BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20735_g1_i1 len=454 path=[1544:0-453]

Length=454
                                                                      Score     E

ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             177   3e-50   
emb|CDO96758.1|  unnamed protein product                                175   7e-50   
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           175   1e-49   
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           174   4e-49   
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         173   7e-49   
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     172   1e-48   Vitis vinifera
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            171   4e-48   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           170   1e-47   
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           169   1e-47   
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           169   3e-47   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           168   3e-47   
emb|CBI21954.3|  unnamed protein product                                168   5e-47   
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                168   6e-47   
gb|KHN18919.1|  Phospholipase A1-IIgamma                                167   7e-47   
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           168   7e-47   
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           167   9e-47   
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           167   1e-46   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           167   1e-46   
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                167   2e-46   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    167   3e-46   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    167   3e-46   
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           166   4e-46   
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           165   5e-46   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          164   2e-45   
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           163   4e-45   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           163   5e-45   
ref|XP_003593747.1|  Lipase                                             163   5e-45   
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       163   6e-45   
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             163   7e-45   
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           162   8e-45   
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              162   2e-44   
gb|AFK35349.1|  unknown                                                 157   2e-44   
ref|XP_010557126.1|  PREDICTED: phospholipase A1-IIbeta isoform X2      159   2e-44   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           160   3e-44   
gb|KHN08451.1|  Phospholipase A1-IIgamma                                160   3e-44   
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                161   5e-44   
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           160   6e-44   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   160   8e-44   
gb|EPS68357.1|  hypothetical protein M569_06414                         153   1e-43   
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           159   1e-43   
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      159   1e-43   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              159   2e-43   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           158   2e-43   
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              158   4e-43   
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           157   4e-43   
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     158   4e-43   
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           157   5e-43   
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           158   6e-43   
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           157   8e-43   
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           157   1e-42   
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                156   2e-42   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              156   3e-42   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           155   4e-42   
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                155   4e-42   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             154   6e-42   
gb|EPS70940.1|  hypothetical protein M569_03817                         154   6e-42   
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           154   8e-42   
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              154   8e-42   
gb|ABQ95989.1|  phospholipase A1                                        154   8e-42   Capsicum annuum
emb|CDX99456.1|  BnaC01g10960D                                          154   9e-42   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           154   1e-41   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   154   1e-41   
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           153   2e-41   
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           154   2e-41   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           153   2e-41   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              154   2e-41   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           153   2e-41   
ref|XP_010518796.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    152   2e-41   
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           153   3e-41   
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           153   3e-41   
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    152   4e-41   
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           152   4e-41   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           153   5e-41   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           152   5e-41   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           152   5e-41   
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    152   5e-41   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    152   6e-41   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           152   6e-41   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    150   8e-41   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           152   1e-40   
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              151   1e-40   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    151   1e-40   
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             150   2e-40   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    150   3e-40   
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           150   4e-40   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           149   4e-40   
gb|AFK39140.1|  unknown                                                 144   5e-40   
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           149   6e-40   
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                150   8e-40   
emb|CDP11819.1|  unnamed protein product                                148   2e-39   
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             148   2e-39   
emb|CDX76515.1|  BnaA08g08850D                                          147   2e-39   
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                147   5e-39   
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           146   7e-39   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              146   7e-39   
emb|CDY01554.1|  BnaC07g35440D                                          147   7e-39   
ref|XP_009137120.1|  PREDICTED: phospholipase A1-IIgamma-like           145   9e-39   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                146   1e-38   
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              146   1e-38   
ref|XP_002867985.1|  lipase class 3 family protein                      146   1e-38   
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    146   1e-38   
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           146   1e-38   
emb|CDY34061.1|  BnaC03g62710D                                          145   1e-38   
ref|XP_003608120.1|  Lipase                                             145   2e-38   
ref|XP_003608122.1|  Lipase                                             144   3e-38   
gb|AFK47098.1|  unknown                                                 144   3e-38   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           145   4e-38   
ref|XP_010446304.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    142   4e-38   
ref|NP_193590.1|  phospholipase A1-IIgamma                              144   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522554.1|  triacylglycerol lipase, putative                   144   7e-38   Ricinus communis
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                144   8e-38   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             144   9e-38   
ref|XP_002525127.1|  triacylglycerol lipase, putative                   143   9e-38   Ricinus communis
ref|XP_002316835.2|  lipase class 3 family protein                      144   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           143   2e-37   
ref|XP_002892328.1|  predicted protein                                  140   6e-37   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           141   6e-37   
gb|AAM61647.1|  lipase-like protein                                     140   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           140   2e-36   
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           140   2e-36   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              140   3e-36   
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   139   3e-36   
ref|NP_172115.1|  phospholipase A1-IIalpha                              138   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   138   1e-35   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                138   1e-35   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                138   1e-35   
emb|CDY57813.1|  BnaA10g28020D                                          138   2e-35   
ref|XP_002305750.2|  lipase class 3 family protein                      137   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             137   2e-35   
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              137   2e-35   
emb|CDY10187.1|  BnaC05g04300D                                          137   3e-35   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    136   3e-35   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    136   4e-35   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    136   4e-35   
gb|AAB07724.1|  Pn47p                                                   136   4e-35   Ipomoea nil [qian niu]
ref|XP_011100290.1|  PREDICTED: phospholipase A1-IIgamma-like           136   5e-35   
emb|CBI30665.3|  unnamed protein product                                135   8e-35   
emb|CDO96757.1|  unnamed protein product                                135   1e-34   
gb|EYU24809.1|  hypothetical protein MIMGU_mgv1a007765mg                135   1e-34   
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    134   2e-34   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    134   2e-34   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    134   2e-34   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             133   7e-34   
emb|CDM85400.1|  unnamed protein product                                132   2e-33   
ref|XP_003528483.1|  PREDICTED: phospholipase A1-IIgamma-like           130   4e-33   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    130   4e-33   
emb|CDX86530.1|  BnaC08g01730D                                          130   5e-33   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           130   5e-33   
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              130   1e-32   
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   129   1e-32   
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            129   3e-32   
gb|ABK24664.1|  unknown                                                 129   3e-32   Picea sitchensis
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          128   5e-32   Sorghum bicolor [broomcorn]
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          128   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   127   6e-32   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 127   8e-32   
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          127   9e-32   
emb|CDM83551.1|  unnamed protein product                                127   1e-31   
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            127   1e-31   
dbj|BAJ96485.1|  predicted protein                                      126   1e-31   
gb|EMT15519.1|  Lipase                                                  126   2e-31   
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          126   2e-31   Sorghum bicolor [broomcorn]
gb|EMS63185.1|  Phospholipase A1-II 1                                   128   5e-31   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             125   5e-31   
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           125   6e-31   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              124   8e-31   
gb|EAY75191.1|  hypothetical protein OsI_03083                          123   1e-30   Oryza sativa Indica Group [Indian rice]
emb|CDY23963.1|  BnaC03g17280D                                          124   2e-30   
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             124   2e-30   Oryza sativa Indica Group [Indian rice]
emb|CDX84801.1|  BnaA03g14290D                                          124   2e-30   
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              123   2e-30   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            124   2e-30   
gb|ABR18391.1|  unknown                                                 123   2e-30   Picea sitchensis
emb|CDY10774.1|  BnaA05g11620D                                          122   4e-30   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    125   5e-30   
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    122   6e-30   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    122   7e-30   
gb|ABK23399.1|  unknown                                                 122   7e-30   Picea sitchensis
ref|XP_009144598.1|  PREDICTED: phospholipase A1-IIbeta-like            122   8e-30   
ref|XP_002525129.1|  triacylglycerol lipase, putative                   122   8e-30   Ricinus communis
gb|EMS51987.1|  Phospholipase A1-II 3                                   121   1e-29   
emb|CDY24728.1|  BnaC04g13330D                                          120   3e-29   
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   120   4e-29   
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             120   4e-29   
gb|ACG40994.1|  triacylglycerol lipase                                  116   6e-29   Zea mays [maize]
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                119   8e-29   
gb|AFW83434.1|  hypothetical protein ZEAMMB73_348788                    115   1e-28   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    118   1e-28   
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              118   2e-28   
ref|XP_002303465.1|  lipase family protein                              118   2e-28   Populus trichocarpa [western balsam poplar]
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    117   2e-28   
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              117   3e-28   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     117   4e-28   Zea mays [maize]
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta-like           117   4e-28   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              117   5e-28   
gb|EMT05578.1|  hypothetical protein F775_13080                         117   5e-28   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              117   5e-28   
gb|EMT21704.1|  Putative lipase                                         117   5e-28   
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          116   7e-28   Sorghum bicolor [broomcorn]
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              116   9e-28   
ref|NP_001152663.1|  triacylglycerol lipase precursor                   115   1e-27   Zea mays [maize]
gb|KDO40783.1|  hypothetical protein CISIN_1g046292mg                   112   1e-27   
gb|EMS52156.1|  Phospholipase A1-II 2                                   115   2e-27   
ref|XP_004960509.1|  PREDICTED: phospholipase A1-II 7-like              115   3e-27   
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              114   3e-27   
ref|XP_002465238.1|  hypothetical protein SORBIDRAFT_01g034810          114   4e-27   Sorghum bicolor [broomcorn]
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             114   4e-27   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           114   5e-27   
ref|XP_004300994.1|  PREDICTED: uncharacterized protein LOC101301206    114   6e-27   
ref|XP_004306113.1|  PREDICTED: phospholipase A1-IIdelta-like           110   7e-27   
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       116   7e-27   
gb|ACJ85535.1|  unknown                                                 113   9e-27   Medicago truncatula
ref|XP_003607601.1|  Feruloyl esterase A                                113   9e-27   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              113   1e-26   
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                113   1e-26   
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    112   3e-26   
gb|EMT15520.1|  Feruloyl esterase A                                     114   3e-26   
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          112   3e-26   Sorghum bicolor [broomcorn]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              111   5e-26   
ref|NP_001043730.2|  Os01g0651200                                       111   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           110   7e-26   
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           110   8e-26   
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                110   9e-26   
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           110   1e-25   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             110   1e-25   
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   110   1e-25   
ref|NP_001149813.1|  triacylglycerol lipase                             109   2e-25   Zea mays [maize]
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           109   2e-25   
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              109   2e-25   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              109   2e-25   
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             109   2e-25   
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           108   3e-25   
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             108   5e-25   Oryza sativa Indica Group [Indian rice]
dbj|BAD68802.1|  lipase-like protein                                    108   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75192.1|  hypothetical protein OsI_03084                          108   5e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                108   6e-25   
gb|KDO38625.1|  hypothetical protein CISIN_1g0208022mg                  107   6e-25   
gb|EEE55092.1|  hypothetical protein OsJ_02840                          107   7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             107   1e-24   
ref|XP_004292180.1|  PREDICTED: phospholipase A1-IIdelta-like           104   1e-24   
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           108   1e-24   
ref|XP_006858342.1|  hypothetical protein AMTR_s00064p00160580          104   1e-24   
gb|KFK37116.1|  hypothetical protein AALP_AA4G215000                    106   2e-24   
ref|XP_006827274.1|  hypothetical protein AMTR_s00010p00263480          107   2e-24   
emb|CDP15943.1|  unnamed protein product                                106   2e-24   
emb|CDX97819.1|  BnaC04g41200D                                          107   3e-24   
dbj|BAH56866.1|  AT2G42690                                              105   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    107   4e-24   
emb|CDY29665.1|  BnaA04g17620D                                          107   4e-24   
ref|XP_002879267.1|  lipase class 3 family protein                      107   5e-24   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           105   5e-24   
ref|NP_181797.1|  phospholipase A1-IIdelta                              105   6e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             105   7e-24   
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              105   7e-24   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    106   7e-24   
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         105   8e-24   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    106   8e-24   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    105   9e-24   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    105   1e-23   
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              104   1e-23   
gb|EAY99121.1|  hypothetical protein OsI_21080                          104   1e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             104   1e-23   
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    104   1e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_850148.1|  phospholipase A1-Igamma2                              105   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043734.1|  Os01g0651800                                       104   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    104   2e-23   
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     103   2e-23   
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           104   2e-23   
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           104   2e-23   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           103   2e-23   
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             103   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_565701.1|  phospholipase A1-Igamma2                              105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451276.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    104   2e-23   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             103   2e-23   
ref|XP_010486704.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   2e-23   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    104   3e-23   
ref|XP_010486696.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   3e-23   
gb|EPS65211.1|  hypothetical protein M569_09564                         103   3e-23   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   3e-23   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   4e-23   
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       103   4e-23   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             104   4e-23   
ref|XP_010486640.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   4e-23   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   5e-23   
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    103   5e-23   
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                102   5e-23   
ref|XP_008371801.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   5e-23   
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         103   5e-23   
ref|XP_008369474.1|  PREDICTED: phospholipase A1-II 2-like              100   6e-23   
ref|XP_010486634.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   6e-23   
gb|KHG20660.1|  Phospholipase A1-IIgamma -like protein                  102   6e-23   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             103   6e-23   
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    102   7e-23   
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         102   8e-23   
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          102   8e-23   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             103   9e-23   
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                102   9e-23   
ref|XP_003566295.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   9e-23   
gb|KCW49834.1|  hypothetical protein EUGRSUZ_K03311                     103   1e-22   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           102   1e-22   
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                102   1e-22   
ref|XP_010038036.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    103   1e-22   
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             101   1e-22   
gb|KDP38020.1|  hypothetical protein JCGZ_04663                         102   1e-22   
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              102   1e-22   
ref|XP_009766306.1|  PREDICTED: phospholipase A1-IIdelta-like           102   1e-22   
emb|CDP21091.1|  unnamed protein product                                102   1e-22   
emb|CDO98286.1|  unnamed protein product                                101   2e-22   
ref|NP_001151242.1|  triacylglycerol lipase                             101   2e-22   
ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           101   2e-22   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    102   2e-22   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    102   2e-22   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    102   2e-22   
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             102   2e-22   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    102   3e-22   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    102   3e-22   
ref|XP_007208931.1|  hypothetical protein PRUPE_ppb012141mg           97.8    3e-22   
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                100   4e-22   
ref|XP_010414253.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    100   4e-22   
ref|XP_009362274.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    101   4e-22   
gb|EMT11182.1|  hypothetical protein F775_27795                         100   4e-22   
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    100   4e-22   
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    100   5e-22   
ref|XP_010414254.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    100   5e-22   
ref|XP_007208858.1|  hypothetical protein PRUPE_ppa025833mg           99.8    5e-22   
ref|XP_008238420.1|  PREDICTED: phospholipase A1-IIgamma-like         99.8    5e-22   
gb|EMS63790.1|  Phospholipase A1-II 7                                   101   5e-22   
gb|ABR16123.1|  unknown                                                 101   5e-22   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    101   6e-22   
emb|CDY54880.1|  BnaA10g27930D                                          100   6e-22   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    101   6e-22   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    101   6e-22   
ref|XP_011079988.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    100   7e-22   
ref|XP_008371806.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    100   7e-22   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    100   7e-22   
dbj|BAJ85876.1|  predicted protein                                      100   8e-22   
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like         99.4    8e-22   
dbj|BAJ88202.1|  predicted protein                                      100   9e-22   
ref|XP_011079989.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  99.8    1e-21   
gb|EMT04701.1|  Lipase                                                99.0    1e-21   
ref|XP_004289499.1|  PREDICTED: phospholipase A1-IIgamma-like         98.6    1e-21   
gb|EMS48809.1|  Phospholipase A1-II 6                                 99.8    1e-21   
emb|CBI21996.3|  unnamed protein product                                100   1e-21   
ref|NP_563772.1|  phospholipase A1-Igamma1                            99.4    1e-21   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    100   1e-21   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    100   1e-21   
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta              99.8    1e-21   
ref|XP_004250927.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    100   1e-21   
gb|AAD01804.1|  lipase                                                99.4    1e-21   
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    100   1e-21   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    100   1e-21   
ref|XP_008371821.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  99.8    2e-21   
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like            99.0    2e-21   
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660        99.4    2e-21   
ref|NP_849603.1|  phospholipase A1-Igamma1                            99.8    2e-21   
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4           98.2    2e-21   
gb|ACJ76846.1|  chloroplast lipase protein                            99.8    2e-21   
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like            99.0    2e-21   
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg              98.2    2e-21   
ref|XP_009362273.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  99.4    2e-21   
emb|CDY10228.1|  BnaC05g04710D                                        99.4    2e-21   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                  99.4    2e-21   
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like         98.2    3e-21   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  99.4    3e-21   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  99.4    3e-21   
ref|XP_010655697.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  99.0    3e-21   
ref|XP_007015095.1|  Alpha/beta-Hydrolases superfamily protein        99.0    3e-21   
ref|XP_002892359.1|  lipase class 3 family protein                    99.0    3e-21   
ref|XP_010655698.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  99.0    3e-21   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  99.0    3e-21   
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                 98.6    4e-21   
ref|XP_009801144.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  99.0    4e-21   
ref|NP_001055438.1|  Os05g0390000                                     98.6    4e-21   
ref|XP_004146990.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  99.0    4e-21   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein        97.4    4e-21   
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  98.6    4e-21   
gb|KGN44761.1|  hypothetical protein Csa_7G378500                     98.6    4e-21   
dbj|BAJ95995.1|  predicted protein                                    97.8    4e-21   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  98.6    4e-21   
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg              97.8    4e-21   
ref|XP_007212825.1|  hypothetical protein PRUPE_ppa020655mg           98.6    5e-21   
emb|CDM83808.1|  unnamed protein product                              98.2    5e-21   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg           98.6    5e-21   
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg           97.4    5e-21   
gb|EEC79153.1|  hypothetical protein OsI_19824                        99.0    6e-21   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                       98.2    6e-21   
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.4    6e-21   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  98.6    6e-21   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g           98.2    7e-21   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  98.2    7e-21   
ref|XP_004962194.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  98.6    7e-21   
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.4    7e-21   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  98.2    7e-21   
ref|XP_006655277.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  97.1    7e-21   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  97.8    8e-21   
ref|XP_008225538.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  98.2    8e-21   
gb|EMS63050.1|  Phospholipase A1-II 5                                 97.8    8e-21   
ref|XP_010326538.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  97.4    8e-21   
ref|XP_009142882.1|  PREDICTED: phospholipase A1-IIdelta-like         96.3    9e-21   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g           97.8    9e-21   
gb|KDO75376.1|  hypothetical protein CISIN_1g037474mg                 97.8    9e-21   
ref|XP_006468077.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.8    1e-20   
ref|XP_011028727.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  96.7    1e-20   
ref|XP_010274200.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  97.1    1e-20   
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like         96.3    1e-20   
emb|CBI16352.3|  unnamed protein product                              97.4    1e-20   
ref|XP_006448978.1|  hypothetical protein CICLE_v10014927mg           97.4    1e-20   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  97.4    1e-20   
emb|CBI30961.3|  unnamed protein product                              94.4    1e-20   
emb|CDM86668.1|  unnamed protein product                              97.4    1e-20   
gb|EYU31376.1|  hypothetical protein MIMGU_mgv1a004679mg              97.4    1e-20   
emb|CAN74039.1|  hypothetical protein VITISV_012945                   97.4    1e-20   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg           97.4    1e-20   
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642           95.9    1e-20   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.4    1e-20   
ref|XP_010685025.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.1    1e-20   
ref|XP_009593784.1|  PREDICTED: phospholipase A1-IIdelta              97.1    1e-20   
dbj|BAJ99811.1|  predicted protein                                    97.1    1e-20   
ref|XP_002522552.1|  triacylglycerol lipase, putative                 95.9    2e-20   
ref|XP_011080360.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.1    2e-20   
ref|XP_007024951.1|  Alpha/beta-Hydrolases superfamily protein        97.1    2e-20   
emb|CAN83233.1|  hypothetical protein VITISV_005768                   96.7    2e-20   
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  97.1    2e-20   
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like         95.5    2e-20   
ref|XP_011042425.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  95.9    2e-20   
ref|XP_004301746.1|  PREDICTED: phospholipase A1-IIgamma-like         95.5    2e-20   
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g           96.7    2e-20   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein        96.7    2e-20   
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like            95.9    2e-20   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like         95.5    2e-20   
gb|KEH23857.1|  phospholipase A1                                      96.3    2e-20   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                   95.9    2e-20   
emb|CDY49813.1|  BnaC06g04560D                                        96.7    3e-20   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                 95.5    3e-20   
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                 95.9    3e-20   
ref|XP_001754450.1|  predicted protein                                94.7    3e-20   
ref|XP_006489506.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  95.5    3e-20   
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like         95.1    3e-20   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  96.3    3e-20   
ref|XP_002520983.1|  triacylglycerol lipase, putative                 95.5    4e-20   
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  96.3    4e-20   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  96.3    4e-20   
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg              96.3    4e-20   
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like         94.7    4e-20   
ref|XP_007025427.1|  Alpha/beta-Hydrolases superfamily protein        94.4    4e-20   
ref|XP_002891639.1|  lipase class 3 family protein                    95.9    4e-20   
gb|KCW51163.1|  hypothetical protein EUGRSUZ_J00755                   95.9    5e-20   
ref|XP_004243279.1|  PREDICTED: phospholipase A1-IIdelta              95.5    5e-20   
ref|XP_002441042.1|  hypothetical protein SORBIDRAFT_09g019276        95.5    5e-20   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  95.9    5e-20   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  95.9    5e-20   
ref|XP_009793565.1|  PREDICTED: uncharacterized protein LOC104240421  92.0    5e-20   
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like         95.5    5e-20   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  95.9    5e-20   
ref|XP_008382954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.7    5e-20   
ref|XP_006853087.1|  hypothetical protein AMTR_s00038p00110060        95.5    5e-20   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  95.5    5e-20   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg           95.1    6e-20   
ref|XP_010102366.1|  Phospholipase A1-Igamma3                         95.9    6e-20   
gb|KDP21072.1|  hypothetical protein JCGZ_21543                       94.4    6e-20   
emb|CDY50817.1|  BnaC04g52540D                                        94.0    6e-20   
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like            94.0    7e-20   
ref|XP_007201554.1|  hypothetical protein PRUPE_ppa017780mg           95.1    7e-20   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  95.5    7e-20   
ref|XP_008444745.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  95.5    7e-20   
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like         94.4    7e-20   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                  95.1    8e-20   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like            94.0    8e-20   
ref|XP_001779106.1|  predicted protein                                94.7    8e-20   
ref|XP_009622048.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...  94.7    1e-19   
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                 94.0    1e-19   
ref|XP_006576920.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  93.6    1e-19   
gb|KDO63322.1|  hypothetical protein CISIN_1g0475241mg                89.4    1e-19   
ref|XP_009614944.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  93.6    1e-19   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg           94.7    1e-19   
gb|KGN66495.1|  hypothetical protein Csa_1G614650                     94.7    1e-19   
ref|XP_004167249.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.7    1e-19   
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  94.4    1e-19   
ref|XP_006853086.1|  hypothetical protein AMTR_s00038p00106840        94.7    1e-19   
ref|XP_004135535.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.7    1e-19   
dbj|BAJ85084.1|  predicted protein                                    93.6    1e-19   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  94.4    1e-19   
gb|KCW57435.1|  hypothetical protein EUGRSUZ_H00215                   94.0    1e-19   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.4    1e-19   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...  94.7    2e-19   
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.4    2e-19   
ref|XP_010069172.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.4    2e-19   
ref|XP_002893614.1|  lipase class 3 family protein                    94.4    2e-19   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...  94.0    2e-19   
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940        94.4    2e-19   
ref|XP_003607369.1|  Lipase                                           94.4    2e-19   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like         92.8    2e-19   
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                 93.6    2e-19   
gb|KEH23856.1|  phospholipase A1                                      94.0    2e-19   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...  94.0    2e-19   
emb|CDY22842.1|  BnaA06g02350D                                        94.0    2e-19   
ref|XP_002513514.1|  triacylglycerol lipase, putative                 93.6    3e-19   
ref|XP_002531054.1|  triacylglycerol lipase, putative                 94.0    3e-19   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g           92.8    3e-19   
ref|XP_002518706.1|  triacylglycerol lipase, putative                 92.8    3e-19   



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -2

Query  372  RRKMS-SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            ++KM  ++SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG+M +A Y+TFN E ASKY
Sbjct  14   KKKMEMANSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEMAQAAYDTFNTEKASKY  73

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AG S Y++ + F+KVGLDKGNPYKY VTK+FYATS   +P+AFII P+  +AWS+ESNWM
Sbjct  74   AGDSIYAKKDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWM  133

Query  15   GYVAV  1
            GYVAV
Sbjct  134  GYVAV  138



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   175 bits (444),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+RW+VLSG+ +W GL DPLD DLR Y+IHYG+M +ATY++FNAE AS+YAGS  Y++
Sbjct  3    SIAKRWKVLSGNYDWDGLLDPLDYDLRRYIIHYGEMAQATYDSFNAEKASRYAGSCLYAK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +LFAKVGL  GNP+KY VTKY YATSS  LPDAFI+K    +AWS+ESNWMGYVAV
Sbjct  63   KDLFAKVGLQNGNPFKYRVTKYLYATSSIQLPDAFIVKSFSREAWSKESNWMGYVAV  119



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -2

Query  372  RRKMS-SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            ++KM  + SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG++ +A Y+TFN E ASKY
Sbjct  14   KKKMEMADSIAKKWRSLSGQNNWEGLLDPLDIDLRRYMIHYGEIAQAAYDTFNTEKASKY  73

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AG S Y++ + F+KVGLDKGNPYKY VTK+FYATS   +P+AFII P+  +AWS+ESNWM
Sbjct  74   AGDSIYAKKDFFSKVGLDKGNPYKYNVTKFFYATSQIHVPEAFIIVPLSREAWSKESNWM  133

Query  15   GYVAV  1
            GYVAV
Sbjct  134  GYVAV  138



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  378  IERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASK  199
            ++++K +  SIAE+W+ LSG  NW+GL DPL++DLR Y+IH G+M +ATY+ FN E ASK
Sbjct  25   VKKKKRNMGSIAEKWKYLSGEKNWEGLLDPLNIDLRRYIIHNGEMAQATYDAFNGEKASK  84

Query  198  YAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNW  19
            YAGSSRY   +LFAKV L+ GNP+KY VTK+ YATS   +PDAFI+K +  +AWS+ESNW
Sbjct  85   YAGSSRYGRKDLFAKVSLENGNPFKYSVTKFLYATSQVDVPDAFIVKSLSREAWSKESNW  144

Query  18   MGYVAV  1
            MGYVAV
Sbjct  145  MGYVAV  150



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   173 bits (438),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M + SIA+RW+ LSG  NWK L +PLD+DLR ++IHYG+M +ATY+ FN++ ASK+AGSS
Sbjct  1    MVAGSIAKRWKHLSGENNWKNLLEPLDIDLRRFIIHYGEMAQATYDAFNSQKASKFAGSS  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
             Y++   F+KVGLDKGNPYKY VTK+FYATS   LP+AFI+K +  +AWS+ESNWMGY+A
Sbjct  61   LYAKNGFFSKVGLDKGNPYKYTVTKFFYATSQIQLPEAFIVKSLSREAWSKESNWMGYIA  120

Query  3    V  1
            V
Sbjct  121  V  121



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -2

Query  372  RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYA  193
            R   +  SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+TFN+E AS++A
Sbjct  11   RMNKTMDSIAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFA  70

Query  192  GSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            GSSRY++ + F+KVG+D GNP+KY VTKY YATS   +PD FI+K +  +AWS+ESNWMG
Sbjct  71   GSSRYAKKDFFSKVGIDIGNPFKYYVTKYLYATSEIQVPDGFILKSLSREAWSKESNWMG  130

Query  12   YVAV  1
            YVAV
Sbjct  131  YVAV  134



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            SS SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+ FN E ASKYAGSSR
Sbjct  3    SSHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKYAGSSR  62

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            Y+  N F++VGL+KGN +KY VTK+ YATS   +P+AF+IK +  ++W +ESNWMGYVAV
Sbjct  63   YARKNFFSRVGLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWMGYVAV  122



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  369  RKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAG  190
            +K+ +SSIA++W  LSG  +WKGL DPLD+DLR Y+IHYG+M +A Y+ FN E ASKYAG
Sbjct  25   KKIMNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAG  84

Query  189  SSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGY  10
            SSRY++ + F+KVGL  GNP+ Y VTK+ YATS   +PDAFIIK    +AWSRESNW+GY
Sbjct  85   SSRYAKKSFFSKVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGY  144

Query  9    VAV  1
            VAV
Sbjct  145  VAV  147



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
             SIA RW++L+G  NWK L DPLD+DLR  +I YG+  +ATY+TFN+E AS +AGSSRYS
Sbjct  3    QSIATRWKLLNGQNNWKNLLDPLDVDLRRNIIQYGERAQATYDTFNSEKASMFAGSSRYS  62

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +AN F+K+GL+K NPYKY VTK+ YATS   +PDAFIIK +  +AWSRESNWMGYVAV
Sbjct  63   KANFFSKLGLEKANPYKYNVTKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAV  120



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  378  IERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASK  199
            ++++  SS SIA++W+ LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+ FN E  SK
Sbjct  35   VKKKMDSSRSIAKKWKHLSGEHNWEGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKTSK  94

Query  198  YAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNW  19
            YAGSSRY+  N F+KVGL+K NP+KY VTK+ YATS   +P+AF+IK +  ++W +ESNW
Sbjct  95   YAGSSRYARKNFFSKVGLEKANPFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNW  154

Query  18   MGYVAV  1
            M YVAV
Sbjct  155  MAYVAV  160



>ref|XP_010657149.1| PREDICTED: phospholipase A1-IIgamma-like [Vitis vinifera]
Length=407

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+RW  LSG  +WK L DPLD+DLR Y+IHYG+M +ATY+TFN E  SK+AGSS YS 
Sbjct  4    SIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF++VGL K NPY Y  TKY YATS   +P AFI+KPIP+DAWS++SNW+G+VAV
Sbjct  64   RNLFSQVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAV  120



>emb|CBI21954.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   168 bits (425),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+RW  LSG  +WK L DPLD+DLR Y+IHYG+M +ATY+TFN E  SK+AGSS YS 
Sbjct  4    SIAKRWRTLSGQDDWKTLLDPLDIDLRQYIIHYGEMAQATYDTFNREPKSKFAGSSIYSR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF++VGL K NPY Y  TKY YATS   +P AFI+KPIP+DAWS++SNW+G+VAV
Sbjct  64   RNLFSQVGLAKPNPYTYTPTKYLYATSEIKVPTAFILKPIPIDAWSKQSNWIGFVAV  120



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  438  FHG*NHKQKHHNIYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLI  259
            F G   K+    I P +   ++++  S+ SIA++W+ LSG   W GL DPL++DLR Y+I
Sbjct  6    FRGVYIKKAIRLILPTRMLGVKKKMDSNHSIAKKWKHLSGENKWDGLLDPLNIDLRRYII  65

Query  258  HYGQMTEATYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTL  79
            HYG+M +ATY+ FN+E  SKYAGSSRY+  N F+KVGL+KGNP+KY VTK+ YATS   +
Sbjct  66   HYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFSKVGLEKGNPFKYNVTKFVYATSQIQV  125

Query  78   PDAFIIKPIPLDAWSRESNWMGYVAV  1
            P+AF+IK +  ++W +ESNWM Y+AV
Sbjct  126  PEAFLIKSLSRESWCKESNWMAYIAV  151



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   167 bits (424),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            +SSIA++W  LSG  +WKGL DPLD+DLR Y+IHYG+M +A Y+ FN E ASKYAGSSRY
Sbjct  2    NSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIIHYGEMAQAAYDAFNTEKASKYAGSSRY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ + F+KVGL  GNP+ Y VTK+ YATS   +PDAFIIK    +AWSRESNW+GYVAV
Sbjct  62   AKKSFFSKVGLVNGNPFTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAV  120



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -2

Query  438  FHG*NHKQKHHNIYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLI  259
            F G   K+    I P +   ++++  S+ SIA++W+ LSG   W GL DPL++DLR Y+I
Sbjct  6    FRGVYIKKAIRLILPTRMLGVKKKMDSNHSIAKKWKHLSGENKWDGLLDPLNIDLRRYII  65

Query  258  HYGQMTEATYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTL  79
            HYG+M +ATY+ FN+E  SKYAGSSRY+  N F+KVGL+KGNP+KY VTK+ YATS   +
Sbjct  66   HYGEMAQATYDAFNSEKTSKYAGSSRYARKNFFSKVGLEKGNPFKYNVTKFVYATSQIPI  125

Query  78   PDAFIIKPIPLDAWSRESNWMGYVAV  1
            P+AF+IK +  ++W +ESNWM Y+AV
Sbjct  126  PEAFLIKSLSRESWCKESNWMAYIAV  151



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  387  KTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAEL  208
            KT+   +      I  +W +LSG  NW+GL DPLD+DLR  +IHYG+M +ATY+ F+ E 
Sbjct  4    KTKCLAQGYLKDEIPRKWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEK  63

Query  207  ASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRE  28
            AS++AGSSRY++ + F+KVGLDKGNP+KY VTK+ YATS   +PDAF+IKP+  +AW +E
Sbjct  64   ASRFAGSSRYAKRDFFSKVGLDKGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKE  123

Query  27   SNWMGYVAV  1
            SNW+GYVAV
Sbjct  124  SNWIGYVAV  132



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + +IAERW VLSG+ NW+GL DPLD DLR YLIHYG+M +A  + FN +  SKYAG SRY
Sbjct  5    NKNIAERWRVLSGNNNWEGLLDPLDNDLRRYLIHYGEMVQAIRDAFNNDETSKYAGCSRY  64

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            S+ NLF+KVG++  NP+KYEVTKY YATSS  +P+AFIIK +  +AWS+ESNW+G+VAV
Sbjct  65   SKKNLFSKVGIEISNPFKYEVTKYVYATSSIQVPEAFIIKSLSGEAWSKESNWIGFVAV  123



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I  RW +LSG  NW+GL DPLD+DLR  +IHYG+M +ATY+ F+ E AS++AGSSRY++ 
Sbjct  17   IPRRWRLLSGENNWEGLLDPLDIDLRRIIIHYGEMAQATYDAFDTEKASRFAGSSRYAKR  76

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + F+KVGLD GNP+KY VTK+ YATS   +PDAF+IKP+  +AW +ESNW+GYVAV
Sbjct  77   DFFSKVGLDNGNPFKYSVTKFLYATSEIHVPDAFLIKPLSREAWRKESNWIGYVAV  132



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -2

Query  372  RRKMSSS-SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            ++KM SS SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+ FN E ASKY
Sbjct  27   KKKMDSSHSIAKKWRHLSGQNNWQGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKY  86

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AGSSRY+  + F++V L+KGN +KY VTK+ YATS   +P+AF+IK +  ++W +ESNWM
Sbjct  87   AGSSRYARKSFFSRVCLEKGNAFKYNVTKFVYATSQIQVPEAFLIKSLSRESWCKESNWM  146

Query  15   GYVAV  1
            GYVAV
Sbjct  147  GYVAV  151



>ref|XP_010279084.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Nelumbo nucifera]
Length=459

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + SIA RW  L+G  NWK L DPLD+DLR  +IHYG+  +ATY+TFN+E AS +AGSSRY
Sbjct  2    ADSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            S+AN F+ + L+KGNPYKY +TK+ YATS   +PDAFIIK +  +AWSRESNWMGYVAV
Sbjct  62   SKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAV  120



>ref|XP_010279085.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + SIA RW  L+G  NWK L DPLD+DLR  +IHYG+  +ATY+TFN+E AS +AGSSRY
Sbjct  2    ADSIATRWRELNGEDNWKNLLDPLDIDLRRIIIHYGERAQATYDTFNSEKASMFAGSSRY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            S+AN F+ + L+KGNPYKY +TK+ YATS   +PDAFIIK +  +AWSRESNWMGYVAV
Sbjct  62   SKANFFSGLFLEKGNPYKYNITKFLYATSRIDVPDAFIIKSLSREAWSRESNWMGYVAV  120



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            +S  SI +RW+ LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+ FN E ASK+AGSS
Sbjct  36   ISKHSIVKRWKKLSGENNWEGLLDPLDIDLRKYIIHYGEMAQATYDAFNTERASKFAGSS  95

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY+  + F++VGL+K N ++Y VTK+ YATS   +P+AFI+K +  +AWS+ESNW+GYVA
Sbjct  96   RYARKSFFSRVGLEKANAFRYNVTKFLYATSQIQVPEAFIVKSLSREAWSKESNWIGYVA  155

Query  3    V  1
            V
Sbjct  156  V  156



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   165 bits (418),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI +RW +L+G  NWK L DPLD+DLR  +IHYG+M +ATY+TF  E ASK+AGSSRY+ 
Sbjct  4    SIDKRWRLLNGQENWKNLLDPLDIDLRRNIIHYGEMAQATYDTFITEKASKFAGSSRYAR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            A+ F+KVGL K NP+KY+VTK+ YATS   +P+AFIIK +  +AWSRESNWMGYVAV
Sbjct  64   ADFFSKVGLVKTNPFKYQVTKFLYATSRIEVPEAFIIKSLSREAWSRESNWMGYVAV  120



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  375  ERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            +++K   SSIA+RW+ LSG  +W  L DPLD+DLR Y+IHYG+M +ATY+ FN E ASK+
Sbjct  13   KKKKAMGSSIAKRWKPLSGQNHWGELLDPLDIDLRRYIIHYGEMAQATYDAFNNEKASKF  72

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AGSS Y + + F+KV L+KGNPY+Y+VTK+ YATS   LP+AFI+K    +AWS+ESNW+
Sbjct  73   AGSSLYGKEDFFSKVNLEKGNPYRYQVTKFLYATSQIQLPEAFIVKSSSREAWSKESNWI  132

Query  15   GYVAV  1
            GYVAV
Sbjct  133  GYVAV  137



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  375  ERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            + +K+ +SSIA++W  LSG  +WKGL DPLD+DLR Y+I YG+M +A Y+ FN E ASKY
Sbjct  21   KEKKIMNSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKY  80

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AGS RY++ + F+KV L  GNPY Y VTK+ YATS   +PDAFIIK    +AWSRESNW+
Sbjct  81   AGSCRYAKKSFFSKVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWI  140

Query  15   GYVAV  1
            GYVAV
Sbjct  141  GYVAV  145



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W+ L GS NWKGL +PL +DLR YLIHYGQM +ATY+TFN E ASK+AGSSRYS+ + FA
Sbjct  44   WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  103

Query  156  KVGLDKG--NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            K+GL+KG   PYKY VTK+ YATS   +PDAFI++ +  +AWS+ESNW+GYVAV
Sbjct  104  KIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAV  157



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            SSSIA +W+ LSG  +W GL DPLD+DLR Y+IHYG+M +ATY+ FN E ASK+AGS RY
Sbjct  17   SSSIANKWQQLSGENHWIGLLDPLDIDLRRYIIHYGEMAQATYDAFNTEKASKFAGSCRY  76

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ + F+KV L+ GNP+KY VTK+ YATS   +P+AFIIK +  +AWS+ESNW+G+VAV
Sbjct  77   AKNDFFSKVFLENGNPFKYSVTKFIYATSEINVPEAFIIKSLSREAWSKESNWIGFVAV  135



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 92/114 (81%), Gaps = 2/114 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W+ L GS NWKGL +PL +DLR YLIHYGQM +ATY+TFN E ASK+AGSSRYS+ + FA
Sbjct  50   WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKASKFAGSSRYSKQDFFA  109

Query  156  KVGLDKG--NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            K+GL+KG   PYKY VTK+ YATS   +PDAFI++ +  +AWS+ESNW+GYVAV
Sbjct  110  KIGLEKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAV  163



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  387  KTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAEL  208
            K  I  +K   SSIA++W  LSG ++WKGL +PLD+DLR Y+IHYG+M +A Y+ F +E 
Sbjct  20   KRGIGAKKKMDSSIAKKWRELSGQSHWKGLMEPLDIDLRRYIIHYGEMAQAAYDAFISEK  79

Query  207  ASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRE  28
             SKYAG SRY++ N F+KVGL  GN + Y VTK+ YATSS  LP+AFIIK    +AWSRE
Sbjct  80   VSKYAGCSRYAKRNFFSKVGLMNGNAFTYSVTKFLYATSSIDLPEAFIIKSFSREAWSRE  139

Query  27   SNWMGYVAV  1
            SNW+GYVAV
Sbjct  140  SNWIGYVAV  148



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  387  KTQIERRKMSS----SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETF  220
            +  +++RKM++    SSIA +W  LSG  NW GL  PLD+DLR Y+IHYG+M +ATY+ F
Sbjct  6    RNNLKKRKMNNNINRSSIANKWRQLSGENNWNGLLYPLDIDLRRYIIHYGEMAQATYDAF  65

Query  219  NAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDA  40
            N E ASK+AGS RY++ + F+KV L+ GNP+KY VTKY YATS   +P+AFIIK    +A
Sbjct  66   NTEKASKFAGSCRYAKNDFFSKVYLENGNPFKYNVTKYIYATSEMDVPEAFIIKSFSREA  125

Query  39   WSRESNWMGYVAV  1
            WS+ESNW+GYV V
Sbjct  126  WSKESNWIGYVGV  138



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -2

Query  405  NIYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYE  226
            N +  K+ +I        SIA+RW++LSG +NW+GL DPLDLDLR Y+IHYG M +ATY+
Sbjct  2    NCFKKKRRRIGGADKKEGSIAKRWKLLSGKSNWEGLLDPLDLDLRRYVIHYGTMAQATYD  61

Query  225  TFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPL  46
            TFN+E ASK+AGSSRY++ +LF+ VG+DKGNP+KY VTKYFYATSS  +PDAFI+     
Sbjct  62   TFNSENASKFAGSSRYAKNDLFSNVGMDKGNPFKYRVTKYFYATSSAQVPDAFIVPSWSR  121

Query  45   DAWSRESNWMGYVAV  1
            +AWS+ESNWMGYVAV
Sbjct  122  EAWSKESNWMGYVAV  136



>gb|AFK35349.1| unknown [Lotus japonicus]
Length=246

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA +W+ LSG  +W  L DPLD+DLR Y+IHYG+  +ATY+TFN E ASK AG++RY + 
Sbjct  38   IASKWQQLSGQDDWNNLLDPLDIDLRQYIIHYGERAQATYDTFNTEKASKNAGNTRYGKD  97

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + F+KV L++GNP+KY VTK+ YATS   LP+AFI+K +  +AWSRESNW+GYVAV
Sbjct  98   DFFSKVSLEQGNPFKYSVTKFLYATSKIDLPEAFIVKSLSREAWSRESNWIGYVAV  153



>ref|XP_010557126.1| PREDICTED: phospholipase A1-IIbeta isoform X2 [Tarenaya hassleriana]
Length=327

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA RW+ LSG   WKGL DPLD DLR Y++HYG+M E TY+ FN++  SKYAG S +S+ 
Sbjct  5    IARRWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKT  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  KGNPY+Y+VTK+FYATSS  LP +FI+K +  +AWS+ESNWMGY+AV
Sbjct  65   ELFARTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAV  120



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            + S+IA+RW +LSG  NW+GL DPL+ DLR Y+IHYG+M +A+Y+ FN+  ASK AG++R
Sbjct  8    TDSTIAKRWMLLSGKNNWEGLMDPLNYDLRRYIIHYGEMAQASYDNFNSNKASKNAGNNR  67

Query  180  YSEANLFAKVGLDKG-NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            YS+ NLF KVGLDK  NP+KY VTKY YATSS  +P+AFI+K +  ++WS+ESNW+G++A
Sbjct  68   YSKNNLFTKVGLDKDHNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESWSKESNWIGFIA  127

Query  3    V  1
            V
Sbjct  128  V  128



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            +SSIA++W  LSG  +WKGL DPLD+DLR Y+I YG+M +A Y+ FN E ASKYAGS RY
Sbjct  2    NSSIAKKWRQLSGQDHWKGLIDPLDIDLRRYIILYGEMAQAAYDAFNTEKASKYAGSCRY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ + F+KV L  GNPY Y VTK+ YATS   +PDAFIIK    +AWSRESNW+GYVAV
Sbjct  62   AKKSFFSKVALVNGNPYTYSVTKFLYATSEIDVPDAFIIKSFSREAWSRESNWIGYVAV  120



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W+ L GS NWKGL +PL +DLR YLIHYGQM +ATY+TFN E  SK+AGSSRYS+ + FA
Sbjct  50   WKQLMGSDNWKGLLEPLHIDLRRYLIHYGQMAQATYDTFNTEKVSKFAGSSRYSKQDFFA  109

Query  156  KVGLDKG--NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            K+GL KG   PYKY VTK+ YATS   +PDAFI++ +  +AWS+ESNW+GYVAV
Sbjct  110  KIGLGKGKTGPYKYRVTKFLYATSQVQVPDAFIVRSLSREAWSKESNWIGYVAV  163



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            ++AE+WE LSG  NW+GL +PLDLDLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS 
Sbjct  3    NMAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYSM  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF KVGLD   P KY VTK+FYATSS  LPDAFI+K +  +AWS+ESN+MGY+AV
Sbjct  63   ENLFTKVGLD---PLKYRVTKFFYATSSIPLPDAFIVKSLSREAWSKESNFMGYIAV  116



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = -2

Query  372  RRKMS------SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            +RKM        SSIA+RW +LSG  NW+GL DPLD +LR Y+IHYG+M +A+Y+ FN+ 
Sbjct  6    KRKMKKNTEKKDSSIAKRWMLLSGKNNWEGLMDPLDYNLRRYIIHYGEMAQASYDNFNSN  65

Query  210  LASKYAGSSRYSEANLFAKVGLDK--GNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAW  37
             ASK AG++RYS  N F KVGLDK   NP+KY VTKY YATSS  +P+AFI+K +  ++W
Sbjct  66   KASKNAGNNRYSRNNFFTKVGLDKDHNNPFKYRVTKYLYATSSIQVPEAFIVKSLSRESW  125

Query  36   SRESNWMGYVAV  1
            S+ESNW+G++AV
Sbjct  126  SKESNWIGFIAV  137



>gb|EPS68357.1| hypothetical protein M569_06414, partial [Genlisea aurea]
Length=191

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A RW++L+G   W+GL DPLD DLR ++IHYG+  +ATY+ FN+E ASKYAGS RY + +
Sbjct  1    ASRWKILNGQDRWEGLLDPLDPDLRRWIIHYGERAQATYDAFNSEKASKYAGSCRYLKRD  60

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F++ GL+ GNPY+Y VT+Y YATS+  +PDAF+++    +AWS+ESNWMGYVAV
Sbjct  61   FFSRAGLEVGNPYRYRVTRYLYATSNGAMPDAFLVRSWSREAWSKESNWMGYVAV  115



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+RW +L+G   WK L DPLD+DLR  +IHYG+M +ATY+ F  E  SK+AGSSRY++
Sbjct  3    SIAKRWRLLNGQEMWKNLLDPLDIDLRRSIIHYGEMAQATYDAFITEKVSKFAGSSRYAK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + F+KVGL   NPYKY VTK+ YATS   +P+AFIIK +  +AWSRESNWMGYVAV
Sbjct  63   RDFFSKVGLVNANPYKYNVTKFLYATSRMDVPEAFIIKSLSREAWSRESNWMGYVAV  119



>ref|XP_010557125.1| PREDICTED: phospholipase A1-IIbeta isoform X1 [Tarenaya hassleriana]
Length=403

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA RW+ LSG   WKGL DPLD DLR Y++HYG+M E TY+ FN++  SKYAG S +S+ 
Sbjct  5    IARRWKELSGEHKWKGLLDPLDNDLRRYIVHYGEMAEVTYDAFNSDRRSKYAGDSYFSKT  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  KGNPY+Y+VTK+FYATSS  LP +FI+K +  +AWS+ESNWMGY+AV
Sbjct  65   ELFARTGFLKGNPYRYKVTKFFYATSSVKLPGSFIVKSLSREAWSKESNWMGYIAV  120



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +SIAE+WE LSG  NWKGL +PLD++LR Y+I YG++ +ATY+TF ++ ASKYAGSSRYS
Sbjct  2    ASIAEKWEELSGKENWKGLLNPLDVNLRKYIIQYGELAQATYDTFISDRASKYAGSSRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + NLFAKVGLD   P  Y VTKYFYATSS+ LP+AF++K    +AWS+ESN+MGYVAV
Sbjct  62   KENLFAKVGLD---PEMYHVTKYFYATSSFPLPEAFMVKSWSREAWSKESNFMGYVAV  116



>ref|XP_004232963.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            AE+WE LSG  NW GL +PLDLDLR Y+IHYG++ +ATY+TF +E ASKYAG+SRYS  N
Sbjct  6    AEKWEELSGKNNWDGLLNPLDLDLRKYIIHYGELAQATYDTFISERASKYAGASRYSMEN  65

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F KVGLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGY+AV
Sbjct  66   FFTKVGLD---PKKYCVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYIAV  117



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = -2

Query  381  QIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELAS  202
            +++   +   +IAERW  LSG+ +W+GL DPLD DLR Y+IHYG M +AT + FN    S
Sbjct  30   KMQSADLDMGNIAERWRFLSGNNSWEGLLDPLDNDLRRYIIHYGGMAQATRDAFNTNKIS  89

Query  201  KYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESN  22
            KYAGS RYS+ NL ++VG++  NP+KYEVTKY YATSS  +P+A IIK +  +AWS+ESN
Sbjct  90   KYAGSCRYSKKNLLSQVGIEMSNPFKYEVTKYIYATSSVQVPEALIIKSLSREAWSKESN  149

Query  21   WMGYVAV  1
            W+G+VAV
Sbjct  150  WVGFVAV  156



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            + +AE+WE LSG  NW+GL +PLDLDLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    ACMAEKWEQLSGKDNWEGLLNPLDLDLRRYIIQYGELAQATYDTFITEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF  VGLD   P KY VTK+FYATSS  LPDAF++K +  +AWS+ESN+MGYVAV
Sbjct  62   MENLFTGVGLD---PLKYRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYVAV  116



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  372  RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYA  193
            ++   S+S+A++W +LSG  +W+ L DPL++DLR Y++HYG+M +A Y+ F AE  SK+A
Sbjct  13   KKTADSNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFA  72

Query  192  GSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            G  RY+  + F+KVGL+ GNPYKY VTK+ YATS   +PDAFI+K +  +AWS+ESNW+G
Sbjct  73   GGCRYARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIG  132

Query  12   YVAV  1
            YVAV
Sbjct  133  YVAV  136



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +AE+WE LSG  NW+GL  PLD+DLR Y+IHYG++ +ATY+TF  E ASKYAG+SRYS  
Sbjct  1    MAEKWEELSGKNNWEGLLHPLDVDLRKYIIHYGELAQATYDTFITERASKYAGASRYSME  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            NLF KVGLD   P KY VTK+FYAT+S  LPD FI+K +  +AWS+ESN+MGY+AV
Sbjct  61   NLFTKVGLD---PNKYRVTKFFYATASIPLPDGFIVKSLSREAWSKESNFMGYIAV  113



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  372  RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYA  193
            ++   S+S+A++W +LSG  +W+ L DPL++DLR Y++HYG+M +A Y+ F AE  SK+A
Sbjct  53   KKTADSNSVAKKWRILSGEDDWEHLLDPLNIDLRRYILHYGEMAQAAYDAFIAEKESKFA  112

Query  192  GSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            G  RY+  + F+KVGL+ GNPYKY VTK+ YATS   +PDAFI+K +  +AWS+ESNW+G
Sbjct  113  GGCRYARRDFFSKVGLELGNPYKYSVTKFLYATSQVQVPDAFIVKSLSREAWSKESNWIG  172

Query  12   YVAV  1
            YVAV
Sbjct  173  YVAV  176



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + +IA +W  LSG +NWKGL DPLD+DLR Y+IHYGQ+ +ATY+ FN+E  SKYAG+SRY
Sbjct  2    AGNIARKWRDLSGRSNWKGLLDPLDIDLRPYIIHYGQLAQATYDAFNSEKTSKYAGNSRY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + + F+KVGL+ GNP++Y+V K+ YATS  +  +AF++K    D+WS++SNW+GYVAV
Sbjct  62   PKKDFFSKVGLENGNPFRYDVKKFLYATSKASDAEAFLLKSFSKDSWSKQSNWIGYVAV  120



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 94/118 (80%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL +PLDLDLR Y+I YG+  E TY+TF +E ASKYAG+SRYS
Sbjct  2    ASMAEKWEQLSGKNNWEGLLNPLDLDLRKYIIQYGEKAEVTYDTFISETASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLFAKVGLD   P KY VTK+FYATSS  LP AF++K +  +AW++ESN+MGY+AV
Sbjct  62   MENLFAKVGLD---PSKYRVTKFFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAV  116



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK ++      +  IA+RW++LSG+  W+GL DPLDLDLR Y+IHYG+M +A Y+TFN+E
Sbjct  14   KKKRMVTGNKGAVGIAKRWKLLSGTNQWEGLLDPLDLDLRRYIIHYGEMAQAAYDTFNSE  73

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
             ASKYAGSSRY++ NLF+KVG+++ NP+KY VTKYFYATSS  +PDAFI+K    +AWSR
Sbjct  74   KASKYAGSSRYAKENLFSKVGIEQANPFKYRVTKYFYATSSTKVPDAFILKSWSREAWSR  133

Query  30   ESNWMGYVAV  1
            ESNW+GYVAV
Sbjct  134  ESNWIGYVAV  143



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            AERW +LSG+ NW+GL DPLD DLR YLI YG+M +A  + FN    SKYAGS RYS+ N
Sbjct  48   AERWRLLSGNNNWEGLLDPLDNDLRRYLIRYGEMAQAARDAFNTNKMSKYAGSCRYSKKN  107

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            LF++ G++  NP+KYEVTKY YATSS  +PDA  IK +  +AWS+ESNW+G+VAV
Sbjct  108  LFSRTGIEISNPFKYEVTKYIYATSSVQVPDALFIKSLSREAWSKESNWVGFVAV  162



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 91/116 (78%), Gaps = 3/116 (3%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +AE+WE LSG  NW+GL  PLD+DLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS  
Sbjct  1    MAEKWEELSGKNNWEGLLHPLDIDLRKYIIQYGELAQATYDTFITERASKYAGASRYSME  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            NLF KVGLD   P KY VTK+FYAT+S  LPDAFI+K    +AWS+ESN+MGY+AV
Sbjct  61   NLFTKVGLD---PNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAV  113



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            +   SIA +W++LSG+ NW+GL DPLDLDLR Y+IHYGQM++ATY+TFN+E ASKYAGSS
Sbjct  21   IRGDSIARKWKLLSGANNWQGLLDPLDLDLRKYIIHYGQMSQATYDTFNSEKASKYAGSS  80

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYT-LPDAFIIKPIPLDAWSRESNWMGYV  7
            RYS+ NL +KVG+DK NP+KY VTKY YATSS T +PDAFI++    +AW++ESNW+GYV
Sbjct  81   RYSKDNLLSKVGVDKANPFKYRVTKYVYATSSLTEVPDAFILRSWSREAWTKESNWIGYV  140

Query  6    AV  1
            AV
Sbjct  141  AV  142



>ref|XP_007153706.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
 gb|ESW25700.1| hypothetical protein PHAVU_003G058000g [Phaseolus vulgaris]
Length=399

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA +W  LSG +NWKGL DPLD+DLR Y+IHYGQ+ +ATY+ FN+E AS  AG+SRYS+
Sbjct  3    SIARKWRELSGRSNWKGLLDPLDIDLRRYIIHYGQLAQATYDGFNSEKASNLAGNSRYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
               F KVGL+ GNP+KY VTK+ YATS  +  + F+++    DAWS +SNW+GYVAV
Sbjct  63   REFFGKVGLENGNPFKYLVTKFLYATSKASDSEKFLLRSFSKDAWSLQSNWIGYVAV  119



>gb|EPS70940.1| hypothetical protein M569_03817 [Genlisea aurea]
Length=397

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            ++++I +RW+ LSG  NW+ L DPLD+DL+ Y+IHYG M +ATY+ FN++  S+ AG + 
Sbjct  4    TTNNIPQRWKSLSGDGNWRSLLDPLDVDLQQYIIHYGAMAQATYDNFNSDPVSRNAGCNI  63

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +S++N+F+ VGLDKGNP+KY VTKY YATSS  LP +F+ K +   AWS+ESNW+GYVAV
Sbjct  64   HSKSNMFSSVGLDKGNPFKYRVTKYIYATSSIALPLSFLCKSLSEKAWSKESNWIGYVAV  123



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 89/117 (76%), Gaps = 3/117 (3%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            S AE+WE LSG  NW GL +PLD+DLR Y+IHYG++  ATY+T   E ASKYAG+SRYS 
Sbjct  3    STAEKWEELSGKNNWDGLLNPLDVDLRKYIIHYGELAHATYDTLIMERASKYAGASRYSM  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             N F KVGLD   P KY VTK+FYAT+S  LPDAFI+K    +AWS+ESN+MGY+AV
Sbjct  63   ENFFTKVGLD---PNKYRVTKFFYATASIPLPDAFIVKSFSREAWSKESNFMGYIAV  116



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 94/118 (80%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +SIAE WE LSG  NWKGL +PLD +LR Y+I YG++ +ATY+TF +E ASKYAGSSRYS
Sbjct  2    TSIAENWEQLSGKENWKGLLNPLDFNLRKYIIQYGELAQATYDTFISERASKYAGSSRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + NLF +VGLD   P  Y +TKYFYATSS+ LP+AF+I+    +AWS+ESN+MG+VAV
Sbjct  62   KENLFKRVGLD---PEMYHITKYFYATSSFPLPEAFMIRSWSREAWSKESNFMGFVAV  116



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            S+AE+WE LSG  NW+GL +PLDLDLR Y+I YG++ +ATY+TF +E ASKYAG+SRYS 
Sbjct  3    SMAEKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSM  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             N F KVGLD   P KY VTK+FY TSS  LPDAF+ + +  +AWS+ESN+MGY+AV
Sbjct  63   ENFFTKVGLD---PSKYHVTKFFYGTSSIPLPDAFMTRSLSREAWSKESNFMGYIAV  116



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   154 bits (389),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S  IA+RW  LSG  +WKGL  PLD DLR Y+IHYG+M +A Y+TFN    SKYAG+S
Sbjct  30   IVSREIAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P+AF++ P+  + WS+ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>ref|XP_010529190.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
 ref|XP_010529191.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=425

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M+S  + +RW  LSG  +WK   +PLDL+LR Y+IHYG+M +ATY+TFNA   SKYAGSS
Sbjct  22   MASRPLGKRWRDLSGRNHWKDALEPLDLELRQYIIHYGEMAQATYDTFNANTKSKYAGSS  81

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + F+KVGL+KG+PY KY+VTK+ Y+TS  ++PD+F++ P+  + W++ESNW+GYV
Sbjct  82   IYSRQDFFSKVGLEKGHPYCKYQVTKFLYSTSQISVPDSFLVFPVSREGWTKESNWIGYV  141

Query  6    AV  1
            AV
Sbjct  142  AV  143



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            SS+AE+WE LSG   W+GL +PLD+DLR Y+I YG++ E TY+TF ++  SKYAG+SRYS
Sbjct  2    SSMAEKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAEVTYDTFISDKVSKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF+ VGLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGY+AV
Sbjct  62   MENLFSNVGLD---PSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAV  116



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
             S+AE+WE L G  NW GL +PL +DLR Y+IHYG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    GSMAEKWEELGGKNNWNGLLNPLAVDLRKYIIHYGELAQATYDTFIMERASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              N F KVGLD   P KY VTK+FYATSS  LPD FI+K    +AWS+ESN+MGY+AV
Sbjct  62   MENFFTKVGLD---PNKYRVTKFFYATSSIPLPDGFIVKSFSREAWSKESNFMGYIAV  116



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S  IA+RW  LSG  +WKGL  PLD DLR Y+IHYG+M +A Y+TFN    SKYAG+S
Sbjct  30   IVSREIAKRWRDLSGQNHWKGLLQPLDQDLRQYIIHYGEMAQAGYDTFNINTESKYAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P+AF++ P+  + WS+ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPEAFLLFPVSREGWSKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>ref|XP_006362445.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A++WE LSG  NW GL +PLDLDLR Y+I YG++ +ATY+TF +E ASKYAG+SRYS  N
Sbjct  6    ADKWEELSGKNNWDGLLNPLDLDLRKYIIQYGELAQATYDTFISERASKYAGASRYSMEN  65

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F KVGLD   P KY VTKYFYATSS  LPDAFI K    +AWS+ESN+MGY+AV
Sbjct  66   FFTKVGLD---PKKYCVTKYFYATSSMPLPDAFITKSFSREAWSKESNFMGYIAV  117



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +I ERW +LSG++NW+GL DPLD DLR YLI YG+MT+A  + FN    SKYAG+ RYS+
Sbjct  44   NITERWRILSGNSNWEGLLDPLDNDLRRYLIRYGEMTQAARDAFNTNKISKYAGTCRYSK  103

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             N F++ G++  NP+KYEVTKY YATS+  +P+A  IK +  +AWS+ESNW G+VAV
Sbjct  104  KNFFSRTGIEISNPFKYEVTKYIYATSAVQVPEALFIKSLSREAWSKESNWAGFVAV  160



>ref|XP_009628626.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=394

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL +PLDLDLR YLI YG++ +ATY+TF  E  SK AG+SRYS
Sbjct  2    ASMAEKWEQLSGKNNWEGLLNPLDLDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF +VGLD   P KY VTK+FYATSS  LPD   ++ + L+AWS+ESN+MGYVAV
Sbjct  62   MENLFTRVGLD---PLKYRVTKFFYATSSIPLPDGLFVRSLSLEAWSKESNFMGYVAV  116



>ref|XP_010518796.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Tarenaya 
hassleriana]
Length=383

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI   W  LSG +NWKGL  PLD DLR Y+IHYG+M +ATY+TFN+   SKYAGSS YS 
Sbjct  4    SIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSR  63

Query  171  ANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + F+KVGL+K NPY KY+VTK+ YATS   +PD+F++ P+  +  ++ESNWMGYVAV
Sbjct  64   QDFFSKVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAV  121



>ref|XP_006364324.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=398

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
             S+AE+WE LSG   W+GL +PLD+DLR Y+I YG++   TY+TF +E ASKYAG+SRYS
Sbjct  2    GSMAEKWEELSGKNKWEGLLNPLDVDLRRYIIQYGELAHVTYDTFISEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF+K GLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGY+AV
Sbjct  62   MENLFSKAGLD---PTKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAV  116



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 92/118 (78%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL DPLD+DLR Y+I YG++   TY+TF  E ASKYAG+SRYS
Sbjct  2    ASMAEKWEQLSGKNNWEGLLDPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF + GLD   P KY+VTKYFYATSS  LP AF++K +  +AW++ESN+MGY+AV
Sbjct  62   MENLFTRAGLD---PLKYKVTKYFYATSSIPLPSAFLVKSLSREAWNKESNFMGYIAV  116



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI   W  LSG +NWKGL  PLD DLR Y+IHYG+M +ATY+TFN+   SKYAGSS YS 
Sbjct  4    SIGRGWRDLSGESNWKGLLQPLDQDLRQYIIHYGEMAQATYDTFNSNTKSKYAGSSIYSR  63

Query  171  ANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + F+KVGL+K NPY KY+VTK+ YATS   +PD+F++ P+  +  ++ESNWMGYVAV
Sbjct  64   QDFFSKVGLEKNNPYSKYQVTKFLYATSQIEVPDSFLVFPVSREGRTKESNWMGYVAV  121



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            SS+A++WE LSG   W+GL +PLD+DLR Y+I YG++   TY+TF  E ASKYAG+SRYS
Sbjct  2    SSMADKWEELSGKNKWEGLLNPLDVDLRKYIIQYGELAHVTYDTFITEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF+K GLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGY+AV
Sbjct  62   MENLFSKAGLD---PSKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAV  116



>ref|XP_010518797.1| PREDICTED: phospholipase A1-IIgamma-like [Tarenaya hassleriana]
Length=437

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK  + +    S+SIA+RW  LSG ++W GL +PLDLDLR Y++HYG+M +A Y+TFN+ 
Sbjct  27   KKEPVSKPPAKSASIAQRWRDLSGQSHWNGLLEPLDLDLRQYIVHYGEMVQAAYDTFNSC  86

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWS  34
              S+YAGSS YS  + F+KVG+  GNPY KY+VTK+ YATS   +P AF++ P     W+
Sbjct  87   TESQYAGSSIYSRQDFFSKVGIVNGNPYCKYQVTKFLYATSEARMPGAFMVFPASGQGWT  146

Query  33   RESNWMGYVAV  1
            ++SNW+GYVAV
Sbjct  147  KQSNWIGYVAV  157



>ref|XP_003528482.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31003.1| Phospholipase A1-IIgamma [Glycine soja]
Length=408

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA +W  LSG +NWKGL DPLD DLR Y+IHYGQ+ +A Y+ FN E ASK AG+SRY+ 
Sbjct  3    TIARKWRDLSGQSNWKGLLDPLDTDLRRYIIHYGQLAQAAYDAFNTEKASKCAGNSRYAM  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ F+KVGL+ GN +KY VTK+ YAT      ++FI+K    DAWS+ESNW+GYVAV
Sbjct  63   SDFFSKVGLENGNCFKYVVTKFLYATCKAGASESFILKSFNKDAWSQESNWIGYVAV  119



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            + +AE+WE LSG  NW+ L +PLDLDLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    ACMAEKWEQLSGKDNWEALLNPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF  VG D   P KY VTK+FYATSS  LPDAF++K +  +AWS+ESN+MGY+AV
Sbjct  62   MENLFTGVGHD---PLKYRVTKFFYATSSIPLPDAFVVKSLSREAWSKESNFMGYIAV  116



>ref|XP_009757707.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=394

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL +PLD DLR YLI YG++ +ATY+TF  E  SK AG+SRYS
Sbjct  2    ASMAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF +VGLD   P KY VTK+FYATSS  LPD F ++ + L+AWS++SN+MGYVAV
Sbjct  62   LENLFTRVGLD---PLKYRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAV  116



>ref|XP_009757709.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=397

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL +PLD DLR YLI YG++ +ATY+TF  E  SK AG+SRYS
Sbjct  2    ASMAEKWEQLSGKNNWEGLLNPLDFDLRKYLIQYGELAQATYDTFITEEKSKNAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF +VGLD   P KY VTK+FYATSS  LPD F ++ + L+AWS++SN+MGYVAV
Sbjct  62   LENLFTRVGLD---PLKYRVTKFFYATSSIPLPDGFFVRSLSLEAWSKDSNFMGYVAV  116



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 90/116 (78%), Gaps = 3/116 (3%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +AE+WE LSG  NW+GL +PLD+DLR Y+I YG+  E TY+TF ++  SKYAG+SRYS  
Sbjct  1    MAEKWEELSGKNNWEGLLNPLDVDLRKYIIQYGEKAEVTYDTFISDKVSKYAGASRYSME  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            NLF+ VGLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGYVAV
Sbjct  61   NLFSNVGLD---PSKYRVTKYFYATSSMPLPDAFITKSLSREAWSKESNFMGYVAV  113



>ref|XP_004505133.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Cicer arietinum]
Length=364

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA +W  LSG + WKGL DPL +DLR YL+HYGQ+ ++TY+ FN+E ASKYAG+  YS+
Sbjct  3    SIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
             +LF+KV L+KGNP+KY +TK+ YATS  +  ++F+++ I   DAWS ESNW+GYVAV
Sbjct  63   KDLFSKVNLEKGNPFKYSITKFIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAV  120



>ref|XP_010696586.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=432

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            S  IA+ W+ LSG  NW GL  PLD+DLR Y+IHYG+M+++TY+TFN+   SKY GSS Y
Sbjct  22   SHHIAKEWKELSGENNWDGLLSPLDMDLRRYVIHYGEMSQSTYDTFNSSKLSKYGGSSIY  81

Query  177  SEANLFAKVGLDKGN--PYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            S+ + F+KVGL KGN  PYKY VTKY YATS   +PDAFI+K    +AWS+ESN++GYVA
Sbjct  82   SKKDFFSKVGLVKGNNDPYKYRVTKYLYATSGIDVPDAFILKSSSREAWSKESNFIGYVA  141

Query  3    V  1
            V
Sbjct  142  V  142



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IAERW  LSG+ +W+GL +PLD DLR YLIHYG+M +AT + FN    SKYAGS RYS+
Sbjct  29   NIAERWRFLSGNNSWEGLLNPLDDDLRRYLIHYGEMAQATRDAFNTNKLSKYAGSCRYSK  88

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NL ++ G++  NP+ YEVTKY YATSS  +P+A  IK +  +AWS+ESNW+G+VAV
Sbjct  89   KNLLSRAGIEMPNPFNYEVTKYIYATSSVQVPEALFIKSLSREAWSKESNWVGFVAV  145



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S  IA++W  LSG  +WKG+  PLD DLR Y++HYG+M +A Y+TFN    SK+AG+S
Sbjct  12   IVSKEIAKKWRDLSGQNHWKGMLHPLDQDLRQYIVHYGEMAQAGYDTFNTNTESKFAGAS  71

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K NPY KY+VTK+ YATS   +PD+F++ P+  + W++ESNWMGYV
Sbjct  72   IYSRKDFFAKVGLEKANPYTKYKVTKFLYATSQIHVPDSFLLFPVSREGWTKESNWMGYV  131

Query  6    AV  1
            AV
Sbjct  132  AV  133



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M S SI  +W  LSG +NW+G+ DPLD+DLR Y++HYGQ+ +ATY+ FN+E  S +AG+ 
Sbjct  1    MDSHSIGRKWRDLSGRSNWEGMLDPLDIDLRQYILHYGQLAQATYDAFNSEKLSMHAGNC  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY++ + F+KVGL+ GNP+KYEVT++ YATS  T    F +K    D W  ESNW+GYVA
Sbjct  61   RYAKRDFFSKVGLEHGNPFKYEVTEFLYATSKATASKQFALKLFSKDEWGMESNWIGYVA  120

Query  3    V  1
            V
Sbjct  121  V  121



>ref|XP_004505132.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Cicer arietinum]
Length=401

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA +W  LSG + WKGL DPL +DLR YL+HYGQ+ ++TY+ FN+E ASKYAG+  YS+
Sbjct  3    SIARKWRELSGESKWKGLLDPLKIDLRKYLLHYGQLAQSTYDAFNSEKASKYAGNCLYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
             +LF+KV L+KGNP+KY +TK+ YATS  +  ++F+++ I   DAWS ESNW+GYVAV
Sbjct  63   KDLFSKVNLEKGNPFKYSITKFIYATSKASDSESFLLRSILSKDAWSMESNWIGYVAV  120



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   150 bits (378),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 91/118 (77%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +S+AE+WE LSG  NW+GL +PLD+DLR Y+I YG++   TY+TF  E ASKYAG+SRYS
Sbjct  2    ASMAEKWEHLSGKNNWEGLLNPLDVDLRKYIIQYGELAHVTYDTFIDEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              NLF + GLD   P  Y+VTKYFYATSS  LP AF++K +  +AWS+ESN+MGY+AV
Sbjct  62   MENLFTRAGLD---PLNYKVTKYFYATSSIPLPSAFLVKSLSREAWSKESNFMGYIAV  116



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW +LSG  NWK L DPLD+DLR Y++HYG M +ATY++FN+   SK+AG S +S 
Sbjct  4    NIATRWRLLSGEDNWKNLLDPLDIDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF++VGL   NPYKY +TK+ YATS   + +AF+++ +  +AW++ESNW+GY+AV
Sbjct  64   KNLFSRVGLAIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAV  120



>gb|AFK39140.1| unknown [Medicago truncatula]
Length=196

 Score =   144 bits (364),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA  W  LSG + WKGL +PL +DLR YL+HYGQ  +ATY+ FN E ASKYAG+ RYS+
Sbjct  3    SIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
             + F+KV L+KGNP+KY VTKY YATS      AF++  I   DAWS E+NWMGYVAV
Sbjct  63   KDFFSKVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAV  120



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            + +AE+WE LSG +NW GL  PL +DLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    AGMAEKWEELSGKSNWDGLVHPLAVDLRKYIIQYGELAQATYDTFITERASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              N F KVGLD   P KY VTK+FYAT+S  LPDAFI +    +AWS+ESN+MGYVAV
Sbjct  62   NENFFTKVGLD---PNKYGVTKFFYATASIPLPDAFITRSFSREAWSKESNFMGYVAV  116



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW +LSG  NWK L DPLD+DLR Y++HYG M +ATY++FN+   SK+AG S +S 
Sbjct  85   NIATRWRLLSGEDNWKSLLDPLDVDLRQYILHYGDMAQATYDSFNSNRLSKFAGDSHFSR  144

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF++VGL   NPYKY +TK+ YATS   + +AF+++ +  +AW++ESNW+GY+AV
Sbjct  145  KNLFSRVGLSIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNWIGYIAV  201



>emb|CDP11819.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I  RW +LSG  NWK L DPLD+DLR Y+IHYG+  +ATY+TF+ E ASKYAGSS Y   
Sbjct  5    IPRRWRLLSGQDNWKNLLDPLDIDLRRYIIHYGERAQATYDTFDHEKASKYAGSSLYKPD  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LF  VGL K NP+KY+V KY YATS  ++PDAFI K +  D+  +ESN+MGYVAV
Sbjct  65   VLFKSVGLCKRNPFKYKVVKYLYATSKISVPDAFIEKSLSKDSVCKESNFMGYVAV  120



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S  IA+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  31   IVSREIAKRWRELSGQNHWKGMLHPLDQDLRQYIIHYGEMAQAGYDTFNINTESKFAGAS  90

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + F+KVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  91   IYSRKDFFSKVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPMSREGWTKESNWMGYV  150

Query  6    AV  1
            AV
Sbjct  151  AV  152



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            ++S  IA+RW  LSG  +WKGL  PLD DLR YLIHYG+M +A Y+TFN    SK+AGSS
Sbjct  29   IASRGIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSS  88

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ +ATS   +P++F++ P+  +  ++ESNW+GYV
Sbjct  89   IYSRKDFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYV  148

Query  6    AV  1
            AV
Sbjct  149  AV  150



>ref|XP_009108369.1| PREDICTED: phospholipase A1-IIgamma [Brassica rapa]
Length=434

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            ++S  IA+RW  LSG  +WKGL  PLD DLR YLIHYG+M +A Y+TFN    SK+AGSS
Sbjct  29   IASRGIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSKFAGSS  88

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ +ATS   +P++F++ P+  +  ++ESNW+GYV
Sbjct  89   IYSRKDFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYV  148

Query  6    AV  1
            AV
Sbjct  149  AV  150



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            S+A++WE LSG  NW+GL +PLDLDLR Y+I YG++ +A  +TF  E ASKYAG+SRYS 
Sbjct  3    SMADKWEELSGKNNWEGLLNPLDLDLRKYIIQYGELAQAINDTFITEKASKYAGASRYSM  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDA-FIIKPIPLDAWSRESNWMGYVAV  1
             NLF KVGLD   P KY VTKYFYAT+S  LPD  F +K +  +AWS+ESN+MGY+AV
Sbjct  63   ENLFTKVGLD---PTKYRVTKYFYATASIPLPDGVFFVKSLSREAWSKESNFMGYIAV  117



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 4/117 (3%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS-E  172
            +AE+WE LSG  NW GL +PLD+DLR Y+I YG++ +A Y+TF  E ASKYAG+SRYS E
Sbjct  1    MAEKWEELSGKNNWDGLLNPLDIDLRKYIIQYGELCQAIYDTFITETASKYAGASRYSME  60

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
               F + GLD   P KY VTKYFYATSS  LPDAFI K +  +AWS+ESN+MGY+AV
Sbjct  61   KPFFTRFGLD---PNKYRVTKYFYATSSIPLPDAFITKSLSREAWSKESNFMGYIAV  114



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S+ IA+RW  LSG  +W G+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  28   IVSTEIAKRWRDLSGQNHWNGMLQPLDQDLREYVIHYGEMAQAGYDTFNINTESKFAGAS  87

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VT++ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  88   IYSRKDFFAKVGLEKAHPYTKYKVTRFLYATSQIHVPESFLLFPLSREGWTKESNWMGYV  147

Query  6    AV  1
            AV
Sbjct  148  AV  149



>ref|XP_009137120.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=349

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S+ IA+RW  L+G  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  28   IVSTEIAKRWRDLNGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGAS  87

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  +  ++ESNWMGYV
Sbjct  88   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSQIHVPESFLLFPLSREGCTKESNWMGYV  147

Query  6    AV  1
            AV
Sbjct  148  AV  149



>ref|XP_010496242.1| PREDICTED: phospholipase A1-IIgamma [Camelina sativa]
Length=435

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  30   IVAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>ref|XP_010686472.1| PREDICTED: phospholipase A1-II 1-like [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -2

Query  402  IYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYET  223
            I P   T    R      IA++WE+L G  +W+G  DPLD+DLR  +IHYG+M +ATY+T
Sbjct  21   IRPPHNTH--HRSSDDGYIADKWELLMGRNHWEGQLDPLDIDLRRNIIHYGEMAQATYDT  78

Query  222  FNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLD  43
            F  E  SK+AG+SR+++ N FAK+GL+ G+PYKY VTK+ YATS   +PDA+I K + ++
Sbjct  79   FIREKYSKHAGASRFNKNNFFAKLGLELGHPYKYCVTKFIYATSGLEMPDAYIFKSLSIE  138

Query  42   AWSRESNWMGYVAV  1
             W  +SN+MG+VAV
Sbjct  139  PWCEDSNFMGFVAV  152



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S   A+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    S++AG+S
Sbjct  13   IVSREFAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTDSQFAGAS  72

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  73   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSEIHVPESFLLFPVSREGWTKESNWMGYV  132

Query  6    AV  1
            AV
Sbjct  133  AV  134



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  30   IVAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  30   IVAKEFAKRWRDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>emb|CDY34061.1| BnaC03g62710D [Brassica napus]
Length=402

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            ++S  IA+RW  LSG  +WKGL  PLD DLR YLIHYG+M +A Y+TFN    S++AGSS
Sbjct  29   IASRGIAKRWRDLSGQNHWKGLLQPLDQDLRQYLIHYGEMAQAGYDTFNINTQSEFAGSS  88

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ +ATS   +P++F++ P+  +  ++ESNW+GYV
Sbjct  89   IYSRKDFFAKVGLEKAHPYTKYKVTKFLFATSQIHVPESFLLFPVSREGCTKESNWIGYV  148

Query  6    AV  1
            AV
Sbjct  149  AV  150



>ref|XP_003608120.1| Lipase [Medicago truncatula]
 gb|AES90317.1| phospholipase A1 [Medicago truncatula]
Length=408

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  366  KMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGS  187
            K    SIA+ W  LSG + WKGL +PL +DLR YL+HYGQ  +ATY+ FN E ASKYAG+
Sbjct  7    KKDMGSIAKTWRELSGKSKWKGLLEPLHIDLRKYLLHYGQFAQATYDAFNFEKASKYAGN  66

Query  186  SRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGY  10
             RYS+ + F+KV L++GNPYKY VTKY YATS  +   AF++  I   DAWS ESNW+GY
Sbjct  67   CRYSKKDFFSKVYLEEGNPYKYSVTKYLYATSKASDSAAFLLTSIFSKDAWSLESNWIGY  126

Query  9    VAV  1
            VAV
Sbjct  127  VAV  129



>ref|XP_003608122.1| Lipase [Medicago truncatula]
Length=387

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA  W  LSG + WKGL +PL +DLR YL+HYGQ  +ATY+ FN E ASKYAG+ RYS+
Sbjct  3    SIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
             + F+KV L+KGNP+KY VTKY YATS      AF++  I   DAWS E+NWMGYVAV
Sbjct  63   KDFFSKVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAV  120



>gb|AFK47098.1| unknown [Medicago truncatula]
 gb|AES90319.2| phospholipase A1 [Medicago truncatula]
Length=400

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA  W  LSG + WKGL +PL +DLR YL+HYGQ  +ATY+ FN E ASKYAG+ RYS+
Sbjct  3    SIARTWRELSGKSKWKGLLEPLHIDLRRYLLHYGQFAQATYDGFNFEKASKYAGNCRYSK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
             + F+KV L+KGNP+KY VTKY YATS      AF++  I   DAWS E+NWMGYVAV
Sbjct  63   KDFFSKVYLEKGNPFKYSVTKYLYATSKARDSAAFLLTSIFSKDAWSLETNWMGYVAV  120



>ref|XP_010501341.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=424

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ L+G   W+GL DPLD DLR YLIHYG+M++  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY YAT+S  LP  FI+KP+  DA   ++NWMGY+AV
Sbjct  65   QLFARTGFIKANPFRYEVTKYIYATASINLPICFIVKPLSKDASRVQTNWMGYIAV  120



>ref|XP_010446304.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010446311.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=309

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+ W  LSG  +WKG   PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  30   IVAKEFAKSWRDLSGLNHWKGTLQPLDQDLREYIIHYGEMGQAGYDTFNINTESKFAGAS  89

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+K +PY KY+VTK+ YATS   +P++F++ P+  + W++ESNWMGYV
Sbjct  90   IYSRKDFFAKVGLEKAHPYTKYKVTKFLYATSQVHVPESFLLFPVSREGWTKESNWMGYV  149

Query  6    AV  1
            AV
Sbjct  150  AV  151



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+RW  LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    S++AG+S
Sbjct  14   IVTREFAKRWRDLSGQNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESQFAGAS  73

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+  +PY KY+VTK+ YATS   +P++F++ PI  + WS+ESNWMGYV
Sbjct  74   IYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYV  133

Query  6    AV  1
            AV
Sbjct  134  AV  135



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            +++SIA+RW+ LSG  +WK L DPLD+DLR+Y+IHYG+M +A Y+ FN + ASK AGSS 
Sbjct  24   NNNSIAKRWKHLSGEHHWKDLLDPLDIDLRHYIIHYGEMAQAAYDAFNTQKASKNAGSSL  83

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            Y++   F+KVGL+ GNPYKY+VTK+ YATS   LP+AFIIK +  +AWS+ESNWMGYVAV
Sbjct  84   YTKEAFFSKVGLENGNPYKYQVTKFLYATSQIQLPEAFIIKSLSREAWSKESNWMGYVAV  143



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  375  ERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            +++ M   SI +RW+ LSG  +WK L DPLD DLR Y+IHYG+M +ATY+ FNA+ ASKY
Sbjct  13   KKKTMLVGSIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDGFNAQKASKY  72

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AGSS Y++ + F KV L+KGNP+KY VTK+ YATS   LP+AFI+K +  +AWS+ESNW+
Sbjct  73   AGSSLYAKDDFFTKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWI  132

Query  15   GYVAV  1
            G+VAV
Sbjct  133  GFVAV  137



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + S   A+RW+ LSG  +WKG+  PLD DLR Y+IHYG+M +A Y+TFN    SK+AG+S
Sbjct  35   IVSREFAKRWKDLSGLNHWKGMLQPLDQDLREYIIHYGEMAQAGYDTFNINTESKFAGAS  94

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             Y+  + FAKV L+K +PY KY+VTK+ YATS   +P++F++ PI  + W++ESNWMGYV
Sbjct  95   IYARKDFFAKVCLEKAHPYTKYKVTKFLYATSEVHVPESFLLFPISREGWTKESNWMGYV  154

Query  6    AV  1
            AV
Sbjct  155  AV  156



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            MS   IA+RW++LSG   W+GL DPLDLDLR YLIHYG+M +ATY+TF  E  SKYAG S
Sbjct  1    MSVEDIAKRWKLLSGQQKWEGLLDPLDLDLRRYLIHYGEMAQATYDTFIMEKVSKYAGDS  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RYS  NLF++VGL   NP+ Y+  KY YATS   +P++FI+KP+  DAW+RESNW+GY+A
Sbjct  61   RYSMKNLFSEVGLVLNNPFVYQPVKYLYATSKIDVPESFILKPLSRDAWNRESNWIGYIA  120

Query  3    V  1
            V
Sbjct  121  V  121



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   144 bits (362),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = -2

Query  375  ERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            +++ +   SI +RW+ LSG  +WK L DPLD DLR Y+IHYG+M +ATY++FNA+ ASKY
Sbjct  13   KKKTILVGSIDKRWKHLSGENHWKDLLDPLDNDLRRYIIHYGEMAQATYDSFNAQKASKY  72

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
            AGSS Y++ + F+KV L+KGNP+KY VTK+ YATS   LP+AFI+K +  +AWS+ESNW+
Sbjct  73   AGSSLYAKDDFFSKVHLEKGNPFKYRVTKFLYATSQVQLPEAFIVKSLSREAWSKESNWI  132

Query  15   GYVAV  1
            G+VAV
Sbjct  133  GFVAV  137



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -2

Query  342  ERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANL  163
            + W+ LSG  NW+GL DPLD++LR  +I YG+M +A+Y+TFN+   SKYAGSSRY++ + 
Sbjct  11   KNWKNLSGQNNWEGLLDPLDINLRRSIIRYGEMAQASYDTFNSTNISKYAGSSRYTKKDF  70

Query  162  FAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            F KVGL  G PYKY VTK+ YATS   LP AF+ K +  +AWS+ESN++GYVAV
Sbjct  71   FTKVGLAMGKPYKYRVTKFLYATSGIDLPSAFMFKSLSREAWSKESNFIGYVAV  124



>ref|XP_002892328.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68587.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+VLSG   W+GL DPLD DLR Y+IHYG+M++  Y+ FN +  SKYAG   YS+ 
Sbjct  5    IPKRWKVLSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSKYAGDCYYSKN  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  65   QLFARTGFLKANPFRYNVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAV  120



>ref|XP_010475356.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
 ref|XP_010475357.1| PREDICTED: phospholipase A1-IIalpha-like [Camelina sativa]
Length=423

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            + IA+RW+ L+G   W+GL DPLD DLR YLIHYG+M++  Y+ FN +  S+YAG   YS
Sbjct  3    NDIAKRWKELNGQKKWQGLLDPLDPDLRRYLIHYGEMSQVGYDAFNWDRKSRYAGDCYYS  62

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +  LFA+ G  K NP++YEVTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  63   KKQLFARTGFIKANPFRYEVTKYIYATASLNLPICFIVKSLSKDASRVQTNWMGYIAV  120



>gb|AAM61647.1| lipase-like protein [Arabidopsis thaliana]
Length=423

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+VLSG   WKGL DPLD DLR Y+IHYG+M++  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKN  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++Y+VTKY YAT+S  LP +FI+K +  DA   ++NWMGY+AV
Sbjct  65   RLFARTGFLKANPFRYKVTKYIYATASIKLPISFIVKSLSKDASHVQTNWMGYIAV  120



>ref|XP_006362439.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=419

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 87/130 (67%), Gaps = 13/130 (10%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK  IE R    +SIAERWE+L+G  NW+GL DPLD DLR YLIHYGQM +A  ++FN+E
Sbjct  21   KKKGIENR---DNSIAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSE  77

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
            +ASK  G++RYS+ N F +VGLDK NP+KYEVTKY Y  S        I          +
Sbjct  78   IASKNLGTNRYSKKNFFKRVGLDKNNPFKYEVTKYIYGASDVPSKTEKI----------K  127

Query  30   ESNWMGYVAV  1
             SNW+G+VAV
Sbjct  128  SSNWIGFVAV  137



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+RW+ LSG  NWK L DPLD DLR+Y+IHYG+M +ATY++FN + ASKYAG S Y++
Sbjct  4    SIAKRWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKASKYAGCSLYAK  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
               F +V L+KGNP+KY VTK+ YATS   + +AFIIK +  +AWS+ESNWMG+VAV
Sbjct  64   DEFFNRVHLEKGNPFKYRVTKFVYATSQVHISEAFIIKSLSREAWSKESNWMGFVAV  120



>ref|XP_004232958.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=419

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 13/130 (10%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK  IE R    +S+AERWE+L+G  NW+GL DPLD DLR YLIHYGQM +A  ++FN+E
Sbjct  21   KKKGIENR---DNSVAERWEILNGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNSE  77

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
            +ASK  G++RYS+ N F +VGLDK NP+KYEVTKY Y  S        I          +
Sbjct  78   IASKNLGTNRYSKKNFFKRVGLDKNNPFKYEVTKYIYGASDVPSKTEKI----------K  127

Query  30   ESNWMGYVAV  1
             SNW+G+VAV
Sbjct  128  SSNWIGFVAV  137



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + SIA+RW VL G  +WKGL DPLD+DLR  L+ YG+M +A Y+ F  +  S++AG+  Y
Sbjct  2    TGSIAKRWRVLQGKDSWKGLLDPLDVDLRRSLVLYGEMAQAVYDGFIRQKKSRFAGAPLY  61

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + +N+  KV L +G    Y VTK+FYATS   +PDAFIIK +   AWS++SNWMGYVAV
Sbjct  62   ARSNILQKVALSQGQERLYRVTKFFYATSGVQVPDAFIIKSLSRQAWSKDSNWMGYVAV  120



>ref|NP_172115.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
 sp|Q9LNC2.1|PLA18_ARATH RecName: Full=Phospholipase A1-IIalpha [Arabidopsis thaliana]
 gb|AAF80222.1|AC025290_11 Contains similarity to petal abundant lipase-like protein Pn47p 
mRNA from Ipomoea nil gb|U55867 and contains a lipase PF|01764 
domain [Arabidopsis thaliana]
 gb|AEE27968.1| phospholipase A1-IIalpha [Arabidopsis thaliana]
Length=423

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+VLSG   WKGL DPLD DLR Y+IHYG+M++  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKN  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             L A+ G  K NP++Y+VTKY YAT+S  LP +FI+K +  DA   ++NWMGY+AV
Sbjct  65   RLLARTGFLKANPFRYKVTKYIYATASIKLPISFIVKSLSKDASRVQTNWMGYIAV  120



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I ERW  LSG  NWK L DPLDLDLR YLIHYG+   ATY+TFN+E+ SKYAG SRY   
Sbjct  5    IPERWRELSGQNNWKNLLDPLDLDLRRYLIHYGERASATYDTFNSEVKSKYAGDSRYGLK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            NLF+ VGL   NP++Y  TKYFYATSS  LP  F+++ +  +AW++ESNW+GYVAV
Sbjct  65   NLFSNVGLSIANPFEYTATKYFYATSSVKLPGCFLLRSLSREAWNKESNWIGYVAV  120



>ref|XP_009119078.1| PREDICTED: phospholipase A1-IIalpha [Brassica rapa]
Length=440

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 0/142 (0%)
 Frame = -2

Query  426  NHKQKHHNIYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQ  247
            N   + +N+   KK   + +     +IA+RW+VLSG   WKGL DPLD DLR Y+IHYG+
Sbjct  17   NSFTQRNNVTIQKKQGKKLKASMLGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGE  76

Query  246  MTEATYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAF  67
            M +  Y+ FN +  S YAG   YS++ +FA+ G  K NP++Y VTKY YAT+S  LP  F
Sbjct  77   MAQVGYDAFNWDRKSLYAGDCYYSKSQIFARTGYLKANPFRYNVTKYIYATASLNLPICF  136

Query  66   IIKPIPLDAWSRESNWMGYVAV  1
            I+K +  +A   ++NW+GYVAV
Sbjct  137  IVKSLSKEASRVQTNWIGYVAV  158



>ref|XP_010457749.1| PREDICTED: phospholipase A1-IIalpha [Camelina sativa]
Length=423

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ L+G   W+GL DPLD DLR  LIHYG+M++  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IAKRWKELNGQKKWQGLLDPLDPDLRRCLIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  65   QLFARTGFLKANPFRYEVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAV  120



>emb|CDY57813.1| BnaA10g28020D [Brassica napus]
Length=545

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -2

Query  390  KKTQIERRKMSS-SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNA  214
            +K Q ++ K S   +IA+RW+VLSG   WKGL DPLD DLR Y+IHYG+M +  Y+ FN 
Sbjct  133  QKKQGKKLKASMLGAIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNW  192

Query  213  ELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWS  34
            +  S YAG   YS++ +FA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  +A  
Sbjct  193  DRKSLYAGDCYYSKSQIFARTGYLKANPFRYNVTKYIYATASLNLPICFIVKSLSKEASR  252

Query  33   RESNWMGYVAV  1
             ++NW+GYVAV
Sbjct  253  VQTNWIGYVAV  263



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA+ W+ LSG  NWK L DPLD DLR+Y+IHYG+M +ATY++FN +  SKYAGSS Y++
Sbjct  4    SIAKGWKHLSGENNWKDLLDPLDNDLRHYIIHYGEMAQATYDSFNTQKVSKYAGSSLYAK  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
               F +V L+KGNP+KY VTK+ YATS   + +AFIIK +  +AWS+ESNWMG+VAV
Sbjct  64   DEFFNRVHLEKGNPFKYRVTKFLYATSQVHISEAFIIKSLSREAWSKESNWMGFVAV  120



>ref|XP_006306316.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
 gb|EOA39214.1| hypothetical protein CARUB_v10012192mg [Capsella rubella]
Length=423

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG   W+GL DPLD DLR Y+IHYG+M++  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IAKRWKELSGQNKWQGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSRYAGDCYYSKK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +FA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  65   QIFARTGYLKANPFRYNVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAV  120



>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1
 pdb|2YIJ|B Chain B, Crystal Structure Of Phospholipase A1
Length=419

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 86/122 (70%), Gaps = 1/122 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            + +   A+RW  LSG  +WKG   PLD DLR Y+IHYG+  +A Y+TFN    S++AG+S
Sbjct  14   IVTREFAKRWRDLSGQNHWKGXLQPLDQDLREYIIHYGEXAQAGYDTFNINTESQFAGAS  73

Query  183  RYSEANLFAKVGLDKGNPY-KYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
             YS  + FAKVGL+  +PY KY+VTK+ YATS   +P++F++ PI  + WS+ESNW GYV
Sbjct  74   IYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWXGYV  133

Query  6    AV  1
            AV
Sbjct  134  AV  135



>emb|CDY10187.1| BnaC05g04300D [Brassica napus]
Length=402

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
              IA+RW+VLSG   WKGL DPLD DLR Y+IHYG+M +  Y+ FN +  S YAG   YS
Sbjct  3    GGIAKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSLYAGDCYYS  62

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ +FA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  +A   ++NW+GYVAV
Sbjct  63   KSQIFARTGYLKANPFRYNVTKYIYATASLNLPICFIVKSLSKEASRVQTNWIGYVAV  120



>ref|XP_010316799.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Solanum lycopersicum]
Length=410

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 19/130 (15%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK  IE R    +SIAERWE+LSG  NW+GL DPLD DLR YLIHYGQM +A  ++FN E
Sbjct  21   KKKGIENR---DNSIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNE  77

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
              SKY G+SRYS+ NLF +VGLDK NP  YE+TKY YA SS T               ++
Sbjct  78   KVSKYRGTSRYSKKNLFTRVGLDK-NP--YEITKYVYAASSKTEE-------------TK  121

Query  30   ESNWMGYVAV  1
            ESNW+G+VAV
Sbjct  122  ESNWIGFVAV  131



>ref|XP_007025432.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOY28054.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=406

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 9/124 (7%)
 Frame = -2

Query  372  RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYA  193
            ++K    SIA+RW  LSG  NW+GL DPLD DLR Y+IHYG+ T+A  + FN E ASK+ 
Sbjct  6    KKKKLMGSIAQRWRELSGENNWEGLLDPLDKDLRKYIIHYGERTQAVMDAFNGEKASKWV  65

Query  192  GSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            G SRYS  + F+KVGL+ GNPYKY+VTK+FYA S   + D F          + ESNW+G
Sbjct  66   GFSRYSTEDFFSKVGLEMGNPYKYKVTKFFYARSEIQILDWFA---------AVESNWIG  116

Query  12   YVAV  1
            YVAV
Sbjct  117  YVAV  120



>ref|XP_004232955.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Solanum lycopersicum]
Length=408

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 19/130 (15%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KK  IE R    +SIAERWE+LSG  NW+GL DPLD DLR YLIHYGQM +A  ++FN E
Sbjct  21   KKKGIENR---DNSIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAICDSFNNE  77

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
              SKY G+SRYS+ NLF +VGLDK NP  YE+TKY YA SS T               ++
Sbjct  78   KVSKYRGTSRYSKKNLFTRVGLDK-NP--YEITKYVYAASSKTEE-------------TK  121

Query  30   ESNWMGYVAV  1
            ESNW+G+VAV
Sbjct  122  ESNWIGFVAV  131



>gb|AAB07724.1| Pn47p [Ipomoea nil]
Length=402

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            S IA+RW+VLSGS NW+GL +PLD DLR YLIHYG M     ++F  E ASK  G  RY+
Sbjct  2    SGIAKRWKVLSGSDNWEGLLEPLDSDLRRYLIHYGTMVSPATDSFINEAASKNVGLPRYA  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPD-AFIIKPIPLDAWSRESNWMGYVAV  1
              NL A  GL KGNP+KYEVTKYFYA S+  LPD  + ++    DA  +ESNW GYVAV
Sbjct  62   RRNLLANCGLVKGNPFKYEVTKYFYAPSTIPLPDEGYNVRATRADAVLKESNWNGYVAV  120



>ref|XP_011100290.1| PREDICTED: phospholipase A1-IIgamma-like [Sesamum indicum]
Length=395

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 84/118 (71%), Gaps = 2/118 (2%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW +LSG  NW  L  PLD DL+ YL+HYG M +AT + F+ ++ SKY G S++S  
Sbjct  5    IAQRWRLLSGHNNWTNLLKPLDSDLQRYLLHYGGMAQATNDAFDFDILSKYIGYSKFSRK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATS--SYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +LF + GL KGNP++Y+  KY YATS    +LP++FI+KP+    W +ESNWMGY+AV
Sbjct  65   HLFERCGLVKGNPFRYKAVKYIYATSGPGISLPESFILKPLSEKTWYKESNWMGYIAV  122



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 82/117 (70%), Gaps = 23/117 (20%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA++W  LSG  NW+GL DPLD+DLR Y+IHYG+M +ATY+TFN+E AS++AGSSRY++
Sbjct  3    SIAKKWRHLSGQNNWEGLLDPLDIDLRRYIIHYGEMAQATYDTFNSEKASRFAGSSRYAK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + F+KVG+D GNP+KY VTKYF                       +ESNWMGYVAV
Sbjct  63   KDFFSKVGIDIGNPFKYYVTKYF-----------------------KESNWMGYVAV  96



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 79/117 (68%), Gaps = 23/117 (20%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI +RWEVLSG+ NW GL DPLD DLR Y+IHYG+M +ATY++FNAE AS+YAGS  Y++
Sbjct  3    SIDKRWEVLSGNNNWDGLLDPLDYDLRQYIIHYGEMAQATYDSFNAEKASRYAGSCLYAK  62

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +LFAKVGL  GNP+KY VTKY                        +ESNWMGYVAV
Sbjct  63   KDLFAKVGLQNGNPFKYRVTKYL-----------------------KESNWMGYVAV  96



>gb|EYU24809.1| hypothetical protein MIMGU_mgv1a007765mg [Erythranthe guttata]
Length=396

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            ++A+RW  LSG   W+ L +PLD D++ YL+HYG M + TY+TFN +  S+YAGSSRY+ 
Sbjct  4    NVAKRWRELSGQHGWRNLLNPLDADMQTYLLHYGGMAQVTYDTFNKQQMSRYAGSSRYAR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSY-TLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             NLF   G  KG+PY+Y+  KY YAT+S   LP  F++K +  + W  ESNWMGYVAV
Sbjct  64   NNLFHATGSAKGSPYRYDAVKYIYATASIGGLPQGFMVKSMADNPWMDESNWMGYVAV  121



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +++AE WE LSG  NW+GL  PLDLDLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    ANMAENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              +LF KVGLD   P KY VTK+FYAT+S  LPDAFI+K +  +AWS+ESN+MGY+AV
Sbjct  62   MESLFTKVGLD---PLKYRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAV  116



>gb|KFK42950.1| hypothetical protein AALP_AA1G060100 [Arabis alpina]
Length=412

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+ LSG   W+GL DPLD DLR Y+IHYG+M +  Y+ FN +  SKYAG   YS+ 
Sbjct  5    IPKRWKELSGLNKWQGLLDPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSKYAGDCYYSKK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +FA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  65   QVFARTGYLKANPFRYNVTKYIYATASIKLPICFIVKSLSKDATRVQTNWMGYIAV  120



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            +++AE WE LSG  NW+GL  PLDLDLR Y+I YG++ +ATY+TF  E ASKYAG+SRYS
Sbjct  2    ANMAENWEQLSGKNNWEGLLRPLDLDLRKYIIQYGELAQATYDTFITEKASKYAGASRYS  61

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              +LF KVGLD   P KY VTK+FYAT+S  LPDAFI+K +  +AWS+ESN+MGY+AV
Sbjct  62   MESLFTKVGLD---PLKYRVTKFFYATASIPLPDAFIVKSLSREAWSKESNFMGYIAV  116



>ref|XP_006417941.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
 gb|ESQ36294.1| hypothetical protein EUTSA_v10007767mg [Eutrema salsugineum]
Length=411

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+ LSG   W+GL +PLD DLR Y+IHYG+M +  Y+ FN +  S+YAG   YS+ 
Sbjct  5    IPKRWKELSGVNKWQGLLEPLDPDLRRYIIHYGEMAQVGYDAFNWDRKSRYAGDCYYSKR  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +FA+ G  K NP++Y VTKY YAT+S  LP  FI+K +  DA   ++NWMGY+AV
Sbjct  65   QIFARTGFLKANPFRYNVTKYIYATASLKLPICFIVKSLSKDASRVQTNWMGYIAV  120



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA+RW  +SGS  W GL DPLD+D+R  +I YG++ +AT + F  + AS YAG+ RYS 
Sbjct  19   AIAQRWREISGSNQWSGLLDPLDIDVRREVIRYGELAQATSDAFITDPASPYAGACRYSP  78

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            A+ F KV     +P  Y VT++ YATSS  LPD F+ +P+P  AWS +SNWMGYVAV
Sbjct  79   ASFFNKV--QASDPGAYRVTRFIYATSSARLPDGFMARPLPAGAWSTDSNWMGYVAV  133



>ref|XP_003528483.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31004.1| Phospholipase A1-IIgamma [Glycine soja]
Length=366

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA +W  LSG +NW+GL D LD+DLR Y++HYGQ+ +ATY+ FN+E      G+ RY  
Sbjct  3    SIARKWRDLSGQSNWQGLLDSLDIDLRRYILHYGQLAQATYDAFNSE-----NGNCRYPM  57

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            ++ F+KVGL+ GNP+KY VTK+ YATS  + P A I+       W+  +NW+GYVAV
Sbjct  58   SDFFSKVGLENGNPFKYVVTKFLYATSQTSAPRACILNLFSKKEWNTRTNWIGYVAV  114



>ref|XP_006469038.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-IIbeta-like 
[Citrus sinensis]
Length=395

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI E+W VLSG+ NWK L DPLD+DLR Y+IHYG+  + TY+ FN   ASKYAG S++  
Sbjct  4    SIKEKWRVLSGNDNWKDLLDPLDIDLRRYIIHYGERAQXTYDAFNRGKASKYAGDSQFGR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             N F++VG  KGNP+KYEVTK+ YATSS+ LP  FI K +  + W +ES+W+ Y+AV
Sbjct  64   KNFFSRVGXYKGNPFKYEVTKFLYATSSFPLPAVFIFKSLSRECWHKESDWIRYIAV  120



>emb|CDX86530.1| BnaC08g01730D [Brassica napus]
Length=408

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+VLSG   WKGL DPLD DLR YLIHYG+M +  Y+ FN +  S+Y G   YS++
Sbjct  5    IPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYYSKS  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + A+ G  K NP +Y VTKY YAT+S  +P  FI+K +   A   ++NWMGY+AV
Sbjct  65   QIHARTGYLKANPIRYNVTKYIYATASIKMPLCFIVKSLSKKASRVQTNWMGYIAV  120



>ref|XP_009110999.1| PREDICTED: phospholipase A1-IIalpha-like [Brassica rapa]
 emb|CDY15570.1| BnaA08g28540D [Brassica napus]
Length=408

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I +RW+VLSG   WKGL DPLD DLR YLIHYG+M +  Y+ FN +  S+Y G   YS++
Sbjct  5    IPKRWKVLSGQNKWKGLLDPLDSDLRRYLIHYGEMAQVGYDAFNWDRKSEYCGDCYYSKS  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + A+ G  K NP +Y VTKY YAT+S  +P  FI+K +   A   ++NWMGY+AV
Sbjct  65   QIHARTGYLKANPIRYNVTKYIYATASIKMPLCFIVKSLSKKASRVQTNWMGYIAV  120



>ref|XP_004232956.1| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=410

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 80/118 (68%), Gaps = 16/118 (14%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            ++IAERWE+LSG  NW+GL DPLD DLR YLIHYGQM +A Y++FN E  SKY G+SRYS
Sbjct  30   NNIAERWEILSGKNNWEGLLDPLDYDLRRYLIHYGQMPQAIYDSFNNEKVSKYRGTSRYS  89

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + NLF +VGL +    KYE+TKYFY  SS T                + SNW+G+VAV
Sbjct  90   KKNLFTRVGLHRN---KYEITKYFYGASSKTEK-------------VKVSNWIGFVAV  131



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+R   L+G  N KGL+DPLD+DLR  ++ YG+M +ATY+ F  E  S+YAG  RY+  
Sbjct  5    IAKRLRELNGRDNRKGLSDPLDIDLRRNILLYGEMAQATYDAFITEKKSRYAGDCRYARR  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            + F KV         Y VTK+FYATSS  +P+AF+IK +  +AWS+ESNWMGYVAV
Sbjct  65   DFFDKVATSTDQQSLYRVTKFFYATSSIDVPEAFLIKSLSREAWSKESNWMGYVAV  120



>ref|XP_010414181.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=423

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = -2

Query  375  ERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKY  196
            ++RKM    IA RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY
Sbjct  6    DKRKMVGD-IANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKY  64

Query  195  AGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWM  16
             G S Y++  LFA+ G  K NP++YEVTK+ Y TSS  LP+ FIIK +  +AW++ESNW+
Sbjct  65   VGDSCYTKEELFARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWL  124

Query  15   GYVAV  1
            GY+AV
Sbjct  125  GYIAV  129



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -2

Query  339  RWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLF  160
            +W  + GS NW+GL +PLD DLR  ++ YG +T+ATY+ FN++  SK+ GSSRY + + F
Sbjct  10   KWRAVQGSDNWEGLLEPLDNDLREAILLYGDLTQATYDAFNSDPHSKFCGSSRYGKKDFF  69

Query  159  AKVGLDKG-NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             KV L  G + + YEVT++ YATS   LP AF++K +  +AWSRESNW+GYVAV
Sbjct  70   QKVSLATGDDEWNYEVTRFLYATSRLELPQAFMLKSLSREAWSRESNWIGYVAV  123



>ref|XP_002440467.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
 gb|EES18897.1| hypothetical protein SORBIDRAFT_09g001420 [Sorghum bicolor]
Length=408

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 4/121 (3%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            ++ IA+RW  L G  +WKGL DPLDLDLR  +I YG++ EATY+ FN E  S +AG+  Y
Sbjct  10   AAGIAKRWRELHGDNSWKGLMDPLDLDLRKTIISYGELAEATYDGFNTERRSPHAGACIY  69

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPL--DAWSRESNWMGYVA  4
              ++L A  G+       YEVT++ YATS   LPDAF+++P+    D WSRESN+MGYVA
Sbjct  70   GYSDLLASSGVAAAG--HYEVTRFIYATSGQPLPDAFLVRPLAALKDVWSRESNFMGYVA  127

Query  3    V  1
            V
Sbjct  128  V  128



>sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta [Arabidopsis thaliana]
Length=414

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA RW+ LSGS+ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S Y++ 
Sbjct  5    IATRWKELSGSSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY Y TSS  LP+ FIIK +  +AW++ESNW+GY+AV
Sbjct  65   ELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAV  120



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 83/117 (71%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            ++A+RW+ L+G   WKGL DPLDLDLR  +I+YG++++ATY   N E  S+YAGS  ++ 
Sbjct  9    NVAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQATYTGLNRERRSRYAGSCLFNR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F++K +   AWSR+SNWMG+VAV
Sbjct  69   RDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAV  123



>ref|XP_010510242.1| PREDICTED: phospholipase A1-IIbeta [Camelina sativa]
Length=415

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S Y++ 
Sbjct  5    IAKRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTK+ Y TSS  LP+ FIIK +  +AW++ESNW+GY+AV
Sbjct  65   ELFARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAV  120



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   127 bits (319),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            MS  ++A RW +L G  NW+GL DPLDLDLR  L+ YG M +A Y+ FN E  SKYAGS 
Sbjct  1    MSIRTVASRWRILQGRDNWEGLLDPLDLDLRRLLLLYGDMAQAAYDAFNHERVSKYAGSC  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY++ + F+KV L  GNP++Y +TK+ YATSS  +P+AF+I+ +  +AWS+ESNWMG+VA
Sbjct  61   RYAKRDFFSKVNLVNGNPFEYTITKFIYATSSVQVPEAFLIRSLSREAWSKESNWMGFVA  120

Query  3    V  1
            V
Sbjct  121  V  121



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G+  WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  +  
Sbjct  9    NIARRWRELNGANYWKGLLDPLDIDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F+IKP+   AWS++SNWMG+VAV
Sbjct  69   KDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAV  123



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S Y++ 
Sbjct  5    IANRWKELSGTSKWKDLLDPLDLDLRRYIVHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTK+ Y TSS  LP+ FIIK +  +AW++ESNW+GY+AV
Sbjct  65   ELFARTGYLKANPFRYEVTKFIYGTSSIRLPECFIIKSLSREAWNKESNWLGYIAV  120



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G+  WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  +  
Sbjct  9    NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F+IKP+   AWS++SNWMG+VAV
Sbjct  69   KDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAV  123



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G+  WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  +  
Sbjct  9    NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F+IKP+   AWS++SNWMG+VAV
Sbjct  69   KDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAV  123



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 82/117 (70%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA+RW+ L+G   WKGL DPLDLDLR  +I+YG++++A Y   N E  S+YAGS  ++ 
Sbjct  9    NIAKRWKELNGLNYWKGLVDPLDLDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F++K +   AWSR+SNWMG+VAV
Sbjct  69   RDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAV  123



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G+  WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  +  
Sbjct  412  NIARRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  471

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F+IKP+   AWS++SNWMG+VAV
Sbjct  472  KDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDDFMIKPLSKAAWSKQSNWMGFVAV  526



>ref|XP_006410236.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
 gb|ESQ51689.1| hypothetical protein EUTSA_v10016726mg [Eutrema salsugineum]
Length=414

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY Y TSS  LP+ FII  +  +AW++ESNW+GY+AV
Sbjct  65   ELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFIINSLSREAWNKESNWLGYIAV  120



>ref|XP_010686321.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +A RWE+L G  NW+ L DPLD DLR  +IHYG+M +A Y+TF  +  SKYAGSSR+S+ 
Sbjct  38   VANRWELLMGENNWEDLLDPLDKDLRELIIHYGEMAQAAYDTFIRDKYSKYAGSSRFSKN  97

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPI-PLDAWSRESNWMGYVAV  1
            N FAK+GL+ G+PYKY VTK+FYATS+  +PDAFI K +  ++  S+++N+MGY+AV
Sbjct  98   NFFAKLGLELGHPYKYRVTKFFYATSAIDVPDAFIFKSLSSIEQSSKDTNFMGYIAV  154



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            ++  + A+RW  +SG   W GL DPL+++LR  +I YG++ +AT + F  + AS YAG+S
Sbjct  16   LTDVATAQRWREISGRDQWSGLLDPLNIELRREIIRYGELAQATSDAFIGDPASPYAGAS  75

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY     F KV     +P  Y VT++ YATSS  L DAF+ +P+P  AWS ESNWMGYVA
Sbjct  76   RYGPGTFFYKV--QAADPGAYRVTRFLYATSSARLRDAFMTRPVPAGAWSTESNWMGYVA  133

Query  3    V  1
            V
Sbjct  134  V  134



>gb|EAY75191.1| hypothetical protein OsI_03083 [Oryza sativa Indica Group]
 gb|EAZ12913.1| hypothetical protein OsJ_02836 [Oryza sativa Japonica Group]
Length=358

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G + WKGL DPLD+DLRN +I+YG++++A Y   N E  S+YAGS  +S 
Sbjct  9    NIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  Y +TK+ YA  + +LPDAF+IK     AWS++SNWMG+VAV
Sbjct  69   KDFLSRV--DVSNPNLYVITKFIYAMCTVSLPDAFMIKSWSKAAWSKQSNWMGFVAV  123



>emb|CDY23963.1| BnaC03g17280D [Brassica napus]
Length=414

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG + WK L DPLDLDLR Y++HYG M E  Y TFN++  SKY G S Y++ 
Sbjct  5    IAKRWKQLSGDSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY Y TSS  LP+ F+I  +  +AW+++SNW+GY AV
Sbjct  65   ELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAV  120



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G + WKGL DPLD+DLRN +I+YG++++A Y   N E  S+YAGS  +S 
Sbjct  9    NIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  Y +TK+ YA  + +LPDAF+IK     AWS++SNWMG+VAV
Sbjct  69   KDFLSRV--DVSNPNLYVITKFIYAMCTVSLPDAFMIKSWSKAAWSKQSNWMGFVAV  123



>emb|CDX84801.1| BnaA03g14290D [Brassica napus]
Length=414

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y TFN++  SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY Y TSS  LP+ F+I  +  +AW+++SNW+GY AV
Sbjct  65   ELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAV  120



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            ++A RW  L+G   WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  ++ 
Sbjct  9    NVARRWRELNGVNYWKGLLDPLDIDLRRNIINYGELSQAAYTGLNRERRSRYAGSCLFNR  68

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F++K +   AWSR+SNWMG+VAV
Sbjct  69   RDFLSRV--DVSNPDLYEITKFVYAMCTVSLPDGFMVKSLSKAAWSRQSNWMGFVAV  123



>ref|XP_009132769.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=414

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y TFN++  SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGDMAEVGYVTFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTKY Y TSS  LP+ F+I  +  +AW+++SNW+GY AV
Sbjct  65   ELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFLINSLSREAWNKDSNWLGYTAV  120



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M+  SIA+RW +L GS  W+GLTDPLD DLR  ++ YG   +ATY+TF ++  SKYAGSS
Sbjct  1    MAEGSIAKRWRLLQGSQRWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSS  60

Query  183  RYSEANLFAKVGLDKG-NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
            RY   + F  +GL K    + Y ++K+ YATS+  +P+AFI   +  +  SRESNWMGYV
Sbjct  61   RYGGPHFFEDLGLTKRPTEWGYSLSKFIYATSTIKVPEAFIRTSLSREGGSRESNWMGYV  120

Query  6    A  4
            A
Sbjct  121  A  121



>emb|CDY10774.1| BnaA05g11620D [Brassica napus]
Length=368

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y TFN    SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNCGRLSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTK+ Y TSS  LP+ F+I     +AW++ESNW+GYVAV
Sbjct  65   ELFARTGYLKDNPFRYEVTKFIYGTSSIKLPECFMINSWSREAWNKESNWLGYVAV  120



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA+RW  L+G+  WKGL DPLD+DLR  +I+YG++++A Y   N E  S+YAGS  +  
Sbjct  606  NIAKRWRELNGANYWKGLLDPLDVDLRKNIINYGELSQAAYTGLNRERRSRYAGSCLFRR  665

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  YE+TK+ YA  + +LPD F+IK +   AWS++SNWMG+VAV
Sbjct  666  EDFLSRV--DVSNPNLYEITKFIYAMCTVSLPDGFMIKSLSKAAWSKQSNWMGFVAV  720



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G + WKGL DPLD+DLRN +I+YG++++A Y   N E  S+YAGS  +S 
Sbjct  12   NIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSR  71

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  Y +TK+ YA  +  LPD F+IK     AWS++SNWMG+VAV
Sbjct  72   KDFLSRV--DVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAV  126



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA RW  L+G + WKGL DPLD+DLRN +I+YG++++A Y   N E  S+YAGS  +S 
Sbjct  12   NIARRWRELNGVSYWKGLLDPLDVDLRNNIINYGELSQAAYTGLNRERRSRYAGSCLFSR  71

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             +  ++V  D  NP  Y +TK+ YA  +  LPD F+IK     AWS++SNWMG+VAV
Sbjct  72   KDFLSRV--DVSNPNLYVITKFIYAMCTVNLPDGFMIKSWSKAAWSKQSNWMGFVAV  126



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M+  S+A+RW +L GS  W+GLTDPLD DLR  ++ YG   +ATY+TF ++  SKYAGSS
Sbjct  1    MAERSVAKRWRLLQGSQLWEGLTDPLDSDLRKSILIYGDHCQATYDTFISDRGSKYAGSS  60

Query  183  RYSEANLFAKVGLDKG-NPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYV  7
            RY   + F  +GL K    + Y ++K+ YATS+  +P+AFI   +  +  SRESNWMGYV
Sbjct  61   RYGGPHFFDDLGLTKRPTEWGYSLSKFIYATSTIKVPEAFITTSLSREGGSRESNWMGYV  120

Query  6    A  4
            A
Sbjct  121  A  121



>ref|XP_009144598.1| PREDICTED: phospholipase A1-IIbeta-like [Brassica rapa]
Length=408

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y TFN    SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNCGRLSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTK+ Y TSS  LP+ F+I     +AW++ESNW+GYVAV
Sbjct  65   ELFARTGYLKDNPFRYEVTKFIYGTSSIKLPECFMINSWSREAWNKESNWLGYVAV  120



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            MS  +IA RW  LSG   W+GL +PLD DLR YLIHYG + +ATY+ F  +  S++AG +
Sbjct  1    MSGGNIARRWRQLSGQQKWQGLLEPLDNDLRQYLIHYGDLAQATYDNFIMQKYSQFAGDN  60

Query  183  RYSEANLFAKVGLD-KGNPYKYEVTKYFYATSSYTLPDAFIIKP------IPLDAWSRES  25
            R+S  NLF++VGL  + N + Y+  KY YATS   +P +FI+ P      +P    + ES
Sbjct  61   RFSMKNLFSRVGLGMRNNQFVYKPVKYLYATSKVDVPQSFIMSPASTSRAVP----NGES  116

Query  24   NWMGYVAV  1
            NW+GY+AV
Sbjct  117  NWIGYIAV  124



>gb|EMS51987.1| Phospholipase A1-II 3 [Triticum urartu]
Length=423

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  LSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFAKVG  148
            +SGS  W GL DPL++D+R  +I YG++ +AT + F  + AS YAG+ RYS A+ F KV 
Sbjct  6    ISGSNQWSGLLDPLNIDVRREVIRYGELAQATSDGFITDPASPYAGACRYSPASFFTKV-  64

Query  147  LDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
                +P  Y VT++ YATSS  LP+ F+ +P+P+ AWS ESNWMGYVAV
Sbjct  65   -QASDPGAYRVTRFIYATSSARLPEGFMARPLPVGAWSTESNWMGYVAV  112



>emb|CDY24728.1| BnaC04g13330D [Brassica napus]
Length=408

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y TFN    SKY G S Y++ 
Sbjct  5    IAKRWKELSGNSKWKDLLDPLDLDLRRYILHYGHMVEVGYITFNYGRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YEVTK+ Y TSS  LP+ F+I     +AW++ESNW+GYVAV
Sbjct  65   ELFARTGYLKDNPFRYEVTKFIYGTSSIKLPECFMINSWSREAWNKESNWLGYVAV  120



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            +IA+RW  L+G  NWK L DPLD+DLR  ++ YG+M EATY+ F  E  S+YAG  RY+ 
Sbjct  4    NIAKRWRELNGKDNWKDLLDPLDIDLRRNILLYGEMAEATYDAFITEKKSRYAGDCRYAR  63

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             + F KV +  G    Y VTK+FYATSS  +PDAF+I+ +  +AWS+ESNWMGYVAV
Sbjct  64   RDFFDKVAISTGQHSLYRVTKFFYATSSIDVPDAFLIRSLSREAWSKESNWMGYVAV  120



>ref|XP_006295721.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
 gb|EOA28619.1| hypothetical protein CARUB_v10024849mg [Capsella rubella]
Length=411

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA+RW+ LSG++ WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S Y++ 
Sbjct  5    IAKRWKELSGTSKWKDLLDPLDLDLRRYILHYGDMAEVGYLAFNSDRRSKYVGDSCYTKE  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  K NP++YE TK+ Y TSS  LP+ FIIK +  +A  +ESNW+GYVAV
Sbjct  65   ELFARTGYLKANPFRYEATKFIYGTSSIRLPECFIIKSLSREALYKESNWLGYVAV  120



>gb|ACG40994.1| triacylglycerol lipase [Zea mays]
Length=223

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F  + AS YAG+SRY+      
Sbjct  33   WAELSGRDNWDGLLDPLDGDLRRAVIRYGKLAQATSDAFIGDPASPYAGASRYAPGAFLR  92

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +      +P  Y VT++ YATSS  +P  FI +P P  AWS ESNWMGYVAV
Sbjct  93   RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAV  142



>ref|XP_011028053.1| PREDICTED: phospholipase A1-IIdelta [Populus euphratica]
Length=413

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  + GS NW  L DPLDL LR  +I  G   +ATY+ FN +  S+Y G+SRY + N F 
Sbjct  9    WPEILGSKNWDNLLDPLDLSLRKLIIRCGDFCQATYDAFNNDKNSRYCGTSRYGKRNFFH  68

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV LD  NP  Y+V+ + YAT+  +LP+AF++  +  D+W RE+NW+GY+AV
Sbjct  69   KVMLD--NPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAV  118



>gb|AFW83434.1| hypothetical protein ZEAMMB73_348788 [Zea mays]
Length=226

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F  + AS YAG+SRY+      
Sbjct  37   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +      +P  Y VT++ YATSS  +P  FI +P P  AWS ESNWMGYVAV
Sbjct  97   RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAV  146



>gb|AFW74936.1| hypothetical protein ZEAMMB73_664132 [Zea mays]
Length=401

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            SSS+ A RW  L G+ +W GL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  
Sbjct  25   SSSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACL  84

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDA-FIIKPIP--LDAWSRESNWMGY  10
            Y  A+L   VG+      +Y VT++ YATS+  +P + F + P+P   +AWSRESNW+GY
Sbjct  85   YGRADLLPGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGY  142

Query  9    VAV  1
            VAV
Sbjct  143  VAV  145



>ref|XP_008648636.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=446

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            SSS+ A RW  L G+ +W GL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  
Sbjct  36   SSSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACL  95

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDA-FIIKPIP--LDAWSRESNWMGY  10
            Y  A+L   VG+      +Y VT++ YATS+  +P + F + P+P   +AWSRESNW+GY
Sbjct  96   YGRADLLPGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETREAWSRESNWIGY  153

Query  9    VAV  1
            VAV
Sbjct  154  VAV  156



>ref|XP_002303465.1| lipase family protein [Populus trichocarpa]
 gb|EEE78444.1| lipase family protein [Populus trichocarpa]
Length=411

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 74/112 (66%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  + GS NW  L DPLDL LR  ++  G   +ATY+ FN +  S+Y G+SRY + N F 
Sbjct  9    WPEILGSRNWDNLLDPLDLSLRKLILRCGDFCQATYDAFNNDQNSRYCGTSRYGKRNFFH  68

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV LD  NP  Y+V+ + YAT+  +LP+AF++  +  D+W RE+NW+GY+AV
Sbjct  69   KVMLD--NPENYQVSSFLYATARVSLPEAFLLHSLSRDSWDRETNWIGYIAV  118



>gb|KFK31237.1| hypothetical protein AALP_AA6G086300 [Arabis alpina]
Length=414

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            IA RW+ LSG+  WK L DPLDLDLR Y++HYG M E  Y  FN++  SKY G S ++  
Sbjct  5    IATRWKELSGAGKWKNLLDPLDLDLRRYILHYGDMAEVGYVAFNSDRQSKYVGDSCFTMK  64

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LFA+ G  + NP++YEVTK+ Y TSS  LP+ FI+     +AW+RESNW+GY+AV
Sbjct  65   ELFAQSGYLRANPFRYEVTKFIYGTSSIRLPECFIVNSWSREAWNRESNWLGYIAV  120



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F ++ AS +AG+SRY+      
Sbjct  29   WAELSGRDNWDGLLDPLDADLRRVVIRYGELAQATSDAFISDPASPHAGASRYAPGAFLR  88

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +       P  Y VT++ YATS   +PD  I++P P  AWS ESNWMGYVAV
Sbjct  89   RAQAGADVPDLYRVTRFLYATSGARVPDGIIMRPAPPGAWSLESNWMGYVAV  140



>ref|NP_001132361.1| uncharacterized protein LOC100193806 precursor [Zea mays]
 gb|ACF81176.1| unknown [Zea mays]
 gb|AFW74937.1| hypothetical protein ZEAMMB73_515693 [Zea mays]
Length=427

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 5/123 (4%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            SSS+ A RW  L G+ +W GL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  
Sbjct  25   SSSATATRWRELQGNNSWNGLLDPLDMDLRRSIISYGELVQATYDGFNRERRSPHAGACL  84

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDA-FIIKPIP--LDAWSRESNWMGY  10
            Y  A+L   VG+      +Y VT++ YATS+  +P + F + P+P   +AW+RESNW+GY
Sbjct  85   YGRADLLPGVGVAAAG--RYAVTRFVYATSALPVPGSDFPLLPLPETREAWTRESNWIGY  142

Query  9    VAV  1
            VAV
Sbjct  143  VAV  145



>ref|XP_004303191.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=453

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 77/129 (60%), Gaps = 4/129 (3%)
 Frame = -2

Query  384  TQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELA  205
            TQ +    ++      W  L G  NW GL DPLD+ LR  ++  G   + TY+ FN +  
Sbjct  27   TQTQTPNSTTEPAGPAWSALVGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDAN  86

Query  204  SKYAGSSRYSEANLFAKVGL-DKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRE  28
            SKYAGSSRY  AN F KV L D  N   YE+  + YAT+  ++P+AF++  +  ++W RE
Sbjct  87   SKYAGSSRYGHANFFDKVMLQDAAN---YEIASFLYATAQVSVPEAFLLHSLSRESWDRE  143

Query  27   SNWMGYVAV  1
            SNW+GYVAV
Sbjct  144  SNWIGYVAV  152



>ref|XP_008655897.1| PREDICTED: phospholipase A1-II 7-like [Zea mays]
Length=424

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
             SIA RW  L G  +WKGL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  Y 
Sbjct  3    GSIASRWRELHGKDSWKGLLDPLDMDLRASVIAYGELAQATYDGFNTEARSPHAGACLYG  62

Query  174  EANLF----AKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPL----DAWSRESNW  19
             A+L     +  G   G   +Y VTK+ YATS   +PDAF++ P P     + W RESNW
Sbjct  63   HADLLAASDSAGGGAGGISDRYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNW  122

Query  18   MGYVAV  1
            MGYVAV
Sbjct  123  MGYVAV  128



>gb|EMT05578.1| hypothetical protein F775_13080 [Aegilops tauschii]
Length=414

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 13/128 (10%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI  RW  L G+ +WKGL DPLD DLR  +I YG++ EATY+ FN++  S +AG+  Y  
Sbjct  8    SIPSRWRELQGAGSWKGLLDPLDRDLRASIIAYGELAEATYDGFNSQRRSPHAGACFYGH  67

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSY--------TLPDAFIIKPIPL---DAWSRES  25
            A+L A  G+ +     Y VTK+ YATS +        ++PDAF + P+P    + W RES
Sbjct  68   ADLLAAAGVSRAG--YYSVTKFIYATSGFFLAPTTGTSVPDAFFVLPLPSLLEEPWCRES  125

Query  24   NWMGYVAV  1
            +WMGYVAV
Sbjct  126  HWMGYVAV  133



>tpg|DAA45463.1| TPA: hypothetical protein ZEAMMB73_472202 [Zea mays]
Length=448

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = -2

Query  354  SSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
             SIA RW  L G  +WKGL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  Y 
Sbjct  3    GSIASRWRELHGKDSWKGLLDPLDMDLRASVIAYGELAQATYDGFNTEARSPHAGACLYG  62

Query  174  EANLF----AKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPL----DAWSRESNW  19
             A+L     +  G   G   +Y VTK+ YATS   +PDAF++ P P     + W RESNW
Sbjct  63   HADLLAASDSAGGGAGGISDRYRVTKFVYATSGLHVPDAFLLLPQPALGQQEPWCRESNW  122

Query  18   MGYVAV  1
            MGYVAV
Sbjct  123  MGYVAV  128



>gb|EMT21704.1| Putative lipase [Aegilops tauschii]
Length=433

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 3/119 (3%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            ++A RW  L G  +WKGL DPLDL LR  +I YG+M +ATY+ FN E  S + G+  Y  
Sbjct  39   TVASRWRELHGENSWKGLLDPLDLHLRATIISYGEMVQATYDGFNTERRSPHCGACFYGH  98

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAF--IIKPIPLDAWSRESNWMGYVAV  1
             +L A VG+   +   Y+VTK+ YATSS  LP++F  +  P   D WSRESNWMGYVAV
Sbjct  99   DDLLAGVGVPH-HANNYQVTKFVYATSSLPLPESFLLLPLPSLPDVWSRESNWMGYVAV  156



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F  + AS YAG+SRY+      
Sbjct  36   WAELSGRDNWDGLLDPLDADLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLH  95

Query  156  KVGLDKG-NPYKYEVTKYFYATSS--YTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +     G +P  Y VT++ YATSS    +PD FI +P P  AWS ESNWMGYVAV
Sbjct  96   RTQAPGGSDPDAYAVTRFLYATSSARVPVPDTFITRPAPPGAWSAESNWMGYVAV  150



>ref|XP_003574515.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=438

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 79/121 (65%), Gaps = 4/121 (3%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            + +IA RW  L G T+WK L DPLD  LR  LI YG++ +ATY+ FN+E  S  AGS  +
Sbjct  40   TGTIATRWRELHGETSWKNLLDPLDPHLRATLIAYGELAQATYDGFNSERRSPNAGSCLH  99

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIP--LDAWSRESNWMGYVA  4
               +L     +   +P  Y+VT++ YATSS  LP++F+  P+P   DAWSR+SNW+GYVA
Sbjct  100  GHDDLLTASSVS--SPGHYKVTRFIYATSSIPLPESFLCLPLPSLPDAWSRDSNWIGYVA  157

Query  3    V  1
            V
Sbjct  158  V  158



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F  + AS YAG+SRY+      
Sbjct  37   WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  96

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +      +P  Y VT++ YATSS  +P  FI +P P  AWS ESNWMGYVAV
Sbjct  97   RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAV  146



>gb|KDO40783.1| hypothetical protein CISIN_1g046292mg [Citrus sinensis]
Length=191

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 76/126 (60%), Gaps = 19/126 (15%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M  +SIA+ W+ LSG+ NW GL +PL+++LR Y+IHYG+  +A Y++FN E+ SK  G  
Sbjct  1    MGGTSIADNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGEITSKMYGFP  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSS-----YTLPDAFIIKPIPLDAWSRESNW  19
            RY+  N F+ V L  GNPYKY VT Y YA S      + LPD              +S W
Sbjct  61   RYAPENFFSNVALQNGNPYKYIVTDYLYARSDTDFLEWLLPD--------------QSAW  106

Query  18   MGYVAV  1
            +GYVAV
Sbjct  107  IGYVAV  112



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +AERW  L GS +W  L DPLD+DLR  LI+YG+M  ATYE F AE  S  AG  RY  A
Sbjct  1    MAERWRELHGSDHWDSLLDPLDVDLRRCLINYGEMIMATYEAFIAERRSPNAGMCRYRRA  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +LF +V  +  +P  Y VT+Y YAT+S  +    +++P+  +  +RE NWMGYVAV
Sbjct  61   DLFRRV--EVSHPGWYAVTRYIYATASADVHGKVLLRPLCRNGRARECNWMGYVAV  114



>ref|XP_004960509.1| PREDICTED: phospholipase A1-II 7-like [Setaria italica]
Length=420

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 79/123 (64%), Gaps = 5/123 (4%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            SS + A RW  L G+ +W GL DPLD+DLR  +I YG++ +A  + FN E  S +AG+  
Sbjct  24   SSPTTAVRWRELHGNNSWNGLLDPLDIDLRKSVIAYGELAQAAQDGFNHERRSPHAGACL  83

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPL---DAWSRESNWMGY  10
            Y  ++L A VG+       Y VTK+FYATS+  +P++ ++ P+P     AW RESNW+GY
Sbjct  84   YGRSDLLAGVGVAAAG--SYAVTKFFYATSAVPVPESVLLLPLPELGDAAWCRESNWIGY  141

Query  9    VAV  1
            VAV
Sbjct  142  VAV  144



>ref|XP_006646154.1| PREDICTED: phospholipase A1-II 2-like [Oryza brachyantha]
Length=361

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M S  +A RW  L GS +W GL DPLD+DLR  LI YG+M  ATYE+F  E  S  AG  
Sbjct  1    MFSCDMASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYESFIGEPRSPNAGMC  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY  A+LF +V  D  +P  Y  T+Y YAT++  +    +++P+  +  +RE NWMGYVA
Sbjct  61   RYRRADLFRRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRARECNWMGYVA  118

Query  3    V  1
            V
Sbjct  119  V  119



>ref|XP_002465238.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
 gb|EER92236.1| hypothetical protein SORBIDRAFT_01g034810 [Sorghum bicolor]
Length=423

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 77/127 (61%), Gaps = 10/127 (8%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SIA RW  L G  +WKGL DPLD+DLR  +I YG++ +ATY+ FN E  S +AG+  Y  
Sbjct  4    SIASRWRELHGKDSWKGLLDPLDIDLRASVISYGELAQATYDGFNTEPRSPHAGACVYGL  63

Query  171  ANLFAKVGLDKGNPY-----KYEVTKYFYATSSYTLPDAFIIKPIP-----LDAWSRESN  22
            A+L    G   G        +Y VTK+ YATS   +PDAF++ P P       AW RESN
Sbjct  64   ADLLTASGGAGGAAAAGGSNRYRVTKFVYATSGLQVPDAFLLLPQPGLQGQEPAWCRESN  123

Query  21   WMGYVAV  1
            WMGYVAV
Sbjct  124  WMGYVAV  130



>ref|XP_007217233.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
 gb|EMJ18432.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
Length=455

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M++S   E W  L G+ NW GL DPLDL+LR  ++  G   +ATY+ FN +  SKY GSS
Sbjct  28   MATSETQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGSS  87

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY +A+ F KV L   +   Y+V+ + YAT+  ++P+A ++     ++W RESNW+GY+A
Sbjct  88   RYGKASFFDKVVLQDAS--SYQVSCFLYATAEVSVPEALLLHSQSRESWDRESNWIGYIA  145

Query  3    V  1
            V
Sbjct  146  V  146



>ref|XP_010108435.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19463.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=394

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 79/121 (65%), Gaps = 12/121 (10%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTD-PLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYS  175
            SIAE+W+V SG  +WKGL D PLD D R Y+IHYG+  EA  + F AE  SK  G SRY+
Sbjct  3    SIAEKWKVFSGENDWKGLLDHPLDNDFRRYIIHYGERNEALGDAFIAEEKSKNYGRSRYA  62

Query  174  EANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDA-WS--RESNWMGYVA  4
            + + F+KVGL+KGNPYKYEVT + YA        A  +KP  L A W   ++SN M YVA
Sbjct  63   KRDFFSKVGLEKGNPYKYEVTNFIYA--------ALELKPPSLTATWKVIKQSNLMAYVA  114

Query  3    V  1
            V
Sbjct  115  V  115



>ref|XP_004300994.1| PREDICTED: uncharacterized protein LOC101301206 [Fragaria vesca 
subsp. vesca]
Length=424

 Score =   114 bits (284),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 74/124 (60%), Gaps = 2/124 (2%)
 Frame = -2

Query  372  RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYA  193
            R  + S +    W  L    NW G+ DPLD+ LR  ++      + TYETFN +  SKYA
Sbjct  232  RDGLDSPAAGPAWSALLRENNWAGILDPLDVHLRTLILRCSDFCQGTYETFNNDANSKYA  291

Query  192  GSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            GSSRY  AN F KV L   +   YE+  + YAT+  ++P+AF++  +  ++W RESNW+G
Sbjct  292  GSSRYGHANFFDKVMLQ--DAANYEIASFLYATAQVSVPEAFLLHSMSRESWDRESNWIG  349

Query  12   YVAV  1
            YVAV
Sbjct  350  YVAV  353



>ref|XP_004306113.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L G  NW GL DPLD+ LR  ++  G   + TY+ FN +  SKYAGSSRY  AN F 
Sbjct  24   WSALLGENNWAGLLDPLDVHLRTLILRCGDFCQGTYDAFNNDANSKYAGSSRYGHANFFD  83

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L   +   YE+  + Y T+  ++P+AF++  +  ++W RESNW+GYV V
Sbjct  84   KVMLQ--DAANYEIAFFLYTTAQVSVPEAFLLHSMSHESWDRESNWIGYVVV  133



>ref|XP_008655140.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
Length=1067

 Score =   116 bits (291),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  LSG  NW GL DPLD DLR  +I YG++ +AT + F  + AS YAG+SRY+      
Sbjct  674  WAELSGRDNWDGLLDPLDGDLRRAVIRYGELAQATSDAFIGDPASPYAGASRYAPGAFLR  733

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +      +P  Y VT++ YATSS  +P  FI +P P  AWS ESNWMGYVAV
Sbjct  734  RA--QAPDPDAYNVTRFLYATSSARVPGQFITRPAPPGAWSAESNWMGYVAV  783



>gb|ACJ85535.1| unknown [Medicago truncatula]
Length=435

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -2

Query  384  TQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELA  205
            TQ       ++   E W  L G+ NW+ L +PLDL+LRN ++  G   + TY++FN +  
Sbjct  16   TQTSSSTQPTTINQETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQN  75

Query  204  SKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRES  25
            S Y GSSRY + + F KV L+  NP  Y V  + YAT+  ++P+AFI+  +  ++W RES
Sbjct  76   SIYCGSSRYGKTSFFNKVMLE--NPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRES  133

Query  24   NWMGYVAV  1
            NW+GY+AV
Sbjct  134  NWIGYIAV  141



>ref|XP_003607601.1| Feruloyl esterase A [Medicago truncatula]
 gb|AES89798.1| phospholipase A1 [Medicago truncatula]
Length=442

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -2

Query  384  TQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELA  205
            TQ       ++   E W  L G+ NW+ L +PLDL+LRN ++  G   + TY++FN +  
Sbjct  16   TQTSSSTQPTTINQETWNQLLGNNNWETLLNPLDLNLRNLILRCGDFIQTTYDSFNNDQN  75

Query  204  SKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRES  25
            S Y GSSRY + + F KV L+  NP  Y V  + YAT+  ++P+AFI+  +  ++W RES
Sbjct  76   SIYCGSSRYGKTSFFNKVMLE--NPTHYTVVSFLYATARVSVPEAFILHSLSRESWDRES  133

Query  24   NWMGYVAV  1
            NW+GY+AV
Sbjct  134  NWIGYIAV  141



>ref|XP_003567848.1| PREDICTED: phospholipase A1-II 7-like [Brachypodium distachyon]
Length=425

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 78/136 (57%), Gaps = 21/136 (15%)
 Frame = -2

Query  351  SIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            SI+ RW  L G+++W GL DPLD DLR  +I YG++ EATY+ FN E  S +AG+  Y  
Sbjct  7    SISNRWRELHGASSWAGLLDPLDADLRASVIAYGELAEATYDGFNTERRSPHAGACVYGH  66

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYT----------------LPDAFIIKPIP---  49
            A+L A  G D  +P  Y VTK+ YAT   T                L  AF++ P+P   
Sbjct  67   ADLLA--GADVSSPGNYAVTKFLYATCGITQLASTSTTRESTSASRLAKAFLVLPVPELK  124

Query  48   LDAWSRESNWMGYVAV  1
             + W RESNWMGYVAV
Sbjct  125  EEPWCRESNWMGYVAV  140



>ref|XP_008228927.1| PREDICTED: phospholipase A1-IIdelta [Prunus mume]
Length=455

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            +++S   E W  L G+ NW GL DPLDL+LR  ++  G   +ATY+ FN +  SKY GSS
Sbjct  30   VATSETQEAWPELLGANNWAGLLDPLDLNLRTLILRCGDFCQATYDAFNNDQNSKYCGSS  89

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY +A+ F KV L   +   Y+V+ + YAT+  ++P+A ++     ++W RESNW+GY+A
Sbjct  90   RYGKASFFDKVVLQDAS--SYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIA  147

Query  3    V  1
            V
Sbjct  148  V  148



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A RW  L G   W G+ DPLDLDLR  ++ YG+M +ATY+ FN E AS +AG SR++ A+
Sbjct  11   ARRWRELHGDGGWAGMLDPLDLDLRRTVLRYGEMAQATYDAFNRERASPHAGLSRFARAH  70

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F +V L   +   Y VT++ YATSS  +PDAFI++ +      RESNW+GYVAV
Sbjct  71   FFDRVRL-PAHAAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAV  124



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 61/141 (43%), Positives = 82/141 (58%), Gaps = 7/141 (5%)
 Frame = -2

Query  408  HNIYPCKKTQIERRK-----MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQM  244
            H   P    QI+ +      M SS +AERW  L GS +W GL +PLD+DLR  LI+YG+M
Sbjct  185  HKAEPESSVQIDHKSHHALAMFSSDMAERWRELHGSDHWDGLLNPLDIDLRRCLINYGEM  244

Query  243  TEATYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFI  64
              ATYE F AE  S  AG  RY  A+LF +V  +  +P    V +Y YA +S  +    +
Sbjct  245  IMATYEAFIAERRSPNAGMCRYRRADLFRRV--EVSHPGWSAVPRYIYAAASADVHGKVL  302

Query  63   IKPIPLDAWSRESNWMGYVAV  1
            ++P+  +  +RE NWMGYVAV
Sbjct  303  LRPLCRNGRARECNWMGYVAV  323



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 72/120 (60%), Gaps = 2/120 (2%)
 Frame = -2

Query  360  SSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSR  181
            S    A RW  L GS +W+GL DPLD++LR  LI YG+M  ATYE F  E  S  AG  R
Sbjct  3    SGDMAAGRWRELHGSNHWEGLLDPLDVNLRRCLITYGEMIMATYEAFIGESRSPNAGMCR  62

Query  180  YSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            Y  A+LF +V  D   P  YE T+Y YAT+S  +    +++P+     +RE NWMGYVAV
Sbjct  63   YRRADLFRRV--DVSRPGWYEATRYLYATASAEVRGKVLLRPLCRQGRARECNWMGYVAV  120



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = -2

Query  357  SSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRY  178
            +  +A +W+ L GS +W+GL DPLD+ LR  L+ YG+M  ATYE F  E  S  AG  RY
Sbjct  4    TGDMAAQWKELQGSNHWEGLLDPLDVGLRRCLVTYGEMIMATYEAFIGESRSPNAGMCRY  63

Query  177  SEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
              A+LF +V  D  +P  YE T+Y YAT+S  +    +++P+  +  +RE NWMGYVAV
Sbjct  64   RRADLFQRV--DVSHPGWYEATRYLYATASAEVRGKVLLRPLCRERCARECNWMGYVAV  120



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M S  +A RW  L GS +W GL DPLD+DLR  LI YG+M  ATYE F  E  S  AG  
Sbjct  1    MFSCDMASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMC  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY  A+LF +V  D  +P  Y  T+Y YAT++  +    +++P+  +  + E NWMGYVA
Sbjct  61   RYRHADLFRRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVA  118

Query  3    V  1
            V
Sbjct  119  V  119



>ref|XP_008343100.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A  W  L GS NW GL DPLDL+LR +++  G   +ATY+ FN +  SKY GSSRY + +
Sbjct  11   AAAWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHS  70

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F KV L   +   Y+V+ + YAT+  ++P+A ++     ++W RESNW+GY+AV
Sbjct  71   FFDKVMLQ--DAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAV  123



>ref|XP_008353849.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A  W  L GS NW GL DPLDL+LR +++  G   +ATY+ FN +  SKY GSSRY + +
Sbjct  11   AAAWSELLGSNNWDGLLDPLDLNLRTHILRCGNFCQATYDAFNNDQNSKYCGSSRYGKHS  70

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F KV L   +   Y+V+ + YAT+  ++P+A ++     ++W RESNW+GY+AV
Sbjct  71   FFDKVMLQ--DAANYQVSCFLYATAQVSVPEALLLHSQSRESWDRESNWIGYIAV  123



>ref|XP_010276983.1| PREDICTED: phospholipase A1-IIdelta [Nelumbo nucifera]
Length=428

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L GS  W+GL DPL+L LR  ++  G + +ATY+ FN++  SKY GSSRY + + F 
Sbjct  10   WAELLGSKQWEGLLDPLNLSLRRLILRCGDLCQATYDAFNSDPRSKYCGSSRYGKRSFFE  69

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV     +   YEV  + YATS   +P AF++  +  +AW RESNW+GY+AV
Sbjct  70   KVKFQPAS--DYEVAAFLYATSRVDVPQAFLLHSLSREAWDRESNWIGYIAV  119



>ref|XP_010506105.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=410

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            WE L GS NW  L DPLD  LR  ++  G   +ATY+ F  +  SKY G+SRY +++ F 
Sbjct  7    WEELLGSKNWDTLLDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYGKSSFFE  66

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L+  +P  YEVT + YAT+  TLP   ++     DAW RESNW GY+AV
Sbjct  67   KVMLE--SPSDYEVTSFLYATARVTLPQGLLLGSQSRDAWDRESNWFGYIAV  116



>ref|XP_006428645.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
 ref|XP_006480462.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|ESR41885.1| hypothetical protein CICLE_v10011864mg [Citrus clementina]
Length=410

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 75/126 (60%), Gaps = 19/126 (15%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M  +SIA+ W+ LSG+ NW GL +PL+++LR Y+IHYG+  +A Y++FN E  SK  G  
Sbjct  1    MGGTSIADNWKELSGNNNWDGLLNPLNINLRRYIIHYGERVQAIYDSFNGETTSKMYGFP  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSS-----YTLPDAFIIKPIPLDAWSRESNW  19
            RY+  + F+ V L  GNPYKY VT Y YA S      + LPD              +S W
Sbjct  61   RYAPEDFFSNVALQNGNPYKYIVTNYLYARSDTDFLEWLLPD--------------QSAW  106

Query  18   MGYVAV  1
            +GYVAV
Sbjct  107  IGYVAV  112



>gb|KDO63393.1| hypothetical protein CISIN_1g014927mg [Citrus sinensis]
Length=416

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L GS NW GL DPLDL LR  ++  G   +ATY+ FN +  SKY G+SRY +   F 
Sbjct  12   WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L   N   Y+V  + Y T+  +LP+AF++  +  ++W RESNW+GY+AV
Sbjct  72   KVMLQ--NAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAV  121



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A RW  L G   W G  DPLDLDLR  ++ YG+M +ATY+ FN E AS +AG SR++ A 
Sbjct  11   ARRWRELHGDGGWAGTLDPLDLDLRRTVLRYGEMAQATYDAFNNERASPHAGLSRFARAR  70

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F +V L   +   Y VT++ YATSS  +PDAFI++ +      RESNW+GYVAV
Sbjct  71   FFDRVRL-PAHAAAYRVTRFLYATSSVAVPDAFILRSVSRSRRCRESNWIGYVAV  124



>ref|XP_010104406.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00251.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=400

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M+++     WE L G+ NW GL DPLDL LR  ++  G   + TY+ FN++  SKY G+S
Sbjct  1    MTTTQSEPTWEELLGANNWDGLLDPLDLALRKLILRCGDFCQVTYDAFNSDQNSKYCGAS  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY ++++F  V     N   Y+V  + YAT+  ++P+A ++     D+W RESNWMGY+A
Sbjct  61   RYGKSSIFRAVFFP--NASSYDVVSFLYATARISVPEALLLHSRSRDSWDRESNWMGYIA  118

Query  3    V  1
            V
Sbjct  119  V  119



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 77/138 (56%), Gaps = 2/138 (1%)
 Frame = -2

Query  414  KHHNIYPCKKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEA  235
            ++H  +P +        MS S +A RW  L GS +W+GL DPLD  LR  LI YG+M  A
Sbjct  2    QYHTGWPKRGDSHTAVTMSPSDMAGRWRELQGSDHWEGLLDPLDAGLRRCLIAYGEMITA  61

Query  234  TYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKP  55
            TYE F  E  S  AG  RY  A+L  +V  D  +P  Y  T+Y YAT+S  +    ++ P
Sbjct  62   TYEAFIGERRSPNAGMCRYRRADLLRRV--DVSHPGWYAATRYIYATASAEVRGEALLSP  119

Query  54   IPLDAWSRESNWMGYVAV  1
            +     +RE NWMGYVAV
Sbjct  120  LCRHGRARECNWMGYVAV  137



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 1/115 (1%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A RW  L G  NW GL DP DLDLR  +I YG+M +ATY+ FN E  S +AG SR+    
Sbjct  9    AHRWRELHGQNNWDGLLDPFDLDLRRTVIRYGEMAQATYDAFNHEKLSPHAGLSRFGRRR  68

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F +V L   +   Y VTK+ YATSS  +P+ FI++ + L    RESNW+GYVAV
Sbjct  69   FFERVQLPD-HAAAYRVTKFLYATSSVAVPEPFILRSVSLGRRCRESNWIGYVAV  122



>ref|XP_006446810.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
 gb|ESR60050.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
Length=416

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L GS NW GL DPLDL LR  ++  G   +ATY+ FN +  SKY G+SRY +   F 
Sbjct  12   WPELLGSNNWNGLLDPLDLSLRKLVLRCGDFIQATYDAFNNDQNSKYCGTSRYGKRGFFD  71

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L   N   Y+V  + Y T+  ++P+AF++  +  ++W RESNW+GY+AV
Sbjct  72   KVMLQ--NAPDYQVFSFLYGTARVSVPEAFLVHSLSRESWDRESNWIGYIAV  121



>ref|XP_006468997.1| PREDICTED: phospholipase A1-IIdelta-like [Citrus sinensis]
Length=416

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L G+ NW GL DPLDL LR  ++  G   +ATY+ FN +  SKY G+SRY +   F 
Sbjct  12   WPELLGNNNWNGLLDPLDLSLRKLILRCGDFIQATYDAFNNDQNSKYCGTSRYGKRAFFD  71

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L   N   Y+V  + Y T+  +LP+AF++  +  ++W RESNW+GY+AV
Sbjct  72   KVMLQ--NAPDYQVFSFLYGTARVSLPEAFLVHSLSRESWDRESNWIGYIAV  121



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +A RW  L GS +W GL DPLD+DLR  LI YG+M  ATYE F  E  S  AG  RY  A
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +LF +V  D  +P  Y  T+Y YAT++  +    +++P+  +  + E NWMGYVAV
Sbjct  61   DLFRRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAV  114



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +A RW  L GS +W GL DPLD+DLR  LI YG+M  ATYE F  E  S  AG  RY  A
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRHA  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +LF +V  D  +P  Y  T+Y YAT++  +    +++P+  +  + E NWMGYVAV
Sbjct  61   DLFRRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAV  114



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 2/116 (2%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            +A RW  L GS +W GL DPLD+DLR  LI YG+M  ATYE F  E  S  AG  RY  A
Sbjct  1    MASRWRELHGSGHWDGLLDPLDVDLRRCLITYGEMIMATYEAFIGEHRSPNAGMCRYRRA  60

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            +LF +V  D  +P  Y  T+Y YAT++  +    +++P+  +  + E NWMGYVAV
Sbjct  61   DLFRRV--DVSHPGWYAATRYIYATANADVHGKVLLRPLCREGRATECNWMGYVAV  114



>ref|XP_009142078.1| PREDICTED: phospholipase A1-IIdelta [Brassica rapa]
Length=413

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = -2

Query  345  AERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEAN  166
            A  WE L GS NW  L DPLD  LR  ++  G   +ATY++F  +  SKY G+SRY +++
Sbjct  4    ATPWEELLGSKNWDTLLDPLDQSLRQLILRCGDFCQATYDSFVNDQNSKYCGASRYGKSS  63

Query  165  LFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             F KV L+  N   Y+VT + YAT+  +LP+  +++    D+W RESNW GY+AV
Sbjct  64   FFDKVMLE--NASDYQVTSFLYATARVSLPEGLLLRSQSRDSWDRESNWFGYIAV  116



>gb|KDO38625.1| hypothetical protein CISIN_1g0208022mg, partial [Citrus sinensis]
Length=288

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 70/121 (58%), Gaps = 9/121 (7%)
 Frame = -2

Query  363  MSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSS  184
            M  + IA+ W+ LSGS NW GL  PL+++LR Y+IHYG+  +A Y++FN E  SK  G  
Sbjct  1    MGGTGIADNWKELSGSNNWDGLLKPLNINLRRYIIHYGERAQANYDSFNDETISKMYGFP  60

Query  183  RYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            RY+  + F  V L  GNPYKY VT Y Y  S   L D  +           +S W+GYVA
Sbjct  61   RYAPEDFFYHVALHNGNPYKYTVTNYLYGRSDTDLSDWVL---------PDQSAWIGYVA  111

Query  3    V  1
            V
Sbjct  112  V  112



>gb|EEE55092.1| hypothetical protein OsJ_02840 [Oryza sativa Japonica Group]
Length=385

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 72/119 (61%), Gaps = 6/119 (5%)
 Frame = -2

Query  345  AERWEVLSGS--TNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSE  172
            A+RW   SG     W GL DPLD DLR  +I YG++ +AT +    + AS +AG+SRY+ 
Sbjct  21   AQRWRQTSGGGKDRWDGLLDPLDADLRRDIIRYGELAQATSDALIGDPASPFAGASRYAP  80

Query  171  ANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDA--WSRESNWMGYVAV  1
                 KV     +P  Y VT++ YATSS  LPDAF+ +P P     WS ESNWMGYVAV
Sbjct  81   DAFLRKV--RASDPDAYRVTRFVYATSSVRLPDAFMPRPGPSAGAQWSGESNWMGYVAV  137



>ref|XP_007132834.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132835.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132836.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04828.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04829.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04830.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
Length=414

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L G  NW GL DPL   LR+ ++  G   +ATY+ FN +  S + GSSRY + + F 
Sbjct  7    WAELLGHNNWAGLLDPLHPALRSLILRCGDFIQATYDAFNNDKNSPFCGSSRYGKTSFFR  66

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV LD  N   Y+VT + YAT+  ++P+AF++  +  +AW RESNW+GYVAV
Sbjct  67   KVMLD--NADHYDVTAFLYATARVSVPEAFLLHSLSREAWDRESNWIGYVAV  116



>ref|XP_004292180.1| PREDICTED: phospholipase A1-IIdelta-like [Fragaria vesca subsp. 
vesca]
Length=199

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 7/112 (6%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L G  NW GL DPLD+ L+  ++  G   + TY+ FN +  SKYAGSSRY  AN F 
Sbjct  24   WSALLGENNWAGLLDPLDVHLQTLILCCGDFCQGTYDAFNNDTNSKYAGSSRYDHANFFN  83

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L   +   YE+  + YAT+  ++P+AF++  +     SRESNW+GYVAV
Sbjct  84   KVMLQ--DVANYEIASFLYATAQVSIPEAFLLHSM-----SRESNWIGYVAV  128



>ref|XP_004505480.1| PREDICTED: phospholipase A1-IIdelta-like [Cicer arietinum]
Length=480

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 82/141 (58%), Gaps = 9/141 (6%)
 Frame = -2

Query  402  IYPCKKTQIE-------RRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQM  244
            IYP + T            K + ++    W  L G+ NW+GL +P ++ LRN ++  G  
Sbjct  41   IYPLQNTPFTLTLTLFTMAKSTKTTTEPTWNQLLGTNNWEGLLNPPNIHLRNLILRCGDF  100

Query  243  TEATYETFNAELASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFI  64
             + TY+ FN +  S Y GSSRY +++ F KV L+  NP  Y V  + YAT+  ++P+AFI
Sbjct  101  IQTTYDAFNNDQNSIYCGSSRYGKSSFFHKVMLE--NPTHYTVVTFLYATARVSVPEAFI  158

Query  63   IKPIPLDAWSRESNWMGYVAV  1
            ++    ++W RESNW+GY+AV
Sbjct  159  LRSRSRESWDRESNWIGYIAV  179



>ref|XP_006858342.1| hypothetical protein AMTR_s00064p00160580 [Amborella trichopoda]
 gb|ERN19809.1| hypothetical protein AMTR_s00064p00160580 [Amborella trichopoda]
Length=211

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 12/124 (10%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W+ L GS  W+GL +PL+  LR  ++ YG + +ATY+ FN++  SKY GSSR  + + F 
Sbjct  8    WQELHGSKQWEGLLEPLNEGLREIILRYGDLCQATYDAFNSDPHSKYCGSSRCGKRSFFT  67

Query  156  KVGL------------DKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMG  13
            KVGL            D  +   Y V  + Y T+   +P +F++  +  +AWSRESNW+G
Sbjct  68   KVGLAPPHVSNTAESSDAASGTDYRVAGFLYGTAKIDIPASFLLHSLSREAWSRESNWIG  127

Query  12   YVAV  1
            YVA+
Sbjct  128  YVAI  131



>gb|KFK37116.1| hypothetical protein AALP_AA4G215000 [Arabis alpina]
Length=346

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            WE L GS NW  L DPLDL LR  ++  G   + TY+ F  +  SKY G+SRY +++LF 
Sbjct  8    WEELLGSKNWDTLLDPLDLSLRQLILRCGDFCQVTYDAFVNDENSKYCGASRYGKSSLFD  67

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L+  +   Y VT + YAT+  +LP+  ++     DAW RESNW GY+AV
Sbjct  68   KVMLESAS--HYVVTSFLYATARVSLPEGLLLHSQSRDAWDRESNWFGYIAV  117



>ref|XP_006827274.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
 gb|ERM94511.1| hypothetical protein AMTR_s00010p00263480 [Amborella trichopoda]
Length=450

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 75/116 (65%), Gaps = 4/116 (3%)
 Frame = -2

Query  348  IAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEA  169
            I ERW+ + GS +W+GL +PL   L+  +I YG++ +ATY+ F+ +  S Y GS RYS +
Sbjct  45   IHERWQEIHGSNHWQGLLNPLHPWLQREIIKYGELAQATYDAFDFDCFSHYCGSCRYSPS  104

Query  168  NLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
             LF K+GL +     Y+VTKY YA S   LP   + + +  + WSR+SNWMGYVAV
Sbjct  105  RLFQKLGLTRCG---YKVTKYLYAMSHVDLPH-LLNRSLTGNKWSRDSNWMGYVAV  156



>emb|CDP15943.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            W  L GS NW+GL DPLDL LRN ++  G   +ATY++F  +  SK+AGSSRY + + F 
Sbjct  11   WLELLGSNNWEGLLDPLDLSLRNLILRCGDFCQATYDSFVNDANSKFAGSSRYGKKSFFQ  70

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVA  4
            KV L+  N   Y+V  + YAT+   +P+A ++     +AW RESNW+GY+A
Sbjct  71   KVMLE--NASDYQVYCFLYATAQIGVPEAILLHTRSREAWDRESNWIGYIA  119



>emb|CDX97819.1| BnaC04g41200D [Brassica napus]
Length=491

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KKT+ ERR      + + W  + G  +W GLTDP+D  LR+ LI YG+M +A Y+ F+ +
Sbjct  56   KKTEEERR------LRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFD  109

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
             +S+Y GSSR+S    F  +G+ KG+   YEV +Y YATS+  LP+ F  K      WS+
Sbjct  110  PSSRYCGSSRFSRHEFFDSLGM-KGS--GYEVARYLYATSNINLPN-FFSKSRWSKVWSK  165

Query  30   ESNWMGYVAV  1
             +NWMGYVAV
Sbjct  166  NANWMGYVAV  175



>dbj|BAH56866.1| AT2G42690 [Arabidopsis thaliana]
Length=384

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  WEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAELASKYAGSSRYSEANLFA  157
            WE L GS NW  + DPLD  LR  ++  G   +ATY+ F  +  SKY G+SRY +++ F 
Sbjct  8    WEELLGSKNWDTILDPLDQSLRELILRCGDFCQATYDAFVNDQNSKYCGASRYGKSSFFD  67

Query  156  KVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSRESNWMGYVAV  1
            KV L+  N   YEV  + YAT+  +LP+  +++    D+W RESNW GY+AV
Sbjct  68   KVMLE--NASDYEVVNFLYATARVSLPEGLLLQSQSRDSWDRESNWFGYIAV  117



>ref|XP_009141072.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic [Brassica 
rapa]
Length=523

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KKT+ ERR      + + W  + G  +W GLTDP+D  LR+ LI YG+M +A Y+ F+ +
Sbjct  87   KKTEEERR------LRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFD  140

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
             +S+Y GSSR+S    F  +G+ KG+   YEV +Y YATS+  LP+ F  K      WS+
Sbjct  141  PSSRYCGSSRFSRHEFFDSLGM-KGS--GYEVARYLYATSNINLPN-FFSKSRWSKVWSK  196

Query  30   ESNWMGYVAV  1
             +NWMGYVAV
Sbjct  197  NANWMGYVAV  206



>emb|CDY29665.1| BnaA04g17620D [Brassica napus]
Length=523

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KKT+ ERR      + + W  + G  +W GLTDP+D  LR+ LI YG+M +A Y+ F+ +
Sbjct  87   KKTEEERR------LRDTWRKIQGEDDWAGLTDPMDPVLRSELIRYGEMAQACYDAFDFD  140

Query  210  LASKYAGSSRYSEANLFAKVGLDKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWSR  31
             +S+Y GSSR+S    F  +G+ KG+   YEV +Y YATS+  LP+ F  K      WS+
Sbjct  141  PSSRYCGSSRFSRHEFFDSLGM-KGS--GYEVARYLYATSNINLPN-FFSKSRWSKVWSK  196

Query  30   ESNWMGYVAV  1
             +NWMGYVAV
Sbjct  197  NANWMGYVAV  206



>ref|XP_002879267.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55526.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 12/131 (9%)
 Frame = -2

Query  390  KKTQIERRKMSSSSIAERWEVLSGSTNWKGLTDPLDLDLRNYLIHYGQMTEATYETFNAE  211
            KKT+ ERR      + + W  + G  +W GL DP+D  LR+ LI YG+M +A Y+ F+ +
Sbjct  94   KKTEEERR------LRDTWRKIQGEDDWAGLIDPMDPILRSELIRYGEMAQACYDAFDFD  147

Query  210  LASKYAGSSRYSEANLFAKVGL-DKGNPYKYEVTKYFYATSSYTLPDAFIIKPIPLDAWS  34
             ASKY G+SR+S  + F  +G+ D G    YEV +Y YATS+  LP+ F  K      WS
Sbjct  148  PASKYCGTSRFSRLDFFDSLGMIDSG----YEVARYLYATSNINLPN-FFSKSRWSKVWS  202

Query  33   RESNWMGYVAV  1
            + +NWMGYVAV
Sbjct  203  KNANWMGYVAV  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519406564212