYMKSPGNLSTFHNLEGYLHGVAGTQGTTKADLFRLDV  362

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+EY +PG W V KN GMVQ DDGSWKL+++E
Sbjct  363  KRDIGLVNKSVDGLKDEYMVPGYWRVLKNKGMVQLDDGSWKLLDHE  408



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WM Y+AVATDEGK  LGRRDI++ WRGT+++LEWV+DL+F LV A  I G    P+VH+G
Sbjct  145  WMAYIAVATDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQG  204

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SAR QV+ EV RL+E YK+EE+SIT+ GHSLGA++ATL+AIDI
Sbjct  205  WYSIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDI  264

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+ PVT  V+ASPR G+ NF+ V+    +L  LRIRN  D+VP  P 
Sbjct  265  VANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-  323

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
               L+GY+DVG EL ID  KS Y+K    + +WHN+EGYLHG+AGT+G+    GF L V 
Sbjct  324  --ILLGYSDVGEELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVAGTQGSK--GGFKLEVK  379

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNKS D LKEEY IP +W  EKN  M Q +DGSW L ++EE
Sbjct  380  RDIALVNKSVDALKEEYLIPASWRCEKNKCMTQLEDGSWVLKDHEE  425



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   322 bits (825),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/286 (54%), Positives = 203/286 (71%), Gaps = 6/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GY+AVATD+GK ALGRRDI + WRGTI+ LEW+ D +F L  A +I G     QVH+G
Sbjct  115  WIGYIAVATDQGKQALGRRDITIAWRGTIQPLEWIKDFDFPLTSASDIVGVEKDAQVHQG  174

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F ++Y+S+NP S FN  S R+Q+   +K LV+ Y+NE++S+TV GHSLGA+LATL+A+DI
Sbjct  175  FLSIYTSDNPQSQFNKTSVREQIFETLKELVDKYENEDISVTVTGHSLGAALATLSAVDI  234

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N + D   K+ PVT FV+A PRTGD  F+ V D+  +L +LR+ N PDI+P+VPP
Sbjct  235  VANGLNRSDDQASKACPVTAFVFACPRTGDLAFREVSDSFSDLRILRVTNTPDIIPKVPP  294

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                IGY DVG  L +D  KS+Y+KP+     WHNLE Y+H IAGT+G      F L VN
Sbjct  295  LA--IGYRDVGQNLELDSRKSTYLKPTGAFITWHNLEAYMHCIAGTQGGK--PDFHLEVN  350

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK  + LK+ Y +P  WW EK+ GMVQQ+DGSWKL ++E+
Sbjct  351  RDIALVNKKLNSLKDIYLVPSAWWQEKHKGMVQQEDGSWKLDDHED  396



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   322 bits (826),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 206/288 (72%), Gaps = 11/288 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA---SPQV  825
            ++GYVAVA DE   ALGRRDI++ WRGTI++LEWV+DL+FL V A  I G       P+V
Sbjct  118  FIGYVAVAEDESVAALGRRDIVISWRGTIQSLEWVNDLQFLQVSASSIVGKSDGNDDPKV  177

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            H+G+Y++Y+S++P S FN  SAR QVL E++ LVE YK+EE+SIT+ GHSLGA+LATLNA
Sbjct  178  HQGWYSVYTSDDPKSPFNKTSARYQVLQEIENLVEQYKDEEISITITGHSLGAALATLNA  237

Query  644  IDIATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            IDI  N  N   D   K   VT  ++ASPR GD NFK ++    NL LLR+ N  DIVP 
Sbjct  238  IDIVVNNKNKPKDNPQKQCLVTAIIFASPRVGDSNFKKIFPKYDNLKLLRVHNTLDIVPN  297

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                 PL+GY+DVG EL ID +KS Y+K      NWHN+E YLHG+AGT+G+   +GF L
Sbjct  298  Y----PLLGYSDVGQELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVAGTQGSK--NGFKL  351

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            VV+RDI+LVNKS D+LK+EY IP  WW  KN GMVQQ DGSW LM+NE
Sbjct  352  VVDRDIALVNKSMDNLKDEYLIPVAWWSLKNKGMVQQSDGSWLLMDNE  399



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/281 (57%), Positives = 204/281 (73%), Gaps = 7/281 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK ALGRRDI++ WRGT+++LEWV+DL+F LV A ++ G    P+VH G
Sbjct  145  WMGYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSASKLLGEDGDPKVHEG  204

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SAR QV+ EV+RLVE +K+EE+SIT+ GHSLGA++ATLNA+DI
Sbjct  205  WYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDI  264

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   +   K+ PVT  V+ASPR GD NF+ V+    ++  LR+RN  D+VP  P 
Sbjct  265  VANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRALRVRNALDVVPNYP-  323

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL GY++VG EL ID  KS Y+K    + +WHNLEGYLHG+AGT+G+    GF L V 
Sbjct  324  -IPL-GYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSK--GGFKLEVK  379

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            RDI+LVNKS D LKEEY IP +W  EKN  M Q DDGSW L
Sbjct  380  RDIALVNKSADDLKEEYLIPASWRCEKNKCMTQLDDGSWVL  420



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 202/287 (70%), Gaps = 9/287 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            +MGYVAVATDEGK ALGRRDI+V WRGTIR +E   D +F LVPA  I G   + +VH+G
Sbjct  114  FMGYVAVATDEGKIALGRRDILVAWRGTIRNIELAKDFDFPLVPASMILGKDINAKVHKG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
              ++Y+S +P S +N +SAR QVL  +K LVE +K EEVSIT+ GHSLGA+L+T+NA DI
Sbjct  174  VLSIYTSSDPQSTYNKQSARVQVLEAIKSLVEEFKKEEVSITIAGHSLGAALSTMNAADI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N T     KS  VT F + SPR GD NF+N +++  +LHLLR+RN+PD+VPQVPP
Sbjct  234  VANGYNKTRGMPNKSCMVTAFAFGSPRVGDSNFRNAFESMNDLHLLRVRNIPDLVPQVPP  293

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLE-GYLHGIAGTEGAGVLDGFSLVV  285
                I Y DVG EL ID  KS Y+K   ++  WHNLE  YLH +AGT+G+    GF L V
Sbjct  294  ----IPYADVGEELLIDSRKSPYLKRIGNLEIWHNLEAAYLHAVAGTQGSK--GGFHLEV  347

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             RDISLVNK  D +K+EY IP  WW  KN GMVQQDDGSWKL +++ 
Sbjct  348  KRDISLVNKILDAVKDEYLIPTGWWCLKNKGMVQQDDGSWKLEDHDR  394



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   320 bits (821),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WM Y+AVATDEGK  LGRRDI++ WRGT+++LEWV+DL+F LV A  I G    P+VH+G
Sbjct  145  WMAYIAVATDEGKAVLGRRDIVIAWRGTVQSLEWVNDLQFNLVSASNILGEEGDPKVHQG  204

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SAR QV+ EV RL+E YK+EE+SIT+ GHSLGA++ATL+AIDI
Sbjct  205  WYSIYTSDDSRSPFNKTSARHQVIEEVMRLIEQYKDEEISITITGHSLGAAVATLSAIDI  264

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   D   K+ PVT  V+ASPR G+ NF+ V+    +L  LRIRN  D+VP  P 
Sbjct  265  VANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKDLRALRIRNALDVVPNYP-  323

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
               L+GY+DVG EL ID  KS Y+K    + +WHN+EGYLHG+AGT+G+    GF L V 
Sbjct  324  --ILLGYSDVGEELKIDTQKSKYLKSPGGVASWHNMEGYLHGVAGTQGSK--GGFKLEVK  379

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNKS D LKEEY IP +W  E+N  M Q +DGSW L ++E+
Sbjct  380  RDIALVNKSVDALKEEYLIPASWRCEENKCMTQLEDGSWVLKDHED  425



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 203/281 (72%), Gaps = 7/281 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK ALGRRDI++ WRGT+++LEWV+DL+F LV   ++ G    P+VH G
Sbjct  116  WMGYVAVATDEGKAALGRRDIVIAWRGTVQSLEWVNDLQFNLVSVSKLLGEDGDPKVHEG  175

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y+S++  S FN  SAR QV+ EV+RLVE +K+EE+SIT+ GHSLGA++ATLNA+DI
Sbjct  176  WYSIYTSDDSRSPFNKTSARYQVIEEVRRLVEQFKDEEISITITGHSLGAAIATLNAVDI  235

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   +   K+ PVT  V+ASPR GD NF+ V+    ++  LR+RN  D+VP  P 
Sbjct  236  VANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKDVRTLRVRNALDVVPNYP-  294

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL GY++VG EL ID  KS Y+K    + +WHNLEGYLHG+AGT+G+    GF L V 
Sbjct  295  -IPL-GYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVAGTQGSK--GGFKLEVK  350

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            RDI+LVNKS D L+EEY IP +W  EKN  M Q DDGSW L
Sbjct  351  RDIALVNKSADDLEEEYLIPASWRCEKNKCMTQLDDGSWVL  391



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 202/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145  WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y +Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGA+LATLNA D
Sbjct  205  GWYLIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KSFPVT FV+ASPR GD +FK ++    +L +LR RN+PD++P  P
Sbjct  265  IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP  324

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG EL ID  KS Y+K   ++  +H LE YLHG+AGT+G    D F L V
Sbjct  325  P----IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDV  380

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+E  +PG W V KN GMVQQDDGSW L+++E
Sbjct  381  KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNLLDHE  426



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 202/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWVSD +F LV A +IFG      Q+H+
Sbjct  146  WMGYVAVTDDQGTAILGRRDIVVAWRGSVQPLEWVSDFDFSLVNANKIFGDNNDHVQIHQ  205

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK EEVSITVCGHSLGA+LATLNA D
Sbjct  206  GWYSIYMSQDERSHFNKANARDQVLREIGRLLEKYKEEEVSITVCGHSLGAALATLNATD  265

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +F  ++    +L +LRIRN+PD+VP  P
Sbjct  266  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFMKLFYGLQDLRVLRIRNLPDVVPIYP  325

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY +VG EL ID  KS Y+K   +   +H LE YLHG+AGT+G    D F L V
Sbjct  326  P----LGYAEVGDELPIDTRKSQYMKSPGNFATFHCLEAYLHGVAGTQGTAKSDLFRLDV  381

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+E  IPG+W V KN GMVQQDDGSWKL+++E
Sbjct  382  KRDIGLVNKSVDGLKDECMIPGHWRVLKNKGMVQQDDGSWKLLDHE  427



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 197/292 (67%), Gaps = 8/292 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVATD G   LGRRD++V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  134  WMGYVAVATDAGAARLGRRDVVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  193

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S N  S FN +SAR+QVL E+KRL++ YK E  SIT+ GHSLGA+L+TL A
Sbjct  194  HRGFLSVYASSNSTSRFNKQSAREQVLAEIKRLLDAYKGENCSITITGHSLGAALSTLTA  253

Query  644  IDIATNGANTT-SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            IDI +NG N   S   + PV   V+ SPR GD   K  +D+TP   LLR+RN PDIVP +
Sbjct  254  IDIVSNGVNVRGSTNDTVPVAAIVFGSPRVGDEQLKKAFDSTPGARLLRVRNAPDIVPTI  313

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PA     Y DVGVEL +D  KS ++K P      WHNLE YLHG+AGT+GAG   GF L
Sbjct  314  LPAA---FYKDVGVELLVDTRKSPHLKQPGPGPAAWHNLECYLHGVAGTQGAGDGAGFGL  370

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYI  135
            VV+RD++LVNK  D L +EY +P  WWVE N GMV+   G W L ++EEG +
Sbjct  371  VVDRDLALVNKEVDALDDEYPVPAGWWVEGNKGMVKDGSGRWVLQDHEEGNL  422



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   317 bits (811),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/286 (56%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  150  WMGYVAVTDDQGTALLGRRDIVVVWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  209

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +AR+QVL EV RL++ YK+EEVSIT+CGHSLGA+LATLNA D
Sbjct  210  GWYSIYMSQDDRSPFTKANAREQVLREVGRLLDRYKDEEVSITICGHSLGAALATLNAAD  269

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   K+ PVT FV+ASPR GD +FK ++    NL +LR RN+PD++P  P
Sbjct  270  IVANGYNRPKSRPDKACPVTAFVFASPRVGDSDFKKLFYGLENLRVLRTRNLPDVIPIYP  329

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG EL ID  KS Y+K   ++ ++H LE YLHG+AGT+G    D F L V
Sbjct  330  P----IGYSEVGDELPIDTRKSQYMKSPGNLASYHCLEAYLHGVAGTQGTAKADIFRLDV  385

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+E  +PG W V KN GMVQQDDGSWKL+++E
Sbjct  386  KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  431



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   316 bits (810),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            W+GYVAV  D+G  ALGRRDI+V WRG+++ LEWV+D EF  V A +IFG      Q+H+
Sbjct  144  WIGYVAVTDDQGTAALGRRDIVVAWRGSVQPLEWVNDFEFGFVNAKKIFGEKNDQVQIHQ  203

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S FN  +ARDQVL E+ RL+E YK+E++SI++CGH LGA++ATLNA D
Sbjct  204  GWYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHILGAAIATLNAAD  263

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +FK ++    +L +LR+RN+PD+VP  P
Sbjct  264  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYP  323

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY +VG EL ID  KS Y+K   D+  +H LE YLHG+AGT+G    D F L V
Sbjct  324  P----LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDV  379

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+EY +PG+W + KN GMVQQ+DGSWKLM++E
Sbjct  380  KRDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDGSWKLMDHE  425



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 208/286 (73%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+  +P VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSAINPCVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y++ +P S +N +SAR QVL EVKR+ +LYKNEE SIT+ GHSLGA+LAT+NAI
Sbjct  177  GGWLSVYTTADPGSQYNQESARHQVLNEVKRIQDLYKNEETSITITGHSLGAALATINAI  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     KS PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP+ P 
Sbjct  237  DIVSNGYN-----KSCPVSAFVFGSPRVGNPDFQKAFDSAADLRLLRVRNSPDVVPKWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY DVG EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L+V+
Sbjct  292  ----LGYNDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSS--GGFKLLVD  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK EYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKNEYSIPTSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 202/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145  WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGA+LATLNA D
Sbjct  205  GWYSIYMSQDERSPFTKVNARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KSFPVT FV+ASPR GD +FK ++    +L +LR RN+PD++P  P
Sbjct  265  IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLPDVIPIYP  324

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG E+ ID  KS Y+K   ++  +H LE YLHG+AGT+G    D F L V
Sbjct  325  P----IGYSEVGDEIPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDV  380

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RD+ LVNKS D L  E  +PG W V KN GMVQQDDGSWKL+++E
Sbjct  381  KRDVGLVNKSVDGLNVECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  426



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 203/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI++ WRG+++ LEWVSD +F LV A +IFG   +  Q+H+
Sbjct  145  WMGYVAVTDDQGTAVLGRRDIVIAWRGSVQPLEWVSDFDFSLVNAKKIFGEKYNQVQIHQ  204

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G++++Y SE+  S FN  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGA+LATLNA D
Sbjct  205  GWHSIYMSEDERSHFNKANARDQVLQELGRLLEKYKDEEVSISICGHSLGAALATLNATD  264

Query  638  IATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N      GKS PVT FV+ASPR G+  +K ++    ++ +LR+RN+PD+VP  P
Sbjct  265  IVANGYNRPKSRLGKSCPVTAFVFASPRVGNSEYKKLFSGLEDIRVLRVRNLPDVVPIYP  324

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY +VG E  ID  KS Y+K   +   +H LE YLHG+AGT+G    D F L V
Sbjct  325  P----LGYAEVGDEFPIDTRKSQYMKTPGNFATFHCLESYLHGVAGTQGTSSADLFRLDV  380

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK++Y IPG+W V KN GMVQQDDGSW L+++E
Sbjct  381  KRDIGLVNKSVDGLKDQYMIPGHWRVLKNKGMVQQDDGSWVLLDHE  426



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 201/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  128  WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  187

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +ARDQVL E+ RL+E YK+EEVSIT+CGHSLGA+LATLNA D
Sbjct  188  GWYSIYMSQDERSPFTKANARDQVLRELGRLLEKYKDEEVSITICGHSLGAALATLNATD  247

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +FK +     ++ +LR RN+PD++P  P
Sbjct  248  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLLSILEDMRVLRTRNLPDVIPIYP  307

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG EL ID  KS Y+K   ++  +H LE YLHG+AGT+G    D F L V
Sbjct  308  P----IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADLFRLDV  363

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             R I LVNKS D LK+E  +PG W V KN GMVQQDDGSWKL+++E
Sbjct  364  KRAIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWKLLDHE  409



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 207/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G++  P VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P+S +N +SAR QVL E+KRL ++Y++EE SIT+ GHSLGA+LAT+NA 
Sbjct  177  GGWLSVYTSADPESQYNKQSARYQVLNEIKRLQDMYEHEETSITITGHSLGAALATINAT  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     KS PV+ FV+ SPR G+ +F+  +D+ P+L LLRIRN PD+VP  P 
Sbjct  237  DIVSNGYN-----KSCPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIRNSPDVVPNWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  KS Y+K   +   WH++E Y+HG+AGT+G+    GF L ++
Sbjct  292  ----LGYSDAGTELMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEID  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK EY+IP +WWV +N GMV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  391



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 202/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  ++G   LGRRDI+V WRG+++ LEWV+D EF LV A  IFG      Q+H+
Sbjct  143  WMGYVAVTDNQGTAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKNIFGEKNDQVQIHQ  202

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y SE+  S FN  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGA+LATLNA D
Sbjct  203  GWYSIYMSEDERSPFNKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNATD  262

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +++ ++    +L +LR++N+PDIVP  P
Sbjct  263  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGFEDLRVLRVKNLPDIVPIYP  322

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY +VG EL+ID  KS Y+K   +   +H LE YLHG+AGT+G    D F L V
Sbjct  323  P----LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKNDIFRLDV  378

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D L +E  +PGNW V KN GMVQQDDGSW L+++E
Sbjct  379  KRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVLLDHE  424



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 198/290 (68%), Gaps = 8/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATD    ALGRRD++V WRGT R +EW SDL+ +LVPA  + G G    VHRG
Sbjct  128  WMGYVAVATDGAARALGRRDVVVAWRGTKRMVEWASDLDIVLVPAAGVVGPGGRGSVHRG  187

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F +LY+S+N  S FN +SAR+QVL EV+RL++ YK+E  S+T+ GHSLGA+L+TLNAIDI
Sbjct  188  FLSLYTSKNSTSRFNKQSAREQVLTEVRRLLDTYKDENCSVTLTGHSLGAALSTLNAIDI  247

Query  635  ATNGAN----TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPN-LHLLRIRNVPDIVPQ  471
              NG N    ++ D  + PVT  ++ SPR GD  FK   D+    + LLR+RN PDIVP 
Sbjct  248  VANGINALRSSSGDNITVPVTAILFGSPRVGDEQFKKALDSMAGAVSLLRVRNAPDIVPT  307

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            + P TP   Y DVGVEL +D  KS Y+K       WHNLE YLH +AGT+G G   GFSL
Sbjct  308  ILP-TPF--YRDVGVELLVDTLKSPYLKTPAGPAQWHNLECYLHAVAGTQGPGDDAGFSL  364

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
             V+RD++LVNK +D LK EY +P +WW E N GMV+   G W L ++EEG
Sbjct  365  EVDRDVALVNKEEDALKGEYPVPASWWAENNKGMVKNATGHWVLEDHEEG  414



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 199/290 (69%), Gaps = 13/290 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI+V WRGT++  EWV DL   L PAP IF   A  ++H G
Sbjct  115  WIGYVAVATDEGKAALGRRDIVVAWRGTVQGSEWVQDLHIPLDPAPLIF-RDARAELHNG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY++Y+S NPDS     SAR+QVL EV+RLVE YKNEE+SI+V GHSLGA+LATLNA+DI
Sbjct  174  FYSVYTSNNPDSHITQTSARNQVLEEVRRLVEKYKNEEISISVTGHSLGAALATLNAVDI  233

Query  635  ATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            A  G N   D   + FPVT F++ASPR G+ +F  ++    +L  LRIRN  D VP++P 
Sbjct  234  AAQGLNKPKDQPHRVFPVTAFLFASPRVGNSHFGKIFSEYKHLRALRIRNKKDQVPKLP-  292

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                IG   VG EL ID  KS Y+K        HNLE YLHG+AGT+G     GF+L VN
Sbjct  293  ----IGLAVVGQELVIDTRKSKYLKEGVSA---HNLEAYLHGVAGTQGKK--GGFNLEVN  343

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
            RDI+L+NK  D LK+EY +P  W V +N GMVQQ DG+WKL ++ E  IP
Sbjct  344  RDIALLNKGMDALKDEYLVPVEWRVHENKGMVQQSDGTWKLFDHNEDVIP  393



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   312 bits (799),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 209/336 (62%), Gaps = 56/336 (17%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW+ D EF LV A EI  A    +VH+G
Sbjct  114  WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++P S +N  SAR QVL EVKRLVE +K+EE++IT+ GHSLGA+L  LNA+DI
Sbjct  174  WLSIYTSDDPRSPYNTTSARQQVLEEVKRLVEEFKDEEINITITGHSLGAALGILNAVDI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVY---DATPNLHLLRIRNVPDIVPQ  471
              NG N  +D   K+  VT F++  P  GD NF+NV+   ++T +L LLRIRN  D+VP 
Sbjct  234  VANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRNAIDVVPN  293

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG---  300
             P   P+IGYT VG EL I+   S ++K S +  +WHNLE YLHGIAGT+G+ VL     
Sbjct  294  YP---PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSSVLPATTN  350

Query  299  ---------------------------------------------FSLVVNRDISLVNKS  255
                                                         F LVV RDI+LVNK 
Sbjct  351  KTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRDITLVNKV  410

Query  254  QDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             D LK+E+ +P  WW EKN GMVQ+DDGSWKLM++E
Sbjct  411  MDALKDEFHVPAKWWCEKNKGMVQEDDGSWKLMDHE  446



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 203/284 (71%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GA--GASPQV  825
            WMGY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L PA E+F GA  G  PQ+
Sbjct  114  WMGYIAVATDEGKEKLGRRDIVVAWRGTIQPYEWANDFDFPLDPASELFPGAETGHKPQI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+  LY++++P S FN  SAR+QVLGEV RL+E YK+EEVSIT+ GHSLGA+++TL A
Sbjct  174  ASGWLALYTTDDPRSPFNKTSAREQVLGEVNRLLEQYKDEEVSITLTGHSLGATMSTLCA  233

Query  644  IDIATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
             DIA NG         K F VT F +ASPR GD NFK + D+  NL++LRI NVPD+VP+
Sbjct  234  TDIAYNGHKKMKSLQHKPFYVTAFAFASPRVGDKNFKMLVDSIENLNILRITNVPDVVPR  293

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                 PL+GY D G  LTI+  KS Y+K S ++ N+HN++ YLHG+AGT+G+  L GF L
Sbjct  294  Y----PLLGYDDAGEVLTINTLKSKYLKQSLNLRNYHNIDIYLHGVAGTQGS--LGGFKL  347

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             + +DIS VNK  D L +EY IPG+WW  +N GMVQ DDGSWKL
Sbjct  348  EIEKDISSVNKRLDALDDEYLIPGSWWCVENKGMVQMDDGSWKL  391



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 201/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A  IFG      Q+H+
Sbjct  61   WMGYVAVTDDQGTAVLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAQNIFGEKNDQVQIHQ  120

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
             +Y++Y SE+  S F+  +ARDQVL E+ RL+E YK+EEVSI++CGHSLGA+LATLNA D
Sbjct  121  DWYSIYMSEDERSPFSKANARDQVLREIGRLLEKYKDEEVSISICGHSLGAALATLNASD  180

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +++ ++    +L +LR++N+PD+VP  P
Sbjct  181  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGLEDLRVLRVKNLPDVVPIYP  240

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY +VG EL+ID  KS Y+K   +   +H LE YLHG+AGT+G    D F L V
Sbjct  241  P----LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVAGTQGTSKSDIFRLDV  296

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D L +E  +PGNW V KN GMVQQDDGSW L+++E
Sbjct  297  KRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVLLDHE  342



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 197/286 (69%), Gaps = 6/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GY+AVATD+ K  LGRRDI V WRGT++ LEW+ D +F L  A ++ G     QVH+G
Sbjct  118  WIGYIAVATDQAKEKLGRRDIAVAWRGTLQPLEWIKDFDFPLTSASDVLGGHNDAQVHQG  177

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F+++Y+S+NP S  +  SAR QVL  ++ LV  Y+NEE+S+TV GHSLGA+LATL+A DI
Sbjct  178  FHSVYTSDNPQSQTSKTSARQQVLDGLRELVNKYENEEISVTVVGHSLGAALATLSAADI  237

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N T     KS PVT F +A PRTG+  FK V D+  +L +LRI N PD+VP+VPP
Sbjct  238  VANGFNRTDKQANKSCPVTAFAFACPRTGNRGFKQVCDSLEDLRILRITNTPDMVPKVPP  297

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
               + GY++VG  L ID  KS Y+KP+    +WHNLE YLH IAGT+G      F L   
Sbjct  298  L--IAGYSEVGENLEIDSRKSMYLKPTGGFISWHNLETYLHTIAGTQGK--RSAFRLECQ  353

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDISLVNK+ D LKE+Y +PGNWW   N GM+QQ+DG WKL + ++
Sbjct  354  RDISLVNKNLDALKEKYMVPGNWWCGLNNGMIQQEDGLWKLFDRDK  399



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 206/305 (68%), Gaps = 28/305 (9%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  834
            W+GYVAVATD+GK ALGRRDI++ WRGTI+ LEW SD  F L PA +I G          
Sbjct  22   WIGYVAVATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADT  81

Query  833  -------------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSI  693
                         P+VH GF ++Y+S++P S FN  SAR+QVL EV+RLV+ YK+EE+SI
Sbjct  82   AADAAADDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISI  141

Query  692  TVCGHSLGASLATLNAIDIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDAT  522
            TV GHSLGA+LA+LNA+DIA NG N +   +S    PVT FVYASPR G+  F N+ ++ 
Sbjct  142  TVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSI  201

Query  521  PNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYL  342
            P+L LLR  N+ D+VP+VP A    GY+D G EL I+   S Y+K   +I  WH++E YL
Sbjct  202  PSLRLLRTANLLDVVPKVPGA----GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYL  257

Query  341  HGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWK  162
            HG+AGT+G     GF L V RD++LVNK Q  +++EY +P  WWV KN GMVQ +DGSW+
Sbjct  258  HGLAGTQGTK--GGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDGSWQ  315

Query  161  LMNNE  147
            L ++E
Sbjct  316  LEDHE  320



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 206/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G++  P+VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSANDPRVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGA+LAT++A 
Sbjct  177  GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     K+ PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP  P 
Sbjct  237  DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L V+
Sbjct  292  ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LKEEYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKEEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 205/286 (72%), Gaps = 9/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA-GASPQVHR  819
            W+GYVAVATD+GK  LGRRDI+V WRGTI+TLEW++D +F  + A +IFG  G    VH+
Sbjct  137  WIGYVAVATDQGKQVLGRRDIVVAWRGTIQTLEWINDFDFGTINAKKIFGDNGDGVGVHQ  196

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+SE+  S FN  SARDQVL E++RLVE YK+EE+SIT+CGHSLGA+L+TL+A D
Sbjct  197  GWYSIYTSEDERSPFNKASARDQVLREIRRLVEKYKDEEISITICGHSLGAALSTLSAAD  256

Query  638  IATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT F +ASPR GD +FK ++    +L  LRIRN+PD+VP  P
Sbjct  257  IVANGYNRPKNLPDKSCPVTVFAFASPRVGDSDFKRLFSGLDDLRALRIRNLPDVVPIYP  316

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG EL +D  KS Y+K   +   +H +E YLHGIAGT G      F L +
Sbjct  317  P----IGYSEVGEELVMDTRKSPYLKSPGNPTLFHTMEVYLHGIAGTRGTK--SDFKLEI  370

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI+LVNK  D LK+E+ +PG+W   KN GM QQ+DGSWKLM++E
Sbjct  371  ERDIALVNKPIDGLKDEFMVPGSWRALKNKGMAQQNDGSWKLMDHE  416



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   310 bits (793),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/289 (54%), Positives = 195/289 (67%), Gaps = 7/289 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVATD G  ALGRRDI+V WR T R  EW SDL+F LVPA  I G G   + P V
Sbjct  127  WMGYVAVATDRGAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYV  186

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S+N  S FN +SAR+ VL EV+ L++ YKNE+ SI++ GHSLG +L TLNA
Sbjct  187  HRGFLSVYTSKNSTSRFNRRSARELVLTEVRGLLDTYKNEDCSISITGHSLGGALTTLNA  246

Query  644  IDIATNGANTTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            ID+  NG N     +S  PVT   + +PR GD  FK  + +   L LLR+RNVPDIVP +
Sbjct  247  IDLVANGFNVRGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGLSLLRVRNVPDIVPTI  306

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
             P  P+I Y DVGVEL +D  KS Y+K       WHNLEGYLHG+AGT GA    GF + 
Sbjct  307  LP--PVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGARDSAGFGME  363

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            V+RD++L+NK +D L++EY +P  WW E N GMV+   G W L ++EEG
Sbjct  364  VDRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVLHDHEEG  412



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 198/286 (69%), Gaps = 11/286 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRDI+V WRGTI+ LEWV+DL+F  VPA  + G+ AS      
Sbjct  150  WMGYVAVATDEGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPAAPVLGSAASQNRFAV  209

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S N  S F   SA++QVL EV+RLVELYK+EEVSITVCGHSLGASLATLN
Sbjct  210  VHRGFLSVYTSSNKSSEFTKTSAKEQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLN  269

Query  647  AIDIATNGANT-TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+D+ ++GAN   S  KSFPVT  V+ASP  GD  F++ +++ P+L  L ++N  DIVP 
Sbjct  270  AVDLVSSGANKPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPM  329

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DV VELTI   +S Y++    +   HNLE YLHG+AG +G+    GF L
Sbjct  330  YPP----LGYVDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSA--GGFKL  383

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
             V RD++LVNK  D L  E+ +P  WWV K+  MV+  DG W L +
Sbjct  384  EVERDVALVNKGVDALTNEHPVPAEWWVPKHKFMVKGKDGRWTLQD  429



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 205/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  L PA EI   G++  P+VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLAPASEIVRPGSANDPRVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EVKRL +LYK EE SIT+ GHSLGA+LAT++A 
Sbjct  177  GGWLSVYTSTDPGSRYNEQSARYQVLDEVKRLQDLYKQEETSITITGHSLGAALATISAT  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     K+ PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP  P 
Sbjct  237  DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFRKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L V+
Sbjct  292  ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK+EYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 207/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G++  P VH
Sbjct  120  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  179

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P+S +N +SAR QVL E+KRL ++Y++EE SIT+ GHSLGA+LAT++A 
Sbjct  180  GGWLSVYTSADPESQYNKQSARYQVLNEIKRLQDVYEHEETSITITGHSLGAALATISAT  239

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     KS PV+ FV+ SPR G+ +F+  +D+ P+L LLRIRN PD+VP  P 
Sbjct  240  DIVSNGYN-----KSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWPK  294

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L ++
Sbjct  295  ----LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEID  348

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDISLVNK +D LK EY+IP +WWV +N GMV+  DG W L ++E+
Sbjct  349  RDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  394



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 195/291 (67%), Gaps = 13/291 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATD+G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G  A+      
Sbjct  117  WMGYVAVATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL  176

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S NPDS +N  SARDQVL EV RLV LYK+E  SITVCGHSLGASLATLN
Sbjct  177  VHRGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLN  236

Query  647  AIDIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A+D+A NG N    G S    PVT  V+ASPR GD NFK    + P+L  L ++N  DIV
Sbjct  237  AVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIV  296

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  PP    +GY DV V+L I   +S Y++    I   HNLE YLHG+AG +G+    GF
Sbjct  297  PTYPP----LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSA--GGF  350

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             L V+RD++LVNK +D LK++Y +P  WWV KN  MV+  DG + L + E+
Sbjct  351  RLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYALQDFEQ  401



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 195/291 (67%), Gaps = 13/291 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATD+G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G  A+      
Sbjct  117  WMGYVAVATDDGVAALGRRDILVAWRGTMRGLEWVNDFDFTPVSAAPVLGPAAAANPFAL  176

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S NPDS +N  SARDQVL EV RLV LYK+E  SITVCGHSLGASLATLN
Sbjct  177  VHRGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLVALYKDEVTSITVCGHSLGASLATLN  236

Query  647  AIDIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A+D+A NG N    G S    PVT  V+ASPR GD NFK    + P+L  L ++N  DIV
Sbjct  237  AVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFPDLRALHVKNAGDIV  296

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  PP    +GY DV V+L I   +S Y++    I   HNLE YLHG+AG +G+    GF
Sbjct  297  PTYPP----LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGVAGEQGSA--GGF  350

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             L V+RD++LVNK +D LK++Y +P  WWV KN  MV+  DG + L + E+
Sbjct  351  RLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYALQDFEQ  401



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 193/281 (69%), Gaps = 8/281 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRD++V WRGT+R LEW  DLEF +VP   + G G    VHRG
Sbjct  118  WIGYVAVATDEGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDG-DAMVHRG  176

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S +P S+ N  SAR Q LGEV+RLV+ Y+ EE+SITV GHSLGA+LATLNA DI
Sbjct  177  WLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDI  236

Query  635  ATNGANTTSDG-KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A NG N T+ G  + PVT F +ASPR G   FK  +DA P L LLR+RN  D+VP+    
Sbjct  237  AANGYNVTATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY---  293

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             P++ Y DVG EL ID  +S Y++       WHNLE YLHG+AGT GA    GF L V R
Sbjct  294  -PVVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGA--RGGFELAVAR  350

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLM  156
            D++LVNK+ D L++ + +P  WWV  N GMV+  DG W L+
Sbjct  351  DVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSLV  391



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 205/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  L PA EI   G++  P+VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVMVAWRGTIRVLEWMDDLDISLAPASEIVRPGSADDPRVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGA+LAT++A 
Sbjct  177  GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     K+ PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP  P 
Sbjct  237  DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L V+
Sbjct  292  ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK+EYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKKEYSIPSSWWVVQNKGMVKGKDGRWHLADHED  391



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 206/286 (72%), Gaps = 12/286 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EWV DL+  LVPA EI   G+ A+P VH
Sbjct  117  WMGFVAVATDEGKELLGRRDVVVAWRGTIRMVEWVDDLDISLVPASEIVLPGSAANPCVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EVKR+ +LYK EE SIT+ GHSLGA+LAT+NA 
Sbjct  177  GGWLSVYTSADPGSQYNKESARHQVLNEVKRIQDLYKPEETSITITGHSLGAALATINAT  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N +      PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP+ P 
Sbjct  237  DIVSNGYNRS----CCPVSAFVFGSPRVGNLDFQKAFDSAADLRLLRVRNSPDVVPKWPK  292

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+DVG EL ID  +S Y+K   +   WH++E Y+HG+AG +G+    GF L+V+
Sbjct  293  ----LGYSDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSS--GGFELLVD  346

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RD++LVNK +D L+ E+++P +WWV +N GMV+  DG W L ++EE
Sbjct  347  RDVALVNKHEDALRNEFAVPPSWWVVQNKGMVKGKDGRWHLADHEE  392



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 195/292 (67%), Gaps = 8/292 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVATD G   LGRRDI+V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  140  WMGYVAVATDAGVARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  199

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S N  S FN +SAR+QVL E++RL++ YK E  SIT+ GHSLGA+L+TL A
Sbjct  200  HRGFLSVYASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTA  259

Query  644  IDIATNGANTTS-DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            IDI  NG N    +  + PV   V+ SPR GD  FK  +D+TP   LLR+RN PD+VP V
Sbjct  260  IDIVANGLNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTV  319

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                P   Y DVGVEL +D  KS ++K P      WHNLE YLHG+AGT+GAG   GFSL
Sbjct  320  ---LPNAFYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSL  376

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYI  135
             V+RD++LVNK  D L ++Y +P  WWVE N GM +   G W L ++EEG +
Sbjct  377  EVDRDVALVNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHEEGNL  428



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 206/305 (68%), Gaps = 28/305 (9%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  834
            W+GYVAVATD+GK ALGRRDI++ WRGTI+ LEW SD  F L PA +I G          
Sbjct  114  WIGYVAVATDKGKAALGRRDILIAWRGTIQVLEWASDFNFPLTPATKILGGTDPDADADT  173

Query  833  -------------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSI  693
                         P+VH GF ++Y+S++P S FN  SAR+QVL EV+RLV+ YK+EE+SI
Sbjct  174  AADAAADDVDDIIPKVHSGFLSVYTSDDPRSEFNKSSAREQVLTEVQRLVDQYKDEEISI  233

Query  692  TVCGHSLGASLATLNAIDIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDAT  522
            TV GHSLGA+LA+LNA+DIA NG N +   +S    PVT FVYASPR G+  F N+ ++ 
Sbjct  234  TVAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSI  293

Query  521  PNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYL  342
            P+L LLR  N+ D+VP+VP A    GY+D G EL I+   S Y+K   +I  WH++E YL
Sbjct  294  PSLRLLRTANLLDVVPKVPGA----GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYL  349

Query  341  HGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWK  162
            HG+AGT+G     GF L V RD++LVNK Q  +++EY +P  WWV KN GMVQ +DGSW+
Sbjct  350  HGLAGTQGTK--GGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDGSWQ  407

Query  161  LMNNE  147
            L ++E
Sbjct  408  LEDHE  412



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 192/281 (68%), Gaps = 8/281 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRD++V WRGT+R LEW  DLEF +VP   + G G    VHRG
Sbjct  118  WIGYVAVATDEGKAALGRRDVVVAWRGTMRALEWADDLEFPMVPTGGLLGDG-DAMVHRG  176

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S +P S+ N  SAR Q LGEV+RLV+ Y+ EE+SITV GHSLGA+LATLNA DI
Sbjct  177  WLSMYTSSDPASSHNQDSARHQALGEVRRLVDAYRGEELSITVTGHSLGAALATLNAFDI  236

Query  635  ATNGANTTSDG-KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A NG N  + G  + PVT F +ASPR G   FK  +DA P L LLR+RN  D+VP+    
Sbjct  237  AANGYNVAATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY---  293

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
             P++ Y DVG EL ID  +S Y++       WHNLE YLHG+AGT GA    GF L V R
Sbjct  294  -PVVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAGTRGA--RGGFELAVAR  350

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLM  156
            D++LVNK+ D L++ + +P  WWV  N GMV+  DG W L+
Sbjct  351  DVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGRWSLV  391



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 200/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA-GASPQVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV D EF LV A +IFG      Q+H+
Sbjct  129  WMGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ  188

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +ARDQVL EV RL+E YK+EEVSIT+CGHSLGA+LATL+A D
Sbjct  189  GWYSIYMSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATD  248

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +F+ ++    ++ +LR RN+PD++P  P
Sbjct  249  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP  308

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG E  ID  KS Y+K   ++  +H LEGYLHG+AGT+G    D F L V
Sbjct  309  P----IGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             R I LVNKS D LK+E  +PG W V KN GM QQDDGSW+L+++E
Sbjct  365  ERAIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQDDGSWELVDHE  410



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 205/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G+  +P VH
Sbjct  117  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVLPGSATNPCVH  176

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EVKR+ +LYK EE SI++ GHSLGA+LAT+NAI
Sbjct  177  GGWLSVYTSADPGSQYNKESARHQVLNEVKRIQDLYKTEETSISITGHSLGAALATINAI  236

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     +S PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP+ P 
Sbjct  237  DIVSNGYN-----RSCPVSAFVFGSPRVGNPDFQEAFDSAADLRLLRVRNSPDVVPKWPK  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+DVG EL ID  +S Y+K   +   WH++E Y+HG+AG +G+    GF L V+
Sbjct  292  ----LGYSDVGTELRIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSS--GGFELAVD  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK E+++P +WWV +N  MV+  DG W L ++E+
Sbjct  346  RDIALVNKHEDALKNEFAVPSSWWVVQNKDMVKGKDGRWHLADHED  391



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/287 (53%), Positives = 207/287 (72%), Gaps = 14/287 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR +EW+ DL+  LVPA EI   G++  P VH
Sbjct  120  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRMVEWMDDLDISLVPASEIVRPGSADDPCVH  179

Query  821  RGFYNLYSSENPDSAFNIKSAR-DQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
             G+ ++Y+S +P+S +N +SAR  QVL E+KRL ++Y++EE SIT+ GHSLGA+LAT++A
Sbjct  180  GGWLSVYTSADPESQYNKQSARYQQVLNEIKRLQDVYEHEETSITITGHSLGAALATISA  239

Query  644  IDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
             DI +NG N     KS PV+ FV+ SPR G+ +F+  +D+ P+L LLRIRN PD+VP  P
Sbjct  240  TDIVSNGYN-----KSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIRNSPDVVPNWP  294

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
                 +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L +
Sbjct  295  K----LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSN--GGFKLEI  348

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +RDISLVNK +D LK EY+IP +WWV +N GMV+  DG W L ++E+
Sbjct  349  DRDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHED  395



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 197/285 (69%), Gaps = 8/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GY+AVATDEGK ALGRRDI++ WRGT++ LEWV+D EF LVPA ++FGA    +VH+G
Sbjct  195  WIGYIAVATDEGKAALGRRDIVIAWRGTVQALEWVNDFEFPLVPADKLFGAANDSKVHKG  254

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++  S FNI SAR QVL E+++L+E +++E++SIT+ GHSLGA+L TLNA DI
Sbjct  255  WLSIYTSQDARSPFNINSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDI  314

Query  635  ATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N       K  PVT F++  P  GD NF+  +++   LHLLR RN  DIVP    
Sbjct  315  IANRINKGKKQPQKPCPVTAFLFGCPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY--  372

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL GY  VG EL ID  KS Y+K      +WH+LE YLHG+AGT+G     GF L V 
Sbjct  373  --PLTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNE--GGFMLEVK  428

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDI+ VNK+ + LKEEY +PG+WW  +N GMVQ  DG WKL ++E
Sbjct  429  RDIARVNKALNALKEEYLVPGSWWCAQNKGMVQDADGFWKLDDHE  473



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 197/285 (69%), Gaps = 8/285 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GY+AVATDEGK ALGRRDI++ WRGTI+ LEWV+D EF LVPA ++FGA    +VH+G
Sbjct  114  WIGYIAVATDEGKAALGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            + ++Y+S++  S FN  SAR QVL E+++L+E +++E++SIT+ GHSLGA+L TLNA DI
Sbjct  174  WLSIYTSQDARSPFNTNSARQQVLSEIEKLLEEFQDEDISITITGHSLGAALGTLNATDI  233

Query  635  ATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N       K  PVT F++ SP  GD NF+  +++   LHLLR RN  DIVP    
Sbjct  234  IANQINRGKKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDY--  291

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL GY  VG EL ID  KS Y+K      +WH+LE YLHG+AGT+G     GF+L V 
Sbjct  292  --PLTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNE--GGFTLEVK  347

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDI+ VNK+ + LKEEY +P +WW  +N GMVQ  DG WKL ++E
Sbjct  348  RDIARVNKALNALKEEYLVPESWWCAQNKGMVQDADGFWKLDDHE  392



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/296 (54%), Positives = 208/296 (70%), Gaps = 12/296 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEGK  LGRRDI++CWRGT+R LE ++D++  LV A +I G    P+VH G
Sbjct  114  WIGYVAVTTDEGKAVLGRRDILICWRGTMRNLEVINDIKADLVSAADILGDNGDPKVHHG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            ++++Y++++  S +N  SAR+QVL EV+RLV+LY++EE+SIT+ GHSLG ++ATLNA+DI
Sbjct  174  WHSIYTAKDSKSVYNQASAREQVLSEVRRLVDLYQDEEISITLTGHSLGGAVATLNAVDI  233

Query  635  ATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N  TT   K + VT FV+ASPR GD  FK V+    NLH+LRI+N  D+VP +P 
Sbjct  234  IANGYNKSTTKPDKEYLVTAFVFASPRVGDSGFKKVFSGLKNLHVLRIKNELDMVPSLPI  293

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWN----WHNLEGYLHGIAGTEGAGVLDGFS  294
              PL+ YT VG +L ID  KS Y+K   DI       H LE YLHG+AG++GA     F 
Sbjct  294  PLPLLHYTHVGEKLLIDSHKSPYMKSHLDISENLVIAHQLEPYLHGVAGSQGAK--GEFK  351

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRP  126
            L VNRDI+L+NKS D LK+EY +P  WW+EKN GM QQDDGSW L ++E    P P
Sbjct  352  LEVNRDIALLNKSLDALKDEYKVPVEWWIEKNKGMAQQDDGSWILDDHE----PEP  403



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 209/343 (61%), Gaps = 63/343 (18%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEGK  LGRRDI++ WRG+++ LEW+ D EF LV A EI  A    +VH+G
Sbjct  114  WMGYVAVATDEGKAVLGRRDILIAWRGSVQALEWIDDFEFNLVSASEILRAKTDAKVHQG  173

Query  815  FYNLYSSENPDSAFNIKSARD-------QVLGEVKRLVELYKNEEVSITVCGHSLGASLA  657
            + ++Y+S++P S +N  SAR        QVL EVKRLVE +K+EE++IT+ GHSLGA+L 
Sbjct  174  WLSIYTSDDPRSPYNTTSARQQSITVKFQVLEEVKRLVEEFKDEEINITITGHSLGAALG  233

Query  656  TLNAIDIATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVY---DATPNLHLLRIRN  492
             LNA+DI  NG N  +D   K+  VT F++  P  GD NF+NV+   ++T +L LLRIRN
Sbjct  234  ILNAVDIVANGLNKPTDHPDKACLVTAFLFGCPLVGDANFRNVFSILNSTQHLRLLRIRN  293

Query  491  VPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAG  312
              D+VP  P   P+IGYT VG EL I+   S ++K S +  +WHNLE YLHGIAGT+G+ 
Sbjct  294  AIDVVPNYP---PMIGYTQVGEELVINTDTSPFLKESAEPMSWHNLEIYLHGIAGTQGSS  350

Query  311  VLDG------------------------------------------------FSLVVNRD  276
            VL                                                  F LVV RD
Sbjct  351  VLPATTNKTRTRSRSGSSSSSKHPVIHHLMGLACPCFVAAASSAQGTSEGGEFKLVVKRD  410

Query  275  ISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            I+LVNK  D LK+E+ +P  WW EKN GMVQ+DDGSWKLM++E
Sbjct  411  ITLVNKVMDALKDEFHVPAKWWCEKNKGMVQEDDGSWKLMDHE  453



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 203/294 (69%), Gaps = 13/294 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK +LGRRDI+V WRGTI+  EW+ D  F L  AP IFG  +  Q+H G
Sbjct  114  WIGYVAVATDEGKVSLGRRDIVVAWRGTIQGSEWIKDFHFHLDSAPLIFGLQSPVQIHNG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+S+NP       SAR+QVL E+ RLVE YKNEE+SIT+ GHSLGA+LA +N++DI
Sbjct  174  FYSLYTSDNPGFQSANSSARNQVLSEISRLVEQYKNEEISITITGHSLGAALAVINSVDI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N + +   KS PVT F +ASPR G+ +F N++    +L+ L IRN  DIV    P
Sbjct  234  VANKFNISKEQPQKSCPVTTFAFASPRVGNSSFGNIFSNYKDLNALLIRNQTDIV----P  289

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
             +  +GY++VG EL ID  KS Y+K      + HNLE YLHG+AGT+G+    GF+L VN
Sbjct  290  ISLFLGYSEVGEELLIDTKKSKYLKSGV---SSHNLEVYLHGVAGTQGSK--GGFNLEVN  344

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG--YIPRP  126
            RDI+LVNKS D LK+EY +P  W V +N GMVQQ DG+WKLM++ E    I RP
Sbjct  345  RDIALVNKSNDGLKDEYRVPNAWRVVENKGMVQQFDGTWKLMDDNEDVVLIVRP  398



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 202/286 (71%), Gaps = 12/286 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA---SPQV  825
            WMGYVAVATD G  ALGRRD++V WRGT+R +EW++DL+F LV A  + GAG    +P+V
Sbjct  112  WMGYVAVATDAGVAALGRRDVVVAWRGTVRPMEWLNDLDFTLVSAAGVLGAGGRSPAPRV  171

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRG+ ++Y++ +P S ++  SAR+Q+  E+KRL++ YK+EE SITV GHSLGA++ATLNA
Sbjct  172  HRGWLSIYTASDPASKYSKLSAREQISDEIKRLMDKYKDEETSITVVGHSLGAAVATLNA  231

Query  644  IDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
             DI +NG N      + PVT   +A PR GD  F+ ++D  P L LLR+ N PD+VP+ P
Sbjct  232  ADIVSNGLNQHG---ACPVTAVAFACPRVGDSGFRKLFDELPGLRLLRVCNSPDVVPKYP  288

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY DVGVEL +D  +S Y+K   +   WH+LE Y+HG+AG +G     GF L V
Sbjct  289  P----MGYADVGVELPVDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGK--RGGFKLEV  342

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            +RD++LVNK+ D LKEEY +P +W V+++ GMV+  DG WKLM+ E
Sbjct  343  DRDVALVNKNVDALKEEYHVPPSWSVQRDKGMVRGADGHWKLMDYE  388



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 197/286 (69%), Gaps = 11/286 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG   LGRRDI+V WRGT++ +EWV+DL+F+ VPA  + G+ AS      
Sbjct  76   WMGYVAVATDEGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAV  135

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF ++Y+S N  S F   SARDQV+ EVKRLVELYK+EEVSITVCGHSLGAS+ATLN
Sbjct  136  VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLN  195

Query  647  AIDIATNGANTTSDG-KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+D+ ++G N      KSFPVT  V+ASP  G   F++ + + P+L  L ++NV D+VP 
Sbjct  196  AVDMVSSGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPL  255

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DV V+LTI   +S Y++    +   HNLE YLHG+AG +G+    GF L
Sbjct  256  YPP----LGYVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSA--GGFKL  309

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
             V+RDI+LVNK  D L +E+ +P +WWV K+  MV+  DG W L +
Sbjct  310  EVDRDIALVNKGADALADEHPVPASWWVPKHKFMVKGGDGRWTLQD  355



>ref|XP_004961147.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=406

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 195/290 (67%), Gaps = 12/290 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATD G  ALGRRDI+V WRGT+R LEWV+D +F  V A  + G+ A+      
Sbjct  122  WMGYVAVATDAGVAALGRRDILVAWRGTMRNLEWVNDFDFTPVSAAPVLGSAAAANPAAL  181

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y S NPDS +N  SARDQV  EV+RL+ LYK+E  SITV GHSLGASLATLN
Sbjct  182  VHRGFLSVYRSSNPDSKYNQSSARDQVFEEVRRLMALYKDEVTSITVTGHSLGASLATLN  241

Query  647  AIDIATNGANTTSDGKS--FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            A+D+A NG N  +D      PVT FVYASPR GD NFKN + + P+L  L ++N  D+VP
Sbjct  242  AVDLAANGLNAPADSSQPPCPVTAFVYASPRVGDANFKNAFASFPDLRALHVKNAGDVVP  301

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
              PP    +GY DV V L ID  +S Y++    I   HNLE YLHG+AG +G+    GF 
Sbjct  302  LYPP----LGYVDVAVPLPIDTGRSPYLRQPGTIPTRHNLECYLHGVAGEQGSA--GGFK  355

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L V+RD++L NK +  LK++Y +P +WWV KN  MV+  DG W L + ++
Sbjct  356  LEVDRDVALANKEEGALKDQYPVPADWWVAKNKFMVKGADGHWALQDFQQ  405



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 193/289 (67%), Gaps = 7/289 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVA D      GRRDI+V WRGT R +EW +DL+  LVPA  + G G     P V
Sbjct  131  WMGYVAVAADGVAANAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSV  190

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGA+L+TLNA
Sbjct  191  HRGFLSVYTSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNA  250

Query  644  IDIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            IDI  NG N     +   PVT    ASPR GD  FK  +D+TPNL LLR+RN PDIVP +
Sbjct  251  IDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTPNLSLLRVRNAPDIVPTI  310

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
             P+     + DVG EL +D  +S Y+K       WHNLE YLH +AGT+GAG   GFSLV
Sbjct  311  LPSA---FFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            V+RD++LVNK  D L++EY +P  WWVEKN GMVQ   G W L ++EEG
Sbjct  368  VDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVLQDHEEG  416



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 199/286 (70%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRD++V WRGTI  +EWV+DLEF LVPA E+FG      VH+G
Sbjct  117  WIGYVAVATDEGKVALGRRDVVVAWRGTIMPMEWVNDLEFPLVPASELFGESGVANVHQG  176

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F +LY+S N   + +  SARDQVL EV++ V+L+++EE+SITV GHSLG SL+TLNA+DI
Sbjct  177  FLSLYTSTNESVSVSRTSARDQVLSEVRKQVDLHQDEEISITVVGHSLGGSLSTLNAMDI  236

Query  635  ATNGANT-TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
              NG N  +S  K  PV  F +A PR+GD NF++V  +  +LH+LRI N  DIVP++PP 
Sbjct  237  TYNGVNKPSSREKGCPVAAFAFACPRSGDINFRSVMRSLHDLHILRISNATDIVPRIPP-  295

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLE-GYLHGIAGTEGAGVLDGFSLVVN  282
                 Y DVGVELT+D +KS ++K  +D  N HNLE  YLH +A   G          + 
Sbjct  296  ---FLYVDVGVELTVDSTKSKFLKVFSDFSNHHNLEVAYLHPLAIANG-------DEDIR  345

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+L NK+ D L+ +Y I  NWW ++N GMVQQ+DGSWKL ++E 
Sbjct  346  RDIALANKNSDALRSKYLIKTNWWCQQNHGMVQQEDGSWKLEDHEH  391



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   301 bits (772),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 197/290 (68%), Gaps = 10/290 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMG+VAVATD GK  LGRRD+++ WRGTI  LEWV D +   V A  I G G   +VHRG
Sbjct  115  WMGFVAVATDNGKKQLGRRDVVIAWRGTIEALEWVEDFDIGQVSAAPISGGGDDAKVHRG  174

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            ++++Y+S++  S +N  SAR+QV+ EV+RLVE YK+EE+SIT+ GHSLGA+L TLNAIDI
Sbjct  175  WFSIYTSDDSKSPYNNTSAREQVMSEVRRLVEAYKDEEMSITITGHSLGAALTTLNAIDI  234

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N      G   PVTG V+ASPR G+  FK  ++ +  L LLR+ N  DIVP    
Sbjct  235  VANGTNIPKGRPGTQIPVTGIVFASPRVGNTEFKKRFEGSQGLKLLRVTNALDIVPNY--  292

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PLI Y DVGV L ID  KS ++K        HNLE YLHG+AGT+G     GF L + 
Sbjct  293  --PLISYDDVGVNLGIDTRKSDFLKSPVGPSGVHNLEIYLHGVAGTQGKK--GGFKLEIP  348

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN--NEEGY  138
            RDI+LVNKS D LK +Y++P +W VEKN GMVQ  DGSWKLM+  NE+G+
Sbjct  349  RDIALVNKSLDVLKVDYTVPASWKVEKNKGMVQLPDGSWKLMDHENEDGF  398



>ref|XP_011027708.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
 ref|XP_011015585.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=396

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 202/286 (71%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W  YVAVAT+EGK  LGRRDI+V WRGT+ ++EW+ D +  L+ APEIF    + ++H+G
Sbjct  113  WSAYVAVATNEGKALLGRRDIVVSWRGTLLSVEWLKDFDAELISAPEIFRNDVA-KMHKG  171

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++LY++++  S ++  SARDQVL  V +LVE YK+EE+SITV GHSLGA++ATLNA+DI
Sbjct  172  FHSLYTAKDDKSTYSKTSARDQVLAAVSKLVEQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  635  ATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP-  465
               G N T+    K+FPVT  V+ASPR GD NFK + +   +LH+LR+ N  DIVP +P 
Sbjct  232  VVKGCNKTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGQEDLHVLRVTNERDIVPNLPL  291

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P   +  VG EL ID  KS YVK   D+ ++HNLE Y+HG+AGT+G+    GF+L V
Sbjct  292  DMPPYFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  284  NRDISLVNKSQDHLKEEYSIPGNWW-VEKNMGMVQQDDGSWKLMNN  150
            +RDI+LVNK  D LK+EY IP  WW +E N GMV  DDG WKL+++
Sbjct  350  DRDIALVNKDLDGLKDEYKIPAGWWGIEDNKGMVLGDDGRWKLLSS  395



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 197/286 (69%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA-GASPQVHR  819
            W GYVAV  D+G   LGRRDI+V WRG+++ LEWV D EF LV A +IFG      Q+H+
Sbjct  129  WXGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ  188

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +ARDQVL EV RL+E YK+EEVSIT+CGHSLGA+LATL+A D
Sbjct  189  GWYSIYXSQDERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATD  248

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KS PVT FV+ASPR GD +F+ ++    ++ +LR RN+PD++P  P
Sbjct  249  IVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPIYP  308

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    IGY++VG E  ID  KS Y K   ++  +H LEGYLHG+AGT+G    D F L V
Sbjct  309  P----IGYSEVGDEFPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDV  364

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             R I LVNKS D LK+E  +PG W V KN G  QQDDGSW+L+++E
Sbjct  365  ERAIGLVNKSVDGLKDECXVPGKWRVLKNKGXAQQDDGSWELVDHE  410



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 200/286 (70%), Gaps = 9/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            W+GYVAVAT++G   LGRRDI+V WRGTI T EW+ D +F LV   +IF   + P +VHR
Sbjct  151  WIGYVAVATNDGTAVLGRRDIVVAWRGTIETTEWIDDFDFGLVDGSKIFAGKSKPIKVHR  210

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+ ++Y+S +  S FN   ARDQ+L E+ RLVELYK+E++SITVCGHSLGA+LATL+A D
Sbjct  211  GWLSIYTSYDTRSKFNKICARDQLLQEISRLVELYKDEDISITVCGHSLGAALATLSATD  270

Query  638  IATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N       K+ PVT F +A PR G  +FKN++    NL  LR +N+PD+V    
Sbjct  271  IVFNGYNKPKGRPDKACPVTAFPFACPRVGASDFKNLFSGLDNLRALRTKNLPDVV----  326

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
             A P++GY+DVG EL ID  KS Y+K   ++  +H++E Y+HG+AGT G      F L +
Sbjct  327  CAYPMVGYSDVGDELAIDTRKSPYLKSPGNVTTFHSMEHYMHGVAGTHGTK--GEFRLEI  384

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            NRDISLVNK+ D LK+E+ +P +W V KN GMVQQ DGSWKLM++E
Sbjct  385  NRDISLVNKNTDSLKDEHMVPDHWRVLKNKGMVQQGDGSWKLMDHE  430



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 205/286 (72%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G+   P+VH
Sbjct  520  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRVLEWMDDLDISLVPASEIVRPGSAHDPRVH  579

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL EV+RL +LYK EE SIT+ GHSLGA+LAT++A 
Sbjct  580  GGWLSVYTSTDPGSRYNKQSARYQVLDEVERLQDLYKQEETSITITGHSLGAALATISAT  639

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     K+ PV+ FV+ SPR G+ +F+  +D+  +L LLR+RN PD+VP  P 
Sbjct  640  DIVSNGYN-----KTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVRNSPDVVPNWPK  694

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY+D G EL ID  +S Y+K   +   WH++E Y+HG+AGT+G+    GF L V+
Sbjct  695  ----LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSN--GGFELEVD  748

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK+EYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  749  RDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHED  794



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 195/298 (65%), Gaps = 14/298 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVATD G   LGRRDI+V WRGT R +EW  DL+  LVPA  + G G   + P V
Sbjct  144  WMGYVAVATDAGAARLGRRDIVVAWRGTKRAVEWADDLDITLVPATGVVGPGPGWSQPAV  203

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S N  S FN +SAR+QVL EV+RL++ YK E  SIT+ GHSLGA+LATL A
Sbjct  204  HRGFLSVYASRNSTSRFNKQSAREQVLSEVRRLLDAYKGENCSITLTGHSLGAALATLTA  263

Query  644  IDIATNGANT---TSDGKSFPVTGFVYASPRTGDYNFKNVYDA--TPN--LHLLRIRNVP  486
            IDI  NG N    ++   + PV   V+ SPR GD  FK  +++  TP     LLR+RN P
Sbjct  264  IDIVANGLNVRGGSNSNDTVPVAAIVFGSPRVGDDQFKKAFESPSTPGGGARLLRVRNAP  323

Query  485  DIVPQVPPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGV  309
            DIVP + PA     Y DVGVEL +D  KS ++K P      WHNLE YLHG+AGT+GAG 
Sbjct  324  DIVPTILPAA---FYRDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGD  380

Query  308  LDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYI  135
              GF L V+RD++LVNK  D L +EY +P  WWVE N GM +   G W L ++EEG +
Sbjct  381  GAGFRLEVDRDVALVNKEVDALSDEYPVPAAWWVEGNKGMTRDKSGRWVLQDHEEGNL  438



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 200/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV  D+G   LGRRDI+V WRG+++ LEWV+D EF LV A +IFG      Q+H+
Sbjct  145  WMGYVAVTDDQGTALLGRRDIVVAWRGSVQPLEWVNDFEFGLVNAKKIFGEKNDQVQIHQ  204

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y S++  S F   +ARDQVL EV RL++ YK+EEVSIT+CGHSLGA+LATLNA D
Sbjct  205  GWYSIYMSQDERSPFTKANARDQVLREVGRLLDKYKDEEVSITICGHSLGAALATLNAAD  264

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N   +   KSFPVT FV+ASPR GD +FK ++    +L +LR RN+P     + 
Sbjct  265  IVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLEDLRVLRTRNLP----DII  320

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P  P IGY++VG EL ID  KS Y+K   ++  +H LE YLHG+AGT+G    D F L V
Sbjct  321  PIYPPIGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVAGTQGTAKADEFRLDV  380

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI LVNKS D LK+E  +PG W V KN GMVQQDDGSW L+++E
Sbjct  381  KRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDGSWNLLDHE  426



>dbj|BAJ95995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   300 bits (769),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/286 (53%), Positives = 197/286 (69%), Gaps = 11/286 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG   LGRRDI+V WRGT++ +EWV+DL+F+ VPA  + G+ AS      
Sbjct  151  WMGYVAVATDEGAAKLGRRDIVVAWRGTVQNMEWVNDLDFVPVPAAPVLGSAASQNRLAV  210

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF ++Y+S N  S F   SARDQV+ EVKRLVELYK+EEVSITVCGHSLGAS+ATLN
Sbjct  211  VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVKRLVELYKDEEVSITVCGHSLGASIATLN  270

Query  647  AIDIATNGANTTSDG-KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+D+ ++G N      KSFPVT  V+ASP  G   F++ + + P+L  L ++NV D+VP 
Sbjct  271  AVDMVSSGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDLKALHVQNVGDVVPL  330

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DV V+LTI   +S Y++    +   HNLE YLHG+AG +G+    GF L
Sbjct  331  YPP----LGYVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAGEQGSA--GGFKL  384

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
             V+RDI+LVNK  D L +E+ +P +WWV K+  MV+  DG W L +
Sbjct  385  EVDRDIALVNKGADALADEHPVPASWWVPKHKFMVKGGDGRWTLQD  430



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 192/289 (66%), Gaps = 7/289 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVA D      GRRDI+V WRGT R +EW +DL+  LVPA  + G G     P V
Sbjct  131  WMGYVAVAADGVAAKAGRRDIVVAWRGTKRAVEWANDLDITLVPADGVVGPGPGWTQPSV  190

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGA+L+TLNA
Sbjct  191  HRGFLSVYTSKSFSSPFNKLSAREQVLAEITRLLRAYKNENCSITITGHSLGAALSTLNA  250

Query  644  IDIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            IDI  NG N     +   PVT    ASPR GD  FK  +D+T NL LLR+RN PDIVP +
Sbjct  251  IDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTSNLSLLRVRNAPDIVPTI  310

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
             P+     + DVG EL +D  +S Y+K       WHNLE YLH +AGT+GAG   GFSLV
Sbjct  311  LPSA---FFKDVGAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLV  367

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            V+RD++LVNK  D L++EY +P  WWVEKN GMVQ   G W L ++EEG
Sbjct  368  VDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVLQDHEEG  416



>ref|XP_011047741.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 206/296 (70%), Gaps = 15/296 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  106  WVGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  165

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGA+LATLN +
Sbjct  166  FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGV  225

Query  641  DIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDA-TPNLHLLRIRNVPDIVPQV  468
            D+  NG N  S     FPVT F YASPR GD  F++V++  T +LH+LRI+N  DI+P++
Sbjct  226  DMVANGFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  285

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            PP   L+GY DVG +L ID  KS Y+K P       HNLE YLH IAG +G    + F L
Sbjct  286  PPVF-LLGYQDVGEKLEIDSIKSPYLKDPKAQP---HNLELYLHTIAGYQGQE--EEFKL  339

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            VV+RDI+L+NKS D + ++Y+IP  WW  KN GM+Q D+G WKL +    Y+P PP
Sbjct  340  VVDRDIALLNKSLDLVLDKYNIPPTWWNVKNNGMIQIDNGFWKLND----YVPDPP  391



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/293 (54%), Positives = 193/293 (66%), Gaps = 17/293 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ-VHR  819
            W+GYVAVAT+ GK ALGRRDI+V WRGT+ +LEWV DLEF +V    I   G     VHR
Sbjct  141  WIGYVAVATEAGKAALGRRDIVVAWRGTVESLEWVDDLEFAMVAPRGIVKDGCEDALVHR  200

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+ ++Y+S +P S+ N  SARDQVLGEV+RLVE+YK EEVSITV GHSLGA+LATLNA D
Sbjct  201  GWLSMYTSTHPASSHNKDSARDQVLGEVRRLVEMYKEEEVSITVTGHSLGAALATLNAFD  260

Query  638  IATNGANTT--------SDGKSFPVTGFVYASPRTGDYNFKNVYDATP---NLHLLRIRN  492
            IA NG NT             +FPV  F +ASPR G   FK  + A      L +LRIRN
Sbjct  261  IAENGYNTAIRAGAAPGPRATTFPVAVFAFASPRIGGAGFKKRFAAAAIASPLRVLRIRN  320

Query  491  VPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAG  312
              DIVP+ P     + Y DVG ELTID   S Y+K   +   WHNLE YLHG+AG   +G
Sbjct  321  ARDIVPKYPA----LLYHDVGCELTIDTGASPYLKAPGNERVWHNLESYLHGVAGVPASG  376

Query  311  V-LDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLM  156
                GF LVV RD++LVNK+ D L+EE+ +P  WWV +N GM + DDG W+L+
Sbjct  377  APSSGFELVVARDVALVNKAYDALREEHGVPAGWWVPQNKGMAKGDDGRWRLL  429



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 188/284 (66%), Gaps = 9/284 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG---AGASPQV  825
            W+GYVAVATDEGK ALGRRD++V WRGT++ LEW  DLEF +V    + G   A     V
Sbjct  123  WIGYVAVATDEGKAALGRRDVVVVWRGTMQKLEWADDLEFPMVSTKGLLGDGQAACDAMV  182

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRG+ ++Y+S +P S+ N  SAR Q L EV+RLV+ Y +EE SITV GHSLGA+LATLNA
Sbjct  183  HRGWLSMYTSIDPASSHNQDSARHQALSEVRRLVDAYSDEERSITVVGHSLGAALATLNA  242

Query  644  IDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
             DIA NG N  +   + PVT F +ASPR G   FK  +DA P L LLR+RN  D+VP+  
Sbjct  243  FDIAANGYNVATGAAACPVTAFAFASPRVGGGGFKKRFDAVPGLRLLRVRNARDVVPKY-  301

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P++ Y DVG EL ID  +S Y++       WHNLE YLHG+AGT GA    GF L V
Sbjct  302  ---PIVFYHDVGAELAIDTGESPYLRSPGREHTWHNLEVYLHGVAGTRGA--RGGFELAV  356

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
             RD++LVNK  D L ++Y +P  WWV  N GMV+  DG W LM+
Sbjct  357  ARDVALVNKLYDVLWDDYGVPPGWWVPLNKGMVEGADGRWSLMD  400



>ref|XP_011047800.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=448

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/296 (54%), Positives = 206/296 (70%), Gaps = 15/296 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  143  WIGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  202

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGA+LATLN +
Sbjct  203  FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGM  262

Query  641  DIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDA-TPNLHLLRIRNVPDIVPQV  468
            D+  NG N  S     FPVT F YASPR GD  F++V++  T +LH+LRI+N  DI+P++
Sbjct  263  DMVANGFNKPSGSDIGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  322

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            PP   L+GY DVG +L ID  KS Y+K P       HNLE YLH IAG +G    + F L
Sbjct  323  PPVF-LLGYQDVGEKLEIDSIKSPYLKDPKAQP---HNLELYLHTIAGYQGQE--EEFKL  376

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            VV+RDI+L+NKS D + ++Y+IP  WW  KN GM+Q D+G WKL +    Y+P PP
Sbjct  377  VVDRDIALLNKSLDLVLDKYNIPPTWWNVKNNGMIQIDNGFWKLND----YVPDPP  428



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   311 bits (797),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 194/290 (67%), Gaps = 8/290 (3%)
 Frame = -2

Query  995   WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
             WMGYVAVATD G   LGRRDI+V WRGT R +EW +DL+  LVPA  + G G   + P V
Sbjct  777   WMGYVAVATDAGVARLGRRDIVVAWRGTKRAVEWANDLDITLVPAAGVVGPGPGWSQPAV  836

Query  824   HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
             HRGF ++Y+S N  S FN +SAR+QVL E++RL++ YK E  SIT+ GHSLGA+L+TL A
Sbjct  837   HRGFLSVYASRNSTSRFNKQSAREQVLAEIRRLLDAYKGENCSITLTGHSLGAALSTLTA  896

Query  644   IDIATNGANTTS-DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
             IDI  NG N    +  + PV   V+ SPR GD  FK  +D+TP   LLR+RN PD+VP V
Sbjct  897   IDIVANGLNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGARLLRVRNAPDVVPTV  956

Query  467   PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
              P      Y DVGVEL +D  KS ++K P      WHNLE YLHG+AGT+GAG   GFSL
Sbjct  957   LPNA---FYKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGVAGTQGAGDAAGFSL  1013

Query  290   VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
              V+RD++LVNK  D L ++Y +P  WWVE N GM +   G W L ++EEG
Sbjct  1014  EVDRDVALVNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVLQDHEEG  1063



>gb|ABK96341.1| unknown [Populus trichocarpa x Populus deltoides]
Length=396

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 201/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W  YVAVAT+EGK  LGRRDI+V WRGT  ++EW+ D +  L+  PEIFG   + ++H+G
Sbjct  113  WSAYVAVATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPEIFGNDVA-KMHKG  171

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++LY++++  S ++  SARDQ L  V +LV+ YK+EE+SITV GHSLGA++ATLNA+DI
Sbjct  172  FHSLYTAKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  635  ATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP-  465
               G N T+    K+FPVT  V+ASPR GD NFK + +   +LH+LR+ N  DIVP +P 
Sbjct  232  VVKGYNKTTGEQNKAFPVTAIVFASPRVGDTNFKKLCEGLEDLHVLRVTNEKDIVPNLPF  291

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P   +  VG EL ID  KS YVK   D+ ++HNLE Y+HG+AGT+G+    GF+L V
Sbjct  292  DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  284  NRDISLVNKSQDHLKEEYSIPGNWW-VEKNMGMVQQDDGSWKLMNN  150
            +RDI+LVNK  D LK+EY+IP  WW +E N GMV  DDG WKL+++
Sbjct  350  DRDIALVNKDLDGLKDEYNIPAGWWGIEDNKGMVLGDDGRWKLLSS  395



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 195/291 (67%), Gaps = 11/291 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  819
            W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +    AS   VHR
Sbjct  95   WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHR  154

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+ ++Y+S + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGA+LATLNA D
Sbjct  155  GWLSMYTSRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFD  214

Query  638  IATNGAN----TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATP--NLHLLRIRNVPDIV  477
            I  NG N      +     PVT FV+ASPR G + FK  +D      L LLR+RN  D+V
Sbjct  215  IVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVV  274

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P+ PPA P   Y  VG EL ID  +S Y++   +   WHNLE YLHG+AG  G G    F
Sbjct  275  PRYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRF  330

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             L V RD++L NKS   L++E+++P  WW+  N GMV+  DG W LM+ EE
Sbjct  331  KLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  381



>ref|XP_003608142.1| Lipase [Medicago truncatula]
Length=349

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 192/284 (68%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  64   WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  123

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG +LAT++++DI
Sbjct  124  FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  183

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N       K+ PVT F + SPR G+ NF+ ++    +L  L IRN  DIV    P
Sbjct  184  VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIV----P  239

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
            ++  + Y+ VG EL ID  KS Y+K        HN+E YLHGIAGT+G+    GF+L VN
Sbjct  240  SSLRLAYSKVGEELEIDTEKSKYLKSGVSA---HNMEVYLHGIAGTQGSK--GGFNLEVN  294

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNN  150
            RDI+L+NKS D LK+EY IP NW V +N GMVQQ DG+WKLM++
Sbjct  295  RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDD  338



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/295 (52%), Positives = 203/295 (69%), Gaps = 20/295 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG-------A  837
            ++GYVAVA D    +LGRRDI++ WRG+I++LEWV++L+FL V A ++ G G       A
Sbjct  136  FIGYVAVAEDTAVASLGRRDIVIAWRGSIQSLEWVNNLQFLQVSASDVVGDGDVADHDKA  195

Query  836  SPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLA  657
              +VH+G+Y++Y+S++P S FN  SARDQVL E++ L+E YKNEE+SIT+ GHS+GA+LA
Sbjct  196  KAKVHQGWYSIYTSDDPRSPFNKTSARDQVLLEIQSLMEQYKNEEISITITGHSMGAALA  255

Query  656  TLNAIDIATNGANTTSDGKSFP--VTGFVYASPRTGDYNFKNV---YDATPNLHLLRIRN  492
            TLNA+D+  N  N        P  VT  ++ASPR GD+NFKN+   YD +  L LLR+ N
Sbjct  256  TLNAVDLVANNINIPKSSPKNPCLVTAILFASPRVGDFNFKNIISKYDHS--LKLLRVCN  313

Query  491  VPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAG  312
              D+V   PP    IGY  VG EL+ID  +S Y+K   + W WHN E YLHGIAG  G G
Sbjct  314  ALDVVLHYPP----IGYCHVGKELSIDTIRSPYLKFPGNFWTWHNSEAYLHGIAG--GQG  367

Query  311  VLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
              + F LVV+RD+SL+NK  D+LK+EY IP  WW  +N GMVQQ DGSW LM++E
Sbjct  368  SEEEFKLVVDRDLSLLNKHWDNLKDEYLIPAFWWTLRNKGMVQQSDGSWLLMDHE  422



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 195/291 (67%), Gaps = 11/291 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  819
            W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +    AS   VHR
Sbjct  119  WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRDKASDAMVHR  178

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+ ++Y+S + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGA+LATLNA D
Sbjct  179  GWLSMYTSRDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFD  238

Query  638  IATNGAN----TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATP--NLHLLRIRNVPDIV  477
            I  NG N      +     PVT FV+ASPR G + FK  +D      L LLR+RN  D+V
Sbjct  239  IVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVV  298

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P+ PPA P   Y  VG EL ID  +S Y++   +   WHNLE YLHG+AG  G G    F
Sbjct  299  PRYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRF  354

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             L V RD++L NKS   L++E+++P  WW+  N GMV+  DG W LM+ EE
Sbjct  355  KLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  405



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/293 (53%), Positives = 193/293 (66%), Gaps = 13/293 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G     G+ P 
Sbjct  131  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGADGSDPS  190

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+S +  S  + KSAR QVL E+ RL++ YK+EE SITV GHSLGA+LATLN
Sbjct  191  VHRGYLSLYTSADEGSKLSKKSARMQVLTEIARLMDKYKDEETSITVVGHSLGATLATLN  250

Query  647  AIDIATNGANTTS---DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A DI  N  N +S   DG+  PVT  V+ SPRTGD  F++V+     L +LR+RN PD +
Sbjct  251  AADIVANACNKSSGFDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLRGLRMLRVRNKPDRI  310

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  PP    +GY DVGVEL ID  +S ++KP  +    H+LE +LHG+AG +G G   GF
Sbjct  311  PHYPP----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDG--GGF  364

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
             LVV RD++LVNK  D L +EY +P  W V  N  MV+  DG W L ++E  Y
Sbjct  365  ELVVERDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  417



>ref|XP_009333706.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=378

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 194/286 (68%), Gaps = 10/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEGK  LGRRDI+V WRGT    EW  DL F LV A +I G    P+VH G
Sbjct  98   WLGYVAVTTDEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHG  157

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
             ++ Y+S +P+S ++  S R QVL  +K +V+ YK+EE+SITVCGHS+G + A LNAIDI
Sbjct  158  IHSYYNSADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNAIDI  217

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N  +D   K+  VT  V+ASPR GD  F NV+ +  NLH+LR+ N  DIVP +P 
Sbjct  218  VCNGYNKPTDRPDKACLVTSIVFASPRLGDQGFHNVFSSLNNLHVLRVTNSYDIVPYLP-  276

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL  Y DVG EL ID  KS Y+K +    + H LE YLHG+AGT+G    +GF LV+N
Sbjct  277  --PLEKYVDVGKELKIDTLKSPYLKNAKK--DAHRLEIYLHGVAGTQGR---NGFQLVIN  329

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK  D LK+EY++  NWW EKN  MVQ DDGSW L+++E+
Sbjct  330  RDIALVNKKLDGLKDEYNVIVNWWTEKNKSMVQMDDGSWVLLDHEK  375



>ref|XP_006374296.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
 gb|ERP52093.1| hypothetical protein POPTR_0015s05770g [Populus trichocarpa]
Length=412

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 204/295 (69%), Gaps = 14/295 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG T LGRRDI+VCWRGTI   EW  +L+F LV A EI G   +P++H G
Sbjct  106  WIGYVAVTTDEGNTVLGRRDILVCWRGTILASEWAKNLQFDLVSAAEILGGAHNPKMHHG  165

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKN--EEVSITVCGHSLGASLATLNAI  642
            F+++Y +++  S +N  SAR+QVL EV+RLV+ Y +  E+VSITV GHSLGA+LATLNA+
Sbjct  166  FHSVYLAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAM  225

Query  641  DIATNGANTTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            DI +NG N  +   + F VT F YASPR GD  F++V++   NLH+LRI+N  DI+P +P
Sbjct  226  DIVSNGYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNENDIIPSLP  285

Query  464  PATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
            PA     Y D+G EL ID SKS Y+K P+ +    HNL+ YLH IAG +G   L  F LV
Sbjct  286  PAF-YNTYKDIGEELEIDSSKSPYLKDPNAEP---HNLDIYLHAIAGYQGK--LGEFRLV  339

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            ++RDI+LVNKS D L E+Y +P NW    N GM+Q D+G WKL +    Y+P PP
Sbjct  340  IDRDIALVNKSADVLPEKYKVPPNWRTVMNKGMIQMDNGFWKLND----YVPDPP  390



>ref|XP_002305084.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
 gb|EEE85595.2| hypothetical protein POPTR_0004s05380g [Populus trichocarpa]
Length=396

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 200/286 (70%), Gaps = 7/286 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W  YVAVAT+EGK  LGRRDI+V WRGT  ++EW+ D +  L+  P IFG   + ++H+G
Sbjct  113  WSAYVAVATNEGKALLGRRDIVVSWRGTSLSVEWLKDFDAELISVPGIFGNDVA-KMHKG  171

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++LY++++  S ++  SARDQ L  V +LV+ YK+EE+SITV GHSLGA++ATLNA+DI
Sbjct  172  FHSLYTAKDDKSTYSKTSARDQALAAVSKLVDQYKDEEISITVTGHSLGAAIATLNALDI  231

Query  635  ATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP-  465
               G N T+    K+FPVT  V+ASPR GD NFK + +   +LH+LR+ N  DIVP +P 
Sbjct  232  VVKGYNKTTGEQNKAFPVTAIVFASPRVGDANFKKLCEGLEDLHVLRVTNEKDIVPNLPL  291

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               P   +  VG EL ID  KS YVK   D+ ++HNLE Y+HG+AGT+G+    GF+L V
Sbjct  292  DIPPSFSFKHVGEELRIDTRKSPYVKSMDDLGDFHNLELYIHGVAGTQGSE--GGFNLEV  349

Query  284  NRDISLVNKSQDHLKEEYSIPGNWW-VEKNMGMVQQDDGSWKLMNN  150
            +RDI+LVNK  D LK+EY+IP  WW +E N GMV  DDG WKL+++
Sbjct  350  DRDIALVNKDLDGLKDEYNIPAGWWGIEDNKGMVLGDDGRWKLLSS  395



>ref|XP_002441554.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
 gb|EES19984.1| hypothetical protein SORBIDRAFT_09g029230 [Sorghum bicolor]
Length=361

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/289 (52%), Positives = 192/289 (66%), Gaps = 13/289 (4%)
 Frame = -2

Query  989  GYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----VH  822
            G   VATD+G  ALGRRDI+V WRGT+R+LEWV+D +F  V A  + G+ A+      VH
Sbjct  78   GNYTVATDDGVAALGRRDILVAWRGTMRSLEWVNDFDFTPVSAAPVLGSAAAANPAALVH  137

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RGF ++Y+S NPDS +N  SARDQVL EV RL+ LYK+E  SITV GHSLGASLATLNA+
Sbjct  138  RGFLSVYTSSNPDSKYNQTSARDQVLAEVSRLMALYKDEVTSITVTGHSLGASLATLNAV  197

Query  641  DIATNGANTTSDGK---SFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            D+A NG N    G    + PVT FV+ASPR GD NFK  + + P+L  L ++N  D+VP 
Sbjct  198  DLAANGVNAPPAGSAQPACPVTAFVFASPRVGDGNFKRAFASFPDLRALHVKNAGDVVPT  257

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DV V+L I   +S Y+K    I   HNLE YLHG+AG +G+    GF L
Sbjct  258  YPP----LGYVDVAVQLPIATGRSPYLKQPGTILTLHNLECYLHGVAGEQGSA--GGFKL  311

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V+RD++L NK +D LK +Y +P +WWV KN  MV+  DG W L + E+
Sbjct  312  EVDRDVALANKGEDALKNQYPVPVSWWVAKNNFMVKGTDGHWALQDFEQ  360



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/287 (52%), Positives = 187/287 (65%), Gaps = 30/287 (10%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVATD G  ALGRRDI+V WR T R  EW SDL+F LVPA  I G G   + P V
Sbjct  106  WMGYVAVATDRGAAALGRRDIVVAWRATKRATEWASDLDFALVPAAGIVGPGRGWSQPYV  165

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S+N  S FN +SAR+QVL EV+ L++ YKNE+ SI++ GHSLG +L+TLNA
Sbjct  166  HRGFLSVYTSKNSTSRFNRRSAREQVLTEVRALLDTYKNEDCSISITGHSLGGALSTLNA  225

Query  644  IDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            ID+  NG                        +NFK  + A   L LLR+RNVPDIVP + 
Sbjct  226  IDLVANG------------------------FNFKKAFHAMAGLSLLRVRNVPDIVPTIL  261

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P  P+I Y DVGVEL +D  KS Y+K       WHNLEGYLHG+AGT GAG   GF L V
Sbjct  262  P--PVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAGTHGAGDSAGFGLEV  318

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +RD++L+NK +D L++EY +P  WW E N GMV+   G W L ++E+
Sbjct  319  DRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVLHDHEQ  365



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   306 bits (784),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 204/286 (71%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMG+VAVATDEGK  LGRRD++V WRGTIR LEW+ DL+  LVPA EI   G++  P VH
Sbjct  714  WMGFVAVATDEGKEVLGRRDVVVAWRGTIRILEWMDDLDISLVPASEIVRPGSADDPCVH  773

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             G+ ++Y+S +P S +N +SAR QVL E+KRL ++YK EE SIT+ GHSLGA+LAT++A 
Sbjct  774  GGWLSVYTSTDPGSRYNKQSARYQVLDEIKRLQDVYKQEETSITITGHSLGAALATISAT  833

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI +NG N     +S PV+ FV+ SPR G+ +F+  +D+  +L LLR+ N PD+VP+ P 
Sbjct  834  DIVSNGYN-----QSCPVSAFVFGSPRVGNSDFQKAFDSADDLRLLRVENSPDVVPKWPK  888

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY++ G EL ID  +S Y+K   +   WH++E Y+HGIAGT+G+    GF L V+
Sbjct  889  ----LGYSEAGTELMIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSN--GGFELEVD  942

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK +D LK EYSIP +WWV +N GMV+  DG W L ++E+
Sbjct  943  RDIALVNKHEDALKNEYSIPSSWWVMQNKGMVKGKDGRWHLADHED  988



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 201/296 (68%), Gaps = 21/296 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  819
            W+G+VAVATDEGK ALGRRDI++ WRGTI   EW  D E  +V   EIF     +  VH+
Sbjct  125  WIGFVAVATDEGKVALGRRDILIVWRGTITVSEWNDDFESSMVQPIEIFRENTDNILVHK  184

Query  818  GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            GFY++Y+S N  S FN   SARDQVL EVKRL++ YK EEVSI+V GHSLG+SLATL AI
Sbjct  185  GFYSIYTSLNHASNFNRTTSARDQVLEEVKRLMDQYKKEEVSISVTGHSLGSSLATLCAI  244

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DIA +  N     K FPVT F++ASPR G+ NFK   +   NLH+LRI N  D++ ++P 
Sbjct  245  DIAVSQVN-----KGFPVTAFLFASPRVGEINFKKACENLKNLHILRITNASDLITKLPD  299

Query  461  ATPLIG-------YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
               + G       Y DVG EL+ID +KS Y+K      N H LE YLHGIAGT G    +
Sbjct  300  RGQVEGCETDWRVYEDVGFELSIDTTKSDYLKKEI---NGHILEVYLHGIAGTHG---FE  353

Query  302  G-FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
            G F L +NRDI+L+NK+ D LK+EY +P +WW+EKN GMVQ ++GSW LM++E+ +
Sbjct  354  GEFKLEMNRDIALMNKADDVLKDEYGVPASWWIEKNKGMVQHENGSWILMDHEDDH  409



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 192/292 (66%), Gaps = 12/292 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS-PQVHR  819
            W+GYVAVATD+GKTALGRRDI+V WRGT + LEW++D+EF++ P   + G  AS   VHR
Sbjct  116  WIGYVAVATDDGKTALGRRDIVVAWRGTTQALEWINDMEFVMAPPRSLLGDEASEATVHR  175

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+ ++Y+S +P+S+ N  SARDQVL EV RLV +Y  EE+SITV GHSLGA+L TLNA D
Sbjct  176  GWLSMYTSSDPESSHNKDSARDQVLSEVARLVSMYDGEELSITVTGHSLGAALGTLNAFD  235

Query  638  IATNGANTT-----SDGKSFPVTGFVYASPRTGDYNFKNVYDAT--PNLHLLRIRNVPDI  480
            IA NG N +     +     PVT F +ASPR G + F+  +D      L LLR+RN  DI
Sbjct  236  IAANGYNRSPRAAAATATGCPVTAFAFASPRVGGHGFRRRFDGARGAGLRLLRVRNARDI  295

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            VP+ P A   + Y DVG EL ID  +S Y++   +   WHNLE YLHG+AG  G G    
Sbjct  296  VPRYPTA---LLYHDVGAELAIDTGESPYLRNPGNELLWHNLESYLHGVAGARG-GEAGR  351

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            F L V RD++L NK    L++E+ +P  WW+  N GMV+  DG W LM+ EE
Sbjct  352  FELAVERDVALTNKFYGALRDEHPVPAGWWIPSNRGMVRGADGRWTLMDCEE  403



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 193/284 (68%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  114  WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG +LAT++++DI
Sbjct  174  FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N       K+ PVT F + SPR G+ NF+ ++    +L  L IRN  DIV    P
Sbjct  234  VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIV----P  289

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
            ++  + Y+ VG EL ID  KS Y+K      + HN+E YLHGIAGT+G+    GF+L VN
Sbjct  290  SSLRLAYSKVGEELEIDTEKSKYLKSGV---SEHNMEVYLHGIAGTQGSK--GGFNLEVN  344

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNN  150
            RDI+L+NKS D LK+EY IP NW V +N GMVQQ DG+WKLM++
Sbjct  345  RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDD  388



>ref|XP_006428509.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
 gb|ESR41749.1| hypothetical protein CICLE_v10011873mg [Citrus clementina]
Length=407

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 162/300 (54%), Positives = 195/300 (65%), Gaps = 15/300 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA--GASPQVH  822
            W+GYVAVATDEGKT LGRRDI++ WRGT    EW  D +F L PA ++FG     +P VH
Sbjct  106  WIGYVAVATDEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVH  165

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             GF++LY   NPDS +   SA+DQV   V+ LV+ Y +EE+SITV GHSLG++LATLNA 
Sbjct  166  LGFHSLYVQSNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAA  225

Query  641  DIATNGAN--TTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            D+A NG N  T SD  S   VT  V+ASPR GD  FK  ++    L LLRI N  DIVP 
Sbjct  226  DLAANGYNKPTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRITNKNDIVPN  285

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVK----PSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            VPP     GY DVG EL +D +KS+YVK    P +     HNLE YLHGIAGT      D
Sbjct  286  VPPV--FSGYVDVGRELKVDTTKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDD  343

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
             F L ++RDI+L+NK  D LK+EY +P NWW  KN GMVQ D+G WKL    E Y+P PP
Sbjct  344  DFELAIDRDIALLNKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKL----EDYVPDPP  399



>ref|XP_006374295.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
 gb|ERP52092.1| hypothetical protein POPTR_0015s05760g [Populus trichocarpa]
Length=412

 Score =   291 bits (746),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 201/295 (68%), Gaps = 17/295 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW+ D  F+L+PA +IFGA  +P+VH G
Sbjct  121  WIGYVAVTTDEGQRVLGRRDILVCWRGTILPAEWLKDFLFVLIPASDIFGATNNPKVHSG  180

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            F+N+Y +++  S +N  SAR+QVL EV+RLV+ Y    EEVSITV GHSLGA+LATLNA+
Sbjct  181  FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDRYALNGEEVSITVAGHSLGAALATLNAM  240

Query  641  DIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDA-TPNLHLLRIRNVPDIVPQV  468
            DI  NG N  S     FPVT F YA PR GD  F++V++  T +LH+LRI+N  D VP+ 
Sbjct  241  DIVANGYNKPSGSDIGFPVTVFAYACPRVGDQGFQDVFNGLTNDLHVLRIKNSKDPVPR-  299

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
                P++ Y DVG EL ID  KS Y K  T     H+LE YLH IAG +G    + F LV
Sbjct  300  ---HPVLLYQDVGKELEIDSIKSPYPKDPTKP---HDLELYLHTIAGYQGKE--EEFKLV  351

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            V+RDI+L+NK  D L ++Y IP NWW  KN GM+Q D+G WKL +    Y+P PP
Sbjct  352  VDRDIALLNKGLDLLPDKYKIPPNWWNVKNNGMIQTDNGFWKLND----YVPDPP  402



>ref|XP_006491814.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
Length=407

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 195/300 (65%), Gaps = 15/300 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA--GASPQVH  822
            W+GYVAVATDEGKT LGRRDI++ WRGT    EW  D +F L PA ++FG     +P VH
Sbjct  106  WIGYVAVATDEGKTLLGRRDILISWRGTQSAAEWFKDFQFPLTPASDLFGDTYDPTPMVH  165

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             GF++LY   NPDS +   SA+DQV   V+ LV+ Y +EE+SITV GHSLG++LATLNA 
Sbjct  166  LGFHSLYVQSNPDSTYCKFSAKDQVRSAVRTLVDKYGDEEMSITVIGHSLGSALATLNAA  225

Query  641  DIATNGAN--TTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            D+A NG N  T SD  S   VT  V+ASPR GD  FK  ++    L LLR+ N  DIVP 
Sbjct  226  DLAANGYNKPTGSDTASGCMVTTIVFASPRVGDSAFKTAFEDQKLLRLLRVTNKNDIVPN  285

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVK----PSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            VPP     GY DVG EL +D +KS+YVK    P +     HNLE YLHGIAGT      D
Sbjct  286  VPPV--FSGYVDVGRELKVDATKSTYVKTVIPPLSLPSVLHNLENYLHGIAGTSQGDDDD  343

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
             F L ++RDI+L+NK  D LK+EY +P NWW  KN GMVQ D+G WKL    E Y+P PP
Sbjct  344  DFELAIDRDIALLNKGLDLLKDEYGVPPNWWTVKNKGMVQLDNGFWKL----EDYVPDPP  399



>ref|XP_011005460.1| PREDICTED: phospholipase A1-II 4-like [Populus euphratica]
Length=412

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/295 (53%), Positives = 204/295 (69%), Gaps = 14/295 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG T LGRRDI+VCWRGTI   EW  +L+F LV A EI G   +P++H G
Sbjct  106  WIGYVAVTTDEGNTVLGRRDILVCWRGTILGSEWAKNLQFDLVSAAEILGGAHNPKMHHG  165

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKN--EEVSITVCGHSLGASLATLNAI  642
            F+++Y +++  S +N  SAR+QVL EV+RLV+ Y +  E+VSITV GHSLGA+LATLNA+
Sbjct  166  FHSVYLAKSSSSKYNKTSAREQVLAEVRRLVDKYAHNGEDVSITVAGHSLGAALATLNAM  225

Query  641  DIATNGANTTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            DI +NG N  +   + F VT F YASPR GD  F++V++   NLH+LRI+N  DI+P +P
Sbjct  226  DIVSNGYNKPAGSYTGFRVTVFAYASPRLGDKGFQDVFNGLANLHVLRIKNEKDIIPNLP  285

Query  464  PATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
            PA     Y D+G EL ID SKS Y+K P+ +    HNL+ YLH IAG +G   L  F LV
Sbjct  286  PAF-YNTYKDIGEELEIDSSKSPYLKDPNAEP---HNLDIYLHTIAGYQGK--LGEFRLV  339

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            ++RDI+LVNKS D L E+Y +P NW    N GM+Q D+G WKL +    Y+P PP
Sbjct  340  IDRDIALVNKSADVLPEKYKVPPNWRTVMNKGMIQLDNGFWKLND----YVPDPP  390



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 190/289 (66%), Gaps = 7/289 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAG---ASPQV  825
            WMGYVAVA D    A GRRDI+V WRGT R +EW +DL+  LVPA  I G G   + P V
Sbjct  137  WMGYVAVAADGVAAAAGRRDIVVAWRGTKRAVEWANDLDITLVPADGIIGPGPGWSQPSV  196

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S++  S FN  SAR+QVL E+ RL+  YKNE  SIT+ GHSLGA+L+TLNA
Sbjct  197  HRGFLSVYTSKSFSSRFNKLSAREQVLAEIARLLRAYKNENCSITITGHSLGAALSTLNA  256

Query  644  IDIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            +DI  NG N     +   PVT    ASPR GD  FK  +D+   + LLR+RN PDIVP +
Sbjct  257  VDIVANGYNVRGPSRVPVPVTAIALASPRVGDDQFKRAFDSMAGVSLLRVRNAPDIVPTI  316

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
             P+     + DVG EL +D  +S Y+K       WHNLE YLH +AGT+GAG   GFSL 
Sbjct  317  LPSA---FFKDVGAELLVDTRRSPYLKSPAGPAQWHNLECYLHAVAGTQGAGDGAGFSLA  373

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            V+RD++LVNK  D L++EY +P  WW EKN GMVQ   G W L ++EEG
Sbjct  374  VDRDVALVNKEVDALRDEYQVPAAWWGEKNKGMVQNASGRWVLQDHEEG  422



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/292 (52%), Positives = 194/292 (66%), Gaps = 12/292 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG----AGASPQ  828
            WMGYVAVATD+G  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G     G+ P 
Sbjct  114  WMGYVAVATDQGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGAGGSDPS  173

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+S +  S  + +SAR QVL E+ RL++ YK+EE SITV GHSLGA++ATLN
Sbjct  174  VHRGYLSLYTSADEGSNLSKQSARMQVLTEIARLMDKYKDEETSITVVGHSLGATMATLN  233

Query  647  AIDIATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            A DI  N  N T   D +  PVT  V+ SPRTGD +F++V+   P+L +LRIRN PD +P
Sbjct  234  AADIVANAYNKTPGYDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPDLRMLRIRNRPDRIP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
              PP    +GY DVGVEL ID  +S ++KP  +    H+LE +LHG+AG +G     GF 
Sbjct  294  HYPP----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVAGWQGDH--GGFE  347

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
            LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W L ++E  Y
Sbjct  348  LVVDRDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEPDY  399



>gb|EMS68153.1| Phospholipase A1-II 7 [Triticum urartu]
Length=388

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 187/276 (68%), Gaps = 11/276 (4%)
 Frame = -2

Query  965  EGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----VHRGFYNLYS  798
             G  ALGRRDI+V WRGTI+ LEWV+DL+F  VPA  + G+ AS      VHRGF ++Y+
Sbjct  115  HGAAALGRRDIVVAWRGTIKNLEWVNDLDFTPVPATPVLGSAASQNRFAVVHRGFLSVYT  174

Query  797  SENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDIATNGAN  618
            S N  S F   SA+DQVL EV+RLVELYK+EEVSITVCGHSLGASLATLNA+D+ ++GAN
Sbjct  175  SSNKSSEFTKTSAKDQVLKEVRRLVELYKDEEVSITVCGHSLGASLATLNAVDLVSSGAN  234

Query  617  T-TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPATPLIGY  441
               S  KSFPVT  V+ASP  GD  F++ +++ P+L  L ++N  DIVP  PP    +GY
Sbjct  235  KPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDLKALHVQNAGDIVPMYPP----LGY  290

Query  440  TDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRDISLVN  261
             DV VELTI   +S Y++    +   HNLE YLHG+AG +G+    GF L V RD++LVN
Sbjct  291  VDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAGEQGSA--GGFKLEVERDVALVN  348

Query  260  KSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
            K  D L  E+ +P  WWV K+  MV+  DG W L +
Sbjct  349  KGADALTNEHPVPAEWWVPKHKFMVKGKDGRWALQD  384



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 198/295 (67%), Gaps = 13/295 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI+V WRGTI   EWV DL F L  AP IF   A  +VH G
Sbjct  113  WIGYVAVATDEGKAALGRRDIVVAWRGTINAAEWVQDLHFHLDSAPLIFD-DARAKVHHG  171

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            FY++Y+S  P S FN    R QVL EV+RLVE Y  KNEE+SITV GHSLGA+LAT+NA+
Sbjct  172  FYSVYTSNKPGSEFNDTCVRHQVLEEVRRLVEEYNRKNEEISITVIGHSLGAALATINAV  231

Query  641  DIATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DI   G N   D   K+  VT FV+ASPR G+ +F  ++    +L  LRIRN  D+VP++
Sbjct  232  DIVAKGLNIPKDQPEKACSVTTFVFASPRVGNSHFAKIFTGHKHLRALRIRNETDVVPKL  291

Query  467  PPATPLI--GYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            P        G++DVG EL ID +KS Y+K        HNLE YLHG+AGT+G    + F 
Sbjct  292  PLKHLFFLDGFSDVGEELVIDTTKSKYLKKEVSA---HNLEVYLHGVAGTQGKNG-EIFD  347

Query  293  LVVN-RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN-NEEGYI  135
            L  + RDI+L+NKS+D LK+EY  P  W V +N GMVQQ DG+WKLM+ N++G +
Sbjct  348  LDESLRDIALLNKSKDALKDEYHCPVAWRVHENKGMVQQKDGTWKLMDHNKDGIL  402



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   290 bits (743),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 197/290 (68%), Gaps = 16/290 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            W+GYVAVATDEG  ALGRRDI+V WRGT++ LEWV+DL+F  V A  + G+ A       
Sbjct  152  WIGYVAVATDEGAEALGRRDIVVAWRGTVKNLEWVNDLDFTPVSAAPVLGSAAGKNRLAV  211

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S N  S F   SARDQVL EV+RLVEL+K+EE SITV GHSLGASLATLN
Sbjct  212  VHRGFLSVYTSSNKSSKFTKTSARDQVLEEVRRLVELHKDEETSITVTGHSLGASLATLN  271

Query  647  AIDIATNGAN--TTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            A+D+ ++G N  ++SDG  K FPVT  V+ASP  GD  F++ + + P+L  L ++NV DI
Sbjct  272  AVDLVSSGTNKPSSSDGDKKPFPVTAIVFASPHVGDRFFRSAFGSFPDLKALHVQNVGDI  331

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            VP  PP    +GY DV  ELTI   +S Y+  P T +   HNLE YLHG+AG +G+    
Sbjct  332  VPLYPP----LGYVDVATELTIRTIRSPYLSVPGTPV-TLHNLECYLHGVAGEQGS--RG  384

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
            GF L V RD++LVNK  D L +E+ +P  WW  K+  MV+ DDG W L +
Sbjct  385  GFKLEVARDVALVNKGVDALTDEHPVPAGWWTPKHRCMVRGDDGRWTLQD  434



>gb|KDP31780.1| hypothetical protein JCGZ_12241 [Jatropha curcas]
Length=372

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 195/284 (69%), Gaps = 5/284 (2%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK  LGRRDI++ WRGTI+ +EWV D +  L+ A  I      P+VH+G
Sbjct  88   WIGYVAVATDEGKAMLGRRDIVIAWRGTIQPIEWVKDFQAPLISASNILKWDKDPRVHQG  147

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F +LY++ +  SA++  SAR+QV+ EVKRL++ +K+EE S+TV GHSLGA+LATLNAIDI
Sbjct  148  FLSLYNTADFVSAYSKTSAREQVIEEVKRLMQEFKHEETSLTVTGHSLGAALATLNAIDI  207

Query  635  ATNGANTTSDGKSF-PVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPA  459
            A NG N   + K   PVT FV+ASPR GD NFK + ++  NLH+L+I+N+ D+VP  PP 
Sbjct  208  AANGFNIGDESKERSPVTAFVFASPRVGDRNFKELSESVENLHILKIKNLNDLVPLTPPK  267

Query  458  TPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
                GY DVG EL ++   S +V       +WHNLE YLHG+AGT+G   +  F L V R
Sbjct  268  ES--GYADVGKELLLNTLISPFVNRPGGPLSWHNLEAYLHGVAGTQGDKPV--FHLEVKR  323

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            DI+L+NK   +L+ +Y IP  W   +N GMV+  DGSW+L + E
Sbjct  324  DIALLNKEISNLQPDYLIPPAWRCPRNTGMVKMKDGSWELRDQE  367



>ref|XP_004961148.1| PREDICTED: phospholipase A1-II 6-like [Setaria italica]
Length=409

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/289 (52%), Positives = 189/289 (65%), Gaps = 9/289 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  822
            W+GYVAVATDEGK ALGRRD++V WRGT++ LEWV DLEF +VP   + G        VH
Sbjct  118  WIGYVAVATDEGKAALGRRDVVVAWRGTVQALEWVEDLEFAMVPPRGLLGDREACDAMVH  177

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RG+ ++Y+S +P S+ N  SARDQ L EV+RLV+ YK+EE+SITV GHSLGA+LATLNA 
Sbjct  178  RGWLSMYTSADPVSSHNQDSARDQALREVRRLVDTYKDEELSITVTGHSLGAALATLNAF  237

Query  641  DIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            DIA NG N           PVT F +A PR G   FK  +DA   L LLR+RN  DIVP+
Sbjct  238  DIAANGYNVAPAAAGMAACPVTAFAFACPRVGGSGFKKRFDAVSGLRLLRVRNARDIVPR  297

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             P     + Y DVG EL ID   S Y++       WHNLE YLHG+AG  G     GF L
Sbjct  298  YPA----VFYHDVGAELAIDTGASPYLRSPGHEQTWHNLEVYLHGMAGARGGAGGGGFEL  353

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             V RD++LVNK+ D L++++ +P  WWV  N GMV+  DG W+LM+ E+
Sbjct  354  AVARDVALVNKAYDALRDDHGVPPGWWVPHNRGMVKGSDGRWRLMDCED  402



>ref|XP_008345355.1| PREDICTED: phospholipase A1-IIgamma-like [Malus domestica]
Length=407

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 192/286 (67%), Gaps = 10/286 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV T EGK  LGRRDI+V WRGT    EW  DL F LV A +I G    P+VH G
Sbjct  127  WLGYVAVTTXEGKEVLGRRDILVTWRGTELDAEWGVDLLFDLVSASDILGDKYDPKVHHG  186

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++ Y+S +P+S ++  S R QVL  +K +V+ YK+EE+SITVCGHS+G + A LNA DI
Sbjct  187  FHSYYNSADPESPYSKTSCRAQVLTAIKEVVDQYKDEEISITVCGHSMGGAFAILNATDI  246

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N  +D   K+  VT  V+ASPR GD  F +V+ +  NLH+LR+ N  DIVP +P 
Sbjct  247  VCNGYNKPTDRPDKACLVTSIVFASPRLGDQGFHDVFSSLKNLHVLRVTNSYDIVPHLP-  305

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
              PL  Y DVG EL ID  KS Y+K +    + H LE YLHG+AGT+G    +GF LV+N
Sbjct  306  --PLEKYVDVGKELKIDTLKSPYLKNAKK--DAHRLEIYLHGVAGTQGR---NGFQLVIN  358

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            RDI+LVNK  D LK+EY++   WW EKN  MVQ DDGSW L+++E+
Sbjct  359  RDIALVNKKLDGLKDEYNVIVKWWTEKNKSMVQMDDGSWVLLDHEK  404



>ref|XP_011005461.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=411

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 206/296 (70%), Gaps = 15/296 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEG+  LGRRDI+VCWRGTI   EW  D +F L PA +IFGA  +P+VH G
Sbjct  106  WIGYVAVTTDEGQRVLGRRDILVCWRGTILASEWSQDFQFDLTPASDIFGATNNPKVHHG  165

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY--KNEEVSITVCGHSLGASLATLNAI  642
            F+N+Y +++  S +N  SAR+QVL EV+RLV++Y    EEVSITV GHSLGA+LATLN +
Sbjct  166  FHNVYVAKSSKSKYNKTSAREQVLAEVRRLVDMYALNGEEVSITVAGHSLGAALATLNGV  225

Query  641  DIATNGANTTSDGK-SFPVTGFVYASPRTGDYNFKNVYDA-TPNLHLLRIRNVPDIVPQV  468
            D+  NG N  S     FPVT F YASPR GD  F++V++  T +LH+LRI+N  DI+P++
Sbjct  226  DMVANGFNKPSGSDVGFPVTVFAYASPRVGDQGFQDVFNGLTTDLHVLRIKNSKDIIPRL  285

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
            PP   L+GY DVG +L ID  KS Y+K P       HNLE YLH IAG +G    + F L
Sbjct  286  PPVF-LLGYQDVGEKLEIDSIKSPYLKDPKAQP---HNLELYLHTIAGYQGQE--EEFKL  339

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            VV+RDI+L+NKS D L ++Y+IP  WW  KN GM+Q D+G WKL +    Y+P PP
Sbjct  340  VVDRDIALLNKSLDLLLDKYNIPPKWWNVKNNGMIQIDNGFWKLND----YVPDPP  391



>gb|EEE64776.1| hypothetical protein OsJ_19632 [Oryza sativa Japonica Group]
Length=287

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 197/292 (67%), Gaps = 15/292 (5%)
 Frame = -2

Query  992  MGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQ--V  825
            MGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+D +F  VPA  + GA A  +P+  V
Sbjct  1    MGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAIV  60

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
            HRGF ++Y+S N DS +N  SARDQVL EV+RL+ELYK+E  SITV GHSLGASLATLNA
Sbjct  61   HRGFLSVYTSSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLNA  120

Query  644  IDIATNGANT-----TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            +DI  NGAN      +S     PVT  V+ASPR GD  FK  + + P+L  L ++N  D+
Sbjct  121  VDIVANGANCPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGDV  180

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            VP  PP    +GY DV V+L I  S+S Y++    I   HNLE YLHG+AG +G+    G
Sbjct  181  VPMYPP----LGYVDVAVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSA--GG  234

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            F L V+RD++L NK  D LK++Y +P  WWV KN  MV+  DG W L + E+
Sbjct  235  FKLEVDRDVALANKGVDALKDKYPVPPRWWVSKNRCMVKDADGHWALHDFEQ  286



>gb|EMT30117.1| Mono- and diacylglycerol lipase [Aegilops tauschii]
Length=419

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 189/289 (65%), Gaps = 11/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  822
            W+GYVAVATD GK  L RRD++V WRGTI+ LEWV DLEF +V    I G  AGA   VH
Sbjct  124  WIGYVAVATDAGKAVLSRRDVVVAWRGTIQALEWVDDLEFAMVHPKGILGDAAGADAMVH  183

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RG++++Y+S +P S  N  +AR QVL EV++LV++YK+EEVSITV GHSLGA+LATLNA 
Sbjct  184  RGWFSIYTSTDPASTHNKDNARSQVLAEVRKLVDMYKDEEVSITVTGHSLGAALATLNAF  243

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATP---NLHLLRIRNVPDIVPQ  471
            DI  NG N  +   +FPVT F +ASPR G   FK  +DA      L +LR+RN  DIVP+
Sbjct  244  DIVENGYNCMASA-TFPVTAFAFASPRVGGAGFKKRFDAAAAAVGLRVLRVRNARDIVPK  302

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             P     + Y DVG EL ID   S Y++ + D   WHNLE YLH             F +
Sbjct  303  YPA----LLYHDVGSELAIDTGASPYLRATGDKRVWHNLECYLH-GVAGAPTAAGGAFEI  357

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            VV RD++LVNK  D L+EE+ +P  WWV  N GMV+ DDG W+L++ E+
Sbjct  358  VVERDVALVNKLYDALREEHGVPAGWWVPWNKGMVKGDDGRWRLVDCED  406



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/300 (52%), Positives = 195/300 (65%), Gaps = 38/300 (13%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            WMGYVAV TDEG   LGRRDI+V WRG+I+TLEW++D  F+LV A  IFG  +   QVH+
Sbjct  115  WMGYVAVTTDEGTELLGRRDIVVAWRGSIQTLEWINDFHFVLVDAKNIFGEKSKGVQVHQ  174

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            G+Y++Y+S +  S FN  SARDQVL EV+RLVE YK+EE+SITVCGHSLGA+LATLNA D
Sbjct  175  GWYSIYTSSDERSPFNKSSARDQVLQEVRRLVEKYKDEEISITVCGHSLGAALATLNAAD  234

Query  638  IATNGANTTSDGKSFP--VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  NG N T +    P  VT FV+ASPR G+ +FK ++    +L  LR+RN+PDIVP  P
Sbjct  235  IVANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKSLRGLRVRNLPDIVPTYP  294

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY+DVG ELTID  KS Y+K   D+ ++HNLE  LHG+AGT+G           
Sbjct  295  P----LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVAGTQG---------TT  341

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE-EGYIPRPP*LLFL  108
             ++  L NK                     GMVQQDDGSWKLM++E +G     P L F+
Sbjct  342  TKEFKLQNK---------------------GMVQQDDGSWKLMDHEMDGEDVHEPCLYFV  380



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 191/288 (66%), Gaps = 16/288 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  822
            WMGY+AVATDEGK ALGRRDI++ WRGTI  +EW  D EF LVPA +I G   G++  VH
Sbjct  116  WMGYIAVATDEGKAALGRRDILIAWRGTIMPIEWEKDFEFPLVPASKILGKCGGSNAHVH  175

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            +GF ++Y++ NP S ++  SARDQVL E+K+L+E YK+EE+SIT+ GHSLG +L+TL A 
Sbjct  176  QGFLSIYTATNPRSKYSKTSARDQVLSELKKLIEQYKHEELSITLTGHSLGGALSTLCAT  235

Query  641  DIATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            DI  NG N       K+ PVT F Y +P  GD NFK+  ++  +LH+L I NVPDIVP+ 
Sbjct  236  DIVCNGYNKICHNPYKTCPVTAFRYGAPMVGDSNFKHTAESMNDLHMLSIHNVPDIVPK-  294

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEG-YLHGIAGTEGAGVLDGFSL  291
             PA P  GYT VG E  +D  KS Y+    D + WHNLEG YLH +A   G         
Sbjct  295  SPAMP--GYTRVGQEHFVDSKKSPYLTFPGDTYTWHNLEGAYLHSLAIENGG--------  344

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
               RD++LVNK    LK +Y IP +WW E+N GMVQ+ DGSW+L + E
Sbjct  345  EPKRDLALVNKGSGALKPKYGIPFSWWCEENKGMVQKSDGSWQLRDYE  392



>ref|NP_001056387.1| Os05g0574100 [Oryza sativa Japonica Group]
 sp|Q6F357.1|PLA7_ORYSJ RecName: Full=Phospholipase A1-II 7 [Oryza sativa Japonica Group]
 sp|A2Y7R2.1|PLA7_ORYSI RecName: Full=Phospholipase A1-II 7 [Oryza sativa Indica Group]
 gb|AAT69581.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44111.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF18301.1| Os05g0574100 [Oryza sativa Japonica Group]
 gb|EAY99122.1| hypothetical protein OsI_21081 [Oryza sativa Indica Group]
Length=407

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/293 (54%), Positives = 198/293 (68%), Gaps = 15/293 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA--SPQ--  828
            WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+D +F  VPA  + GA A  +P+  
Sbjct  120  WMGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDFDFTPVPAAPVLGAAAAANPRAI  179

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S N DS +N  SARDQVL EV+RL+ELYK+E  SITV GHSLGASLATLN
Sbjct  180  VHRGFLSVYTSSNKDSKYNKASARDQVLEEVRRLMELYKDEVTSITVVGHSLGASLATLN  239

Query  647  AIDIATNGANT-----TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPD  483
            A+DI  NGAN      +S     PVT  V+ASPR GD  FK  + + P+L  L ++N  D
Sbjct  240  AVDIVANGANCPPASSSSSQPPCPVTAIVFASPRVGDGFFKAAFASFPDLRALHVKNAGD  299

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            +VP  PP    +GY DV V+L I  S+S Y++    I   HNLE YLHG+AG +G+    
Sbjct  300  VVPMYPP----LGYVDVAVKLRISTSRSPYLRSPGTIETLHNLECYLHGVAGEQGSA--G  353

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            GF L V+RD++L NK  D LK++Y +P  WWV KN  MV+  DG W L + E+
Sbjct  354  GFKLEVDRDVALANKGVDALKDKYPVPPRWWVSKNRCMVKDADGHWALHDFEQ  406



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 150/284 (53%), Positives = 191/284 (67%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  ++ Q+H G
Sbjct  123  WIGYVAVATDEAKEALGRRDIVVVWRGTIQGSEWVQNFNIDLDPAPLIFGPKSNVQIHNG  182

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+SEN        SAR QVL E+ RLVELYKNEE+SITV GHSLG +LAT++++DI
Sbjct  183  FYSLYTSENSGLPSADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSVDI  242

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N   +   K+ PVT F + +PR G+  F+ ++    +L  L +RN  DIVP+   
Sbjct  243  VANKFNMPKEQPQKACPVTTFAFGAPRVGNSYFQKIFSDHKDLSALFVRNENDIVPK---  299

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
             +    Y  VG EL ID  +S Y+K        HN+E YLHGIAGT+G+    GF+L VN
Sbjct  300  -SLTFFYYKVGEELEIDTEESKYLKSGVSA---HNMEVYLHGIAGTQGSK--GGFNLEVN  353

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNN  150
            RDI+L+NKS D LK+EY IP NW V +N GMVQQ DG+WKLM++
Sbjct  354  RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDD  397



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 193/296 (65%), Gaps = 16/296 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--------AG  840
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+  L  A  I G         G
Sbjct  114  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLALASAAGILGPEGGGGGSGG  173

Query  839  ASPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASL  660
            + P VHRG+ +LY+S+   S  + +SAR QVL E+ RL++ YK EE SITV GHSLGA++
Sbjct  174  SDPSVHRGYLSLYTSDYEGSNLSKQSARMQVLTEIVRLMDKYKGEETSITVVGHSLGATM  233

Query  659  ATLNAIDIATNGANTTS--DGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVP  486
            ATLNA+DIA N  N     D +  PVT  V+ SPRTGD +F++V+  TP+L +LR+RN P
Sbjct  234  ATLNAVDIAANAYNKIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPDLRMLRVRNRP  293

Query  485  DIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVL  306
            D +P  PP    +GY DVGVEL ID  +S ++K        H+LE +LHGIAG +G    
Sbjct  294  DRIPHYPP----VGYADVGVELLIDTRRSPFLKHHGSESQSHDLEVHLHGIAGWQGD--R  347

Query  305  DGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
             GF LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W L +++  Y
Sbjct  348  GGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDPDY  403



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 195/292 (67%), Gaps = 14/292 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASP--Q  828
            +MGYVAVATDEG  ALGRRDI+V WRGT+++LEWV+DL F  VPA  + G  A A+P   
Sbjct  122  FMGYVAVATDEGAAALGRRDIVVAWRGTVQSLEWVNDLTFTPVPAAPVLGKKAAANPLAM  181

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF +LY+S +  S FN  SARDQV  EV+RLVELYK+EE+SIT+ GHSLGA+++ LN
Sbjct  182  VHMGFLSLYTSSHAGSKFNKTSARDQVFEEVRRLVELYKDEELSITITGHSLGAAISILN  241

Query  647  AIDIATNGANTTSDG---KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A+DI +NG N  + G    + PVT FV+A P  GD  F+  + +  +L  L ++N  D+V
Sbjct  242  AVDIVSNGVNVPAGGGGSAACPVTAFVFACPHVGDRFFRAAFHSFRDLRALHVKNAGDVV  301

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  PP    + Y DV V L I+  +S Y+K    +   HNLE YLHG+AG +G+    GF
Sbjct  302  PMYPP----LAYVDVAVTLNINTGRSPYLKWPGTVLTLHNLECYLHGVAGEQGSA--GGF  355

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQD-DGSWKLMNNEE  144
             L V RD++LVNK  D LK+EY +P +WW  +N GMV+ D DG  KL + ++
Sbjct  356  KLEVKRDVALVNKGADALKDEYPVPASWWALENKGMVKDDADGLLKLNDFQQ  407



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 195/293 (67%), Gaps = 20/293 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  819
            W+G+VAVATDEGK ALGRRDI++ WRGT    E   D ++ LV   +IFG    +  VH+
Sbjct  125  WIGFVAVATDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHK  184

Query  818  GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            GFY++Y+  N  S FN   SARDQVL E+KRL++ Y  EE+SI+V G S+G+SL TL AI
Sbjct  185  GFYSVYTCLNEASNFNRTTSARDQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLCAI  244

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI  N  N     K FPVT F+++SPR G+ NFK  Y    NLH+LRI NVPD +P++  
Sbjct  245  DIVVNEIN-----KEFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKLME  299

Query  461  ATPLIG--------YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVL  306
               + G        Y DVG EL ID +KS Y+K   DI++ H LE YLHGIAGT G  V 
Sbjct  300  RGQVEGCAITEWRAYEDVGFELVIDTTKSEYLKK--DIFS-HFLEVYLHGIAGTHG--VE  354

Query  305  DGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
              F L +NRDI+LVNK  D LKEEY +P  WW+EKN GMVQQ+DGSW L+++E
Sbjct  355  GEFKLEINRDIALVNKQGDFLKEEYGVPSAWWIEKNKGMVQQEDGSWILIDHE  407



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 197/326 (60%), Gaps = 51/326 (16%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRDI+V WRGT++ +EWV+DL+F  VPA  + G+ AS      
Sbjct  151  WMGYVAVATDEGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAGPVLGSAASQHRLAV  210

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQ----------------------------------  750
            VH GF ++Y+S N  S F   SARDQ                                  
Sbjct  211  VHHGFLSMYTSSNKSSEFTKTSARDQRGLVCGRLSLRPYARLLAHTQSWQLPCVSAGYMV  270

Query  749  ------VLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDIATNGANTTSDG-KSFP  591
                  V+ EV+RLVELYKNEEVSITVCGHSLGAS+ATLNA+D+ ++G N      KSFP
Sbjct  271  TAIALLVVKEVRRLVELYKNEEVSITVCGHSLGASVATLNAVDLVSSGINKPEGSTKSFP  330

Query  590  VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTID  411
            VT  V+ASP  G   F++ +++ P+L  L ++N  D+VP  PP    +GY DV VELTI 
Sbjct  331  VTAIVFASPHVGCRFFRSAFNSFPDLKALHVQNAGDVVPMYPP----LGYVDVAVELTIR  386

Query  410  FSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEY  231
              +S Y++    +   HNLE YLHG+AG +G+    GF L V+RDI+LVNK  D L +E+
Sbjct  387  TIRSPYIRKPATVGTLHNLECYLHGVAGEQGSA--GGFKLEVDRDIALVNKGADALTDEH  444

Query  230  SIPGNWWVEKNMGMVQQDDGSWKLMN  153
             +P  WWV ++  MV+ +DG W L +
Sbjct  445  PVPACWWVPRHKFMVKGEDGRWTLQD  470



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 197/298 (66%), Gaps = 23/298 (8%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEGKTALGRRDI+V WRG+++ +EW+ D +F L  A  I G   +P  HR 
Sbjct  114  WIGFVAVATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRC  173

Query  815  FYNLYSSENPDSAFNIKSARDQV------------LGEVKRLVELYKNEEVSITVCGHSL  672
            + ++Y+S +P S FN +SARDQV            L EVKRLV+ YK+EE+SIT+ GHSL
Sbjct  174  WVSIYTSHDPKSRFNKQSARDQVIVGICAHKQMRFLSEVKRLVDKYKDEEISITITGHSL  233

Query  671  GASLATLNAIDIATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRI  498
            GA+L TL A DI  N  N   +   KS PVT F++ SPR GD NF+N+  +  NLHL+R+
Sbjct  234  GAALGTLCAADIVANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRV  293

Query  497  RNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEG  318
             NVPDIV  +PP      Y++VG EL ID   S+++K       WH+LE +LHG+AGT+G
Sbjct  294  TNVPDIVTTLPPEG---YYSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQG  350

Query  317  AGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +    GF L V+R I+LVNK  D LK+EY +P +WW  +N GM     GSW+L ++E+
Sbjct  351  SK--GGFHLEVDRSIALVNKMLDALKDEYPVPASWWCMRNKGM----KGSWELKDHEK  402



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 191/293 (65%), Gaps = 19/293 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASP-QVHR  819
            W+G+VAVATD+GK ALGRRDI++ WRGT+   EW  D +++LVP  +IFG       VHR
Sbjct  131  WIGFVAVATDDGKVALGRRDILIAWRGTMSPAEWNDDYDWVLVPPTKIFGENTHDILVHR  190

Query  818  GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            GFY++Y+S N  S FN   SARDQV+ EVKRLVE YK ++VSIT+ GHS+G+SLATL A+
Sbjct  191  GFYSVYTSLNEASKFNRTTSARDQVIEEVKRLVEQYKGDKVSITLSGHSIGSSLATLCAV  250

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI  N  N     K FPVT F+ ASPRTG+ NFK  Y    NL +LRI N  D VP+ P 
Sbjct  251  DIVVNQIN-----KEFPVTAFLLASPRTGEANFKKAYQNLKNLQILRITNALDEVPEKPD  305

Query  461  ATPLIG-------YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
               + G       Y  VG EL ID +KS Y+K      N H +E YLHGIAGT GA    
Sbjct  306  RGQVEGSETDWRVYEHVGFELKIDTTKSEYLKKDV---NNHTVEVYLHGIAGTHGAE--G  360

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             F L +NRDI+LVNK  D LK EY +P  W + +N GMVQQ+DGSW L + E+
Sbjct  361  EFKLEINRDIALVNKEADALKNEYGVPVYWRIVQNKGMVQQEDGSWSLNDRED  413



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 185/285 (65%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVA ATDEG   LGRRDI+V WRGT R LEWV+DL+     A  I G     G+ P 
Sbjct  115  WMGYVAAATDEGAARLGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGPEGADGSDPS  174

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+S +P S  + +SAR QVL E+ RL++ YK+EE SITV GHSLGA+LATLN
Sbjct  175  VHRGYLSLYTSADPGSELSKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  234

Query  647  AIDIATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
            A+DIA N  N    +  ++ PVT  V+ SPRTGD +F++ +   P L +LR+RN PD +P
Sbjct  235  AVDIAANSYNRFALNGRRATPVTAVVFGSPRTGDRDFRDAFHRVPGLRMLRVRNRPDRIP  294

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
              PP    +GY DVGVEL ID  +S ++KP       H+LE +LHGIAG  G      F 
Sbjct  295  LYPP----VGYADVGVELLIDTRRSPFLKPHGSESQSHDLECHLHGIAGWHGEH--GAFE  348

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W L
Sbjct  349  LVVDRDVALVNKFDDCLADEYPVPVGWKVNHNKNMVKGRDGRWVL  393



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 190/296 (64%), Gaps = 17/296 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATD+G  ALGRRDI+V WRGT+ +LEWV+DL+FL   A  + G  A       
Sbjct  134  WMGYVAVATDDGVAALGRRDIVVAWRGTLESLEWVNDLDFLPASAAPVLGPAAEEHGNAV  193

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF  +Y++ + DS +N  SARDQVL EVKRL+EL+K E  SIT+ GHSLGASLA LN
Sbjct  194  VHHGFLTVYTASDEDSKYNKTSARDQVLEEVKRLMELHKGEVTSITLTGHSLGASLAILN  253

Query  647  AIDIATNGANTTSDGKS-------FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNV  489
            A+DI +NG NT S   S        PVT  V+A P  G+ +FK+ + +  +L  L + N 
Sbjct  254  AVDIVSNGLNTPSTSSSSSSQLPPCPVTAIVFACPHVGNDDFKSAFASFSDLRALHVINA  313

Query  488  PDIVPQVPPATPLIGYTDVG-VELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAG  312
             DIVP  PP    IGY DV    L ID S+S Y++       WHNLE YLHG+AG +G G
Sbjct  314  RDIVPLYPP----IGYVDVATAALRIDTSRSPYLRSPGTPQTWHNLECYLHGVAGEQG-G  368

Query  311  VLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
               GF L V+RD++LVNK  D LK+EY +P NWWV  N GMV+   G WKL + EE
Sbjct  369  QGRGFRLEVDRDVALVNKGSDALKDEYPVPANWWVVSNKGMVRGAGGHWKLKDFEE  424



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 187/291 (64%), Gaps = 14/291 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+SE+  S  N +SAR QVL E+ RL++ YK+EE SITV GHSLGA+LATLN
Sbjct  168  VHRGYLSLYTSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  227

Query  647  AIDIATNGANTTSDGKS----FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            A DIA N  NT+S   S     PVT  V+ SPRTGD  F++ +    +L +LR+RN PD 
Sbjct  228  AADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDR  287

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            +P  PP    +GY DVGVEL ID   S +++        H+LE +LHG+AG  G     G
Sbjct  288  IPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDH--RG  341

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            F LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W L ++E
Sbjct  342  FELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  392



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/291 (52%), Positives = 187/291 (64%), Gaps = 14/291 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  113  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  172

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+SE+  S  N +SAR QVL E+ RL++ YK+EE SITV GHSLGA+LATLN
Sbjct  173  VHRGYLSLYTSEDQCSELNKQSARMQVLTEIARLMDKYKDEETSITVIGHSLGATLATLN  232

Query  647  AIDIATNGANTTSDGKS----FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            A DIA N  NT+S   S     PVT  V+ SPRTGD  F++ +    +L +LR+RN PD 
Sbjct  233  AADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRLRDLRMLRVRNRPDR  292

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            +P  PP    +GY DVGVEL ID   S +++        H+LE +LHG+AG  G     G
Sbjct  293  IPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHGVAGWHGDH--RG  346

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            F LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W L ++E
Sbjct  347  FELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVLQDHE  397



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 160/300 (53%), Positives = 196/300 (65%), Gaps = 18/300 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF--GAGASPQVH  822
            W+GYVAVATDEGK  LGRRDI++ WRGT    EW  D+EF L  A +IF    G +P+VH
Sbjct  106  WIGYVAVATDEGKAVLGRRDILISWRGTQSAAEWFKDIEFSLTAASDIFEDTYGPTPEVH  165

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
             GF++LY   +  S +N  SA+DQV   V+ LV+ YK EE+SITV GHSLG++LATLNA 
Sbjct  166  SGFHSLYVKSDSASTYNKSSAKDQVRSAVRTLVDKYKEEEMSITVIGHSLGSALATLNAA  225

Query  641  DIATNGAN--TTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            D+  NG N  T SD  S   VT  V+ASPR G+  FK V++   +LHLLRI N  DIVP 
Sbjct  226  DLVANGYNKPTGSDAASGCMVTAIVFASPRVGNSAFKTVFEDLNHLHLLRITNKDDIVPD  285

Query  470  VPPA-TPLI--GYTDVGVELTIDFSKSSYV---KPSTDIWNWHNLEGYLHGIAGT-EGAG  312
            +PP   P I  GY  VG EL ID +KS+YV   KPS  +   HNLE YLHGIAGT +G  
Sbjct  286  LPPRYLPHIAMGYVHVGQELKIDTTKSTYVKKRKPSLSV--LHNLENYLHGIAGTPKGDD  343

Query  311  VLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
              D F L ++RDI+LVNK  D L+ +Y +P NWW  KN  MVQ D+G WKL    E Y+P
Sbjct  344  DDDDFELAIDRDIALVNKGLDLLEVKYGVPPNWWAVKNKSMVQLDNGFWKL----EDYVP  399



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/289 (53%), Positives = 192/289 (66%), Gaps = 11/289 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W GYVAVATDEGK ALGRRDI++ WRGTIR  EW  +L F  V AP  FG  + P VH+G
Sbjct  114  WNGYVAVATDEGKVALGRRDILIVWRGTIRKSEWNENLTFWFVKAPLFFGQNSDPLVHKG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y++ N DS  N KSARDQ+  EV RLVELYK+E++SITV GHSLG+S+ATLNA+D+
Sbjct  174  WYDMYTTINQDSQLNEKSARDQIREEVARLVELYKDEDISITVTGHSLGSSMATLNAVDL  233

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP--  462
            A   AN  ++ K+  VT F+YASP+ GD NFKNV     NL  LRI +V DIV  VPP  
Sbjct  234  A---ANPINNNKNILVTAFLYASPKVGDENFKNVISNQQNLRALRISDVNDIVTAVPPFG  290

Query  461  ----ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
                    I Y DVGV L ID  KS Y+KP     + H+L  Y+H I G +G+    GF 
Sbjct  291  WKEGDNTAILYGDVGVGLVIDSKKSHYLKPDFPNLSTHDLMLYMHAIDGYQGSQ--GGFE  348

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
               + D++ VNK  D+LK EY IP  W+  K+ GMVQQDDG++ L ++E
Sbjct  349  RQEDFDLAKVNKYGDYLKAEYPIPIGWFNIKDKGMVQQDDGNYILDDHE  397



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 197/291 (68%), Gaps = 14/291 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG-----AGASP  831
            +MGY+AVA D+    LGRR+I+V WRG++  +EW++DL+FL V A +I           P
Sbjct  148  FMGYIAVAEDDAVELLGRREIVVAWRGSVEFMEWLNDLKFLQVSASDILAHEGDDGEPEP  207

Query  830  QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATL  651
            +VH+G++++Y+++N  S F   SAR QVL E+ +LVE YKNEE+SIT+ GHSLGA+LATL
Sbjct  208  EVHQGWHSIYTTDNLSSPFEKTSARQQVLTELTKLVEQYKNEEISITITGHSLGAALATL  267

Query  650  NAIDIATNGAN---TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            NA DI  N  N    + + K   VT  V+ASPR GD NFK       +L +LR+RN  D 
Sbjct  268  NAADIVANKINQPKNSPNSKPCKVTAIVFASPRVGDANFKKTLSKYDDLGVLRVRNAQDF  327

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            VP      PLI Y+DVG ELTID ++S+Y+K    +   HNLE Y+HG+AGT+G+  ++G
Sbjct  328  VPNY----PLIDYSDVGEELTIDTTQSAYLKNPGLLSVSHNLEVYMHGVAGTQGS--VEG  381

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            F LVV RD++L+NK  D LK++Y +P  WWV +  GMVQQ DGSW LM++E
Sbjct  382  FKLVVERDVALLNKFYDFLKDDYLVPVGWWVAQYKGMVQQADGSWLLMDHE  432



>ref|XP_007025431.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28053.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=383

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 192/294 (65%), Gaps = 15/294 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W GYVAVATDEGKTALGRRDI+V WRGT    EW+ D  F   PA E+FG   + +VH G
Sbjct  97   WFGYVAVATDEGKTALGRRDILVSWRGTGTEPEWIDDARFFTTPAKELFGTDHA-KVHSG  155

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F  +Y+ +  +S +N  SARDQVL  V++LV+ Y+NE++SITV GHSLGA+LATLNA DI
Sbjct  156  FLAIYTGKVSNSPYNQTSARDQVLKAVRKLVDKYQNEDISITVVGHSLGAALATLNATDI  215

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            A  G N  +D   K+  VT F YASP  G+  FK V D    LH+LRI N  DI+P++P 
Sbjct  216  AAKGYNKPTDNSNKTCMVTAFAYASPHVGNQEFKEVIDGLIELHILRITNSTDIIPKLP-  274

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
               L+GYTDVG  L ID +KSSY++      N HNLE +LHG+AG + +G    F L V+
Sbjct  275  --VLLGYTDVGENLAIDTTKSSYLRQGI---NAHNLEVHLHGVAGVQESG---EFKLEVD  326

Query  281  RDISLVNKSQDHLKEEYSIPGNWW-VEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            RDI+L+NK  D L+ +Y IP  WW  EK   MVQ   G W+ ++    Y+P PP
Sbjct  327  RDIALINKKIDGLQNKYKIPPEWWNHEKFKNMVQMYTGRWQFVDC--AYVPDPP  378



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 191/286 (67%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I GA    G+ P 
Sbjct  317  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAAGILGAEGADGSEPS  376

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRG+ +LY+S +  S  + +SAR QVL E+ R+++ YK+E+ SITV GHSLGA+LATLN
Sbjct  377  VHRGYLSLYTSADEGSEISKQSARMQVLTEIARMMDKYKDEQTSITVVGHSLGATLATLN  436

Query  647  AIDIATNGANTT---SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A+DIA N  N +   + G   PVT  V+ SPRTGD +F++++   P L +LR+RN PD +
Sbjct  437  AVDIAANYYNKSALCTAGSRAPVTAVVFGSPRTGDRDFRDIFHRLPGLRMLRVRNRPDRI  496

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  PP    +GY DVGVEL ID  +S ++KP  +    H+LE +LHGIAG +G      F
Sbjct  497  PLYPP----VGYADVGVELLIDTRRSLFLKPHGNESQSHDLECHLHGIAGWQGEH--GEF  550

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             LVV+RDI+LVNK  D L +E+ +P  W V  N  MV+  DGSW+ 
Sbjct  551  ELVVDRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGTDGSWRC  596



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/306 (51%), Positives = 196/306 (64%), Gaps = 30/306 (10%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLE----FLLVPAPEIFGAGASP-  831
            WMGYVA  TD GKT  GRRDI V WRGT+++LEWV+D +     L    P+  G      
Sbjct  116  WMGYVAHVTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETD  175

Query  830  -------QVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEE-VSITVCGHS  675
                   +V RG++++Y+SE+  S FN  SAR+QVL EVKRL+E YK+EE +SIT  GHS
Sbjct  176  KVLRNDVRVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHS  235

Query  674  LGASLATLNAIDIATNGANTTSDGKSFP--VTGFVYASPRTGDYNFKNVYDATPNLHLLR  501
            LGA+LATL A DI  NG N  S G++ P  VT  V+ASPR G+  FK V D  P+L +LR
Sbjct  236  LGATLATLCAFDIVINGLNKPS-GRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLR  294

Query  500  IRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTE  321
            + N PD+VP      P +GY +VGVEL +D  KS Y+K   D   WHNLE YLH +AGT+
Sbjct  295  VTNNPDLVP----LHPFLGYVEVGVELRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  320  GAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEG  141
            G      F L V+RDI+LVNKS D LK+EY +P +WWVEKN GMVQ +DG W        
Sbjct  351  GKN--GAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHW--------  400

Query  140  YIPRPP  123
            ++ +PP
Sbjct  401  FMAKPP  406



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 195/295 (66%), Gaps = 22/295 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-SPQVHR  819
            W+G+VAVATDEGK ALGRRDI++ WRGT    E   D ++ LV   +IFG    +  VH+
Sbjct  125  WIGFVAVATDEGKVALGRRDILIAWRGTKTKSEMNEDDKWSLVQPSKIFGENRDNILVHK  184

Query  818  GFYNLYSSENPDSAFN-IKSARDQ--VLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            GFY++Y+  N  S FN   SARDQ  VL E+KRL++ Y  EE+SI+V G S+G+SL TL 
Sbjct  185  GFYSVYTCLNEASNFNRTTSARDQRQVLEEIKRLLKQYSKEEISISVTGQSMGSSLGTLC  244

Query  647  AIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            AIDI  N  N     K FPVT F+++SPR G+ NFK  Y    NLH+LRI NVPD +P++
Sbjct  245  AIDIVVNEIN-----KEFPVTAFLFSSPRVGEANFKKAYRNLKNLHILRITNVPDPIPKL  299

Query  467  PPATPLIG--------YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAG  312
                 + G        Y DVG EL ID +KS Y+K   DI++ H LE YLHGIAGT G  
Sbjct  300  MERGQVEGCAITEWRAYEDVGFELVIDTTKSEYLKK--DIFS-HFLEVYLHGIAGTHG--  354

Query  311  VLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            V   F L +NRDI+LVNK  D LKEEY +P  WW+EKN GMVQQ+DGSW L+++E
Sbjct  355  VEGEFKLEINRDIALVNKQGDFLKEEYGVPSAWWIEKNKGMVQQEDGSWILIDHE  409



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/287 (50%), Positives = 194/287 (68%), Gaps = 12/287 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+G+VAVATDEGKTALGRRDI+V WRG+++ +EW+ D +F L  A  I G   +P  HR 
Sbjct  114  WIGFVAVATDEGKTALGRRDIVVAWRGSVQIVEWLKDFDFPLASASMIVGEKGNPYAHRC  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEV-KRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            + ++Y+S +P S FN +SARDQV   +  RLV+ YK+EE+SIT+ GHSLGA+L TL A D
Sbjct  174  WVSIYTSHDPKSRFNKQSARDQVYIYIPTRLVDKYKDEEISITITGHSLGAALGTLCAAD  233

Query  638  IATNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I  N  N   +   KS PVT F++ SPR GD NF+N+  +  NLHL+R+ NVPDIV  +P
Sbjct  234  IVANKFNKPKNKPQKSCPVTAFLFGSPRVGDLNFRNMLLSLENLHLIRVTNVPDIVTTLP  293

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P      Y++VG EL ID   S+++K       WH+LE +LHG+AGT+G+    GF L V
Sbjct  294  PEG---YYSEVGQELVIDTRFSNFLKFPGCYDTWHSLEAHLHGVAGTQGSK--GGFHLEV  348

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +R I+LVNK  D LK+EY +P +WW  +N GM     GSW+L ++E+
Sbjct  349  DRSIALVNKMLDALKDEYPVPASWWCMRNKGM----KGSWELKDHEK  391



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 147/293 (50%), Positives = 188/293 (64%), Gaps = 14/293 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            W+GYVAVATDEG   LGRRD++V WRGT++ LEW +D  F  V A  + G+ A+      
Sbjct  139  WIGYVAVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAAPVLGSAAAANPLAV  198

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH+GF ++Y+S N DS FN  SARDQVL EV+RL+ELYK E  SITV GHSLGA+LATLN
Sbjct  199  VHQGFLSVYTSSNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSLGAALATLN  258

Query  647  AIDIATNGANT---TSDGKSFPVTGFVYASPRTGDYNFKNVYDAT-PNLHLLRIRNVPDI  480
            A+DIA NG N    +S     PVT  ++A P  GD  F+  +     +L  L +RN  D+
Sbjct  259  AVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGYFRDLRALHVRNAGDV  318

Query  479  VPQVPPATPLIGYTDVGVE-LTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            VP VPP    + Y DV V  L ID S+S Y++        HNLE YLHG+AG +G+    
Sbjct  319  VPVVPP----LAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAGEQGSAA-G  373

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            GF L V+RD++LVNK  D L++EY +P NWWV +N  MV+  DG W L + EE
Sbjct  374  GFRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSDGHWVLKDFEE  426



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 191/292 (65%), Gaps = 22/292 (8%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLE----FLLVPAPEIFGAGAS--  834
            WMGYVA  TD GKT  GRRDI V WRGT+++LEWV+D +     L    P+  G      
Sbjct  116  WMGYVAHVTDTGKTQYGRRDITVAWRGTLQSLEWVNDFDPGQASLSTLLPDQTGLDRETD  175

Query  833  ------PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEE-VSITVCGHS  675
                   +V RG++++Y+SE+  S FN  SAR+QVL EVKRL+E YK+EE +SIT  GHS
Sbjct  176  KVLRNDARVQRGWFDIYTSEDSRSPFNKSSAREQVLREVKRLLEKYKDEEEISITTTGHS  235

Query  674  LGASLATLNAIDIATNGANTTSDGKSFP--VTGFVYASPRTGDYNFKNVYDATPNLHLLR  501
            LGA+LATL A DI  NG N  S G++ P  VT  V+ASPR G+  FK V D  P+L +LR
Sbjct  236  LGATLATLCAFDIVINGLNKPS-GRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRVLR  294

Query  500  IRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTE  321
            + N PD+VP      P +GY +VGVEL +D  KS Y+K   D   WHNLE YLH +AGT+
Sbjct  295  VTNNPDLVP----LHPFLGYVEVGVELPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  320  GAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSW  165
            G      F L V+RDI+LVNKS D LK+EY +P +WWVEKN GMVQ +DG W
Sbjct  351  GKN--GAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHW  400



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/293 (52%), Positives = 190/293 (65%), Gaps = 19/293 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ-VHR  819
            W+G+VAVATDEGK ALGRRDI++ WRGT+   EW  D +++LVP  +IFG       VHR
Sbjct  131  WIGFVAVATDEGKVALGRRDILIAWRGTMCPAEWNDDSDWVLVPPTKIFGENTHDTLVHR  190

Query  818  GFYNLYSSENPDSAFN-IKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            GFY++Y+S N  S FN   SARDQV+ EVKRLVE YK ++VSIT+ GHS+G+SL+TL AI
Sbjct  191  GFYSVYTSLNDASKFNRTASARDQVIEEVKRLVEQYKRDKVSITLSGHSIGSSLSTLCAI  250

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DI  N  N     K FPVT F++ASPRTG+ NFK  +    NL +LRI N  D VP+ P 
Sbjct  251  DIVVNKIN-----KEFPVTAFLFASPRTGEANFKKAHQHLKNLQILRITNALDEVPEKPD  305

Query  461  ATPLIG-------YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
               + G       Y  VG E+ ID +KS Y+K      N H+LE YLHGIAGT G     
Sbjct  306  RGQVEGSDTDWRVYEHVGYEVKIDTTKSEYLKKDV---NNHSLEVYLHGIAGTHGPE--G  360

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             F L + RDI+LVNK  D LK EY +P  W   +N GMVQQ+DGSW L + E+
Sbjct  361  EFKLEITRDIALVNKETDALKNEYGVPVYWRTVQNKGMVQQEDGSWILNDRED  413



>ref|XP_007014120.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY31739.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=428

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 147/295 (50%), Positives = 196/295 (66%), Gaps = 14/295 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W GYVAV TD+GK  LGRRDI+V WRGT+   E ++D++F    A E+FG    PQVH G
Sbjct  142  WFGYVAVTTDDGKAVLGRRDILVAWRGTMTDSESINDVQFFPTSASELFGEDNDPQVHSG  201

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F +LY+  + +S ++  SARDQV   V++LV+ Y++E++SITV G+SLGA+LATL+A+DI
Sbjct  202  FLSLYTGRSSNSPYSQTSARDQVREAVRKLVDKYQDEDISITVTGYSLGAALATLSAMDI  261

Query  635  ATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              +G N  T +  KS  VT F YA PR G+  FK V++   +LHLLRI N  DIVP++P 
Sbjct  262  VASGYNKPTGNSEKSCMVTTFTYAGPRVGNEGFKKVFEGLSDLHLLRITNSTDIVPKIP-  320

Query  461  ATPLIG-YTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
               L G YT VG EL ID +KS Y+K + D    HNL+ YLHG+AG +       F+L V
Sbjct  321  --ILFGIYTHVGEELEIDTTKSDYLKSNADA---HNLDVYLHGVAGVQETN--GDFTLEV  373

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNM-GMVQQDDGSWKLMNNEEGYIPRPP  123
            + DI+L+NK  D LK++Y IP  WW  +N   MVQ DDG WKL++N   Y+P PP
Sbjct  374  DHDIALINKHLDGLKDDYKIPPEWWNNENFKNMVQMDDGHWKLVDN--AYVPDPP  426



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/293 (50%), Positives = 188/293 (64%), Gaps = 15/293 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA----SPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+DL+F    A  + G  A    S  
Sbjct  127  WMGYVAVATDEGVAALGRRDIVVAWRGTVESLEWVNDLDFTPASAEPVLGPAAGDFDSAV  186

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF ++Y+S + DS FN +SARDQV  EV+RL+E +K E  SITV GHSLGASLATLN
Sbjct  187  VHHGFLSVYTSSDEDSKFNQQSARDQVTEEVRRLMEAHKEEATSITVTGHSLGASLATLN  246

Query  647  AIDIATNGANT----TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            A+D+ ++G N            PVT  ++ASP  GD +FK+ + + P+L  L +RN  D+
Sbjct  247  AVDMVSHGVNVPPSSPQQQPPCPVTAILFASPHVGDDSFKSAFASFPDLRALHVRNAGDV  306

Query  479  VPQVPPATPLIGYTDVGVE-LTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            VP  PP    +GY D     L +D  +S Y+K    +   HNLE YLHG+AG +GA    
Sbjct  307  VPLYPP----LGYVDAATAVLPVDTGRSPYLKQPGTVQTRHNLECYLHGVAGFQGAS--G  360

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            GF L V+RD++LVNK  D LK++Y +P NW V  N  MV+  DG WKL + EE
Sbjct  361  GFKLEVDRDVALVNKGADALKDKYPVPPNWHVINNKSMVRDSDGHWKLRDFEE  413



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 185/290 (64%), Gaps = 21/290 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK ALGRRDI+V WRGT+++LEW+ D++F++VP   +            
Sbjct  119  WIGYVAVATDEGKAALGRRDIVVAWRGTVQSLEWIKDMDFVMVPPKGLLRD---------  169

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
               L +  + +S+ N  SARDQVL EV +LV +Y++EE+SITV GHSLGA+LATLNA DI
Sbjct  170  --KLPTPWDSESSHNKDSARDQVLSEVAKLVSMYQDEELSITVTGHSLGAALATLNAFDI  227

Query  635  ATNGAN----TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATP--NLHLLRIRNVPDIVP  474
              NG N      +     PVT FV+ASPR G + FK  +D      L LLR+RN  D+VP
Sbjct  228  VENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGARGLGLRLLRVRNARDVVP  287

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            + PPA P   Y  VG EL ID  +S Y++   +   WHNLE YLHG+AG  G G    F 
Sbjct  288  RYPPAPP---YHGVGTELAIDTGESPYLRRPGNELVWHNLECYLHGVAGARG-GEAGRFK  343

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            L V RD++L NKS   L++E+++P  WW+  N GMV+  DG W LM+ EE
Sbjct  344  LAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTLMDREE  393



>gb|EMS63790.1| Phospholipase A1-II 7 [Triticum urartu]
Length=515

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 181/260 (70%), Gaps = 11/260 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRDI+V WRGT++ +EWV+DL+F  VPA  + G+ AS      
Sbjct  151  WMGYVAVATDEGAAALGRRDIVVAWRGTVQNMEWVNDLDFAPVPAAPVLGSAASQHRLAV  210

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF ++Y+S N  S F   SARDQV+ EV+RLVELYK+EEVSIT+CGHSLGAS+ATLN
Sbjct  211  VHHGFLSMYTSSNKSSEFTKTSARDQVVKEVRRLVELYKDEEVSITICGHSLGASVATLN  270

Query  647  AIDIATNGANTTSDG-KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+D+ ++G N      KSFPVT  V+ASP  G   F++ +++ P+L  L ++N  D+VP 
Sbjct  271  AVDLVSSGINKPEGSTKSFPVTAIVFASPHVGCRFFRSAFNSFPDLKTLHVQNAGDVVPM  330

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
             PP    +GY DV VELTI   +S Y++    +   HNLE YLHG+AG +G+    GF L
Sbjct  331  YPP----LGYVDVAVELTIRTIRSPYMRKPATVGTLHNLECYLHGVAGEQGSA--GGFKL  384

Query  290  VVNRDISLVNKSQDHLKEEY  231
             V+RDI+LVNK  D L +E+
Sbjct  385  EVDRDIALVNKGADALTDEH  404



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 184/285 (65%), Gaps = 24/285 (8%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDE K ALGRRDI+V WRGTI+  EWV +    L PAP IFG  +  Q+H G
Sbjct  114  WMGYVAVATDEAKEALGRRDIVVAWRGTIQGAEWVQNFNIDLDPAPLIFGPKSDVQLHNG  173

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FY+LY+S+N        SAR QVL E+ RLVELYKNEE+SITV GHSLG +LAT++++DI
Sbjct  174  FYSLYTSDNSSLPLADSSARKQVLNEISRLVELYKNEEISITVTGHSLGGALATISSMDI  233

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              N  N       K+ PVT F + SPR G+ NF+ ++    +L  L IRN  DIVP    
Sbjct  234  VANKFNIPKGQPQKTCPVTLFAFGSPRVGNSNFEKIFSDNNDLRALFIRNNNDIVPS---  290

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                          ++  + S Y+K      + HN+E YLHGIAGT+G+    GF+L VN
Sbjct  291  --------------SLRLAYSKYLKSGV---SEHNMEVYLHGIAGTQGSK--GGFNLEVN  331

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDI+L+NKS D LK+EY IP NW V +N GMVQQ DG+WKLM++ 
Sbjct  332  RDIALLNKSNDGLKDEYHIPENWRVVENKGMVQQSDGTWKLMDDH  376



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   271 bits (694),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 188/308 (61%), Gaps = 30/308 (10%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRD++V WRGT+R+LEWV+DL+F  VPA  + G+ A+      
Sbjct  122  WMGYVAVATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAM  181

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH GF +LY+S N  S +N  SARDQVL EV+RL+ELYK+EE SI+V GHSLGASLATLN
Sbjct  182  VHGGFLSLYTSSNASSKYNKLSARDQVLEEVRRLMELYKDEETSISVTGHSLGASLATLN  241

Query  647  AIDIATNGANT--------------------TSDGKSFPVTGFVYASPRTGDYNFKNVYD  528
            A+D+  NG N                            PVT  V+ASPR G   FK  + 
Sbjct  242  AVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRAGCPVTAIVFASPRVGGPFFKAAFA  301

Query  527  ATPNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEG  348
            +  +L  L +RN  D+VP  PP    +GY DV V L I  ++S +++        HNLE 
Sbjct  302  SFADLRALHVRNKGDVVPLYPP----LGYVDVAVPLPIHTARSPWLRRPGTPQTLHNLEC  357

Query  347  YLHGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGS  168
            YLHG+AG +GA    GF L V RD++LVNK  D L++EY +P  W V  N GMV+  DG 
Sbjct  358  YLHGVAGEQGAA--GGFRLEVGRDVALVNKGADALRDEYPVPARWRVALNKGMVRGADGR  415

Query  167  WKLMNNEE  144
            W L + E 
Sbjct  416  WALKDFEH  423



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 192/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  114  WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174  ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  233

Query  644  IDIATN---GANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D   N       +   +   VT F + SPR GD +FK + ++  +LH+LR+ NVPD++P
Sbjct  234  ADFLHNELPKITPSLQHRLTCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            +     P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F 
Sbjct  294  RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  347

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            L + RDI+LVNK  D L+++Y +PG+WWV +N GMVQ DDG+WKL
Sbjct  348  LEIKRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  392



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/286 (50%), Positives = 191/286 (67%), Gaps = 13/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  834
            W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F           
Sbjct  114  WLGYIAVATDEGKKLLGRRDIVVAWRGTIQLYEWANDFDFPLELAVSVFPRIDPNDPNDP  173

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P+V  G+ +LY+S +P S F+  SAR+QV GE+KRL+ LYK+EEVSIT+ GHSLGA L+ 
Sbjct  174  PRVANGWLSLYTSTDPRSRFDKTSAREQVQGELKRLLALYKDEEVSITLTGHSLGAVLSI  233

Query  653  LNAIDIATNG-ANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            L+A D   N         K   VT F + SPR GD NFK + ++   L++LRI NVPD++
Sbjct  234  LSAADFLQNEWPKIPPQNKVSCVTVFAFGSPRIGDLNFKRLVESFKPLNILRIANVPDLI  293

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P+     P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F
Sbjct  294  PRY----PVFRFTDVGEELQINTLKSEYLKRSLNLKHFHNLEAYLHGVAGTQHNQT--EF  347

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L +NRDI+LVNK  D L+++Y +PGNWWV +N GM+Q+ DG+WKL
Sbjct  348  KLEINRDIALVNKGLDALQDKYLVPGNWWVLENKGMIQKADGTWKL  393



>gb|KDP46903.1| hypothetical protein JCGZ_24112 [Jatropha curcas]
Length=402

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/299 (51%), Positives = 202/299 (68%), Gaps = 16/299 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGASPQVHR  819
            W  YVA ATD+GK  LGRRDI+V WRGTI   E ++DLEF+ +PA +IF      P +H 
Sbjct  112  WCAYVAGATDDGKKKLGRRDIVVSWRGTILPGEKLNDLEFIPIPASDIFPNNNNDPLIHF  171

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            GF+ +Y++EN +S +N KSARDQVL  V +LV+ YK+EEVSITV GHSLG++LATLNA+D
Sbjct  172  GFHRIYTTENDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMD  231

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I   G N  T +  KSFPVT  V+ASP  G+  FK V+D   ++H+LR+ N  D VP++P
Sbjct  232  IVYKGINKPTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENANDPVPKLP  291

Query  464  PATPLI---GYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            P   LI    Y  VG  L ID + S ++K ++D+ N H+L  YLHG+AGT+G+    GF+
Sbjct  292  PNDILIPQHRYYHVGESLPIDTTLSPFLK-TSDV-NPHDLNVYLHGVAGTQGSK--GGFN  347

Query  293  LVVNRDISLVNKSQDHLKEE--YSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            L    D +L+NK+ D L E+  Y+IP NWWVE+N GMV QDDG++K     E YIP  P
Sbjct  348  LDYPLDTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTYK----AEFYIPDAP  402



>ref|XP_006655614.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-II 7-like [Oryza 
brachyantha]
Length=416

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 184/295 (62%), Gaps = 17/295 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRDI+V WRGT+ +LEWV+DL+F  VPA  + G  A+      
Sbjct  127  WMGYVAVATDEGVAALGRRDIVVAWRGTMESLEWVNDLDFTPVPAAPVLGPAAAANPLAI  186

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF ++Y+S N DS +N  SARDQVL EV+RL+E YK+E  SITV GHSLGASLATLN
Sbjct  187  VHRGFLSVYTSSNKDSKYNQSSARDQVLEEVRRLMEQYKDEVTSITVIGHSLGASLATLN  246

Query  647  AIDIATNGANTTSDGKS---FPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
            A+DI  NGAN+   G S    P              +FK  + + P+L  L ++N  D+V
Sbjct  247  AVDIVANGANSPPAGSSQPPCPXXXXXXXXXXXAPGHFKAAFASFPDLRALHVKNAGDVV  306

Query  476  PQVPPATPLIGYTDVGVELTIDF----SKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGV  309
            P  PP    +GY DV V+L +       +S Y++    I   HNLE YLHG+AG +G+  
Sbjct  307  PMYPP----LGYVDVAVKLPVKLPISTGRSPYLRSPGTIETLHNLECYLHGVAGEQGSA-  361

Query  308  LDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
              GF L V+RD++L NK  D LK++Y +P  WWV KN  M    DG W L + ++
Sbjct  362  -GGFKLEVDRDVALANKGADALKDQYPVPPGWWVPKNNCMAMGPDGHWSLHDFKQ  415



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 183/285 (64%), Gaps = 41/285 (14%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV  D+G  ALGRRDI                                   VH+G
Sbjct  144  WIGYVAVTDDQGTAALGRRDI-----------------------------------VHQG  168

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            +Y++Y S++  S FN  +ARDQVL E+ RL+E YK+E++SI++CGHSLGA++ATLNA DI
Sbjct  169  WYSIYMSKDERSPFNKANARDQVLREIGRLLEKYKDEKISISICGHSLGAAIATLNAADI  228

Query  635  ATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
              NG N   +   KS PVT FV+ASPR GD +FK ++    +L +LR+RN+PD+VP  PP
Sbjct  229  VANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVVPIYPP  288

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                +GY +VG EL ID  KS Y+K   D+  +H LE YLHG+AGT+G    D F L V 
Sbjct  289  ----LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLAGTQGTSKADLFRLDVK  344

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            RDI LVNKS D LK+EY +PG+W + KN GMVQQ+DGSWKLM++E
Sbjct  345  RDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDGSWKLMDHE  389



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 187/306 (61%), Gaps = 29/306 (9%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQ---------------VLGEVKRLVELYKNEEVSI  693
            VHRG+ +LY+SE+  S  N +SAR Q               VL E+ RL++ YK+EE SI
Sbjct  168  VHRGYLSLYTSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSI  227

Query  692  TVCGHSLGASLATLNAIDIATNGANTTSDGKS----FPVTGFVYASPRTGDYNFKNVYDA  525
            TV GHSLGA+LATLNA DIA N  NT+S   S     PVT  V+ SPRTGD  F++ +  
Sbjct  228  TVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHR  287

Query  524  TPNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGY  345
              +L +LR+RN PD +P  PP    +GY DVGVEL ID   S +++        H+LE +
Sbjct  288  LRDLRMLRVRNRPDRIPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECH  343

Query  344  LHGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSW  165
            LHG+AG  G     GF LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W
Sbjct  344  LHGVAGWHGDH--RGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRW  401

Query  164  KLMNNE  147
             L ++E
Sbjct  402  VLQDHE  407



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 187/306 (61%), Gaps = 29/306 (9%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA----GASPQ  828
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  I G     G  P 
Sbjct  108  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAPASAAGILGPEGADGTDPS  167

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQ---------------VLGEVKRLVELYKNEEVSI  693
            VHRG+ +LY+SE+  S  N +SAR Q               VL E+ RL++ YK+EE SI
Sbjct  168  VHRGYLSLYTSEDQCSELNKQSARMQNKKLGFDPMRQTLKKVLTEIARLMDKYKDEETSI  227

Query  692  TVCGHSLGASLATLNAIDIATNGANTTSDGKS----FPVTGFVYASPRTGDYNFKNVYDA  525
            TV GHSLGA+LATLNA DIA N  NT+S   S     PVT  V+ SPRTGD  F++ +  
Sbjct  228  TVIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHR  287

Query  524  TPNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGY  345
              +L +LR+RN PD +P  PP    +GY DVGVEL ID   S +++        H+LE +
Sbjct  288  LRDLRMLRVRNRPDRIPHYPP----VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECH  343

Query  344  LHGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSW  165
            LHG+AG  G     GF LVV+RD++LVNK  D L +EY +P  W V  N  MV+  DG W
Sbjct  344  LHGVAGWHGDH--RGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRW  401

Query  164  KLMNNE  147
             L ++E
Sbjct  402  VLQDHE  407



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/285 (49%), Positives = 191/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  123  WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  182

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  183  ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  242

Query  644  IDIATN---GANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D   N       +   +   VT F   SPR GD +FK + ++  +LH+LR+ NVPD++P
Sbjct  243  ADFLHNELPKIRPSLQHRLTCVTVFALGSPRIGDRSFKRLVESLQHLHILRVTNVPDLIP  302

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            +     P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F 
Sbjct  303  RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  356

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            L + RDI+LVNK  D L+++Y +PG+WWV +N GMVQ DDG+WKL
Sbjct  357  LEIKRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  401



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F    A A+P++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVKDAKANPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +  S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDSRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D      N  N +   K  P+T F + SPR GD +FK + D+   +++LRI NVPD+ P
Sbjct  234  ADFVYGKNNKTNISLPKKQVPITVFAFGSPRIGDQDFKKIVDSLQQINILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGT-EGAGVLDGF  297
                  PL+ Y ++G  L I+   S+Y+K S +  N+HNLE YLHG+AG  + AGV   F
Sbjct  294  HY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMKDTAGV---F  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L + RDISLVNK  D LK+EY +P  W    N GMVQ DDG+WKL
Sbjct  347  KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMDDGTWKL  392



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 193/288 (67%), Gaps = 15/288 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  834
            W+GY+AVATD+GK  LGRRDI+V WRGTI+  EW +D +F L PA  +F           
Sbjct  114  WLGYIAVATDQGKELLGRRDIVVAWRGTIQLYEWANDFDFPLEPAISVFPKTDPNDPSDP  173

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P++  G+ +LY++ +P S F+  SA++QV GE+KRL+ELYK+EEV+IT+ GHSLGA L+ 
Sbjct  174  PRIANGWLSLYTTADPRSRFDKTSAQEQVQGELKRLLELYKDEEVTITLTGHSLGAVLSI  233

Query  653  LNAIDIATN---GANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPD  483
            L+A D   N      T+   +   VT F + SPR GD NFK + ++   L++LRI NVPD
Sbjct  234  LSATDFLHNEWPKTTTSLQDRLSCVTVFAFGSPRIGDLNFKRLVESLKKLNILRISNVPD  293

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            ++P+     P+  + D+G EL I+  KS Y+K S +I ++HNLE YLHG+AGT+      
Sbjct  294  LIPRY----PVFRFADIGEELQINTLKSEYLKRSLNIKHFHNLEAYLHGVAGTQQNQ--G  347

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             F L +NRDI+LVNK  D L+++Y +P +WWV +N GMVQ+DDG+W L
Sbjct  348  EFKLEINRDIALVNKGLDALEDKYLVPDHWWVLENKGMVQRDDGTWML  395



>gb|KDP46901.1| hypothetical protein JCGZ_24110 [Jatropha curcas]
Length=403

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 198/297 (67%), Gaps = 17/297 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGASPQVHR  819
            W  YVAVATD+GK  LGRRDI+V WRGTI   E + D+EF+ +PA ++F      P +H 
Sbjct  112  WCAYVAVATDDGKKKLGRRDIVVSWRGTILPGEKLEDVEFIPIPASDMFPNNNNDPLIHS  171

Query  818  GFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAID  639
            GF+ +Y++E  +S +N KSARDQVL  V +LV+ YK+EEVSITV GHSLG++LATLNA+D
Sbjct  172  GFHQIYTTEKDNSIYNKKSARDQVLNAVSKLVDQYKDEEVSITVTGHSLGSALATLNAMD  231

Query  638  IATNGAN--TTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            I   G N  T +  KSFPVT  V+ASP  G+  FK V+D   ++H+LR+ N  D VP +P
Sbjct  232  IVYKGINKPTGTANKSFPVTAIVFASPMVGNEGFKKVFDELSDIHVLRVENAKDPVPTLP  291

Query  464  P----ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P      P   Y  VG  L ID + S ++K ++D+ N H+L  YLHG+AGT+G+    GF
Sbjct  292  PNKLIVIPQHRYYHVGESLPIDTTLSPFLK-TSDV-NPHDLNVYLHGVAGTQGSK--GGF  347

Query  296  SLVVNRDISLVNKSQDHLKEE--YSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIP  132
            +L    D +L+NK+ D L E+  Y+IP NWWVE+N GMV QDDG++K     E YIP
Sbjct  348  NLDYPLDTALINKTVDGLNEKHNYNIPPNWWVEENNGMVLQDDGTYK----AEFYIP  400



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score =   267 bits (683),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 196/284 (69%), Gaps = 11/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF-GAGAS--PQV  825
            W+GY+AVATDEGK  LGRR I+V WRGTI+  EW +D +F L  A  +F GA  +  P+V
Sbjct  114  WLGYIAVATDEGKKLLGRRGIVVAWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRV  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ +LY+S +P S F+  SA++QV  E+KRL+ELYKNE+V+IT+ GHSLGA ++ L+A
Sbjct  174  ANGWLSLYTSTDPRSRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSA  233

Query  644  IDIATNG--ANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
             D   N     T S   S  VT F + SP+ GD +FK + ++  +LH+LR+ NVPD++P+
Sbjct  234  ADFLHNEWPKITPSLQHSLCVTVFAFGSPQIGDRSFKRLVESLEHLHILRVTNVPDLIPR  293

Query  470  VPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL  291
                 P+  +TD+G EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F L
Sbjct  294  Y----PVFRFTDIGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFKL  347

Query  290  VVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             +NRDI+LVNK  D L+++Y +PG+WWV +N GMVQ DDG+WKL
Sbjct  348  EINRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL  391



>gb|EMS48809.1| Phospholipase A1-II 6 [Triticum urartu]
Length=454

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 182/282 (65%), Gaps = 33/282 (12%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASPQVH  822
            W+GYVAVATD GK+ALGRRD++V WRGTI+ L+W +DLEF +V    I G   GA   VH
Sbjct  125  WIGYVAVATDAGKSALGRRDVVVAWRGTIQALQWTNDLEFAMVHPTGIIGDATGADVMVH  184

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            RG+ ++Y+S +P S  N +SAR    G+V++LV  YK+EEVSITV GHSLGA+LATL+A 
Sbjct  185  RGWLSIYTSTDPASTHNKESAR----GQVRKLVGTYKDEEVSITVTGHSLGAALATLSAF  240

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DIA NG N T+   +FPVT F +ASPR G  +FK                      Q  P
Sbjct  241  DIAENGYNCTASA-TFPVTAFAFASPRVGGASFK----------------------QRSP  277

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
            A P   Y DVGVEL ID S S Y+K   D+  WHNLE YLHG+AG   A   +GF  VV 
Sbjct  278  ALP---YHDVGVELVIDTSASPYLKAPGDVNVWHNLECYLHGVAGAPTASG-EGFEHVVE  333

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLM  156
            RD++LVNKS D LKEE+ +P  WWV  N GMV+ DDG W L+
Sbjct  334  RDVALVNKSYDALKEEHGVPAAWWVPWNRGMVKGDDGRWSLL  375



>ref|XP_002522552.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39852.1| triacylglycerol lipase, putative [Ricinus communis]
Length=403

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/298 (50%), Positives = 186/298 (62%), Gaps = 15/298 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            ++G+VAV+TDEGK  LGRRDIIVCWRGT   +EW  D+    VPA +IF   +   VH G
Sbjct  104  FVGFVAVSTDEGKLVLGRRDIIVCWRGTTLPIEWFQDILCDQVPATDIF-PDSEALVHNG  162

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY----KNEEVSITVCGHSLGASLATLN  648
            FYN+Y++++  S +N  S R+QVL  V+RLV+ +     NE VSITV GHSLGA+LATLN
Sbjct  163  FYNMYTAKDSTSTYNKMSVREQVLAAVRRLVDKHYEAGSNEVVSITVIGHSLGAALATLN  222

Query  647  AIDIATNGANT-TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+DI  N  N  T      PV  FV+ SPR GD  F +V+    NLHLLRIRN  D +P+
Sbjct  223  AVDIVANEYNRPTGSTVELPVASFVFGSPRVGDKGFLDVFSGLKNLHLLRIRNAQDFIPE  282

Query  470  VPPATPL-IGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            +PP   L   Y DVG EL ID S S Y+K +T     H+L  Y HGI+G +G      F 
Sbjct  283  LPPKKILGYSYADVGAELDIDTSLSPYIKKAT-FMEPHDLNLYCHGISGYQGKD--RKFK  339

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVE-KNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            L V+ D++LVNK  D L E+Y +P  WW    N GM Q DDGSWKL +    Y+P PP
Sbjct  340  LAVDFDLALVNKYNDLLLEDYKVPPKWWSNVMNKGMAQMDDGSWKLHD----YVPDPP  393



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F       +P++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +  S ++  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     N  N     K  P+T F + SPR GD+NFKNV D+   L++LRI NVPD+ P
Sbjct  234  ADLVYGKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG-F  297
                  PL+ Y+++G  L I+   S+Y+K S +  N+HNLE YLHG+AG +     DG F
Sbjct  294  HY----PLLLYSEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDT---DGVF  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L + RDISLVNK  D LK+EY +P  W    N GM+Q DDG+WKL
Sbjct  347  KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMLQMDDGTWKL  392



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/298 (46%), Positives = 188/298 (63%), Gaps = 11/298 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGA-------  837
            WMGYVAV+TD    A GRR+I V WRGTIRTLEWV  LE  L+P   I  +         
Sbjct  115  WMGYVAVSTDAAARATGRREIYVAWRGTIRTLEWVDVLEPELLPVDSILSSKKEATAEEE  174

Query  836  SPQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLA  657
             P+V +G++ +Y+S NP+S++N +SAR+Q++ ++K LVE+YK+E +SI   GHSLGA+LA
Sbjct  175  KPKVMKGWFVIYTSSNPNSSYNTQSAREQLVAKIKELVEVYKDESLSIVCVGHSLGAALA  234

Query  656  TLNAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
             L+A DI  NG +   D + FPV   V+ SP+ G+  F +  +  PNL +L +RN  D++
Sbjct  235  ILSAFDIVENGLSKVGDKEEFPVCAMVFGSPQIGNKAFNDRLEKLPNLRVLHVRNKIDLI  294

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            P  P    L+G+ + G  L ID  KS Y+K S    +WHNL+G LH +AG  G      F
Sbjct  295  PLYPSG--LLGFVNTGTVLEIDTRKSPYLKDSRFPGDWHNLQGILHVVAGWNGDE--GEF  350

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
             L V R + LVNKS ++LK+EY +PG+WWVEKN GMV ++DG W L    +   P PP
Sbjct  351  ELKVKRSVGLVNKSSEYLKDEYLVPGSWWVEKNKGMVLEEDGEWVLAAPTDEDAPVPP  408



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 191/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            W+GYVAVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F       +P++
Sbjct  114  WLGYVAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLETAETVFPQANPNDTPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ +LY+S +  S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174  ANGWLSLYTSTDQRSRFDKTSAREQVQGELNRLLELYKDEEVTITITGHSLGAVLSILSA  233

Query  644  IDIATNGA---NTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D   N +     +   +   VT F + SPR GD +FK + ++  +LH+LR+ NVPD++P
Sbjct  234  ADFLYNESLKIRPSLQHRLSCVTVFAFGSPRIGDRSFKRLVESLEHLHILRVTNVPDLIP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
                  P+  +TDVG +L I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F 
Sbjct  294  HY----PVFRFTDVGEDLQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHDQ--GEFK  347

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            L +NRDI+LVNK  D L ++Y +PG+WWV +N  MVQ DDG+WKL
Sbjct  348  LEINRDIALVNKGLDALDDKYLVPGHWWVLENKRMVQSDDGTWKL  392



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 191/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  834
            W+GY AV+TDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F           
Sbjct  114  WLGYTAVSTDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDP  173

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA L+ 
Sbjct  174  PRIANGWLSLYTTSNTHSRFDKTSAKEQVQGELKRLLELYKHEEISITFTGHSLGAVLSI  233

Query  653  LNAIDIATNG--ANTTSDGKSFP-VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPD  483
            L+A D   N     TTS G +   VT F + SPR GD NF+ + ++   L++LRI NVPD
Sbjct  234  LSATDFLHNEWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            ++P      P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+      
Sbjct  294  LIPHY----PVFRFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             F L +NRDI+LVNK  D L+++Y +PG+WWV +N GMVQ DDG+W L
Sbjct  348  EFKLEINRDIALVNKELDALQDKYLVPGHWWVLENRGMVQADDGTWIL  395



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   266 bits (681),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L PA  +F       +P++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLEPAISVFPVTDPKDNPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +  S ++  SA++QV GE+KRL+ELYK+EE+SIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKDEEISITFTGHSLGAVMSVLSA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     N  N     K  P+T F + SPR GD+NFKNV D+   L++LRI NVPD+ P
Sbjct  234  ADLVYGKKNNININLQKKQVPITVFAFGSPRIGDHNFKNVVDSLQPLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG-F  297
                  PL+ Y+++G  L I+   S+Y+K S +  N+HNLE YLHG+AG +     DG F
Sbjct  294  HY----PLLLYSEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDT---DGVF  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L + RDISLVNK  D LK+EY +P  W    N GM+Q DDG+WKL
Sbjct  347  KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMLQMDDGTWKL  392



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   267 bits (682),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 186/285 (65%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLL---VPAPEIFGAGASPQV  825
            W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L   V    +F +   P++
Sbjct  152  WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRI  211

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  212  GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  271

Query  644  IDIATNGANTTSDG---KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     NT S G   K  P+T F +  PR GD +F  + D+   L++LRI NVPD+ P
Sbjct  272  ADLVNGKKNTISSGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  331

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
                  PL+ Y +VG EL I+   S+Y+K S +  N+HNLE YLHG+AG +    L  F 
Sbjct  332  HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL--FK  385

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            LV+ RDISLVNK  D LK+E+ +P  W    N GMVQ+DDG+W+L
Sbjct  386  LVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  430



>gb|KHG20660.1| Phospholipase A1-IIgamma -like protein [Gossypium arboreum]
Length=383

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 183/294 (62%), Gaps = 13/294 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            + GYVAVATDEGK  LGRRDI+V WRGTI   EWVSD       A ++FG G S +VH G
Sbjct  98   YFGYVAVATDEGKVVLGRRDILVSWRGTITISEWVSDANIFRTSAKDLFGTG-SVKVHTG  156

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            FYN Y + N +S +   SAR Q    VK LV+ Y+NEEVSITV GHSLGA+LATLNA+DI
Sbjct  157  FYNTYMNSNANSPYTKTSARQQACKAVKELVDKYQNEEVSITVTGHSLGAALATLNAMDI  216

Query  635  ATNGANTTSD--GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            A NG N  +D   K+F VT F+ ASPR G+  FK V D   N H+LRI N  D VP+VP 
Sbjct  217  AHNGFNKPTDNTNKAFMVTCFLAASPRVGNLAFKGVCDRLENFHILRIVNYKDPVPKVPF  276

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVN  282
                  Y  VG EL ID +KS Y+K      N HNLEGY HGIAG +           ++
Sbjct  277  GPK---YFHVGEELEIDTTKSPYLKEKI---NPHNLEGYQHGIAGMQKDRDFK-LEEELD  329

Query  281  RDISLVNKSQDHLKEEYSIPGNWWVEKNM-GMVQQDDGSWKLMNNEEGYIPRPP  123
             D +++NKS D L ++Y IP NWW ++    MVQ DDG WK   N+  Y+P PP
Sbjct  330  FDNAVINKSSDGLLDKYKIPDNWWTQELFKNMVQTDDGHWKF--NDTAYVPDPP  381



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 190/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF------GAGAS  834
            W+GY AV+TDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F           
Sbjct  114  WLGYTAVSTDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPPTDPNDPNDP  173

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK EE+SIT  GHSLGA L+ 
Sbjct  174  PRIANGWLSLYTTSNTHSRFDKTSAQEQVQGELKRLLELYKQEEISITFTGHSLGAVLSI  233

Query  653  LNAIDIATNG--ANTTSDGKSFP-VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPD  483
            L+A D   N     TTS G +   VT F + SPR GD NF+ + ++   L++LRI NVPD
Sbjct  234  LSATDFLHNEWPKTTTSLGDTLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            ++P      P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+      
Sbjct  294  LIPHY----PVFRFTDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             F L +NRDI+LVNK  D L+++Y +PG+WWV +N GMVQ DDG+W L
Sbjct  348  EFKLEINRDIALVNKELDALQDKYLVPGHWWVLENRGMVQADDGTWIL  395



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 186/285 (65%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L    ++F    S   P++
Sbjct  114  WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVIDSKIVPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  174  GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  233

Query  644  IDIATNGANTTSDG---KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     NT S G   K  P+T F +  PR GD +F  + D+   L++LRI NVPD+ P
Sbjct  234  ADLVNGKKNTISSGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
                  PL+ Y +VG EL I+   S+Y+K S +  N+HNLE YLHG+AG +    L  F 
Sbjct  294  HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL--FK  347

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            LV+ RDISLVNK  D LK+E+ +P  W    N GMVQ+DDG+W+L
Sbjct  348  LVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  392



>ref|XP_007210039.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
 gb|EMJ11238.1| hypothetical protein PRUPE_ppa017270mg [Prunus persica]
Length=376

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/284 (49%), Positives = 176/284 (62%), Gaps = 10/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAVATDEGK  LGRRDI+V WRGT    EW  D+ F LV A +I G    P+VH G
Sbjct  98   WLGYVAVATDEGKKVLGRRDILVSWRGTELVAEWGIDVVFDLVSASDILGEKHDPKVHHG  157

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++ Y+  +P S  N  S R Q L  +K +V  YKNE +SITV GHS+GA++  LNA DI
Sbjct  158  FHSYYTHIDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDI  217

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N        PVT  V+A+PR GD    NV+    NLH+LR+ N  D++P +P   
Sbjct  218  VYNGYNKPPGHPVCPVTAIVFAAPRLGDQGLSNVFYGLKNLHVLRVTNDYDLIPSLP---  274

Query  455  PLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
            P   Y  VG EL  D  KS Y+K P   +   H+LE YLHG+AGT+G    + F L V R
Sbjct  275  PFANYLHVGKELRFDTFKSPYLKDPKQSL---HSLEVYLHGVAGTQGE---NDFKLAVKR  328

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            D++LVNK  D LK++Y +   WW EKN  M+Q DDGSW LM++E
Sbjct  329  DLALVNKYLDGLKDKYLVVAKWWTEKNKSMLQIDDGSWVLMDHE  372



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 191/285 (67%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            W+GY+AVATDEGK  LGRRDI+V WRGTI+  EW +D +F L  A  +F        P+V
Sbjct  114  WLGYIAVATDEGKRLLGRRDIVVAWRGTIQLYEWANDFDFPLESAETVFPRATPNDPPRV  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ +LY+S +P S F+  SAR+QV GE+ RL+ELYK+EEV+IT+ GHSLGA L+ L+A
Sbjct  174  ANGWLSLYTSTDPRSRFDKTSAREQVQGELNRLLELYKDEEVTITLTGHSLGAVLSILSA  233

Query  644  IDIATN---GANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D   N       +   +   VT F + SPR GD +FK + ++  +LH+LR+ NVPD++P
Sbjct  234  ADFLHNEFPKITPSLQQRLSCVTVFAFGSPRIGDRSFKRLVESFQHLHILRVTNVPDLIP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            +     P+  +TDVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+       F 
Sbjct  294  RY----PVFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQ--GEFK  347

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            L + RDI+LVNK  D L+++Y +PG+ WV +N GMVQ DDG+WKL
Sbjct  348  LEIKRDIALVNKGLDALEDKYLVPGHGWVLENKGMVQSDDGTWKL  392



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 188/301 (62%), Gaps = 22/301 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            W+GYVAVATDEG   LGRRD++V WRGT++ LEW +D  F  V A  + G+ A+      
Sbjct  150  WIGYVAVATDEGAAELGRRDVVVAWRGTVKDLEWANDFTFTPVSAVPVLGSAAAANPLAV  209

Query  827  VHRGFYNLY--------SSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSL  672
            VH+GF ++Y        +S N DS FN  SARDQVL EV+RL+ELYK E  SITV GHSL
Sbjct  210  VHQGFLSVYQLSSLTLTTSCNADSRFNKASARDQVLEEVRRLMELYKGEATSITVVGHSL  269

Query  671  GASLATLNAIDIATNGANT---TSDGKSFPVTGFVYASPRTGDYNFKNVYDAT-PNLHLL  504
            GA+LATLNA+DIA NG N    +S     PVT  ++A P  GD  F+  +  +  +L  L
Sbjct  270  GAALATLNAVDIAANGLNEGSGSSQQLPCPVTAILFACPHVGDRFFRAAFVGSFRDLRAL  329

Query  503  RIRNVPDIVPQVPPATPLIGYTDVGVE-LTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAG  327
             +RN  D+VP VPP    + Y DV V  L ID S+S Y++        HNLE YLHG+AG
Sbjct  330  HVRNAGDVVPLVPP----LAYVDVAVAVLPIDTSRSPYLRSPGPAGTLHNLECYLHGVAG  385

Query  326  TEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             + +    GF L V+RD++LVNK  D L++EY +P NWWV +N  MV+  +G W L + E
Sbjct  386  KQSSAA-GGFRLEVDRDVALVNKGADALRDEYPVPANWWVPENRWMVRGSEGHWMLKDFE  444

Query  146  E  144
            E
Sbjct  445  E  445



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/288 (52%), Positives = 190/288 (66%), Gaps = 10/288 (3%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFG--AGASP--Q  828
            W+GYVAVATDEG   LGRRDI+V WRGT+  LEW +D  F  V A  + G  A A+P   
Sbjct  138  WIGYVAVATDEGVAELGRRDIVVAWRGTVTDLEWANDFSFTPVSAAPVLGSSAAANPLAM  197

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VH+GF ++Y+S N +S +N  SARDQV  EV+RL++LYK+EE SIT+ GHSLGA+LA LN
Sbjct  198  VHQGFLSVYTSSNANSKYNKASARDQVFEEVRRLMQLYKDEETSITITGHSLGAALAVLN  257

Query  647  AIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQV  468
            A+DIA NG N  S     PVT  V+A P  GD +FK  +D+  +L  L ++N  D+VP V
Sbjct  258  AVDIAANGLNAASSQPPCPVTAVVFACPHVGDRSFKAAFDSFEHLRALHVKNAGDVVPIV  317

Query  467  PPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLV  288
            PP      Y DVGV L ID  +S Y+K    +   HNLE YLHG+AG +G     GF L 
Sbjct  318  PPVV----YVDVGVLLAIDTGRSPYLKKPGTVQTLHNLECYLHGVAGEQGRA--GGFKLE  371

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            V+RD++LVNK  D L++EY +P NWWV KN  MV+  DG WKL + +E
Sbjct  372  VDRDVALVNKGVDALEDEYPVPANWWVPKNKWMVRGADGHWKLEDFKE  419



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 189/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS---PQV  825
            WMGY+AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F        P++
Sbjct  114  WMGYIAVATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAASVFPVTDPKDVPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ + +S ++  SA++QV GE+ RL+ELYKNEE+SIT  GHSLG  ++TL A
Sbjct  174  GSGWLDIYTASDSNSPYDTTSAQEQVQGELTRLLELYKNEEISITFTGHSLGGVMSTLAA  233

Query  644  IDIATNGANTTSDG---KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+  N  NT + G   K+ P+T F +  PR GD +FK + D+   +++LRI NVPD+ P
Sbjct  234  ADLVHNRKNTINTGLQKKTVPITVFAFGCPRIGDQDFKKLVDSLQQINILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEG-AGVLDGF  297
                  PL+ Y +VG EL I+   S+Y+K S +  N+HNLE YLHG+AG +  AGV   F
Sbjct  294  HY----PLLLYAEVGEELQINTLNSTYLKRSLNFRNYHNLEIYLHGLAGMQDRAGV---F  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            +L V RD+SLVNK  D LK+EY +P  W    N GMVQ DDG+W+L
Sbjct  347  TLQVGRDVSLVNKGLDALKDEYLVPSIWRCLANKGMVQMDDGTWQL  392



>gb|KDP21071.1| hypothetical protein JCGZ_21542 [Jatropha curcas]
Length=407

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/298 (47%), Positives = 194/298 (65%), Gaps = 16/298 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            + G+VAV TDEGK   GRRDI+VCWRGT  T+EW  D + +     ++F      +VH G
Sbjct  104  YFGFVAVTTDEGKIVTGRRDIVVCWRGTSFTIEWFKDFDHIFTSGSDLF-PDTDAKVHNG  162

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKR--LVELYKNEEVSITVCGHSLGASLATLNAI  642
            F+++Y++   DS +N +SAR+QVL   +R    ++   E+VSIT+ GHSLG++LATLNA+
Sbjct  163  FHSVYTTSKSDSTYNKRSAREQVLAAARRNGDKDVALKEDVSITITGHSLGSALATLNAM  222

Query  641  DIATNGANTTSDGKS-FPVTGFVYASPRTGDYNFKNVYDATPN---LHLLRIRNVPDIVP  474
            DIA NG N  S   + +PVT FV+ASPR G+  F++V++   +   LHLLRIRN  DIVP
Sbjct  223  DIAFNGYNKPSGSDTGYPVTAFVFASPRVGNKEFQDVFNGLQDAGTLHLLRIRNYNDIVP  282

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            ++PP      Y DVGVEL +D +KS Y+K  + I   H+L  Y+HG+AG +G    + F 
Sbjct  283  ELPPKILDFTYEDVGVELYLDTTKSPYIKGES-ITEAHDLNLYMHGVAGYQGN---EDFK  338

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEK-NMGMVQQDDGSWKLMNNEEGYIPRPP  123
            LV+N DI+L+NK  D LK+ Y +P NWW      GM+Q DDG+WKL +    Y+P PP
Sbjct  339  LVINLDIALLNKYNDLLKDSYGVPPNWWSNVFRQGMIQFDDGTWKLND----YVPDPP  392



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 188/286 (66%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L  A  +F       +P++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDNPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +P S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDPRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             DI     +  N +   K  P+T F + SPR GD +FK + D+   L++LRI NVPD+ P
Sbjct  234  ADIVYGKNSNINISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLQPLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTE-GAGVLDGF  297
                  PL+ Y ++G  L I+   S+Y+K S +  N+HNLE YLHGIAG +  AGV   F
Sbjct  294  HY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDAAGV---F  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L + RDISLVNK  D LK+EY +P  W    N GMVQ +DG+WKL
Sbjct  347  KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMNDGTWKL  392



>ref|XP_008238421.1| PREDICTED: phospholipase A1-IIgamma-like [Prunus mume]
Length=376

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 175/284 (62%), Gaps = 10/284 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            W+GYVAV TDEGK  LGRRDI+V WRGT    EW  D+ F LV A +I G    P+VH G
Sbjct  98   WLGYVAVTTDEGKKVLGRRDILVSWRGTELVEEWGIDIVFDLVSASDILGEKHDPKVHHG  157

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
            F++ Y+  +P S  N  S R Q L  +K +V  YKNE +SITV GHS+GA++  LNA DI
Sbjct  158  FHSYYTHVDPQSPHNKTSCRAQALAAIKEVVNRYKNETISITVTGHSMGAAMGILNATDI  217

Query  635  ATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPAT  456
              NG N        PVT  V+A+PR GD  F NV+    NLH+LR+ N  D++P +P   
Sbjct  218  VNNGYNKPPGHPVCPVTAIVFAAPRLGDQGFSNVFYGLKNLHVLRVTNDYDLIPSLP---  274

Query  455  PLIGYTDVGVELTIDFSKSSYVK-PSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNR  279
            P   Y  VG EL  D  KS Y+K P   +   H+LE YLHG+AGT+G    + F L V R
Sbjct  275  PFANYLHVGKELRFDTFKSPYLKDPKQSL---HSLEVYLHGVAGTQGE---NDFKLAVKR  328

Query  278  DISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
            D++LVNK  D LK++Y +   WW EKN  M+Q  DGSW LM++E
Sbjct  329  DLALVNKYLDGLKDKYLVVAKWWTEKNKSMLQVGDGSWVLMDHE  372



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score =   263 bits (671),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 183/288 (64%), Gaps = 11/288 (4%)
 Frame = -2

Query  992  MGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRGF  813
            M YVAVATD+GK ALGRRDI+V WRGT+   EW+ DL+F  V A +I G    P+VH G+
Sbjct  110  MAYVAVATDDGKAALGRRDILVSWRGTMLDPEWIKDLDFASVSASKILGTANDPKVHNGW  169

Query  812  YNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDIA  633
            Y+LY+  NPDS     SARDQ++ E+K+ V  YK+E++SIT  GHS+GA++ TLNA DI 
Sbjct  170  YSLYTGTNPDSPLTSISARDQIINEIKKQVAAYKDEDLSITFVGHSMGAAIVTLNATDIV  229

Query  632  TNGANTTSDG--KSFPVTGFVYASPRTGDYNFKNVYDAT--PNLHLLRIRNVPDIVPQVP  465
             NG N   D   K+ PVT F  A PR GD  F  V+      NLH+LRI N  DIVP+ P
Sbjct  230  FNGFNKLPDKPDKAIPVTAFCIACPRIGDEGFSKVFTGLIGSNLHVLRINNYLDIVPKYP  289

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSL-V  288
            P   L  Y+DVG EL +D  +S Y+K +  +   H+LE +LH +AG +G      F L  
Sbjct  290  PGYYL--YSDVGQELVVDSLESPYLKKA--LLTLHSLEVHLHTVAGYQGPD--KEFDLKA  343

Query  287  VNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            + RD   +NK  D+L +EY +   WW EKN  M+Q DDG+W+L ++EE
Sbjct  344  IARDKVFLNKYGDYLDDEYRVVAEWWTEKNKSMIQNDDGTWELKDSEE  391



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 189/288 (66%), Gaps = 15/288 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGA------GAS  834
            W+GY AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F +         
Sbjct  114  WLGYTAVATDEGKELLGRRDIVVAWRGTMQLYEWANDFDFPLELATSVFPSTDPNDPNDP  173

Query  833  PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLAT  654
            P++  G+ +LY++ N  S F+  SA++QV GE+KRL+ELYK+EEVSIT  GHSLGA L+ 
Sbjct  174  PRIANGWLSLYTTSNTHSRFDKTSAQEQVQGELKRLLELYKHEEVSITFTGHSLGAVLSI  233

Query  653  LNAIDIATNG--ANTTSDGKSFP-VTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPD  483
            L+A D   N     TTS G     VT F + SPR GD NF+ + ++   L++LRI NVPD
Sbjct  234  LSATDFLHNEWPKTTTSLGDRLSCVTVFAFGSPRIGDLNFRRLVESLKKLNILRITNVPD  293

Query  482  IVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLD  303
            ++P      P+  + DVG EL I+  KS Y+K S ++ ++HNLE YLHG+AGT+      
Sbjct  294  LIPHY----PVFRFRDVGEELEINTLKSEYLKRSLNLAHFHNLEAYLHGVAGTQHNQA--  347

Query  302  GFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             F L +NRDI+LVNK  D L+++Y +P +WWV +N GMVQ DDG+W L
Sbjct  348  EFKLEINRDIALVNKELDALQDKYLVPSHWWVVENRGMVQADDGTWIL  395



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 185/286 (65%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATDEGK  LGRRDI+V WRGT++  EW +D +F L  A  +F        P+V
Sbjct  114  WMGYIAVATDEGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKVVPRV  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ + +S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLG  ++TL A
Sbjct  174  GSGWLDVYTASDSNSPYDTTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGGVMSTLAA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     N  NT+      P+T F +  PR GD +FK + D+   L++LRI NVPD+ P
Sbjct  234  ADLVHARKNKNNTSLQRNQVPITVFAFGCPRIGDQDFKKIVDSLQPLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEG-AGVLDGF  297
                  PL+ Y +VG  L I+   S+Y+K S +  N+HNLE YLHGIAG +  AGV   F
Sbjct  294  HY----PLLLYAEVGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDRAGV---F  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L V RD+SLVNK  D LK+EY +P  W    N GMVQ DDG+WKL
Sbjct  347  KLEVGRDVSLVNKGLDALKDEYLVPSTWRCLANKGMVQMDDGTWKL  392



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 186/285 (65%), Gaps = 12/285 (4%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLL---VPAPEIFGAGASPQV  825
            W+GYVAVATDEGK  LGRRDI+V WRGT++  EW +D +F L   V    +F +   P++
Sbjct  257  WIGYVAVATDEGKALLGRRDIVVAWRGTLQPYEWANDFDFPLESGVKVFPVFDSKIVPRI  316

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y+S +  S ++  SAR+QV GE+KRL+++YKNEEVSIT  GHSLG  ++TL A
Sbjct  317  GSGWLDVYTSSDAKSPYDTTSAREQVQGELKRLLDVYKNEEVSITFTGHSLGGVMSTLAA  376

Query  644  IDIATNGANTTSDG---KSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             D+     NT S G   K  P+T F +  PR GD +F  + D+   L++LRI NVPD+ P
Sbjct  377  ADLVNGKKNTISAGLERKQVPITVFAFGCPRIGDQDFVKIVDSLKQLNILRIVNVPDVAP  436

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
                  PL+ Y +VG EL I+   S+Y+K S +  N+HNLE YLHG+AG +    L  F 
Sbjct  437  HY----PLLLYAEVGQELQINTLNSTYLKRSLNFRNYHNLEIYLHGMAGMQDKAGL--FK  490

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            LV+ RDISLVNK  D LK+E+ +P  W    N GMVQ+DDG+W+L
Sbjct  491  LVIGRDISLVNKGLDALKDEFLVPSTWRCLANKGMVQKDDGTWQL  535



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/286 (48%), Positives = 189/286 (66%), Gaps = 18/286 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS--PQVH  822
            WMGYVAV+T+EG  ALGRRDI+V WRGT+  +EW+ D +  L+PA +I G G +   ++H
Sbjct  115  WMGYVAVSTNEGSKALGRRDILVAWRGTVLPVEWMKDADAQLIPATDIMGGGGASGAKLH  174

Query  821  RGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAI  642
            +GF+++Y++++  S+FN  SARDQVL EVK+ ++ +K E+VSIT+ GHSLG +LAT+NA 
Sbjct  175  QGFHSIYTAKSASSSFNKTSARDQVLSEVKKQLDKHKGEDVSITITGHSLGGALATINAT  234

Query  641  DIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPP  462
            DIA NG N     KS PVT   +A+P+ GD  +K V D+T +  +L +RNVPDIVP+VP 
Sbjct  235  DIAYNGLN-----KSRPVTAITFAAPQVGDRRYKEVLDSTKDCRVLSVRNVPDIVPRVPG  289

Query  461  ATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLE-GYLHGIAGTEGAGVLDGFSLVV  285
            A    GY +VGVE  I+ +++   +   D    H LE  YLH IA               
Sbjct  290  AA--AGYKNVGVEYKINSTRAPDTRAPGDPLTGHLLESAYLHTIATARPG--------KN  339

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNE  147
             RDI+LVNK  D LK E+ +PG WW EKN G VQ++DGSW + +++
Sbjct  340  KRDINLVNKDSDMLKPEFKVPGFWWGEKNGGFVQRNDGSWAMDDHQ  385



>ref|XP_010925002.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=440

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 185/300 (62%), Gaps = 14/300 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGAS------  834
            W+GY+AV++D      GRR+I V WRGTIR LEWV      LVP   I  +         
Sbjct  114  WIGYIAVSSDAAALKNGRREIYVAWRGTIRPLEWVDVAMPQLVPIDSILSSTQRCWAHDD  173

Query  833  --PQVHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASL  660
              P+V +G+Y +Y+S +P S FN +SARDQ+L ++K+LVE YKNE VSI   GHSLGASL
Sbjct  174  EVPKVMKGWYIIYTSSDPQSPFNKQSARDQLLPKIKQLVERYKNESVSIICVGHSLGASL  233

Query  659  ATLNAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDI  480
            ATL+A DI  NG +   +     V   V+ SP+ G+  FK+  +  PNL +L  +N  D+
Sbjct  234  ATLSAFDIVENGLSKIGENNHAQVCAMVFGSPQIGNKAFKDRLERLPNLRVLHTKNKIDL  293

Query  479  VPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDG  300
            +PQ P  + L+GY   GVEL +D  KS Y+K ST+  +WHNL+G L  +AG  G    DG
Sbjct  294  IPQYP--SGLLGYVFAGVELVVDTRKSPYLKDSTNTGDWHNLQGILQAVAGWNGE---DG  348

Query  299  -FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGYIPRPP  123
             F   V R I+LVNKS D+LK+EY IPG WWVEKN GMV ++DG W L       +P PP
Sbjct  349  EFKFQVERSIALVNKSCDYLKDEYLIPGLWWVEKNKGMVLEEDGEWYLAPPAAEDLPLPP  408



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/286 (48%), Positives = 187/286 (65%), Gaps = 14/286 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L  A  +F       SP++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +  S ++  SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDSRSPYDKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  644  IDIA---TNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVP  474
             DI     +  N +   K  P+T F + SPR GD +FK + D+   L++LRI NVPD+ P
Sbjct  234  ADIVYGKNSIINISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVAP  293

Query  473  QVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEG-AGVLDGF  297
                  PL+ Y ++G  L I+   S+Y+K S +  N+HNLE YLHGIAG +  AGV   F
Sbjct  294  HY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDTAGV---F  346

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
             L + RDISLVNK  D LK+EY +P  W    N GMVQ +DG+WKL
Sbjct  347  KLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMNDGTWKL  392



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/287 (49%), Positives = 187/287 (65%), Gaps = 16/287 (6%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIF---GAGASPQV  825
            WMGY+AVATD+GK  LGRRDI+V WRGT++  EW +D +F L  A  +F       SP++
Sbjct  114  WMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWANDFDFPLESAISVFPVKDPKDSPRI  173

Query  824  HRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNA  645
              G+ ++Y++ +  S +   SAR+QV GE+KRL+E+YKNEEVSIT  GHSLGA ++ L+A
Sbjct  174  GSGWLDIYTASDSRSPYAKTSAREQVQGELKRLLEVYKNEEVSITFTGHSLGAVMSVLSA  233

Query  644  IDIATNGANTTSD----GKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
             DI   G N+  D     K  P+T F + SPR GD +FK + D+   L++LRI NVPD+ 
Sbjct  234  ADIVY-GKNSKIDISLQKKQVPITVFAFGSPRIGDQDFKKIVDSLKPLNILRIVNVPDVA  292

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTE-GAGVLDG  300
            P      PL+ Y ++G  L I+   S+Y+K S +  N+HNLE YLHGIAG +  AGV   
Sbjct  293  PHY----PLLLYAEIGEVLEINTLNSTYLKRSLNFRNYHNLEIYLHGIAGMQDAAGV---  345

Query  299  FSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKL  159
            F L + RDISLVNK  D LK+EY +P  W    N GMVQ +DG+WKL
Sbjct  346  FKLEIGRDISLVNKGLDALKDEYLVPSTWRCLANKGMVQMNDGTWKL  392



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 181/289 (63%), Gaps = 20/289 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            WMGYVAVATDEG  ALGRRDI+V WRGT R LEWV+DL+     A  + GA   P   R 
Sbjct  108  WMGYVAVATDEGAAALGRRDIVVAWRGTQRALEWVADLKLAFASAARVLGAATGPN-RRC  166

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLNAIDI  636
                Y S+            +QVL E+ RL++ YK+E+ SITV GHSLGA+LATLNA+DI
Sbjct  167  TAVQYRSK----------LAEQVLTEIARLMDKYKDEQTSITVVGHSLGATLATLNAVDI  216

Query  635  ATNGANTT---SDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVP  465
            A N  N +   + G   PVT  V+ SPRTGD++F++++   P L +LR+RN PD +P  P
Sbjct  217  AANYYNKSALCTAGSRAPVTAVVFGSPRTGDHDFRDIFHRLPGLRMLRVRNRPDRIPLYP  276

Query  464  PATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVV  285
            P    +GY DVGVEL ID  +S ++KP  +    H+LE +LHG+AG +G      F LVV
Sbjct  277  P----VGYADVGVELLIDTRRSPFLKPHGNESQSHDLECHLHGVAGWQGEH--GEFELVV  330

Query  284  NRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEEGY  138
            +RDI+LVNK  D L +E+ +P  W V  N  MV+  DG W L ++E  Y
Sbjct  331  DRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGPDGRWVLEDHESDY  379



>ref|XP_002522553.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39853.1| triacylglycerol lipase, putative [Ricinus communis]
Length=442

 Score =   259 bits (661),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 144/298 (48%), Positives = 185/298 (62%), Gaps = 15/298 (5%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQVHRG  816
            ++G+VAV++D+GK  LGRRDIIVCWRGT   +EW  D+    VPA +IF   +   VH G
Sbjct  143  YIGFVAVSSDQGKLVLGRRDIIVCWRGTTLPIEWFQDILCDQVPATDIF-PDSKALVHYG  201

Query  815  FYNLYSSENPDSAFNIKSARDQVLGEVKRLVELY----KNEEVSITVCGHSLGASLATLN  648
            FYN+Y++++  + +N  S R+QVL  V+RLV+ Y     NE VSITV GHSLGA+LATLN
Sbjct  202  FYNMYTAKDSTTTYNKMSVREQVLAAVRRLVDKYYKADPNEVVSITVIGHSLGAALATLN  261

Query  647  AIDIATNGANT-TSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQ  471
            A+D   NG N  T     + V  FV+ASPR GD  F +V+    NLHLLRIRN  D +P 
Sbjct  262  AVDRVANGYNKPTGSTTEYSVASFVFASPRVGDKGFLDVFSGLKNLHLLRIRNAQDFIPD  321

Query  470  VPPATPL-IGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFS  294
            +PP   L   Y DVG EL ID S S Y+K +T     H+L  Y HGI+G +G      F 
Sbjct  322  LPPKEILGYSYADVGAELDIDTSLSPYIKKAT-FMEPHDLNLYCHGISGYQGKD--RKFK  378

Query  293  LVVNRDISLVNKSQDHLKEEYSIPGNWWVE-KNMGMVQQDDGSWKLMNNEEGYIPRPP  123
            L V+ D++LVNK  D L ++  +P  WW    N GM Q DDGSWKL +    Y+P PP
Sbjct  379  LAVDFDLALVNKYNDLLLDDCKVPPKWWSNVMNKGMAQMDDGSWKLHD----YVPDPP  432



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 188/332 (57%), Gaps = 54/332 (16%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG  ALGRRD++V WRGT+R+LEWV+DL+F  VPA  + G+ A+      
Sbjct  122  WMGYVAVATDEGAAALGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGSAAAAHPRAM  181

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQ------------------------VLGEVKRLVE  720
            VH GF +LY+S N  S +N  SARDQ                        VL EV+RL+E
Sbjct  182  VHGGFLSLYTSSNASSKYNKLSARDQASGSMSMTQFLPSLLLRRNHRFFEVLEEVRRLME  241

Query  719  LYKNEEVSITVCGHSLGASLATLNAIDIATNGANT--------------------TSDGK  600
            LYK+EE SI+V GHSLGASLATLNA+D+  NG N                          
Sbjct  242  LYKDEETSISVTGHSLGASLATLNAVDMVANGVNAPGAATATGTSGGSSSSPAQPQPQRA  301

Query  599  SFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIVPQVPPATPLIGYTDVGVEL  420
              PVT  V+ASPR G   FK  + +  +L  L +RN  D+VP  PP    +GY DV V L
Sbjct  302  GCPVTAIVFASPRVGGPFFKAAFASFADLRALHVRNKGDVVPLYPP----LGYVDVAVPL  357

Query  419  TIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGFSLVVNRDISLVNKSQDHLK  240
             I  ++S +++        HNLE YLHG+AG +GA    GF L V RD++LVNK  D L+
Sbjct  358  PIHTARSPWLRRPGTPQTLHNLECYLHGVAGEQGAA--GGFRLEVGRDVALVNKGADALR  415

Query  239  EEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
            +EY +P  W V  N GMV+  DG W L + E 
Sbjct  416  DEYPVPARWRVALNKGMVRGADGRWALKDFEH  447



>ref|XP_002438517.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
 gb|EER89884.1| hypothetical protein SORBIDRAFT_10g021250 [Sorghum bicolor]
Length=396

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 188/291 (65%), Gaps = 19/291 (7%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDL-EFLLVPAPEIFGAGASPQ---  828
            WMGYVAVATDEG  ALGRRDI+V WRG+    EW  D+ EF+  PA  + G+ A+     
Sbjct  115  WMGYVAVATDEGVAALGRRDIVVAWRGSATDAEWAKDIIEFVPAPAESVLGSAAAAYPSA  174

Query  827  -VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNE--EVSITVCGHSLGASLA  657
             VH GF +LY++ N DS     SARDQVL EV RLVELYK+E  E+SITV GHSLGA+L+
Sbjct  175  YVHSGFLSLYTTSNADSELGKTSARDQVLQEVSRLVELYKDEDQEMSITVVGHSLGAALS  234

Query  656  TLNAIDIATNGANTTSDGKSFPVTGFVYASPRTGDYNFKNVYDATPNLHLLRIRNVPDIV  477
             LNA+D+ +NG N      S PV   V+A P  G+ +FK+ +D+  +L  L ++N  D+V
Sbjct  235  ILNAVDLVSNGVNN-----SCPVAAVVFACPHVGNNSFKDAFDSFDDLKALHVKNKIDLV  289

Query  476  PQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLHGIAGTEGAGVLDGF  297
            PQ+    P     D+GV L ID S S Y+K   +    H LE YLHG+AG +G+    GF
Sbjct  290  PQLMDWLP-----DLGVTLPIDTSLSPYLKDPKN--TAHELECYLHGVAGVQGSDAGGGF  342

Query  296  SLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMNNEE  144
             LVV+RD++L+N+S D LK+E+ +P +WWV ++  MV+   G W+L + E+
Sbjct  343  DLVVDRDVALLNRSVDALKDEHPVPASWWVAEHKSMVKNAKGKWELKDFEQ  393



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 148/303 (49%), Positives = 188/303 (62%), Gaps = 23/303 (8%)
 Frame = -2

Query  995  WMGYVAVATDEGKTALGRRDIIVCWRGTIRTLEWVSDLEFLLVPAPEIFGAGASPQ----  828
            WMGYVAVATDEG   LGRRD++V WRGT+R+LEWV+DL+F  VPA  + GA A       
Sbjct  124  WMGYVAVATDEGAAELGRRDVVVAWRGTVRSLEWVNDLDFTPVPAAPVLGAAADTHPRAM  183

Query  827  VHRGFYNLYSSENPDSAFNIKSARDQVLGEVKRLVELYKNEEVSITVCGHSLGASLATLN  648
            VHRGF +LY+S N  S +N  SARDQVL E++RL+ELYK+EE SIT+ GHSLGASLATLN
Sbjct  184  VHRGFLSLYTSSNASSKYNKLSARDQVLEEIRRLMELYKHEETSITITGHSLGASLATLN  243

Query  647  AIDIATNGANT-----------TSDGKSFPVTGFVYASPRTGDYNFKNVYDA-TPNLHLL  504
            A+DI  NG N+           +S  +  PVT  V+ASP  G   FK  + +    L  L
Sbjct  244  AVDIVANGLNSPAAAAGGHSSSSSSAQPAPVTAIVFASPHVGGPFFKAAFASFGEQLRAL  303

Query  503  RIRNVPDIVPQVPPATPLIGYTDVGVELTIDFSKSSYVKPSTDIWNWHNLEGYLH---GI  333
             ++N  D+VP  PP    +GY DV V L I  ++S +++        HNLE YLH   G 
Sbjct  304  HVKNQGDVVPLYPP----LGYVDVAVPLPIHTARSPWLRQPGTPQTLHNLECYLHGVAGE  359

Query  332  AGTEGAGVLDGFSLVVNRDISLVNKSQDHLKEEYSIPGNWWVEKNMGMVQQDDGSWKLMN  153
             G  GA    GF L V+RD++LVNK+ D L++EY +P  W V  N GMV+  DG W L +
Sbjct  360  QGGGGADDGGGFRLEVDRDVALVNKAADALRDEYPVPVKWRVALNKGMVRGADGRWVLKD  419

Query  152  NEE  144
             E 
Sbjct  420  FEH  422



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2217996789222