BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20730_g1_i1 len=776 path=[1:0-300 302:301-458 460:459-607
609:608-775]

Length=776
                                                                      Score     E

ref|XP_008243571.1|  PREDICTED: uncharacterized protein LOC103341796    165   6e-47   
ref|XP_007202697.1|  hypothetical protein PRUPE_ppa012685mg             165   7e-47   
ref|XP_002282533.1|  PREDICTED: uncharacterized protein LOC100254636    162   7e-46   Vitis vinifera
ref|XP_009374765.1|  PREDICTED: uncharacterized protein LOC103963655    157   1e-43   
ref|XP_008387001.1|  PREDICTED: uncharacterized protein LOC103449457    148   2e-40   
ref|XP_002308476.1|  hypothetical protein POPTR_0006s22960g             145   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007027753.1|  Uncharacterized protein TCM_022601                 145   2e-39   
gb|KDO70427.1|  hypothetical protein CISIN_1g046004mg                   145   3e-39   
ref|XP_006430191.1|  hypothetical protein CICLE_v10012941mg             145   4e-39   
ref|XP_011004244.1|  PREDICTED: uncharacterized protein LOC105110777    144   1e-38   
ref|XP_011019792.1|  PREDICTED: uncharacterized protein LOC105122399    143   2e-38   
ref|XP_006481765.1|  PREDICTED: uncharacterized protein At1g66480...    142   2e-38   
ref|XP_010271647.1|  PREDICTED: uncharacterized protein LOC104607668    142   3e-38   
ref|XP_010245005.1|  PREDICTED: uncharacterized protein LOC104588679    140   2e-37   
ref|XP_011094328.1|  PREDICTED: uncharacterized protein LOC105174061    139   5e-37   
ref|XP_002528756.1|  conserved hypothetical protein                     137   2e-36   Ricinus communis
ref|XP_009366681.1|  PREDICTED: uncharacterized protein LOC103956425    137   4e-36   
ref|XP_008369728.1|  PREDICTED: uncharacterized protein LOC103433264    137   5e-36   
gb|KDP37299.1|  hypothetical protein JCGZ_06753                         134   6e-35   
emb|CAN62766.1|  hypothetical protein VITISV_021816                     133   2e-34   Vitis vinifera
ref|XP_006430190.1|  hypothetical protein CICLE_v10013433mg             132   3e-34   
gb|EYU38637.1|  hypothetical protein MIMGU_mgv1a020563mg                131   7e-34   
ref|XP_009775608.1|  PREDICTED: uncharacterized protein LOC104225495    130   2e-33   
ref|XP_010912297.1|  PREDICTED: uncharacterized protein LOC105038251    129   4e-33   
ref|XP_002323428.2|  hypothetical protein POPTR_0016s08060g             128   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_003535651.1|  PREDICTED: uncharacterized protein LOC100780937    125   1e-31   
ref|XP_010931137.1|  PREDICTED: uncharacterized protein LOC105052124    124   2e-31   
ref|XP_010101557.1|  hypothetical protein L484_015381                   124   3e-31   
ref|XP_007162908.1|  hypothetical protein PHAVU_001G190500g             123   7e-31   
emb|CDP15420.1|  unnamed protein product                                122   1e-30   
ref|XP_011004113.1|  PREDICTED: uncharacterized protein LOC105110698    122   2e-30   
gb|KHN02220.1|  hypothetical protein glysoja_002244                     121   3e-30   
ref|XP_003542606.1|  PREDICTED: uncharacterized protein LOC100793955    120   7e-30   
ref|NP_001236025.1|  uncharacterized protein LOC100500042               116   2e-28   
ref|XP_008787753.1|  PREDICTED: uncharacterized protein At1g66480...    114   1e-27   
gb|AFK47529.1|  unknown                                                 114   3e-27   
ref|XP_009775609.1|  PREDICTED: uncharacterized protein LOC104225496    112   5e-27   
ref|NP_001241101.1|  uncharacterized protein LOC100780959               112   9e-27   
ref|XP_008784027.1|  PREDICTED: uncharacterized protein LOC103703094    111   1e-26   
ref|XP_004246518.1|  PREDICTED: uncharacterized protein LOC101255524    112   2e-26   
ref|XP_006341112.1|  PREDICTED: uncharacterized protein LOC102603676    112   3e-26   
ref|XP_010683729.1|  PREDICTED: uncharacterized protein LOC104898360    109   1e-25   
ref|XP_009607129.1|  PREDICTED: uncharacterized protein LOC104101400    107   6e-25   
ref|XP_009404360.1|  PREDICTED: uncharacterized protein LOC103987707    107   1e-24   
ref|XP_010036674.1|  PREDICTED: uncharacterized protein LOC104425635    106   3e-24   
ref|XP_009379809.1|  PREDICTED: uncharacterized protein LOC103968359    105   3e-24   
ref|XP_011077928.1|  PREDICTED: uncharacterized protein LOC105161812    100   1e-22   
gb|EYU35495.1|  hypothetical protein MIMGU_mgv1a018874mg                101   1e-22   
ref|XP_008462573.1|  PREDICTED: uncharacterized protein LOC103500900    100   5e-22   
ref|NP_187623.2|  uncharacterized protein                             99.0    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156256.1|  PREDICTED: uncharacterized protein LOC101226128  98.6    2e-21   
ref|XP_004143322.1|  PREDICTED: uncharacterized protein LOC101213283  96.7    9e-21   
ref|XP_006281180.1|  hypothetical protein CARUB_v10027215mg           95.1    4e-20   
emb|CCH47175.1|  similar to iron-sulfur assembly protein IscA-like    93.6    3e-19   
ref|XP_009773722.1|  PREDICTED: uncharacterized protein LOC104223892  90.1    7e-19   
ref|XP_009146870.1|  PREDICTED: uncharacterized protein LOC103870...  90.5    1e-18   
ref|XP_004494186.1|  PREDICTED: uncharacterized protein LOC101511310  89.4    1e-18   
ref|XP_009146871.1|  PREDICTED: uncharacterized protein LOC103870...  90.1    2e-18   
ref|XP_010464670.1|  PREDICTED: uncharacterized protein LOC104745189  90.1    2e-18   
ref|XP_009627512.1|  PREDICTED: uncharacterized protein LOC104118045  88.6    3e-18   
emb|CDY60165.1|  BnaAnng16590D                                        88.6    6e-18   
emb|CDY22216.1|  BnaC01g38850D                                        88.6    7e-18   
ref|XP_010480673.1|  PREDICTED: uncharacterized protein LOC104759418  88.6    7e-18   
ref|XP_010486602.1|  PREDICTED: uncharacterized protein LOC104764713  87.4    2e-17   
ref|XP_006288765.1|  hypothetical protein CARUB_v10002084mg           85.5    1e-16   
gb|AAF04412.1|AC010927_5  unknown protein                             84.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122662.1|  PREDICTED: uncharacterized protein LOC103847352  84.3    2e-16   
emb|CDY00905.1|  BnaC05g42950D                                        84.3    2e-16   
ref|XP_009123110.1|  PREDICTED: uncharacterized protein LOC103847791  84.0    3e-16   
emb|CDY41427.1|  BnaCnng10630D                                        83.6    4e-16   
emb|CDY69711.1|  BnaCnng64930D                                        81.6    2e-15   
ref|XP_010543499.1|  PREDICTED: uncharacterized protein LOC104816397  81.6    2e-15   
gb|AES82047.2|  iron-sulfur assembly IscA-like protein                80.5    2e-15   
ref|XP_002884779.1|  hypothetical protein ARALYDRAFT_478339           80.9    3e-15   
gb|EPS73717.1|  hypothetical protein M569_01042                       79.0    4e-15   
ref|XP_003625829.1|  hypothetical protein MTR_7g104680                80.1    5e-15   
ref|XP_007220082.1|  hypothetical protein PRUPE_ppa024194mg           79.7    6e-15   
ref|NP_196009.1|  uncharacterized protein                             80.1    7e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558222.1|  PREDICTED: uncharacterized protein LOC104826943  79.3    9e-15   
ref|XP_006398849.1|  hypothetical protein EUTSA_v10014801mg           79.7    1e-14   
gb|AFK36703.1|  unknown                                               77.8    2e-14   
ref|XP_009130792.1|  PREDICTED: uncharacterized protein LOC103855548  78.2    6e-14   
ref|XP_006833249.1|  hypothetical protein AMTR_s00113p00094690        77.0    7e-14   
emb|CDY11278.1|  BnaA03g01140D                                        76.3    1e-13   
ref|XP_010024777.1|  PREDICTED: uncharacterized protein LOC104415220  78.6    3e-13   
emb|CDX80897.1|  BnaC03g01510D                                        74.7    5e-13   
gb|KCW90549.1|  hypothetical protein EUGRSUZ_A02661                   73.2    6e-13   
ref|XP_009352095.1|  PREDICTED: uncharacterized protein LOC103943510  72.4    2e-12   
ref|XP_007039187.1|  Uncharacterized protein TCM_015500               72.8    2e-12   
ref|XP_006407607.1|  hypothetical protein EUTSA_v10021626mg           72.8    2e-12   
ref|XP_010662926.1|  PREDICTED: uncharacterized protein LOC104882245  71.6    4e-12   
ref|XP_010452285.1|  PREDICTED: uncharacterized protein LOC104734...  72.0    5e-12   
ref|XP_010423653.1|  PREDICTED: uncharacterized protein LOC104708734  70.9    1e-11   
gb|KFK38400.1|  hypothetical protein AALP_AA3G108100                  70.5    2e-11   
ref|XP_008382871.1|  PREDICTED: uncharacterized protein LOC103445632  69.3    2e-11   
ref|NP_001236548.1|  uncharacterized protein LOC100527730             68.6    4e-11   
ref|XP_008376801.1|  PREDICTED: uncharacterized protein LOC103439932  68.2    5e-11   
ref|XP_009361290.1|  PREDICTED: uncharacterized protein LOC103951595  67.4    7e-11   
ref|XP_010490882.1|  PREDICTED: uncharacterized protein LOC104768579  68.2    1e-10   
ref|NP_001176357.1|  Os11g0152900                                     65.5    3e-10   
ref|XP_004951400.1|  PREDICTED: uncharacterized protein LOC101779099  64.7    7e-10   
ref|XP_010660203.1|  PREDICTED: uncharacterized protein LOC104881495  65.5    8e-10   
gb|KHN23312.1|  hypothetical protein glysoja_015614                   64.7    1e-09   
ref|XP_003526752.1|  PREDICTED: uncharacterized protein LOC100798545  64.3    1e-09   
gb|KDP32098.1|  hypothetical protein JCGZ_12559                       63.9    2e-09   
ref|XP_004978703.1|  PREDICTED: uncharacterized protein LOC101756992  62.8    3e-09   
ref|XP_007136451.1|  hypothetical protein PHAVU_009G046400g           62.4    7e-09   
ref|XP_006663219.1|  PREDICTED: uncharacterized protein LOC102709504  62.0    8e-09   
ref|XP_011075901.1|  PREDICTED: uncharacterized protein LOC105160284  62.4    9e-09   
ref|XP_002450287.1|  hypothetical protein SORBIDRAFT_05g003260        61.6    9e-09   Sorghum bicolor [broomcorn]
ref|XP_002317808.2|  hypothetical protein POPTR_0012s02920g           59.7    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_003602353.1|  hypothetical protein MTR_3g092470                58.2    2e-07   
ref|XP_008679414.1|  PREDICTED: uncharacterized protein LOC103654348  57.4    4e-07   
ref|XP_006663825.1|  PREDICTED: uncharacterized protein LOC102705767  57.0    5e-07   
ref|XP_008231290.1|  PREDICTED: uncharacterized protein LOC103330478  56.6    8e-07   
gb|KGN49817.1|  hypothetical protein Csa_5G138490                     57.0    1e-06   
ref|XP_010940858.1|  PREDICTED: uncharacterized protein LOC105059304  55.5    3e-06   
ref|XP_011047269.1|  PREDICTED: uncharacterized protein LOC105141672  55.1    3e-06   
ref|XP_003578896.1|  PREDICTED: uncharacterized protein LOC100842698  54.7    4e-06   
ref|XP_004502739.1|  PREDICTED: uncharacterized protein LOC101508248  54.3    7e-06   
ref|XP_010251991.1|  PREDICTED: uncharacterized protein LOC104593728  54.3    1e-05   
gb|EMT14345.1|  hypothetical protein F775_28063                       53.5    1e-05   
gb|AFG47069.1|  hypothetical protein 0_11217_01                       52.8    3e-05   
ref|XP_011044744.1|  PREDICTED: uncharacterized protein LOC105139834  52.0    4e-05   
ref|XP_011012587.1|  PREDICTED: uncharacterized protein LOC105116802  52.0    6e-05   
gb|AFG47066.1|  hypothetical protein 0_11217_01                       51.6    6e-05   
gb|EMT11383.1|  hypothetical protein F775_05371                       51.2    7e-05   
dbj|BAJ99189.1|  predicted protein                                    51.2    8e-05   
gb|AFG47068.1|  hypothetical protein 0_11217_01                       50.8    1e-04   
gb|AFG47064.1|  hypothetical protein 0_11217_01                       50.8    1e-04   
gb|AFG47077.1|  hypothetical protein 0_11217_01                       50.8    1e-04   
gb|AFG47067.1|  hypothetical protein 0_11217_01                       50.8    1e-04   
gb|AFG47071.1|  hypothetical protein 0_11217_01                       50.8    1e-04   
tpg|DAA39157.1|  TPA: hypothetical protein ZEAMMB73_577204            50.1    1e-04   
gb|AEW07767.1|  hypothetical protein 0_11217_01                       50.4    1e-04   
ref|XP_002321369.2|  hypothetical protein POPTR_0015s00810g           50.1    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002320460.1|  hypothetical protein POPTR_0014s15150g           49.3    4e-04   Populus trichocarpa [western balsam poplar]



>ref|XP_008243571.1| PREDICTED: uncharacterized protein LOC103341796 [Prunus mume]
Length=158

 Score =   165 bits (417),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q N+ ++M+ DGKILEY+A MKVYQVLSEF+ HAIS++ PV QHLR DT+++G
Sbjct  1    MGNCLVMQENITKIMRPDGKILEYRADMKVYQVLSEFSGHAISETAPVYQHLRPDTKLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            GRLYYL+PLP+P  K ++KKV+FA+   EA+Q+ T VVR+KI+ISKQELQ +L K  +SV
Sbjct  61   GRLYYLVPLPLPPKKASQKKVRFANPEVEAEQE-TKVVRIKIVISKQELQEMLRKGGVSV  119

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            DD+V  LQ ++S D+ N  + +++ NC+GWKP+L SIPE
Sbjct  120  DDLVSQLQSDRSIDKTN--SFNDDGNCEGWKPVLESIPE  156



>ref|XP_007202697.1| hypothetical protein PRUPE_ppa012685mg [Prunus persica]
 gb|EMJ03896.1| hypothetical protein PRUPE_ppa012685mg [Prunus persica]
Length=158

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q N+ ++M+ DGKILEY+A MKVYQVLSEF+ HAIS++ PV QHLR DT+++G
Sbjct  1    MGNCLVMQENITKIMRPDGKILEYRADMKVYQVLSEFSGHAISETAPVYQHLRPDTKLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            GRLYYL+PLP+P  K ++KKV+FA+   EA+Q+ T VVR+KI+ISKQELQ +L K  +SV
Sbjct  61   GRLYYLVPLPLPPKKASQKKVRFANPEVEAEQE-TKVVRIKIVISKQELQEMLRKGGVSV  119

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            DD+V  LQ ++S D+ N    +++ NC+GWKP+L SIPE++
Sbjct  120  DDLVSQLQSDRSIDKTNNF--NDDGNCEGWKPVLESIPEVN  158



>ref|XP_002282533.1| PREDICTED: uncharacterized protein LOC100254636 [Vitis vinifera]
Length=160

 Score =   162 bits (410),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL  Q  +I++M+ DGK+LEYK P+KV QVLSEF+  AISD+LPV+QHLR D EMVG
Sbjct  1    MGNCLAQQEKIIKIMRPDGKVLEYKTPLKVQQVLSEFSGCAISDTLPVIQHLRKDMEMVG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G+LYYL+P+P+P P+  KK ++F+D   EAD QGTGVVR++++I+KQEL+ +L K  +SV
Sbjct  61   GQLYYLIPVPLPSPEVEKKALRFSDPQVEAD-QGTGVVRIRLVITKQELKEMLRKGGVSV  119

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            D MV  LQ+ +  + +++   D   NC+GWKP+L SIPE++
Sbjct  120  DHMVSQLQRGQGRNGVHKLDVDGNGNCRGWKPVLESIPEVN  160



>ref|XP_009374765.1| PREDICTED: uncharacterized protein LOC103963655 [Pyrus x bretschneideri]
 ref|XP_009336973.1| PREDICTED: uncharacterized protein LOC103929488 [Pyrus x bretschneideri]
Length=162

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q N+ ++M++DGKILEY+A MKVYQVLSEF+ HAIS++ PV QHLR D++++G
Sbjct  1    MGNCLVMQENITKIMRSDGKILEYRADMKVYQVLSEFSGHAISETAPVYQHLRPDSKLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G LY+L+PLP+P PK A +K     + E   +Q T VVR+K++ISKQELQ +L K  ++V
Sbjct  61   GHLYHLVPLPLPPPKKASQKKVSFSEPEAEPEQETKVVRIKLVISKQELQEMLRKGGVAV  120

Query  432  -DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
             D+MV  LQ EK  ++ N  + +++ NC+GWKP+L SIPE++
Sbjct  121  LDEMVSRLQSEKGVEQSNTNSFNDDGNCEGWKPVLESIPEVN  162



>ref|XP_008387001.1| PREDICTED: uncharacterized protein LOC103449457 [Malus domestica]
Length=163

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 118/163 (72%), Gaps = 2/163 (1%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q N+ +VM+ DGKILEY+A MKVYQVLSEF+ HAIS++ PV QHLR D++++G
Sbjct  1    MGNCLVMQENITKVMRPDGKILEYRADMKVYQVLSEFSGHAISETAPVYQHLRPDSKLLG  60

Query  252  G-rlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
            G   Y +     P  K ++KKV+F++  E   +Q T VVR+K++I KQELQ +L K  ++
Sbjct  61   GHLYYLVPLPLPPPKKASQKKVRFSEPAEAEPEQETKVVRIKLVIRKQELQEMLIKGGVA  120

Query  429  V-DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            V D+MV  LQ EK  ++ N  + +++  C+GWKP+L SIPEL+
Sbjct  121  VLDEMVSRLQSEKGVEKSNTSSFNDDGXCEGWKPVLQSIPELN  163



>ref|XP_002308476.1| hypothetical protein POPTR_0006s22960g [Populus trichocarpa]
 gb|EEE91999.1| hypothetical protein POPTR_0006s22960g [Populus trichocarpa]
Length=164

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQANVI+VMK DGKILEY+AP+KV QVLS+F+ HAI+DSL   QHL  DT ++G
Sbjct  1    MGNCLVLQANVIKVMKPDGKILEYQAPIKVQQVLSDFSGHAIADSLQAFQHLPPDTSLLG  60

Query  252  G-rlyyllplpvprpkpakkkvkFADQVEEA---DQQGTGVVRVKIIISKQELQALLSKD  419
            G  LYYL+PL +P P+  KKKV+F+   EEA    ++ + VVR+K++ISKQELQ +L K 
Sbjct  61   GDHLYYLVPLQLPSPQAKKKKVRFSIPEEEAKDVQEKTSTVVRIKLVISKQELQEMLRKG  120

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             +SVDDMV HLQ ++   +++   +D E   KGWKP L SIPE
Sbjct  121  GVSVDDMVSHLQGQQRVQKVDISGSDSEH--KGWKPELESIPE  161



>ref|XP_007027753.1| Uncharacterized protein TCM_022601 [Theobroma cacao]
 gb|EOY08255.1| Uncharacterized protein TCM_022601 [Theobroma cacao]
Length=159

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 125/162 (77%), Gaps = 4/162 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL   +I+VMKTDGKILEY+AP+KV QVLS+F+ HA+SDS   +QHLR D +++ 
Sbjct  1    MGNCLVLDLKIIKVMKTDGKILEYQAPIKVQQVLSDFSGHALSDSFSGLQHLRPDAKLLR  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGT-GVVRVKIIISKQELQALLSKDQIS  428
            G+LYYL+P+P P  K  KKKV+F+   E  D+QG+ GVVR+K+IISKQELQ LL K+++S
Sbjct  61   GQLYYLVPVPSPHQKGEKKKVRFSTP-EVNDEQGSAGVVRIKLIISKQELQELLQKERVS  119

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            V DM+  +Q ++S+  +++  +D   NCKGWKP+L SI E++
Sbjct  120  VHDMISQIQSKESTKGVDK--SDGGDNCKGWKPVLESIDEVN  159



>gb|KDO70427.1| hypothetical protein CISIN_1g046004mg [Citrus sinensis]
Length=157

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL+  VI+VMKTDGKILEY  P++V  VL+EF+ HAISDSLP ++HLR D ++VG
Sbjct  1    MGNCLVLEEKVIKVMKTDGKILEYNQPIRVQDVLAEFSGHAISDSLPEIRHLRPDFKLVG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD-QQGTGVVRVKIIISKQELQALLSKDQIS  428
            G LY+L+P+P+P  K  KKKV+F+D+   A  ++  GVVR+K++ISKQEL+ LL K  +S
Sbjct  61   GNLYFLVPVPLPSQKVQKKKVRFSDEEAGAGAKERGGVVRIKLVISKQELEELLQKQGVS  120

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            V DMV  +Q ++S+D+    + D   N K WKP L SIPE+D
Sbjct  121  VKDMVSRIQSKQSADDFQ--SGD---NTKAWKPELESIPEID  157



>ref|XP_006430191.1| hypothetical protein CICLE_v10012941mg [Citrus clementina]
 gb|ESR43431.1| hypothetical protein CICLE_v10012941mg [Citrus clementina]
Length=167

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 120/162 (74%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL+  VI+VMKTDGKILEY  P++V  VL+EF+ HAISDSLP ++HLR D ++VG
Sbjct  11   MGNCLVLEEKVIKVMKTDGKILEYNQPIRVQDVLAEFSGHAISDSLPEIRHLRPDFKLVG  70

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD-QQGTGVVRVKIIISKQELQALLSKDQIS  428
            G LY+L+P+P+P  K  KKKV+F+D+   A  ++  GVVR+K++ISKQEL+ LL K  +S
Sbjct  71   GNLYFLVPVPLPSQKVQKKKVRFSDEEAGAGAKERGGVVRIKLVISKQELEELLQKQGVS  130

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            V DMV  +Q ++S+D+    + D   N K WKP L SIPE+D
Sbjct  131  VKDMVSRIQSKQSADDFQ--SGD---NTKAWKPELESIPEID  167



>ref|XP_011004244.1| PREDICTED: uncharacterized protein LOC105110777 [Populus euphratica]
Length=164

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQANVI+VMK DGKILEY+AP+KV QVLS+F+ HAI+DSL   QHL  DT ++G
Sbjct  1    MGNCLVLQANVIKVMKPDGKILEYQAPIKVQQVLSDFSGHAIADSLQAFQHLPPDTNLLG  60

Query  252  G-rlyyllplpvprpkpakkkvkFADQVEEA---DQQGTGVVRVKIIISKQELQALLSKD  419
            G  LYYL+PL +P P+  KKKV+F+   EEA    ++ + VVR+ ++ISKQELQ +L K 
Sbjct  61   GDHLYYLVPLQLPSPQAKKKKVRFSIPEEEAKDVQEKTSTVVRINLVISKQELQEMLRKG  120

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             +SVDDMV HLQ ++   +++   +D E   KGWKP L SIPE
Sbjct  121  GVSVDDMVSHLQGQQRVQKVDISGSDGEH--KGWKPALESIPE  161



>ref|XP_011019792.1| PREDICTED: uncharacterized protein LOC105122399 [Populus euphratica]
Length=164

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQANVI+VMK DGKILEY+AP+KV QVLS+F+ HAI+DSL   QHL  DT ++G
Sbjct  1    MGNCLVLQANVIKVMKPDGKILEYQAPIKVQQVLSDFSGHAIADSLQAFQHLPPDTNLLG  60

Query  252  G-rlyyllplpvprpkpakkkvkFADQVEEA---DQQGTGVVRVKIIISKQELQALLSKD  419
            G  LYYL+PL +P P+  KKKV+F+   EEA    ++ + VVR+ ++ISKQELQ +L K 
Sbjct  61   GDHLYYLVPLQLPSPQAKKKKVRFSIPEEEAKDVQEKTSTVVRINLVISKQELQEMLRKG  120

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             +SVDDMV HLQ ++   +++   +D E   KGWKP L SIPE
Sbjct  121  GVSVDDMVSHLQGQQRVQKVDISGSDGEH--KGWKPELESIPE  161



>ref|XP_006481765.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis]
Length=157

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 120/162 (74%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL+  VI+VMKTDGKILEY  P++V  VL+EF+ HAISDSLP ++HLR D ++VG
Sbjct  1    MGNCLVLEEKVIKVMKTDGKILEYNQPIRVQDVLAEFSGHAISDSLPEIRHLRPDFKLVG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD-QQGTGVVRVKIIISKQELQALLSKDQIS  428
            G LY+L+P+P+P  K  KKKV+F+D+   A  ++  GVVR+K++ISKQEL+ LL K  +S
Sbjct  61   GNLYFLVPVPLPSQKVQKKKVRFSDEEAGAGAKERGGVVRIKLVISKQELEELLQKQGVS  120

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            V DMV  +Q ++S+D+    + D+    K WKP L SIPE+D
Sbjct  121  VKDMVSRIQSKQSADDFQ--SGDK---TKAWKPELESIPEID  157



>ref|XP_010271647.1| PREDICTED: uncharacterized protein LOC104607668 [Nelumbo nucifera]
Length=164

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 4/160 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL+L    I+VMKTDGK+LEYK P+KV+QVLSEFA H+ISD+LPVV+HL    +M+ 
Sbjct  1    MGNCLLLPEESIKVMKTDGKVLEYKPPLKVHQVLSEFAGHSISDTLPVVRHLAPQIDMLS  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD-QQGTGVVRVKIIISKQELQALLSKDQIS  428
            GRLYYLLP P+P  +  +K    +     A+ +Q TGVVR+K++I+KQEL+ +L+K  IS
Sbjct  61   GRLYYLLPPPLPSTQFVRKVPMVSSNSPTAEPRQRTGVVRIKLVITKQELREMLAKGGIS  120

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            V+++V HLQ  +S   +     D   +CKGW+P+L SIPE
Sbjct  121  VNEIVAHLQSRQSKAGV---VDDNSESCKGWRPVLESIPE  157



>ref|XP_010245005.1| PREDICTED: uncharacterized protein LOC104588679 [Nelumbo nucifera]
Length=152

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 104/159 (65%), Gaps = 15/159 (9%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL  + I+VMKTDGK+LEY+AP++V+QVL++FA HAISD+LPV++HL  DTEM+ 
Sbjct  1    MGNCLVLSRDSIKVMKTDGKVLEYQAPLRVHQVLADFAGHAISDTLPVLRHLPPDTEMLS  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G              P       A+   EA     GVVR+K++I+KQEL+ +L K  +SV
Sbjct  61   G-------RLYYLLPPPLPSTNVAEPRREA-----GVVRIKLVITKQELREMLXKGGVSV  108

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            D+MV  LQ  +S  E+     D E  CKGW+P+L SIPE
Sbjct  109  DEMVSQLQSRQS--EVGVVDDDTEC-CKGWRPVLESIPE  144



>ref|XP_011094328.1| PREDICTED: uncharacterized protein LOC105174061 [Sesamum indicum]
Length=158

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 120/164 (73%), Gaps = 9/164 (5%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++   ++VMKTDGKI+EYK+P+KV+QVLSEF++HAISD LPVV+HL  + EM+G
Sbjct  1    MGNCLVIEEKTVKVMKTDGKIIEYKSPIKVHQVLSEFSHHAISDKLPVVKHLHPNAEMLG  60

Query  252  Grlyyllplpvprpk---pakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
            G LYYLLPLPVP P      KK V+F+D+V E  ++   VVR+K++ISKQELQA++    
Sbjct  61   GHLYYLLPLPVPVPAPSPKKKKTVRFSDEVVEGARRAPEVVRIKLVISKQELQAMMGSGG  120

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            +SV+D++  +Q+E S +++      E  +   W P L SIPE++
Sbjct  121  VSVEDVIAQVQREGSINKI------ESGDTDRWLPDLESIPEVN  158



>ref|XP_002528756.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33668.1| conserved hypothetical protein [Ricinus communis]
Length=157

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 115/162 (71%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VLQ  V++VMK DGKILEY+AP++V QVLSEF+ HAISDSL   QHL  DT++ G
Sbjct  1    MGNCIVLQEKVVKVMKPDGKILEYRAPVRVQQVLSEFSGHAISDSLQDFQHLLPDTKLHG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G LYYL+ LP+P P+  KK        EE +++ TG VR+K++ISKQELQ +L K  +SV
Sbjct  61   GSLYYLVALPLPSPEVKKKVRFSIP--EEENKKETGAVRIKLVISKQELQEILRKGGVSV  118

Query  432  DDMVRHLQKEKSSDELNRCAADEEANC-KGWKPMLGSIPELD  554
            D M+  LQ ++    ++R    +  +C KGWKP+L SIPE+D
Sbjct  119  DYMISQLQGQQ---RVHRVDTSDNDDCHKGWKPVLESIPEID  157



>ref|XP_009366681.1| PREDICTED: uncharacterized protein LOC103956425 [Pyrus x bretschneideri]
Length=166

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q NV ++M+ DGKILEY A MKVYQVLSEF+ HAIS++ P  QHL+ D++++G
Sbjct  1    MGNCLVMQENVTKIMRPDGKILEYSADMKVYQVLSEFSGHAISETAPNYQHLQPDSKLLG  60

Query  252  Grlyyllplpvprpkpakkkv---kFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
            G LYYL+PLP+P PK A +K       +      +Q T VVR+K++ISK+ELQ +L+K  
Sbjct  61   GHLYYLVPLPLPPPKKASQKKVRFSEPEAERPEPEQETKVVRIKLVISKKELQEMLTKGG  120

Query  423  ISV-DDMVRHLQ-KEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            ++V D+MV  LQ +EK  D+ N  + + + NC+GWKP L SIPE+D
Sbjct  121  VAVLDEMVSRLQSEEKGIDKSNSNSFNVDGNCEGWKPALESIPEVD  166



>ref|XP_008369728.1| PREDICTED: uncharacterized protein LOC103433264 [Malus domestica]
Length=166

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV+Q NV ++M+ DGKILEY A MKVYQVLSEF+ HAIS++ P  QHLR D++++G
Sbjct  1    MGNCLVMQENVTKIMRPDGKILEYSADMKVYQVLSEFSGHAISETAPNYQHLRPDSKLLG  60

Query  252  Grlyyllplpvprpkpakkkv---kFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
            G LYYL+PLP+P PK A +K       +      +Q T VVR+K++ISK+ELQ +L+K  
Sbjct  61   GHLYYLVPLPLPPPKKASQKKVRFSEPEAERPEPEQETKVVRIKLVISKKELQEMLTKGG  120

Query  423  ISV-DDMVRHLQ-KEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            ++V D+MV  LQ +EK  D+ N  + + + NC+GWKP L SIPE+
Sbjct  121  VAVLDEMVSRLQSEEKGIDKSNSNSFNVDGNCEGWKPALESIPEV  165



>gb|KDP37299.1| hypothetical protein JCGZ_06753 [Jatropha curcas]
Length=158

 Score =   134 bits (336),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ  V++VMK DGKILEYK+P++V QVLS+F+  A+S S+  +QHL  D +++G
Sbjct  1    MGNCLVLQEKVVKVMKPDGKILEYKSPIRVQQVLSDFSGFAVSASVQALQHLLPDAKLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G   Y L         AKKKV+F+    E  Q+ TGVVR+K++ISKQELQ LL K  +S+
Sbjct  61   G-NLYYLVPLPLPSPEAKKKVRFSIPEGEDKQETTGVVRIKLVISKQELQELLQKGGVSI  119

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            D +V   Q +K  D ++   +D + N K WKP+L SIPE+D
Sbjct  120  DYIVSQFQDQKRVDGVD--ISDNDDNRKAWKPVLESIPEID  158



>emb|CAN62766.1| hypothetical protein VITISV_021816 [Vitis vinifera]
Length=193

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL  Q  +I++M+ DGK+LEYK P+KV QVLSEF+  AISD+LPV+QHLR D EMVG
Sbjct  1    MGNCLAQQEKIIKIMRPDGKVLEYKTPLKVQQVLSEFSGCAISDTLPVIQHLRKDMEMVG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G+LYYL+P+P+P P+  KK ++F+D   EAD  GTGVVR++++I+KQEL+ +L K  +SV
Sbjct  61   GQLYYLIPVPLPSPEVEKKALRFSDPQVEAD-XGTGVVRIRLVITKQELKEMLRKGGVSV  119

Query  432  DDMVRHLQKEKSSDELNRCAAD  497
            D MV  LQ+ +  + +++   D
Sbjct  120  DHMVSQLQRGQGRNGVHKLDVD  141



>ref|XP_006430190.1| hypothetical protein CICLE_v10013433mg [Citrus clementina]
 gb|ESR43430.1| hypothetical protein CICLE_v10013433mg [Citrus clementina]
 gb|KDO70428.1| hypothetical protein CISIN_1g031133mg [Citrus sinensis]
Length=165

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 4/165 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL+L+  VI+VMKTDGKILEYKAPMKV  VL+EFA HAISDS P ++HL  D +++G
Sbjct  1    MGNCLMLEEKVIKVMKTDGKILEYKAPMKVQDVLAEFAGHAISDSFPEIRHLMPDFKLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFA-DQVEEADQQGTGVVRVKIIISKQELQAL--LSKDQ  422
            G LY+L+P+P+P PK  KKKV+F+ ++  +  ++ + VVR+K++ISKQELQ L  L K  
Sbjct  61   GNLYFLVPVPLPSPKVEKKKVRFSEEEARDGAKETSSVVRIKVVISKQELQDLQMLQKGG  120

Query  423  -ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
             +SV D+   LQ ++S++       D   N +GWKP L SIPE+D
Sbjct  121  VVSVQDVASWLQGKQSTNSQAVGFQDGGNNNEGWKPELESIPEVD  165



>gb|EYU38637.1| hypothetical protein MIMGU_mgv1a020563mg [Erythranthe guttata]
Length=160

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 111/171 (65%), Gaps = 21/171 (12%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVL+  ++RVMKTDGKILEYK+P+KV+Q+LSEF+NHAISD LPV++HL  +TEMV 
Sbjct  1    MGNCLVLEEKIVRVMKTDGKILEYKSPIKVHQILSEFSNHAISDKLPVLKHLHLNTEMVQ  60

Query  252  Grlyyll------plpvprpkpakkkvkFADQV-EEADQQGTG-VVRVKIIISKQELQAL  407
              LYYLL                KK V+F+D V E  + + TG VVR+K++ISK+ELQA+
Sbjct  61   NHLYYLLPLPPPIKTTTTTKTKKKKTVRFSDDVIENHENRATGSVVRIKLVISKKELQAM  120

Query  408  LSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKG--WKPMLGSIPELD  554
            L    +SVDD++            N+   +E  N +G    P L SIPE++
Sbjct  121  LINGGVSVDDLIS-----------NQVQKEESTNGRGVSLSPALESIPEVN  160



>ref|XP_009775608.1| PREDICTED: uncharacterized protein LOC104225495 [Nicotiana sylvestris]
Length=159

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 108/165 (65%), Gaps = 12/165 (7%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VLQ  +++VMKTDGKILEYKAP+KVYQVLS+F+ HA+S+SL V+QHL  ++ M+ 
Sbjct  1    MGNCIVLQEKIVKVMKTDGKILEYKAPIKVYQVLSQFSGHAVSESLSVIQHLPPNSNMLA  60

Query  252  Gr----lyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            G+    L  L   P    K  K      + ++E  ++   VVR+K++ISK+ELQ LL ++
Sbjct  61   GQLYYLLPLLPVPPPKIAKKKKVVKFAKEVIQEEAKERKEVVRIKLVISKKELQDLLKEE  120

Query  420  Q-ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
              I+VD++   ++KEK +D       D   N KGWKP+L  IPE 
Sbjct  121  GLITVDEISHLIKKEKQTD-------DNTTNGKGWKPVLDCIPEF  158



>ref|XP_010912297.1| PREDICTED: uncharacterized protein LOC105038251 [Elaeis guineensis]
Length=148

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 102/160 (64%), Gaps = 17/160 (11%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ   VI++M+ DGKIL Y++P+ V+QVLSEF  HAISD+LP + HL   T+M 
Sbjct  1    MGNCLVLQEKKVIKIMRMDGKILSYQSPLIVHQVLSEFPGHAISDTLPAIDHLDPATDMR  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
             G+LYYL+P                  ++E    GTGVVR+K++ISKQEL+ LL K  ++
Sbjct  61   CGQLYYLIPSKT--------------PIKETGGTGTGVVRIKLVISKQELKDLLLKGGVT  106

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             D M+  +Q+  S++  N  + D E  C GW+P L SIPE
Sbjct  107  FDSMISLVQRGPSNN--NSTSGDGEEKCIGWRPALESIPE  144



>ref|XP_002323428.2| hypothetical protein POPTR_0016s08060g [Populus trichocarpa]
 gb|EEF05189.2| hypothetical protein POPTR_0016s08060g [Populus trichocarpa]
Length=159

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 7/161 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NVI++MK+DGKILEY+AP+KV QVLS+F +HAI+DSL   Q+L  DT ++G
Sbjct  1    MGNCLVLQGNVIKIMKSDGKILEYQAPIKVQQVLSDFCDHAIADSLQAFQYLLPDTNLLG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD--QQGTGVVRVKIIISKQELQALLSKDQI  425
            G LYYL+PL +P P   KK      + +E    Q+ T VVR+K++ISKQEL+ +L K  +
Sbjct  61   GHLYYLVPLQLPSPAKKKKVRFSIPEDQEVKDVQEKTSVVRIKLVISKQELEEMLRKGGV  120

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            SVDDMV  L  ++          D       WKP+L SIPE
Sbjct  121  SVDDMVSQLHGQQRVQ-----TVDIPDGVNTWKPVLESIPE  156



>ref|XP_003535651.1| PREDICTED: uncharacterized protein LOC100780937 [Glycine max]
 gb|KHN13518.1| hypothetical protein glysoja_038756 [Glycine soja]
Length=162

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VLQ NV+RVMK+DGKILEYKAP+KV+QVL++F  HAIS SLPV+ HL  +T ++ 
Sbjct  1    MGNCIVLQENVVRVMKSDGKILEYKAPIKVHQVLNQFPGHAISKSLPVLHHLHPNTRLLK  60

Query  252  Gr-lyyllplpvprpkpakkkvkFADQVEEADQ---QGTGVVRVKIIISKQELQALLSKD  419
            G+  Y + P      K  KK+V+FA+   + DQ   +G  VVR+K+++SKQEL+ ++ K 
Sbjct  61   GQLYYLVPPPQPSPKKVNKKRVRFAEPDHDDDQVEDKGDEVVRIKLVLSKQELKDIVQKG  120

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             ISV +++  +Q +    +++ C    + +  GWKP L +IPE
Sbjct  121  GISVREVLSLVQGKGMDGDVDVCTRVNDGS-HGWKPALETIPE  162



>ref|XP_010931137.1| PREDICTED: uncharacterized protein LOC105052124 [Elaeis guineensis]
Length=145

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 94/160 (59%), Gaps = 20/160 (13%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ   +I++M+ DGKIL Y++P+K YQ+LSEF  HAI D+LPVV HL   T+M 
Sbjct  1    MGNCLVLQDKKMIKIMRMDGKILRYQSPLKAYQILSEFPEHAIFDALPVVHHLDPTTDMR  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
             G                   +     ++E    GTGVVR+K++ISKQEL+ LL K  ++
Sbjct  61   SG--------------QLYYLLPLKTPIKETG-LGTGVVRIKLVISKQELKDLLLKGGVT  105

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             D+M+   Q+  S    NR + D E  C GW+P L SI E
Sbjct  106  FDNMISLGQRRPS----NRRSGDGEEKCIGWRPALESIQE  141



>ref|XP_010101557.1| hypothetical protein L484_015381 [Morus notabilis]
 gb|EXB88696.1| hypothetical protein L484_015381 [Morus notabilis]
Length=163

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 108/163 (66%), Gaps = 2/163 (1%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VL   VI++MK DGKILEY++P+KV++VLSEF  HA+ ++   +  LR +T++ G
Sbjct  1    MGNCMVLGEKVIKIMKPDGKILEYRSPIKVHEVLSEFTGHAMRETTTPMSDLRPETKLRG  60

Query  252  Gr-lyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
            GR  Y +    +      KKKV+F++  ++ +QQ + VVR+K++ISKQ+LQ LLSK  +S
Sbjct  61   GRLYYLVPLPALRPQGGVKKKVRFSEPGKDVEQQTSKVVRIKLVISKQQLQELLSKGGVS  120

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKG-WKPMLGSIPELD  554
            VDDMV     EK  D      + ++   +G WKP L SIPE++
Sbjct  121  VDDMVSQPHNEKRKDGSGGSFSCDDGQREGYWKPALESIPEIN  163



>ref|XP_007162908.1| hypothetical protein PHAVU_001G190500g [Phaseolus vulgaris]
 gb|ESW34902.1| hypothetical protein PHAVU_001G190500g [Phaseolus vulgaris]
Length=159

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NV+ +MKTDGKILEYK P+KV +VL +F+ HA+S+SL V+++L   T++VG
Sbjct  1    MGNCLVLQENVVTIMKTDGKILEYKTPIKVEEVLVQFSGHAVSESLTVLRYLEPQTKLVG  60

Query  252  Grlyy--llplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
            G+LYY   LP P P      KKV+FAD   + D Q + VVR+K++ISKQELQ +L     
Sbjct  61   GQLYYLVPLPPPPPPSPKTNKKVRFADPEVQDDVQKSNVVRIKVVISKQELQNMLQNGGF  120

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            SV  M+      K  D     +   E   +GWKP L SIPE+
Sbjct  121  SVSKMLSLADDVKGED----LSQKNEDVSQGWKPALESIPEV  158



>emb|CDP15420.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+ L+   I+V+K+DG++LEY  PMKV  VLS+F  HA+ DSLPVV+HL  DT+M+G
Sbjct  1    MGNCIALRKKPIKVIKSDGRVLEYNPPMKVCHVLSKFGGHALYDSLPVVRHLHPDTDMIG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G    +  L        ++    + ++    Q+G GV+R+K++ISK+ELQA+L K  I+V
Sbjct  61   G---RVYYLLPLLTVHPQRAGDVSSKITATGQEG-GVLRIKLVISKEELQAMLRKGGITV  116

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            D+MV  LQ    +   +  ++D   +   W P+L S+PE
Sbjct  117  DNMVSKLQNNGKTCGTDSFSSDSRRSSPRWMPLLESVPE  155



>ref|XP_011004113.1| PREDICTED: uncharacterized protein LOC105110698 [Populus euphratica]
Length=159

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 107/167 (64%), Gaps = 19/167 (11%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NVI++MK+DGKILEY+AP+KV QVL++F +HAI+DSL   QHL  DT + G
Sbjct  1    MGNCLVLQGNVIKIMKSDGKILEYQAPIKVQQVLADFCDHAIADSLQAFQHLLPDTNLRG  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEAD--QQGTGVVRVKIIISKQELQALLSKDQI  425
            G LYYL+PL +P P   KK      + +E    Q+ T VVR+K++ISKQEL+ +L K  +
Sbjct  61   GHLYYLVPLQLPSPAKKKKVRFSIPEDQEVKDVQEKTSVVRIKLVISKQELEEMLRKGGV  120

Query  426  SVDDMVRHL------QKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            SVDDMV  L      QK    D +N C           K ML SIPE
Sbjct  121  SVDDMVSQLHGQQRVQKVDIPDGVNTC-----------KRMLESIPE  156



>gb|KHN02220.1| hypothetical protein glysoja_002244 [Glycine soja]
Length=155

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NV++++KTDGK+LEYK P+KV +VL +F+ HA+S+SL V++HL   T+++ 
Sbjct  1    MGNCLVLQENVVKIVKTDGKVLEYKTPIKVEEVLIQFSGHAVSESLTVLRHLEPHTKLLR  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G       +P+P      KKV+FA+  E  D   + VVR+K++ISKQ+LQ +L     SV
Sbjct  61   G--QLYYLVPLPPSPKTNKKVRFAEP-EVQDVHKSNVVRIKVVISKQQLQNMLQNGGFSV  117

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
              M+  + +EK +++L++ + D     +GWKP L SIPE+
Sbjct  118  SKMLSLVHEEKGTEDLSQKSED---VSQGWKPALESIPEV  154



>ref|XP_003542606.1| PREDICTED: uncharacterized protein LOC100793955 [Glycine max]
 gb|KHN40919.1| hypothetical protein glysoja_045852 [Glycine soja]
Length=161

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSL-PVVQHLRADTEMV  248
            MGNC+VLQ NV+RVMK+DGKILEYKAP++V+QVL++F  HAIS+SL PV+ HL   T ++
Sbjct  1    MGNCIVLQRNVVRVMKSDGKILEYKAPIRVHQVLNQFRGHAISESLPPVLHHLNPYTRLL  60

Query  249  GGrlyyll-plpvprpkpakkkvkFADQVEEADQQGTG-VVRVKIIISKQELQALLSKDQ  422
             G+LYYL+ P      K  KK+V+FA+  E+   +  G VVR+K+++SKQEL+ ++ K  
Sbjct  61   KGQLYYLVPPPQASSKKVNKKRVRFAEPDEDDQVEDKGCVVRIKLVLSKQELKDMVQKGG  120

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            ISV++++  +Q +     ++ C  D+E    GWKP L +IPE
Sbjct  121  ISVNEVLSLVQGKGIVGGVDACRRDDEG-FHGWKPALETIPE  161



>ref|NP_001236025.1| uncharacterized protein LOC100500042 [Glycine max]
 gb|ACU14724.1| unknown [Glycine max]
Length=155

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NV++++KTDGK+LEYK P+KV +VL +F+ HA+S+SL V++HL   T+++ 
Sbjct  1    MGNCLVLQENVVKIVKTDGKVLEYKTPIKVEEVLIQFSGHAVSESLTVLRHLEPHTKLLR  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G       +P+P      KKV+FA+  E  D   + V R+K++ISKQ+LQ +L     SV
Sbjct  61   G--QLYYLVPLPPSPKTNKKVRFAEP-EVQDVHKSNVARIKVVISKQQLQNMLQNGGFSV  117

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
               +  + +EK +++L + + D     +GWKP L SIPE+
Sbjct  118  SKTLSLVHEEKGTEDLPQKSED---VSQGWKPALESIPEV  154



>ref|XP_008787753.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=145

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 94/160 (59%), Gaps = 20/160 (13%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCL +Q   +I +M+ DGK+L Y++P+K Y+VLSEF  HAISD+LPVV HL   T M 
Sbjct  1    MGNCLAIQDKEMIEIMRMDGKMLRYRSPLKAYRVLSEFPGHAISDALPVVHHLDPTTNMR  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
             GRLYYLLP                 +  +    G GVVR+K++ISKQEL+ LL K  ++
Sbjct  61   SGRLYYLLP---------------PKKPTKETGLGNGVVRIKMVISKQELKDLLRKGGVT  105

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             D M+   Q+  S    N  + D E  C GW+P L SI E
Sbjct  106  FDSMISLGQRGPS----NGRSGDGEEKCIGWRPALESISE  141



>gb|AFK47529.1| unknown [Lotus japonicus]
Length=164

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 113/165 (68%), Gaps = 5/165 (3%)
 Frame = +3

Query  72   MGNCLVL-QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVL Q NV+RVMKTDGKILEYKA +KV QVL++F+ HA+SDS   ++HL+ +T+++
Sbjct  1    MGNCLVLLQENVVRVMKTDGKILEYKALIKVEQVLADFSGHAVSDSQTGLRHLQPNTKLL  60

Query  249  GGrlyy--llplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
            GG+LYY   LP P P P  A+KKV+FA+  E  D Q + VVR+K+++SKQ+L  +L    
Sbjct  61   GGQLYYLVTLPSPPPSPSKARKKVRFAEP-EVQDVQKSSVVRIKLVLSKQQLHDMLQDGG  119

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANC-KGWKPMLGSIPELD  554
             SV+ M+   Q EK  D         E +  +GWKP+L SI E++
Sbjct  120  FSVNKMLSLAQGEKGEDGGEDLLKRREDDVSQGWKPVLESIAEVN  164



>ref|XP_009775609.1| PREDICTED: uncharacterized protein LOC104225496 [Nicotiana sylvestris]
Length=144

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 98/137 (72%), Gaps = 11/137 (8%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFAN-HAISDSLPVVQHLRADTEMV  248
            MGNC+VLQ  V+++MKTDGKILEYKAP+KVY+VLS+FA  +AIS+SL V+QHL  ++ M+
Sbjct  1    MGNCIVLQEKVVKIMKTDGKILEYKAPIKVYEVLSQFAGQYAISESLSVIQHLLPNSNML  60

Query  249  GGrlyyllplp-------vprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQAL  407
             G+LYYLLP+          + K  K   +  DQ E   Q+ T VVR+K++ISK+ELQAL
Sbjct  61   AGQLYYLLPILPVSPPKIAKKKKVVKFAKEVVDQEEAKKQRTTEVVRIKLVISKKELQAL  120

Query  408  LSKDQ---ISVDDMVRH  449
            LS  +   I+V+D+V H
Sbjct  121  LSGTEGGLITVNDIVNH  137



>ref|NP_001241101.1| uncharacterized protein LOC100780959 [Glycine max]
 gb|ACU20703.1| unknown [Glycine max]
 gb|KHN18776.1| hypothetical protein glysoja_021527 [Glycine soja]
Length=156

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 101/160 (63%), Gaps = 5/160 (3%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLVLQ NV++++KTDGK+LEYK P+KV +VL +F+ HA+S+SL V+++L   T+++ 
Sbjct  1    MGNCLVLQENVVKIVKTDGKVLEYKTPIKVEEVLIQFSGHAVSESLTVLRYLEPHTKLLR  60

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
            G   Y L    P      KKV+FA+  E  D   + VVR+K++ISKQELQ +L  +  SV
Sbjct  61   G-QLYYLVPLPPPSPKTNKKVRFAEP-EVQDVHKSNVVRIKLVISKQELQNMLQSEGFSV  118

Query  432  DDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
              M+  + ++ S       +   E   +GWKP   SIPE+
Sbjct  119  SKMLSLVHEDLSQKGTEYLSQKSE---EGWKPAFESIPEV  155



>ref|XP_008784027.1| PREDICTED: uncharacterized protein LOC103703094 [Phoenix dactylifera]
Length=147

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 20/161 (12%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ   VI++M  DGKIL Y++P+KV+Q+L EF  HAISD+LPV+ HL   T+M 
Sbjct  1    MGNCLVLQEKKVIKIMGMDGKILRYQSPVKVHQLLCEFPGHAISDALPVIGHLDPATDMR  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSK-DQI  425
             G+LYYL+P   P                +    G GVVR++++ISKQEL+ LL K   +
Sbjct  61   SGQLYYLVPPKTPL---------------KETGNGNGVVRIELVISKQELKDLLLKGGGV  105

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            + D M+  +Q+  S+D     + D E  C  W+P L SIPE
Sbjct  106  TFDSMISLVQRGPSND---GTSGDGEEKCIEWRPALESIPE  143



>ref|XP_004246518.1| PREDICTED: uncharacterized protein LOC101255524 [Solanum lycopersicum]
Length=191

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 47/199 (24%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVV--QHLRADTEM  245
            MGNC+VLQ  V++VMKTDGKILEYKAP+KV+Q+LS+F+NH IS+S  V+  QHL+ + E+
Sbjct  1    MGNCIVLQEKVVKVMKTDGKILEYKAPIKVHQILSQFSNHVISNSHQVIENQHLQPNDEL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVE----------------------------EA  341
            +GG++YYLLP         KK     DQV+                            EA
Sbjct  61   LGGQIYYLLPSLPKPKSAKKKVKFANDQVKKKVKFANDDQLVNDEKVKCANDHQVELLEA  120

Query  342  D-----QQGTGVVRVKIIISKQELQALLSKDQ---ISVDDMVRHLQKEKSSDELNRCAAD  497
            +      Q   V+RVKI+ISK+ELQ LLS  +   I VDDM+      KS+  +      
Sbjct  121  NHDHHHHQKKEVIRVKIVISKKELQELLSSSEGGIIKVDDMI------KSTTIVEESTI-  173

Query  498  EEANCKGWKPMLGSIPELD  554
              AN KGWKP+L  I E++
Sbjct  174  --ANGKGWKPILDIIAEIN  190



>ref|XP_006341112.1| PREDICTED: uncharacterized protein LOC102603676 [Solanum tuberosum]
Length=193

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 111/199 (56%), Gaps = 48/199 (24%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVV--QHLRADTEM  245
            MGNC+VLQ  V++VMKTDGKILEYKAP+KV+Q+LS+F++H IS+S  V+  QHL+ + ++
Sbjct  1    MGNCIVLQEKVVKVMKTDGKILEYKAPIKVHQILSQFSSHVISNSHQVIENQHLQPNDDL  60

Query  246  VGGrl-------------yyllplpvprpkpakkkvkFA----------------DQVE-  335
            +GG++                           KKKVKFA                DQVE 
Sbjct  61   LGGQIYYLLPSLPKQPPPKSAKKKVKFANDQVKKKVKFANDDQLVNDHEKVKFATDQVEL  120

Query  336  -EAD---QQGTGVVRVKIIISKQELQALLSKDQ---ISVDDMVRHLQKEKSSDELNRCAA  494
             EA+    Q   V+RVKI+ISK+ELQ LLS  +   I VDDM+      KS+  +     
Sbjct  121  LEANHDHHQKKEVIRVKIVISKKELQELLSSSEGGIIKVDDMI------KSTTIVEESTI  174

Query  495  DEEANCKGWKPMLGSIPEL  551
                N KGWKP+L  IPE+
Sbjct  175  ---TNGKGWKPILDIIPEI  190



>ref|XP_010683729.1| PREDICTED: uncharacterized protein LOC104898360 [Beta vulgaris 
subsp. vulgaris]
Length=159

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 107/164 (65%), Gaps = 8/164 (5%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL  Q  V++++K DGKILEYKA +KV  VLSEF  H +SD LPV+Q+L+ + E+V 
Sbjct  1    MGNCLRSQEKVVQIVKPDGKILEYKASIKVSDVLSEFQGHGLSDKLPVLQYLKPNIELVA  60

Query  252  GrlyyllplpvprpkpakkkvkFA--DQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
            G LYYL+P+    PK  KKKV+FA  ++VEE   Q T +  +K++ISKQEL+ +L    +
Sbjct  61   GSLYYLIPVLTQPPKVGKKKVRFAEPEKVEEKKSQDTSLT-IKLVISKQELKEMLKSGAL  119

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEA-NCKGWKPMLGSIPELD  554
            S+D++V   Q +K   E+     DE++   K W P L SI E D
Sbjct  120  SLDELVSKQQNDKCRTEM----LDEQSYGSKTWTPSLKSICEAD  159



>ref|XP_009607129.1| PREDICTED: uncharacterized protein LOC104101400 [Nicotiana tomentosiformis]
Length=154

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 97/142 (68%), Gaps = 14/142 (10%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFAN-HAISDSLPVVQHLRADTEMV  248
            MGNC+VLQ  V++VMKTDGKILEYKAP+KVYQVLS+F   +AIS+SL V+Q+L  ++ M+
Sbjct  1    MGNCIVLQEKVVKVMKTDGKILEYKAPIKVYQVLSQFGGQYAISESLSVIQNLLPNSNML  60

Query  249  GGrlyy-------llplpvprpkpakkkvkFADQVEEADQQ--GTGVVRVKIIISKQELQ  401
             G+LYY         P    + K  K   +  DQ EEA +Q   T  VR+K++ISK+ELQ
Sbjct  61   AGQLYYLLPILPVPPPKIAKKKKVVKFAKEVVDQ-EEAKKQIRTTEAVRIKLVISKKELQ  119

Query  402  ALLSKDQ---ISVDDMVRHLQK  458
            ALLS  +   I+V+D+V  LQK
Sbjct  120  ALLSSTEGGLITVNDIVNRLQK  141



>ref|XP_009404360.1| PREDICTED: uncharacterized protein LOC103987707 [Musa acuminata 
subsp. malaccensis]
Length=189

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 20/161 (12%)
 Frame = +3

Query  69   NMGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
             MGNCL+LQ   VI +M+ DG++L Y +P+KV QVL+EF  HAISD+LPV+  L  +  M
Sbjct  43   GMGNCLILQEKKVIEIMRMDGEVLRYPSPLKVQQVLNEFPGHAISDALPVIACLDPEKRM  102

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
              G+LYYLLP   P  + +                G G+VR+K+++SKQEL+ ++ K  +
Sbjct  103  RHGQLYYLLPPKKPVAETSA---------------GEGLVRIKLVVSKQELKEMVRKGGV  147

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            S+DDM+  L++E+ S    R  A E+     W+P L SIPE
Sbjct  148  SLDDMMSLLRREQQS----RGGASEKERAMEWRPTLESIPE  184



>ref|XP_010036674.1| PREDICTED: uncharacterized protein LOC104425635 [Eucalyptus grandis]
 gb|KCW48304.1| hypothetical protein EUGRSUZ_K02033 [Eucalyptus grandis]
Length=178

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 108/178 (61%), Gaps = 17/178 (10%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEF-ANHAISDSLPVVQHLRADTEMV  248
            MGNCLVL+  VI+++KTDGKILEYK+P++  QVLSEF A HAIS + P +  L  D+ ++
Sbjct  1    MGNCLVLEEKVIKIVKTDGKILEYKSPLRARQVLSEFAAGHAISQTFPAMAVLEPDSRLL  60

Query  249  GGrlyyl-----lplpvprpkpakkkvkFADQ----VEEADQ--QGTG---VVRVKIIIS  386
             GR+YY+                KKKV+FAD     VEE ++  +G G   VVR+K++IS
Sbjct  61   CGRMYYIFPLDPSTTSKFAKTENKKKVRFADDDRKAVEEGEEITKGGGSSSVVRIKVVIS  120

Query  387  KQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEAN--CKGWKPMLGSIPELD  554
            K+EL  LL++  +SV D +   Q  +S +       D+E +   + WKP L SI E++
Sbjct  121  KRELAELLARGGVSVKDEMISSQLFQSEERSTSLGGDDEGDDLSRSWKPSLESIREVN  178



>ref|XP_009379809.1| PREDICTED: uncharacterized protein LOC103968359 [Musa acuminata 
subsp. malaccensis]
Length=148

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 98/160 (61%), Gaps = 18/160 (11%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ   VIR++K DG+IL Y++PMKV QVL EF  HA+SD+LPVV +L     + 
Sbjct  1    MGNCLVLQEKKVIRIVKMDGEILRYRSPMKVQQVLDEFPGHAVSDALPVVTYLDPALCLR  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
             G+LYYLLP   P           A  VE +  +  GV+R+K++I+KQ+L+ +LSK  +S
Sbjct  61   QGQLYYLLPPKKP-----------AAAVETSVGE-EGVIRIKLVITKQQLKDMLSKGGVS  108

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
              DMV  L+ +      +R  A E+     WKP L SIPE
Sbjct  109  HGDMVSFLRGQG-----DRSGASEKERSMEWKPTLESIPE  143



>ref|XP_011077928.1| PREDICTED: uncharacterized protein LOC105161812 [Sesamum indicum]
Length=115

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 85/160 (53%), Gaps = 48/160 (30%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEY-KAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ NV+RVMK DGKI++Y K+P++V QVLS+F++H +S+     +H R      
Sbjct  1    MGNCLVLQENVVRVMKADGKIIQYKKSPIEVDQVLSKFSHHEVSED----EHHRL-----  51

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
                                                GVVR+K++ISKQELQ +L    +S
Sbjct  52   -----------------------------------AGVVRIKLVISKQELQEMLRIGGVS  76

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            VDDM+  +QKE+     +R A       KGW P+L SIPE
Sbjct  77   VDDMISKVQKEEIIKSYDRDAV---MISKGWSPVLESIPE  113



>gb|EYU35495.1| hypothetical protein MIMGU_mgv1a018874mg [Erythranthe guttata]
Length=164

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 101/153 (66%), Gaps = 20/153 (13%)
 Frame = +3

Query  72   MGNCL-VLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHA--ISDSL-PVVQHLRADT  239
            MGNC+ V+Q   + VM+TDGKI+EYK+P+KV+QVLS+F NHA  +SD+L P+V H+  + 
Sbjct  1    MGNCIFVVQDKSVNVMRTDGKIIEYKSPIKVHQVLSDFPNHALLVSDNLPPIVNHMHPNA  60

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEA----------------DQQGTGVVRV  371
            +++ GRLYYL+PLPV      K K K    V  A                 +Q  GV R+
Sbjct  61   DLLRGRLYYLVPLPVVPQPMKKTKTKPKKTVRFAEDVVIVEEEAEEEKEKTRQSNGVTRI  120

Query  372  KIIISKQELQALLSKDQISVDDMVRHLQKEKSS  470
            K++ISK+ELQA+LSK+ +SV+DM+ H+Q+ + S
Sbjct  121  KLVISKKELQAILSKEGVSVEDMISHVQQNEQS  153



>ref|XP_008462573.1| PREDICTED: uncharacterized protein LOC103500900 [Cucumis melo]
Length=174

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 100/165 (61%), Gaps = 8/165 (5%)
 Frame = +3

Query  78   NCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGr  257
            NCL +    IR+MKTDGKILEYK+P +V+QVLS+F+ H ISD++PV  HL    +++ G 
Sbjct  5    NCLFVDHKPIRIMKTDGKILEYKSPTRVFQVLSDFSGHEISDAVPVTHHLHRTAKLLSGH  64

Query  258  lyyllplpvprpkpakkkvkFADQVEEAD-QQGTGVVRVKIIISKQELQALLSKDQISVD  434
            LY+L+P      KP K       + E A    G GVVR+K++++K+ELQ ++ +  IS +
Sbjct  65   LYFLIPKEPHEKKPKKAVRFAEPEKETASATTGGGVVRIKVVMTKKELQEMVERGGISAE  124

Query  435  DMVRHLQKEKS-------SDELNRCAADEEANCKGWKPMLGSIPE  548
            +M+  ++  +         +E      DEE+  + WKP+L SIPE
Sbjct  125  EMICKIKNGRGEISSRSEMEEEEEEEEDEESELQRWKPVLESIPE  169



>ref|NP_187623.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42468.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39927.1| At3g10120 [Arabidopsis thaliana]
 gb|AEE74862.1| uncharacterized protein AT3G10120 [Arabidopsis thaliana]
Length=173

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 105/181 (58%), Gaps = 28/181 (15%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCLVMEKKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLTNNCHLHPQAKLL  60

Query  249  GGrlyy---llplpvprpkpakkkvkFA---------------DQVEEADQQGTGVVRVK  374
             GRLYY        +   K   KKV+FA               D  +   ++  GVVRVK
Sbjct  61   CGRLYYLLPQETNSIKHMKKTMKKVRFANPEVEKEEQEEDRLTDCCDNTKEKTNGVVRVK  120

Query  375  IIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            +++SKQEL+ LL     SV +MV R L K+      + C  D+E + +GW+P+L SIPE 
Sbjct  121  MVVSKQELEKLLQGG--SVHEMVYRTLAKQ------HLCDDDDECHKEGWRPLLDSIPET  172

Query  552  D  554
            D
Sbjct  173  D  173



>ref|XP_004156256.1| PREDICTED: uncharacterized protein LOC101226128 [Cucumis sativus]
 gb|KGN48264.1| hypothetical protein Csa_6G452650 [Cucumis sativus]
Length=172

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 102/165 (62%), Gaps = 10/165 (6%)
 Frame = +3

Query  78   NCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGr  257
            NCL +    IR+MKTDGKILEYK+P +V+QVLS+F+ H ISD++PV  HL    +++ G 
Sbjct  5    NCLFIDNKPIRIMKTDGKILEYKSPTRVFQVLSDFSGHEISDAVPVSHHLHRTAKLLSG-  63

Query  258  lyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVDD  437
              Y L    P  K  KK V+FA+  E+    G GVVR+K++++K+ELQ ++ +  IS ++
Sbjct  64   HLYFLIPKEPEEKKPKKAVRFAEP-EKETATGGGVVRIKVVMTKKELQEMVERGGISAEE  122

Query  438  MVRHLQK--------EKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            M+  ++          +  +E +    DEE+  + WKP+L SIPE
Sbjct  123  MICKIKNGCGEISSRSEMEEEEDDDDDDEESELQRWKPVLESIPE  167



>ref|XP_004143322.1| PREDICTED: uncharacterized protein LOC101213283 [Cucumis sativus]
Length=169

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 82/122 (67%), Gaps = 2/122 (2%)
 Frame = +3

Query  78   NCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGr  257
            NCL +    IR+MKTDGKILEYK+P +V+QVLS+F+ H ISD++PV  HL    +++ G 
Sbjct  5    NCLFIDNKPIRIMKTDGKILEYKSPTRVFQVLSDFSGHEISDAVPVSHHLHRTAKLLSG-  63

Query  258  lyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVDD  437
              Y L    P  K  KK V+FA+  E+    G GVVR+K++++K+ELQ ++ +  IS ++
Sbjct  64   HLYFLIPKEPEEKKPKKAVRFAEP-EKETATGGGVVRIKVVMTKKELQEMVERGGISAEE  122

Query  438  MV  443
            M+
Sbjct  123  MI  124



>ref|XP_006281180.1| hypothetical protein CARUB_v10027215mg [Capsella rubella]
 gb|EOA14078.1| hypothetical protein CARUB_v10027215mg [Capsella rubella]
Length=181

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 110/183 (60%), Gaps = 24/183 (13%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EYK PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCLVMENKVIKIMRNDGKVVEYKGPMKVHHILTQFSPHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyyllplpvprpkpakkkvkFAD-QVEEAD-------------------QQGTGVVR  368
             GRLYYLLP+         KKV+FA+ +VE+ +                   ++  G VR
Sbjct  61   CGRLYYLLPMDTSSTIKTIKKVRFANPEVEKQEEQEQEQEQDSFIGSCDNTMEKTNGFVR  120

Query  369  VKIIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIP  545
            VK+++SKQEL+ LL     SV DMV R L K+   D+ +    +++   KGW+P+L SIP
Sbjct  121  VKMVVSKQELEKLLEGG--SVHDMVYRTLAKQHLCDDDDGDGGEDDECHKGWRPLLDSIP  178

Query  546  ELD  554
            E D
Sbjct  179  ETD  181



>emb|CCH47175.1| similar to iron-sulfur assembly protein IscA-like [Lupinus angustifolius]
Length=221

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 81/147 (55%), Gaps = 27/147 (18%)
 Frame = +3

Query  114  MKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyllplpvprp  293
            MKTDGKILEYK P KV QVL +F+ HAI DSLP +Q+L  +T+ V               
Sbjct  1    MKTDGKILEYKTPNKVEQVLKKFSGHAIYDSLPFLQNLHPNTKKV---------------  45

Query  294  kpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSD  473
                   +F+D     + Q + VVRVKI+ISK+EL  +L K+ ISV+ M+  +  EK  D
Sbjct  46   -------RFSD----LEVQESRVVRVKIVISKKELHDMLQKEGISVEKMLSKVHNEKVID  94

Query  474  ELNRCAADEEANC-KGWKPMLGSIPEL  551
              N   +    +  +GWKP L +I E 
Sbjct  95   SDNEDLSKRTCDIFQGWKPALETIAEF  121



>ref|XP_009773722.1| PREDICTED: uncharacterized protein LOC104223892 [Nicotiana sylvestris]
Length=129

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 96/165 (58%), Gaps = 40/165 (24%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VLQ  +++VMKT+GK+LEYK  MK    +   A    +  +PV + +        
Sbjct  1    MGNCIVLQQKIVKVMKTNGKVLEYKPLMKKDNEVLPLAPEPPT-KVPVNKKV--------  51

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTG-VVRVKIIISKQELQALLSKDQ-I  425
                                  FAD+VEE+ ++G+  V+R+K++ISK+ELQALL++   +
Sbjct  52   ---------------------TFADEVEESSKKGSDQVLRIKLVISKKELQALLNEGGGL  90

Query  426  SVDDMVRH-LQKEK-SSDELNRCAADEEANCKGWKPMLGSIPELD  554
            +VD +V++ LQKE+ SS+E+ +       +C GWKP L SIPELD
Sbjct  91   TVDGIVQYPLQKEQISSNEMIK------NDCIGWKPALDSIPELD  129



>ref|XP_009146870.1| PREDICTED: uncharacterized protein LOC103870489 isoform X1 [Brassica 
rapa]
Length=163

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 107/170 (63%), Gaps = 16/170 (9%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++M+ DG+++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyyll-plpvprpkpakkkvkFAD-QVE-EAD--QQGTGVVRVKIIISKQELQALLS  413
             GRLYYL+            KKV+FAD +VE E D  ++   VVRVK+++SK+EL+ LL 
Sbjct  61   CGRLYYLMPKQTTTVKHKKTKKVRFADPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLLQ  120

Query  414  KDQISVDDMVRHLQKEKSSDELNRC---AADEEANCKGWKPMLGSIPELD  554
                SV ++V      +S D+ + C   AA  E   +GW+P+L SIPE D
Sbjct  121  GG--SVHEVVY-----RSLDKQHLCHDDAAATEECLRGWRPLLDSIPESD  163



>ref|XP_004494186.1| PREDICTED: uncharacterized protein LOC101511310 [Cicer arietinum]
Length=130

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 85/161 (53%), Gaps = 32/161 (20%)
 Frame = +3

Query  72   MGNCLVLQAN-VIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLVLQ N V+++MKTDGKILEYK P+KV +VL +F+      S    + +R      
Sbjct  1    MGNCLVLQENNVVKIMKTDGKILEYKTPIKVEEVLVDFSVPLPPPSPKGQKKVR------  54

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
                                   FA+  E  D   + VVR+K++ISKQ+L  +L    IS
Sbjct  55   -----------------------FANP-EVQDVHKSSVVRIKLVISKQKLHDMLQNGGIS  90

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            V++M+  +Q EK  D    C   +E +  GWKP+L SI E+
Sbjct  91   VENMLSLVQGEKGMDGEYLCEKSDEVSV-GWKPVLKSIAEV  130



>ref|XP_009146871.1| PREDICTED: uncharacterized protein LOC103870489 isoform X2 [Brassica 
rapa]
Length=164

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 110/171 (64%), Gaps = 17/171 (10%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++M+ DG+++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyyll--plpvprpkpakkkvkFAD-QVE-EAD--QQGTGVVRVKIIISKQELQALL  410
             GRLYYL+       + K  KKKV+FAD +VE E D  ++   VVRVK+++SK+EL+ LL
Sbjct  61   CGRLYYLMPKQTTTVKHKKTKKKVRFADPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLL  120

Query  411  SKDQISVDDMVRHLQKEKSSDELNRC---AADEEANCKGWKPMLGSIPELD  554
                 SV ++V      +S D+ + C   AA  E   +GW+P+L SIPE D
Sbjct  121  QGG--SVHEVVY-----RSLDKQHLCHDDAAATEECLRGWRPLLDSIPESD  164



>ref|XP_010464670.1| PREDICTED: uncharacterized protein LOC104745189 [Camelina sativa]
Length=176

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 105/182 (58%), Gaps = 27/182 (15%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCLVMENKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLSNSCHLHPQAKLL  60

Query  249  GGrlyy---llplpvprpkpakkkvkFA----------------DQVEEADQQGTGVVRV  371
             GRLYY          +     KKV+FA                + V+   ++  GVVRV
Sbjct  61   CGRLYYLLPKETTTTKKNMKTMKKVRFAIPEVDKEEEEDDRSLTNCVDNTKEKTNGVVRV  120

Query  372  KIIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            K+++SKQEL+ LL     SV DMV R L K+   D+      D+E + KGW+P+L SIPE
Sbjct  121  KMVVSKQELEKLLQGG--SVHDMVYRTLAKQHLCDDD---GDDDECH-KGWRPLLDSIPE  174

Query  549  LD  554
             +
Sbjct  175  TN  176



>ref|XP_009627512.1| PREDICTED: uncharacterized protein LOC104118045 [Nicotiana tomentosiformis]
Length=138

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 98/167 (59%), Gaps = 37/167 (22%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VLQ  V++VMKT+GK+LEYK  +K             ++ LP+VQ       +  
Sbjct  1    MGNCIVLQEKVVKVMKTNGKVLEYKPLVK-----------KDNEVLPLVQEPPTKVPV--  47

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTG-VVRVKIIISKQELQALLSK-DQI  425
                             KKKV FA++VEE+ ++G+  V+R+K++ISK+ELQALLS+   +
Sbjct  48   -----------------KKKVTFAEEVEESSKKGSDQVLRIKLVISKKELQALLSEGGGL  90

Query  426  SVDDMVRH-LQKEKSSD----ELNRCAADEEANCKGWKPMLGSIPEL  551
            +VD MV++ LQKE +S+    + +    D+  +C  WKP L SIPEL
Sbjct  91   TVDGMVQYPLQKEHNSNIEIIKSDEFTDDDNDHCIRWKPALDSIPEL  137



>emb|CDY60165.1| BnaAnng16590D [Brassica napus]
Length=159

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 105/165 (64%), Gaps = 14/165 (8%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++M+ DG+++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNHCHLHPQAKLL  60

Query  249  GGrlyyll-plpvprpkpakkkvkFAD-QVE-EAD--QQGTGVVRVKIIISKQELQALLS  413
             GRLYYL+            KKV+FA+ +VE E D  ++   VVRVK+++SK+EL+ LL 
Sbjct  61   CGRLYYLMPKQTTTVKHKKTKKVRFANPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLLQ  120

Query  414  KDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
                SV ++V      +S D+ + C  D+E    GW+P+L SIPE
Sbjct  121  GG--SVHEVVY-----RSLDKQHLCRDDDEC-LTGWRPLLDSIPE  157



>emb|CDY22216.1| BnaC01g38850D [Brassica napus]
Length=171

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 101/176 (57%), Gaps = 24/176 (14%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V +  VI++M+ DG+++EY+ PM V+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVAEKKVIKIMRNDGEVVEYRGPMHVHDILTQFSGHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGT--------------GVVRVKIIIS  386
             GR YYL+P      K  K K K    + E ++QG               GVVRVK+++S
Sbjct  61   CGRFYYLMPKQNTTVKHKKTKKKVRFAIPEVEKQGDGLTDCGDNTKEKSPGVVRVKMVVS  120

Query  387  KQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEAN--CKGWKPMLGSIPE  548
            KQEL+ L+     SV +MV      +S  E + C  D+ A+   +GW+P+L SIPE
Sbjct  121  KQELEKLIQGG--SVHEMVY-----RSLAEQHLCHDDDAADEGLRGWRPLLDSIPE  169



>ref|XP_010480673.1| PREDICTED: uncharacterized protein LOC104759418 [Camelina sativa]
Length=175

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 102/181 (56%), Gaps = 26/181 (14%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCLVMENKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyy------------------llplpvprpkpakkkvkFADQVEEADQQGTGVVRVK  374
             GRLYY                  +        K  ++  +  D  +   ++  GVVRVK
Sbjct  61   CGRLYYLLPKETTTTKKNMKTMKKVRFSIPEVDKEEEEDDRLTDCGDNTKEKTNGVVRVK  120

Query  375  IIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            +++SKQEL+ LL     SV DMV R L K+   D+      D+E + KGW+P+L SIPE 
Sbjct  121  MVVSKQELEKLLQGG--SVHDMVYRTLAKQHLCDDG---GDDDECH-KGWRPLLDSIPET  174

Query  552  D  554
            +
Sbjct  175  N  175



>ref|XP_010486602.1| PREDICTED: uncharacterized protein LOC104764713 [Camelina sativa]
Length=175

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 104/181 (57%), Gaps = 26/181 (14%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCLVMENKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLSNNCHLHPQAKLL  60

Query  249  GGrlyy---llplpvprpkpakkkvkFA---------------DQVEEADQQGTGVVRVK  374
             GRLYY          +     KKV+FA               +  +   ++  GVVRVK
Sbjct  61   CGRLYYRLPKETTTTKKNMKTMKKVRFAIPEVDKEEEEDDRLTNCGDNTKEKTNGVVRVK  120

Query  375  IIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            +++SKQEL+ LL     SV DMV R L K+   D+      D+E + KGW+P+L SIPE 
Sbjct  121  MVVSKQELEKLLQGG--SVHDMVYRTLAKQHLCDDD---GDDDECH-KGWRPLLDSIPET  174

Query  552  D  554
            +
Sbjct  175  N  175



>ref|XP_006288765.1| hypothetical protein CARUB_v10002084mg [Capsella rubella]
 gb|EOA21663.1| hypothetical protein CARUB_v10002084mg [Capsella rubella]
Length=178

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 105/179 (59%), Gaps = 28/179 (16%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  VI++++ DGK+LEY+ P+ V+ +L++F+ H++S +     HL  D +++ 
Sbjct  1    MGNCLVMEKKVIKIVRNDGKVLEYREPVCVHHILTQFSGHSLSHN---NTHLLPDAKLIS  57

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGT-----------------GVVRVKII  380
            GRLYYLLP  + + K  KK      +VEE D + +                 GVVR+KI+
Sbjct  58   GRLYYLLPTSMIKKKVNKKVTFANPEVEEDDDERSPLREDDDSSESNSKIMDGVVRMKIV  117

Query  381  ISKQELQALLSKDQISVDDMVRHLQKEK--SSDELNRCAADEEANC-KGWKPMLGSIPE  548
            + KQEL+ LL    +  + M + L+K++   +D+ +    D +  C  GW+PML SIPE
Sbjct  118  VHKQELEKLLQGGSVH-EMMYQTLEKQQLLVTDDHD----DGDLECYSGWRPMLDSIPE  171



>gb|AAF04412.1|AC010927_5 unknown protein [Arabidopsis thaliana]
Length=167

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 99/175 (57%), Gaps = 28/175 (16%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMVGGrlyy  266
            ++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++ GRLYY
Sbjct  1    MEKKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLTNNCHLHPQAKLLCGRLYY  60

Query  267  ---llplpvprpkpakkkvkFA---------------DQVEEADQQGTGVVRVKIIISKQ  392
                    +   K   KKV+FA               D  +   ++  GVVRVK+++SKQ
Sbjct  61   LLPQETNSIKHMKKTMKKVRFANPEVEKEEQEEDRLTDCCDNTKEKTNGVVRVKMVVSKQ  120

Query  393  ELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            EL+ LL     SV +MV R L K+      + C  D+E + +GW+P+L SIPE D
Sbjct  121  ELEKLLQGG--SVHEMVYRTLAKQ------HLCDDDDECHKEGWRPLLDSIPETD  167



>ref|XP_009122662.1| PREDICTED: uncharacterized protein LOC103847352 [Brassica rapa]
 emb|CDX70277.1| BnaA10g26260D [Brassica napus]
Length=171

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 96/181 (53%), Gaps = 31/181 (17%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  VI++++ DGK+LEY+ P  V  +L++F+ H++ D+     HL  D ++  
Sbjct  1    MGNCLVMEKKVIKIVRNDGKVLEYREPTTVRHILTQFSGHSLFDNNSTC-HLLPDAKLFS  59

Query  252  GrlyyllplpvprpkpakkkvkFAD-QVEE-------------------ADQQGTGVVRV  371
            G       +P    K   KKV FAD +VEE                    D +   ++R+
Sbjct  60   G--RLYYLVPTTMKKKKTKKVTFADPEVEEDARVLREEVFDTCESNIDGGDNKNASIMRM  117

Query  372  KIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLGSIPE  548
            KI++SKQEL+ LL     SV +MV    ++++       + D+   C  GW+PML SIPE
Sbjct  118  KIVVSKQELEKLLQGG--SVHEMVYQTLEKQT-----LLSDDDNLECNTGWRPMLDSIPE  170

Query  549  L  551
            +
Sbjct  171  I  171



>emb|CDY00905.1| BnaC05g42950D [Brassica napus]
Length=165

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 105/167 (63%), Gaps = 8/167 (5%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++M+ DG+++EY+ PMKV+ +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNHCHLHPQAKLL  60

Query  249  GGrlyyll-plpvprpkpakkkvkFAD-QVE-EAD--QQGTGVVRVKIIISKQELQALLS  413
             GRLYYL+            KKV+FA+ +VE E D  ++   VVRVK+++SK+EL+ LL 
Sbjct  61   CGRLYYLMPKQTTTVKHKKTKKVRFANPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLLQ  120

Query  414  KDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
               I  + + R L K+    + +  AA +E    GW+P+L SIPE D
Sbjct  121  GGSIH-EVVYRSLDKQHLCRDDDDAAAADEC-LTGWRPLLDSIPESD  165



>ref|XP_009123110.1| PREDICTED: uncharacterized protein LOC103847791 [Brassica rapa]
Length=171

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 104/175 (59%), Gaps = 22/175 (13%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++MK DG+++EY+ PM V  +L++F+ H ++ DSL    HL    +++
Sbjct  1    MGNCIVVEKKVIKIMKNDGEVVEYRGPMHVDDILTQFSGHYSLFDSLSNNCHLHPQVKLL  60

Query  249  GGrlyyl--lplpvprpkpakkkvkFA------------DQVEEADQQGTGVVRVKIIIS  386
             GRLYYL        + K  KKKV+FA            D  +   ++  GVVRVK+++S
Sbjct  61   CGRLYYLMPKQNTTVKHKKTKKKVRFANPEVEKKGDGLTDCGDNTKEKSLGVVRVKMVVS  120

Query  387  KQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            KQEL+ L+     SV +MV R L K+    + +  AADE    +GW+P+L SIPE
Sbjct  121  KQELEKLIQGG--SVHEMVYRSLAKQHLCHDDD--AADE--GLRGWRPLLDSIPE  169



>emb|CDY41427.1| BnaCnng10630D [Brassica napus]
Length=171

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 96/181 (53%), Gaps = 31/181 (17%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  VI++++ DGK+LEY+ P  V  +L++F+ H++ D+     HL  D ++  
Sbjct  1    MGNCLVMEKKVIKIVRNDGKVLEYREPTTVRHILTQFSGHSLFDNNSTC-HLLPDAKLFC  59

Query  252  GrlyyllplpvprpkpakkkvkFAD-QVEE-------------------ADQQGTGVVRV  371
            G       +P    K   KKV FAD +VEE                    D +   ++R+
Sbjct  60   G--RVYYLVPTTMKKKKTKKVTFADPEVEEDARVLREEVFDTCESNIDGGDNKNASIMRM  117

Query  372  KIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLGSIPE  548
            KI++SKQEL+ LL     SV +MV    ++++       + D+   C  GW+PML SIPE
Sbjct  118  KIVVSKQELEKLLQGG--SVHEMVYQTLEKQT-----LLSDDDNLECNTGWRPMLDSIPE  170

Query  549  L  551
            +
Sbjct  171  I  171



>emb|CDY69711.1| BnaCnng64930D [Brassica napus]
Length=171

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 95/181 (52%), Gaps = 31/181 (17%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  VI++++ DGK+LEY+ P  V  +L++F+ H++ D+     HL  D ++  
Sbjct  1    MGNCLVMEKKVIKIVRNDGKVLEYREPTTVRHILTQFSGHSLFDNNSTC-HLLPDAKLFC  59

Query  252  GrlyyllplpvprpkpakkkvkFAD-QVEE-------------------ADQQGTGVVRV  371
            G       +P    K   KKV FAD +VEE                    D +   V+R+
Sbjct  60   G--RVYYLVPTTMKKKKTKKVTFADPEVEEDARVLREEVFDTCESNIDGGDNKNVSVMRM  117

Query  372  KIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLGSIPE  548
            KI++SKQEL+ LL     SV +MV    ++++       + D+   C  GW+PML  IPE
Sbjct  118  KIVVSKQELEKLLQGG--SVHEMVYQTLEKQT-----LLSDDDNLECNTGWRPMLDGIPE  170

Query  549  L  551
            +
Sbjct  171  I  171



>ref|XP_010543499.1| PREDICTED: uncharacterized protein LOC104816397 [Tarenaya hassleriana]
Length=178

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 102/187 (55%), Gaps = 35/187 (19%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+VL+   I++++ DGK+LEY+ PMKV+Q+L++F+ H + D++   QHL  + ++V 
Sbjct  1    MGNCIVLENKAIKIVRNDGKVLEYREPMKVHQILTQFSGHKLFDAISNTQHLNPEAKLVH  60

Query  252  GrlyyllplpvprpkpakkkvkFA-----------------------DQVEEADQQGTGV  362
            G   Y L       K   KKV FA                       D  +E D +   V
Sbjct  61   G-RLYYLVPVPMGKKKMAKKVSFANPEVKHQEEEAEEEEKERLREDDDHNKENDDKNVKV  119

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRH-LQKEKS--SDELNRCAADEEANCKGWKPML  533
            VRVKI+++KQELQ LL     SV +MV   L K+ S  S++L+ C        +GWKP L
Sbjct  120  VRVKIVVTKQELQKLLEGG--SVHEMVNQALGKQDSLVSNDLDECCN------RGWKPAL  171

Query  534  GSIPELD  554
             SIPEL+
Sbjct  172  DSIPELE  178



>gb|AES82047.2| iron-sulfur assembly IscA-like protein [Medicago truncatula]
Length=132

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 85/163 (52%), Gaps = 35/163 (21%)
 Frame = +3

Query  72   MGNCLVLQA-NVIRVMKTDGKILEYKA--PMKVYQVLSEFANHAISDSLPVVQHLRADTE  242
            MGNCLVLQ  NV+++MKT+GKILEYK   P+K  +VL    + + S              
Sbjct  1    MGNCLVLQQINVVKIMKTNGKILEYKTQTPIKAEKVLPSPPSPSPSSP------------  48

Query  243  MVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
                                +KKV+FAD  E  D Q    VR+K++ISKQ+LQ +L    
Sbjct  49   ------------------KERKKVRFADP-EVQDVQKNSAVRIKLVISKQKLQEMLDNGG  89

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            ISV+ M+  +  E   D  + C   ++A C GWKP+L SIPE+
Sbjct  90   ISVEKMLSLVHGENGMDGEDLCKKSDDA-CAGWKPVLQSIPEV  131



>ref|XP_002884779.1| hypothetical protein ARALYDRAFT_478339 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61038.1| hypothetical protein ARALYDRAFT_478339 [Arabidopsis lyrata subsp. 
lyrata]
Length=165

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 98/172 (57%), Gaps = 27/172 (16%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMVGGrlyy  266
            ++  VI++M+ DGK++EY+ P+KV+ +L++F+ H +I DSL    HL    +++ GRLYY
Sbjct  1    MEKKVIKIMRNDGKVVEYRGPLKVHHILTQFSPHYSIFDSLSNNCHLHPQAKLLCGRLYY  60

Query  267  ---llplpvprpkpakkkvkFA--------------DQVEEADQQGTGVVRVKIIISKQE  395
                    +   K   KKV+FA              D  +   ++  GVVRVK+++SKQE
Sbjct  61   LLPQETTKIKHVKKTMKKVRFANPEVEKEEEEDRLTDCCDNTKEKSNGVVRVKMVVSKQE  120

Query  396  LQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            L+ LL     SV +MV R L K+      + CA D++ + + WKP+L SIPE
Sbjct  121  LEKLLQGG--SVHEMVYRTLAKQ------HLCADDDDDHHQVWKPLLDSIPE  164



>gb|EPS73717.1| hypothetical protein M569_01042, partial [Genlisea aurea]
Length=92

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+V Q   + VMK DG+I++YK P++V+QVLS F++HAIS+ LP  +HL  +TEM+ 
Sbjct  1    MGNCVVHQEKAVTVMKHDGEIMKYKQPIRVHQVLSGFSHHAISEKLPGAKHLHPNTEMIH  60

Query  252  G  254
            G
Sbjct  61   G  61



>ref|XP_003625829.1| hypothetical protein MTR_7g104680 [Medicago truncatula]
Length=153

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 84/162 (52%), Gaps = 35/162 (22%)
 Frame = +3

Query  72   MGNCLVLQA-NVIRVMKTDGKILEYKA--PMKVYQVLSEFANHAISDSLPVVQHLRADTE  242
            MGNCLVLQ  NV+++MKT+GKILEYK   P+K  +VL    + + S              
Sbjct  1    MGNCLVLQQINVVKIMKTNGKILEYKTQTPIKAEKVLPSPPSPSPSSP------------  48

Query  243  MVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
                                +KKV+FAD  E  D Q    VR+K++ISKQ+LQ +L    
Sbjct  49   ------------------KERKKVRFADP-EVQDVQKNSAVRIKLVISKQKLQEMLDNGG  89

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            ISV+ M+  +  E   D  + C   ++A C GWKP+L SIPE
Sbjct  90   ISVEKMLSLVHGENGMDGEDLCKKSDDA-CAGWKPVLQSIPE  130



>ref|XP_007220082.1| hypothetical protein PRUPE_ppa024194mg [Prunus persica]
 gb|EMJ21281.1| hypothetical protein PRUPE_ppa024194mg [Prunus persica]
Length=157

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 95/164 (58%), Gaps = 13/164 (8%)
 Frame = +3

Query  72   MGNCLVLQA--NVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGNC VL     V+RV+KTDGK+LE++AP  V  +L  F+   IS+S    + L  + ++
Sbjct  1    MGNCFVLSKPEKVLRVVKTDGKVLEFRAPTLVKDMLMNFSGSGISESKQASELLSPNYKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFAD-QVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
              G++YY++PL       A      +   V+E D+  T   R+KI+I+KQ+LQ LL+K Q
Sbjct  61   KLGKVYYMIPLLGSVASDASSAGIISSVDVKEKDRAATR--RIKIVITKQQLQELLTK-Q  117

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            ISV +++       S  E   C++++ +    WKP L SIPEL+
Sbjct  118  ISVQEVLST-----SGLEQKSCSSNDSST--NWKPKLESIPELE  154



>ref|NP_196009.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB85509.1| putative protein [Arabidopsis thaliana]
 dbj|BAB08615.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90667.1| uncharacterized protein AT5G03890 [Arabidopsis thaliana]
Length=179

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 96/184 (52%), Gaps = 37/184 (20%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  VI++++ DGK+LEY+ P+ V+ +L++F+ H+IS +     HL  D +++ 
Sbjct  1    MGNCLVMEKKVIKIVRDDGKVLEYREPISVHHILTQFSGHSISHN---NTHLLPDAKLLS  57

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQ---------------------QGTGVVR  368
            G   Y L       K   KKV FA+   E D+                     +   VVR
Sbjct  58   G-RLYYLLPTTMTKKKVNKKVTFANPEVEGDERLLREEEDSSESNSNIDGDDTKNVTVVR  116

Query  369  VKIIISKQELQALLSKDQISVDDMVRHLQKE---KSSDELNRCAADEEANCK-GWKPMLG  536
            +KI++ KQEL+ LL    +  + M + L+K+    SSD       D++  C  GW+P L 
Sbjct  117  MKIVVHKQELEKLLQGGSVH-EMMYQTLEKQLLLTSSD-------DDDLECNSGWRPALD  168

Query  537  SIPE  548
            SIPE
Sbjct  169  SIPE  172



>ref|XP_010558222.1| PREDICTED: uncharacterized protein LOC104826943 [Tarenaya hassleriana]
Length=162

 Score = 79.3 bits (194),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 80/124 (65%), Gaps = 11/124 (9%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVV-QHLRADTEMV  248
            MGNCLVL+  V+++++ DGKILEY+ P+K +Q+LS F+ H + D+L    QHL  +  ++
Sbjct  1    MGNCLVLENRVVKIVRNDGKILEYREPVKAHQILSRFSGHRLFDTLTTTQQHLNPEATLL  60

Query  249  GGrlyyl--lplpvprpkpakkkvkFADQVEEA--------DQQGTGVVRVKIIISKQEL  398
             GR+Y L   P   P P P KKKV+FA    EA        D++   VVRV+I++SKQEL
Sbjct  61   CGRVYRLSPAPSENPNPNPKKKKVRFATPEVEAERSREDGDDERNVKVVRVRIVLSKQEL  120

Query  399  QALL  410
            Q LL
Sbjct  121  QKLL  124



>ref|XP_006398849.1| hypothetical protein EUTSA_v10014801mg [Eutrema salsugineum]
 gb|ESQ40302.1| hypothetical protein EUTSA_v10014801mg [Eutrema salsugineum]
Length=180

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 106/185 (57%), Gaps = 30/185 (16%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISD-SLPVVQHLRADTEMV  248
            MGNCLV++  VI++++ DGK+LEY+ P++V+ +L++F+ H++ D +    +HL  + +++
Sbjct  1    MGNCLVMEKKVIKIVRNDGKVLEYREPIRVHHILTQFSGHSLFDNNTRHHRHLLPEAKLL  60

Query  249  GGrlyyllplpvprpkpakkkvkFAD-QVEEA--------DQQGT--------------G  359
             GRLYYLLP  + + K   KKV FA+ +VE+         D  GT               
Sbjct  61   SGRLYYLLPTTMNQNKKKNKKVTFANPEVEDERLVNEDHDDDSGTESSTNSSDDNKINLS  120

Query  360  VVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANC-KGWKPMLG  536
            VVR+KI++ KQEL+ LL    +  + M + L+K+     L     D+   C +GW+P+L 
Sbjct  121  VVRMKIVVHKQELEKLLQGGPVH-EMMYQSLEKQV----LLTDHHDDNLECNRGWRPVLD  175

Query  537  SIPEL  551
             IPE 
Sbjct  176  CIPEF  180



>gb|AFK36703.1| unknown [Medicago truncatula]
Length=132

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 84/163 (52%), Gaps = 35/163 (21%)
 Frame = +3

Query  72   MGNCLVLQA-NVIRVMKTDGKILEYKA--PMKVYQVLSEFANHAISDSLPVVQHLRADTE  242
            MGNCLVLQ  NV+++MKT+GKILEYK   P+K  +VL    + + S              
Sbjct  1    MGNCLVLQQINVVKIMKTNGKILEYKTQTPIKAEKVLPSPPSPSPSSP------------  48

Query  243  MVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
                                +KKV+FAD  E  D Q    VR+K++ISKQ+ Q +L    
Sbjct  49   ------------------KERKKVRFADP-EVQDVQKNSAVRIKLVISKQKSQEMLDNGG  89

Query  423  ISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPEL  551
            ISV+ M+  +  E   D  + C   ++A C GWKP+L SIPE+
Sbjct  90   ISVEKMLSLVHGENGMDGEDLCKKSDDA-CAGWKPVLQSIPEV  131



>ref|XP_009130792.1| PREDICTED: uncharacterized protein LOC103855548 [Brassica rapa]
Length=221

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 96/184 (52%), Gaps = 34/184 (18%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  +I +M+ DGK+LEY+ P+ V+ +L++F+ H++ D+     HL+ D +++ 
Sbjct  44   MGNCLVMEKKLITIMRNDGKVLEYRKPICVHHILTQFSGHSVFDNNTSC-HLQPDAKLLS  102

Query  252  GrlyyllplpvprpkpakkkvkFADQ--------VEEADQQGTG----------------  359
            G       LP    K   KKV+FAD           E D+Q  G                
Sbjct  103  G--RLYYLLPTTINKKKTKKVRFADPEVKPEERLPSEEDEQHHGDTDESKSNRDDNKSMS  160

Query  360  VVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLG  536
            VVR+KI++ KQEL+ LL    +  + M + L+K     ++     D+   C  GW+P+L 
Sbjct  161  VVRMKIVVRKQELEKLLRGGSVH-EMMYQTLEK-----QVLHTDDDDNLECNGGWRPVLD  214

Query  537  SIPE  548
            SIPE
Sbjct  215  SIPE  218



>ref|XP_006833249.1| hypothetical protein AMTR_s00113p00094690 [Amborella trichopoda]
 gb|ERM98527.1| hypothetical protein AMTR_s00113p00094690 [Amborella trichopoda]
Length=161

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 93/171 (54%), Gaps = 28/171 (16%)
 Frame = +3

Query  72   MGNC---------LVLQA---NVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPV  215
            MGNC         L+L+A   N++R+ KTDGKILEY+AP+ V QVL+ F   A+  S   
Sbjct  1    MGNCVLVPQATRPLMLEAEEENIVRIAKTDGKILEYRAPLVVEQVLTTFEGQALYTSGIS  60

Query  216  VQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQE  395
               L  D  +  G+ YYL+P               + + +  +++  GVVR+K++I+KQ+
Sbjct  61   SDSLSKDYRLKPGQPYYLMPNKTVEEPA-------STEEQGLERESGGVVRLKVVITKQQ  113

Query  396  LQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            LQ LL+K  ISV D++  L+  +  D  NR       + +GW+P L +I E
Sbjct  114  LQELLAKS-ISVADVISSLRNME--DGSNR------GHSRGWRPCLETIHE  155



>emb|CDY11278.1| BnaA03g01140D [Brassica napus]
Length=178

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (53%), Gaps = 34/184 (18%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  +I++++ DGK+LEY+ P+ V+ +L++F+ H++ D+     HL+ D +++ 
Sbjct  1    MGNCLVMEKKLIKIVRNDGKVLEYRKPICVHHILAQFSGHSVFDNNTSC-HLQPDAKLLS  59

Query  252  GrlyyllplpvprpkpakkkvkFADQ--------VEEADQQGTG----------------  359
            G       LP    K   KKV+FAD           E D+Q  G                
Sbjct  60   G--RLYYLLPTTINKKKTKKVRFADPEVKPEERLPSEEDEQHHGDTDESKSNRDDNKSMS  117

Query  360  VVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLG  536
            +VR+KI++ KQEL+ LL    +  + M + L+K     ++     D+   C  GW+P+L 
Sbjct  118  IVRMKIVVRKQELEKLLHGGSVH-EMMYQTLEK-----QVLHTDDDDNLECNGGWRPVLD  171

Query  537  SIPE  548
            SIPE
Sbjct  172  SIPE  175



>ref|XP_010024777.1| PREDICTED: uncharacterized protein LOC104415220 [Eucalyptus grandis]
Length=411

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 88/176 (50%), Gaps = 53/176 (30%)
 Frame = +3

Query  33   PQILSF-KASPTKNMGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSL  209
            P+  +F +A P+ +MGNCL L+   I+++KT+GK+LEY+  +KV +    F +  I D  
Sbjct  287  PRTKNFGEAFPSTSMGNCLALRKE-IKIVKTEGKVLEYRTELKVQKAKVSFLDQRIED--  343

Query  210  PVVQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISK  389
                                                     EEA     G  RVK+IIS+
Sbjct  344  ----------------------------------------YEEA-----GPSRVKLIISR  358

Query  390  QELQALLSKDQISVDDM-VRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
            +ELQ +L +  +SV D  +  L++E++  ++N    D+  +C+GWKP+L SIPELD
Sbjct  359  RELQQMLQEGAVSVGDRGLLLLEREQTLQKVN---IDDRGHCEGWKPILQSIPELD  411



>emb|CDX80897.1| BnaC03g01510D [Brassica napus]
Length=180

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 96/183 (52%), Gaps = 30/183 (16%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCLV++  +I++++ DGK+LEY+ P+ V+ +L++F+ H++ D+     HL  D  ++ 
Sbjct  1    MGNCLVMEKKLIKIVRNDGKVLEYRKPICVHHILTQFSGHSVFDNNTSC-HLPPDAMLLS  59

Query  252  GrlyyllplpvprpkpakkkvkFAD----QVE----EADQQGTG----------------  359
            G       LP    K   KKV FAD    Q E    E D+Q  G                
Sbjct  60   G--RLYYLLPTTINKKKTKKVTFADPEVKQEERLPSEEDEQHHGDTDESKSNRDDNKSVS  117

Query  360  VVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGS  539
            VVR+KI++ KQEL+ LL     SV +M+    +++     +    + E N  GW+P+L S
Sbjct  118  VVRMKIVVRKQELEKLLQGG--SVHEMMYQTLEKQVLHTDDDDDDNLECN-GGWRPVLDS  174

Query  540  IPE  548
            IPE
Sbjct  175  IPE  177



>gb|KCW90549.1| hypothetical protein EUGRSUZ_A02661 [Eucalyptus grandis]
Length=111

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 79/162 (49%), Gaps = 52/162 (32%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNCL L+   I+++KT+GK+LEY+  +KV +    F +  I D                
Sbjct  1    MGNCLALRKE-IKIVKTEGKVLEYRTELKVQKAKVSFLDQRIED----------------  43

Query  252  GrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISV  431
                                       EEA     G  RVK+IIS++ELQ +L +  +SV
Sbjct  44   --------------------------YEEA-----GPSRVKLIISRRELQQMLQEGAVSV  72

Query  432  DDM-VRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPELD  554
             D  +  L++E++  ++N    D+  +C+GWKP+L SIPELD
Sbjct  73   GDRGLLLLEREQTLQKVN---IDDRGHCEGWKPILQSIPELD  111



>ref|XP_009352095.1| PREDICTED: uncharacterized protein LOC103943510 [Pyrus x bretschneideri]
Length=140

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 87/161 (54%), Gaps = 26/161 (16%)
 Frame = +3

Query  72   MGNCLVL--QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGNCLVL  +  V+RV+KTDGK+LE++ P  V  +LS F+   IS S    + L  D ++
Sbjct  1    MGNCLVLSKEDKVLRVLKTDGKVLEFRVPTLVKDILSNFSGVGISLSKQASEQLSPDCKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
              G++YY++PLP                   A+       R+KI+++KQ+L+ LL+K QI
Sbjct  61   KLGKVYYMIPLPG-----------------SAENDSAATRRIKIVVTKQQLEELLTK-QI  102

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            SV + +     EK +   + C      + K WKP L SIPE
Sbjct  103  SVQEALSASGPEKKAS--SSCV----DSSKIWKPKLKSIPE  137



>ref|XP_007039187.1| Uncharacterized protein TCM_015500 [Theobroma cacao]
 gb|EOY23688.1| Uncharacterized protein TCM_015500 [Theobroma cacao]
Length=163

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 91/174 (52%), Gaps = 29/174 (17%)
 Frame = +3

Query  72   MGNCLVLQ---------------ANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDS  206
            MGNC  L+                 V++V+K DGKILE++AP+ V  VL +F+   I  S
Sbjct  1    MGNCWALRRPSEGSCLGAVNAKPEKVLQVVKIDGKILEFRAPILVKDVLVKFSGSGIGLS  60

Query  207  LPVVQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIIS  386
              V QHL  D E+  G++YY+LP   P   P  +++          QQ  GV R+K++I 
Sbjct  61   KTVTQHLPLDFELKMGKVYYILPSEDPVGAPTPERISSVG----GTQQTGGVRRIKVVIR  116

Query  387  KQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            KQELQ LL+K QISV++++  L+K            +   + + WKP L SI E
Sbjct  117  KQELQQLLTK-QISVEEVLAGLEKSN---------GNFVGSPRNWKPKLESISE  160



>ref|XP_006407607.1| hypothetical protein EUTSA_v10021626mg [Eutrema salsugineum]
 gb|ESQ49060.1| hypothetical protein EUTSA_v10021626mg [Eutrema salsugineum]
Length=178

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 105/185 (57%), Gaps = 35/185 (19%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNC+V++  VI++M+ DGK++EY+ PMKV+ +L++F+ H ++ DSL    HL   ++++
Sbjct  1    MGNCIVMEKKVIKIMRNDGKVVEYRGPMKVHDILTQFSGHYSLFDSLSNNCHLHPQSKLL  60

Query  249  GGrlyy---llplpvprpkpakkkvkFA---------------------DQVEEADQQGT  356
             GRLYY        + + +   KKV+FA                     D  +   ++  
Sbjct  61   CGRLYYLMPKETTTIIKHQKTLKKVRFANPEVEKKEEDLEEEEEEDRLTDCGDNTKEKSV  120

Query  357  GVVRVKIIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCKGWKPML  533
            GVVRVK+++SKQEL+ LL     S+ ++V + L K+  SD+ + C        +GW+P+L
Sbjct  121  GVVRVKMVVSKQELEKLLQGG--SIQELVYKSLAKQNLSDDDDECH-------RGWRPLL  171

Query  534  GSIPE  548
             SIPE
Sbjct  172  DSIPE  176



>ref|XP_010662926.1| PREDICTED: uncharacterized protein LOC104882245 [Vitis vinifera]
Length=151

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 85/163 (52%), Gaps = 19/163 (12%)
 Frame = +3

Query  72   MGNCLVL----QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            MGNC  L    +  V+ V+K DGK+++++ P+ V  VL  F+   +  S   +QHL +D 
Sbjct  1    MGNCFALCIPSKRRVLWVVKRDGKMIQFRGPILVKDVLVNFSGLGVGVSREALQHLPSDY  60

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            E+  G   Y +         +    + +   ++  Q+G+G+ R+K++I+KQ+LQ LLSK 
Sbjct  61   ELKIG-KVYYILPCPCSSGGSVSAPEVSSMADDGGQKGSGMKRIKVVITKQQLQDLLSK-  118

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            QIS+++++     + SS              + WKP L  IPE
Sbjct  119  QISLEELLLSQSVDLSSP-------------RNWKPKLDPIPE  148



>ref|XP_010452285.1| PREDICTED: uncharacterized protein LOC104734413 isoform X1 [Camelina 
sativa]
Length=180

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 93/183 (51%), Gaps = 34/183 (19%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+V++  VI++++ DGK+LEY+ P+ V+ +L++F+ H +S +     +L  D +++ 
Sbjct  1    MGNCIVMEKKVIKIVRNDGKVLEYREPVSVHHILTQFSGHTLSHN---NTYLLPDAKLLS  57

Query  252  GrlyyllplpvprpkpakkkvkFAD------------------QVEEADQQGTG-----V  362
            G       LP    K   KKV FA+                     E++    G     V
Sbjct  58   G--RLYYLLPTMIKKKVNKKVTFANPEVEEEDDERRSLRDDDDDTSESNNNVDGDENKSV  115

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCK-GWKPMLGS  539
            VR+KII+ KQEL+ LL    +  + M + L+K+     L     D++  C   WKP+L S
Sbjct  116  VRMKIIVHKQELEKLLQGGSVH-EMMYQTLEKQL----LLTSFDDDDLECNSSWKPVLDS  170

Query  540  IPE  548
            IPE
Sbjct  171  IPE  173



>ref|XP_010423653.1| PREDICTED: uncharacterized protein LOC104708734 [Camelina sativa]
Length=180

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 40/186 (22%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+V++  VI++++ DGK+LEY+ P+ V  +L++F+ H +S +     +L  D +++ 
Sbjct  1    MGNCIVMEKKVIKIVRNDGKVLEYREPVSVGHILTQFSGHTLSHN---NTYLLPDAKLLS  57

Query  252  GrlyyllplpvprpkpakkkvkFAD------------------QVEEADQQGTG-----V  362
            G       LP    K   KKV FA+                     E++    G     V
Sbjct  58   G--RLYYLLPTMIKKKVNKKVTFANPEVEEEDDERRSLRDDDDDTSESNNNIDGDENKSV  115

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRHLQKE---KSSDELNRCAADEEANCK-GWKPM  530
            VR+KII+ KQEL+ LL    +  + M + L+K+    SSD       D++  C   WKP+
Sbjct  116  VRMKIIVHKQELEKLLQGGSVH-EMMYQTLEKQLLLTSSD-------DDDLECNSSWKPV  167

Query  531  LGSIPE  548
            L SIPE
Sbjct  168  LDSIPE  173



>gb|KFK38400.1| hypothetical protein AALP_AA3G108100 [Arabis alpina]
Length=179

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 105/184 (57%), Gaps = 28/184 (15%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANH-AISDSLPVVQHLRADTEMV  248
            MGNCLV++  VI++M+ DGK++EY+ PMKV+ +L++F+NH ++ DSL    HL   ++++
Sbjct  1    MGNCLVMEKKVIKIMRNDGKVVEYRGPMKVHHILTQFSNHYSLFDSLSNNSHLPPQSKLL  60

Query  249  GGrlyy-----llplpvprpkpakkkvkFA----------DQVEEADQQGT-----GVVR  368
             GRLYY        +         KKV FA          D++ +     T      VVR
Sbjct  61   CGRLYYLMPKDTTTIHCKNTTKTTKKVSFANPEVEKEEEEDRLRDCSDNNTKEKSVSVVR  120

Query  369  VKIIISKQELQALLSKDQISVDDMV-RHLQKEKSSDELNRCAADEEANCK-GWKPMLGSI  542
            VK+++SKQEL+ LL     SV ++V R L K+  S + +    DE   C+ GW+P+L SI
Sbjct  121  VKMVVSKQELEKLLQGG--SVHELVYRSLAKQHLSHDDDDNGDDE---CQGGWRPLLDSI  175

Query  543  PELD  554
            PE D
Sbjct  176  PESD  179



>ref|XP_008382871.1| PREDICTED: uncharacterized protein LOC103445632 [Malus domestica]
 ref|XP_008343858.1| PREDICTED: uncharacterized protein LOC103406651 [Malus domestica]
Length=140

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 87/161 (54%), Gaps = 26/161 (16%)
 Frame = +3

Query  72   MGNCLVL--QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGN LVL  +  V+RV+KTDGK+LE++AP  V  +LS F+   IS S    + L  D ++
Sbjct  1    MGNXLVLSKEDKVLRVLKTDGKVLEFRAPTLVKDILSNFSGVGISLSKQASEQLSPDYKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
              G++YY++PLP                   A+       R+KI+++KQ LQ LL+K QI
Sbjct  61   KLGKVYYMIPLP-----------------XSAENDSAATRRIKIVVTKQRLQELLTK-QI  102

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            SV++++     EK +   + C      + K WKP L SI E
Sbjct  103  SVEEVLSASGPEKKAS--SSCV----DSSKIWKPKLKSITE  137



>ref|NP_001236548.1| uncharacterized protein LOC100527730 [Glycine max]
 gb|ACU16889.1| unknown [Glycine max]
 gb|KHN19551.1| hypothetical protein glysoja_027808 [Glycine soja]
Length=148

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 13/127 (10%)
 Frame = +3

Query  75   GNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGG  254
            G+C+  +  ++RV K DGKILE+  P+ V  +L+ +  + +  S  V +HL  D E+  G
Sbjct  13   GSCIAKKVKLVRVAKPDGKILEFSTPIHVKDILTSYPAYGVGVSKKVTEHLSPDHELKAG  72

Query  255  rlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVD  434
            RLYYLLP     P              ++ + G G+ R+K+II+KQ+LQ L++K QISV+
Sbjct  73   RLYYLLPSLHSPPNL------------KSLKTGGGIKRIKVIITKQQLQQLVTK-QISVE  119

Query  435  DMVRHLQ  455
            D++  +Q
Sbjct  120  DILSEVQ  126



>ref|XP_008376801.1| PREDICTED: uncharacterized protein LOC103439932 [Malus domestica]
Length=126

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 83/161 (52%), Gaps = 40/161 (25%)
 Frame = +3

Query  72   MGNCLVL--QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGNCLVL  +  V++V+KTDGK+LE++AP  V  +LS F+   I  S    + L  D ++
Sbjct  1    MGNCLVLSKEDKVLKVLKTDGKVLEFRAPTLVKDILSNFSGVGIGLSKQASEQLSPDCKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
              G++YY+ PLP                   A+       R+K++I+KQ+LQ LL+K +I
Sbjct  61   KPGKVYYMTPLPG-----------------SAENDSAATRRIKMVITKQQLQELLTK-KI  102

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            SV +++                    ++ K WKP L SIPE
Sbjct  103  SVQEVL--------------------SDSKIWKPKLKSIPE  123



>ref|XP_009361290.1| PREDICTED: uncharacterized protein LOC103951595 [Pyrus x bretschneideri]
Length=126

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 83/161 (52%), Gaps = 40/161 (25%)
 Frame = +3

Query  72   MGNCLVL--QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGNCLVL  +  V+RV+KTDGK+LE++AP  V  +LS F+   I  S    + L  D ++
Sbjct  1    MGNCLVLSKEDKVLRVLKTDGKVLEFRAPTLVKDILSNFSGVGIGLSKQASEQLSPDCKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQI  425
              G++YY+ PLP                   A+       R+K++I+KQ+LQ LL+K +I
Sbjct  61   KLGKVYYMTPLPG-----------------SAENDSAATRRIKMVITKQQLQELLTK-KI  102

Query  426  SVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            S+ +++                    ++ K WKP L SIPE
Sbjct  103  SLQEVL--------------------SDSKIWKPKLRSIPE  123



>ref|XP_010490882.1| PREDICTED: uncharacterized protein LOC104768579 [Camelina sativa]
Length=180

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 92/182 (51%), Gaps = 32/182 (18%)
 Frame = +3

Query  72   MGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVG  251
            MGNC+V++  VI++++ DGK+LEY+ P+ V  +L++F+ H +S +     +L  D +++ 
Sbjct  1    MGNCIVMEKKVIKIVRNDGKVLEYREPVSVGHILTQFSGHTLSHN---NTYLLPDAKLLS  57

Query  252  GrlyyllplpvprpkpakkkvkFAD------------------QVEEADQQGTG-----V  362
            G       LP    K   KKV FA+                     E++    G     V
Sbjct  58   G--RLYYLLPTMIKKKVNKKVTFANPEVEEEDDERRSLRDDDDDTSESNNNIDGDENKSV  115

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSI  542
            VR+KII+ KQEL+ LL     SV +M+ +   EK     +    D + N + WKP+L SI
Sbjct  116  VRMKIIVHKQELEKLLQGG--SVHEMM-YQTLEKQLLLTSSDDDDLDCN-RSWKPLLDSI  171

Query  543  PE  548
            PE
Sbjct  172  PE  173



>ref|NP_001176357.1| Os11g0152900 [Oryza sativa Japonica Group]
 gb|AAX94846.1| Similar to At3g10120 [Oryza sativa Japonica Group]
 gb|ABA91513.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAY79979.1| hypothetical protein OsI_35144 [Oryza sativa Indica Group]
 gb|EAZ17465.1| hypothetical protein OsJ_32994 [Oryza sativa Japonica Group]
 dbj|BAG98667.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH95085.1| Os11g0152900 [Oryza sativa Japonica Group]
Length=121

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 8/64 (13%)
 Frame = +3

Query  357  GVVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLG  536
            GVVRVK++ISKQ+L+ +L KD +S+DDMV  +Q+E S  E+         +C+GW+P L 
Sbjct  62   GVVRVKLVISKQQLKKMLHKDGVSLDDMVSLMQREASEQEM--------ISCRGWRPALK  113

Query  537  SIPE  548
            SIPE
Sbjct  114  SIPE  117



>ref|XP_004951400.1| PREDICTED: uncharacterized protein LOC101779099 [Setaria italica]
Length=117

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 76/160 (48%), Gaps = 48/160 (30%)
 Frame = +3

Query  72   MGNCLVLQANV-IRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMV  248
            MGNCLV++    I++M  DG         +V ++ S  ++  + +SLP V  ++A   +V
Sbjct  1    MGNCLVIKVRKEIKIMSVDGS--------EVLKMPSSTSSLKVQESLPDVLPVKAPAAVV  52

Query  249  GGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQIS  428
                                                  VRVK++ISKQEL+ +L K+ +S
Sbjct  53   ---------------------------------DPGAAVRVKLVISKQELKKMLDKEGMS  79

Query  429  VDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +DDMV  ++KE++ D+       E+  C GW+P L SIPE
Sbjct  80   LDDMVSLMRKEQAKDD------REQECCGGWRPALESIPE  113



>ref|XP_010660203.1| PREDICTED: uncharacterized protein LOC104881495 [Vitis vinifera]
Length=165

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 28/174 (16%)
 Frame = +3

Query  72   MGNCLVL---------------QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDS  206
            M NC VL                  V++V+K DGKILEY+APM V  +L +F  +  + S
Sbjct  1    MANCFVLYRPRKRPIPLAAAARHKKVLQVVKEDGKILEYRAPMLVKDMLIKFPGYGFALS  60

Query  207  LPVVQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIIS  386
               +Q L    ++  G +Y+LLPL  P    +      +  ++ A+    G  R+K+II+
Sbjct  61   PEALQPLPPSYQLKAGHVYHLLPLYDPVQIASPAHNSPSVDLDSAN----GTKRIKVIIT  116

Query  387  KQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            K +LQ LL + ++SV++M+  LQK+ + D ++       ++ K W+P+L +IPE
Sbjct  117  KHQLQELLLQ-KVSVEEMLSGLQKD-AWDGVH-------SSVKRWRPLLETIPE  161



>gb|KHN23312.1| hypothetical protein glysoja_015614 [Glycine soja]
Length=148

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  75   GNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGG  254
            G+C+  +  ++RV K DGKILE+  P+ V  +L+ +  + +  S  V +HL  D  +  G
Sbjct  13   GSCIAKKVKLVRVAKPDGKILEFSTPIHVKDILTNYPAYGVGVSKKVREHLSPDQVLKAG  72

Query  255  rlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVD  434
            RLYYLLP     P  A              + G G+ R+K+II+KQ+LQ L++K QISV+
Sbjct  73   RLYYLLPSLHSPPNLASL------------RTGGGIKRIKVIITKQQLQKLVTK-QISVE  119

Query  435  DMVRHLQ  455
            D++  +Q
Sbjct  120  DLLSEVQ  126



>ref|XP_003526752.1| PREDICTED: uncharacterized protein LOC100798545 [Glycine max]
Length=148

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 13/127 (10%)
 Frame = +3

Query  75   GNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGG  254
            G+C+  +  ++RV K DGKILE+  P+ V  +L+ +  + +  S  V +HL  D  +  G
Sbjct  13   GSCIAKKVKLVRVAKRDGKILEFSTPIHVKDILTNYPAYGVGVSKKVREHLSPDQVLKAG  72

Query  255  rlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKDQISVD  434
            RLYYLLP     P  A              + G G+ R+K+II+KQ+LQ L++K QISV+
Sbjct  73   RLYYLLPSLHSPPNLASL------------RTGGGIKRIKVIITKQQLQKLVTK-QISVE  119

Query  435  DMVRHLQ  455
            D++  +Q
Sbjct  120  DLLSEVQ  126



>gb|KDP32098.1| hypothetical protein JCGZ_12559 [Jatropha curcas]
Length=149

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 79/163 (48%), Gaps = 20/163 (12%)
 Frame = +3

Query  72   MGNCLVL-QANVIRVMK---TDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            MGNC      N+ R  K   TDGKI EYK PM V  +L  F+ + +S S   +Q L  + 
Sbjct  1    MGNCFPWPNFNIFRKRKSFETDGKITEYKKPMLVKDILINFSGYGVSISKKPLQALPYNY  60

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            ++  G +YYL P                D V  A   GT   R+K+II+KQELQ LLS +
Sbjct  61   KLKIGYVYYLFPASGVSDG--------GDSVTAA--TGTTTERIKLIITKQELQELLS-N  109

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +IS ++M       +  D+     +        W+P+L +IPE
Sbjct  110  KISAEEMCLLGVNNEDDDKWRGTNSSSR-----WRPVLETIPE  147



>ref|XP_004978703.1| PREDICTED: uncharacterized protein LOC101756992 [Setaria italica]
Length=112

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 7/64 (11%)
 Frame = +3

Query  357  GVVRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLG  536
            G VRVK++ISKQEL+ +L K+ +S+DDMV  ++KE++SD    C       C GW+P L 
Sbjct  52   GSVRVKLVISKQELKKMLDKEGMSLDDMVCLMRKEQASDREQDC-------CGGWRPALE  104

Query  537  SIPE  548
            SIPE
Sbjct  105  SIPE  108



>ref|XP_007136451.1| hypothetical protein PHAVU_009G046400g [Phaseolus vulgaris]
 gb|ESW08445.1| hypothetical protein PHAVU_009G046400g [Phaseolus vulgaris]
Length=152

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 84/171 (49%), Gaps = 34/171 (20%)
 Frame = +3

Query  72   MGNCLVL------------QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPV  215
            MGNCLV             +  ++RV K DGKILE+  P+ V  +L+ +    ++ S  V
Sbjct  1    MGNCLVFCKPSSGSCIMAKKVKIVRVAKPDGKILEFSTPIHVKDILTNYPASGVAVSEKV  60

Query  216  VQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQE  395
             + L  D E+  GRLYYLLP     P  A  +    D          G+ R+K+II+KQ+
Sbjct  61   TEPLSPDHELKAGRLYYLLPSLNSPPNLASLRNVETD---------GGIKRIKVIITKQQ  111

Query  396  LQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            L+ L++K QISV+D++  +Q        NR            KP L +IPE
Sbjct  112  LELLVNK-QISVEDILSEVQTVGVQFPNNR------------KPKLDTIPE  149



>ref|XP_006663219.1| PREDICTED: uncharacterized protein LOC102709504 [Oryza brachyantha]
 emb|CBX25330.1| hypothetical_protein [Oryza brachyantha]
Length=138

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 9/61 (15%)
 Frame = +3

Query  366  RVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIP  545
            RVK++ISKQ+L+ +L KD IS+DDMV  +Q+E         A+ +E +C+GW+P L SIP
Sbjct  83   RVKMVISKQQLKKMLHKDAISLDDMVTMMQRE---------ASQQEMSCRGWRPALRSIP  133

Query  546  E  548
            E
Sbjct  134  E  134



>ref|XP_011075901.1| PREDICTED: uncharacterized protein LOC105160284 [Sesamum indicum]
Length=160

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 84/164 (51%), Gaps = 26/164 (16%)
 Frame = +3

Query  72   MGNCLVLQA----NVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            + +C+ L A     V++V+K DGK++E+ AP+ V ++L  F    +  S    +HL    
Sbjct  11   LSSCIRLSACRNRKVLQVVKMDGKVMEFTAPLLVKELLMNFEGFGVMSSRRSSKHLPLSF  70

Query  240  EM-VGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSK  416
            E+ +GG              P++  V+    V    +    V R+K++I+K++LQ LL+K
Sbjct  71   ELKLGG---------TYYLLPSEAPVQLKHTVAAEPEPNAAVKRIKVVITKKQLQDLLAK  121

Query  417  DQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             +ISV  ++  L  +K+      C+ D  AN   WKP L SIPE
Sbjct  122  -KISVGKII--LGTDKT------CSFDSTAN---WKPTLTSIPE  153



>ref|XP_002450287.1| hypothetical protein SORBIDRAFT_05g003260 [Sorghum bicolor]
 gb|EES09275.1| hypothetical protein SORBIDRAFT_05g003260 [Sorghum bicolor]
Length=129

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 5/62 (8%)
 Frame = +3

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSI  542
            VRVK++ISKQEL+ +L K+ +S+DDMV  ++KE S  E      +EE  C GW+P L SI
Sbjct  69   VRVKLVISKQELKKMLDKEGMSLDDMVSLMRKEASGRE-----QEEEFCCGGWRPALESI  123

Query  543  PE  548
            PE
Sbjct  124  PE  125



>ref|XP_002317808.2| hypothetical protein POPTR_0012s02920g [Populus trichocarpa]
 gb|EEE96028.2| hypothetical protein POPTR_0012s02920g [Populus trichocarpa]
Length=168

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (50%), Gaps = 27/165 (16%)
 Frame = +3

Query  72   MGNCLVL----QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQ--HLRA  233
            +G+C+ +    Q  V++V+KTDGK+LE+  P+ V  +L  F+   I  +   ++  HL  
Sbjct  22   IGSCIRIAEAKQEKVLQVVKTDGKVLEFSTPILVKDILVNFSGSGIGLTQEGIEEHHLPP  81

Query  234  DTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLS  413
              E+  G                      +  ++  DQ   GV R+K++I+KQ+L+ LL+
Sbjct  82   GYELKLG----------NVYYILPSAPVISPVIDREDQASGGVQRIKVVITKQQLRHLLT  131

Query  414  KDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            K+ ISV++++  L+++ SS +  R           WK  L  IPE
Sbjct  132  KE-ISVEEVLLGLEQKSSSLDSPR----------NWKSNLEPIPE  165



>ref|XP_003602353.1| hypothetical protein MTR_3g092470 [Medicago truncatula]
 gb|AES72604.1| DUF4228 domain protein [Medicago truncatula]
Length=141

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 77/152 (51%), Gaps = 34/152 (22%)
 Frame = +3

Query  105  IRVMKTDGKILEYKAPMKVYQVLSEF-ANHAISDSLPVVQHLRADTEMVGGrlyyllplp  281
            ++V+K DGKILE+ +P+ V  +L  F  N AI DS    + L  D E+ GG         
Sbjct  17   VKVVKEDGKILEFSSPIHVKDILINFPTNAAIVDSKNATETLSQDHELKGG---------  67

Query  282  vprpkpakkkvkFADQVEEADQQGTG---VVRVKIIISKQELQALLSKDQISVDDMVRHL  452
                    K        +EA++QG G     R+K++I+KQ+LQ L++K ++S+ +++  +
Sbjct  68   --------KLYYLIPHNKEAEEQGGGGTKTKRIKVLITKQQLQQLVTK-EMSLQELLSVV  118

Query  453  QKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            + +  S   +R            KP+L SIPE
Sbjct  119  KTDGVSLTCDR------------KPILDSIPE  138



>ref|XP_008679414.1| PREDICTED: uncharacterized protein LOC103654348 [Zea mays]
 gb|AFW64831.1| hypothetical protein ZEAMMB73_149596 [Zea mays]
Length=127

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 6/63 (10%)
 Frame = +3

Query  363  VRVKIIISKQELQALLSKDQISVDDMVRHL-QKEKSSDELNRCAADEEANCKGWKPMLGS  539
            VRVK++ISKQEL+ +L K+ +S+DDMV  L +KE S  +      ++E  C GW+P L S
Sbjct  66   VRVKLVISKQELRKMLDKEGVSLDDMVSSLVRKEASGGD-----REQELCCGGWRPALES  120

Query  540  IPE  548
            IPE
Sbjct  121  IPE  123



>ref|XP_006663825.1| PREDICTED: uncharacterized protein LOC102705767 [Oryza brachyantha]
Length=123

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = +3

Query  351  GTGVVRVKIIISKQELQA--LLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWK  524
               VVRVK+++SKQEL+   LL  D +S++DMV  L +++ +DE    A DE+ +C  W+
Sbjct  56   AAAVVRVKLVVSKQELRKMLLLHHDGLSMEDMVSSLVQKELADE----ADDEQESCSAWR  111

Query  525  PMLGSIPE  548
            P L SIPE
Sbjct  112  PTLQSIPE  119



>ref|XP_008231290.1| PREDICTED: uncharacterized protein LOC103330478 [Prunus mume]
Length=143

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = +3

Query  72   MGNCLVL--QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            M NC VL  Q  V+RV+KTDGK+LE++AP  V  +L  F+   IS S    + L  + ++
Sbjct  1    MVNCFVLSKQEKVLRVVKTDGKVLEFRAPTFVKDMLMNFSGSGISVSKQASELLPPNYKL  60

Query  246  VGGrlyyllplpvprpkpakkkvkFAD-QVEEADQQGTGVVRVKIIISKQELQALLSKDQ  422
              G++YY++PL       A      +   V E D+  T   R+KI I+KQ+LQ LL+K +
Sbjct  61   KLGKVYYMIPLLGFVASDAISAGIISSVDVTEKDRAATR--RIKIFITKQQLQELLTK-K  117

Query  423  ISVDDMVRHLQKEKSSDELNR  485
            ISV + +     E+ S   N+
Sbjct  118  ISVQEFLSASGLEQKSSYPNQ  138



>gb|KGN49817.1| hypothetical protein Csa_5G138490 [Cucumis sativus]
Length=170

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 78/179 (44%), Gaps = 21/179 (12%)
 Frame = +3

Query  15   TLVLERPQILSFKASPTKNMGNCLVLQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHA  194
            +  ++ P  L   A+  +N G  L       +++K+DGK+LE+  P  V  VL  F    
Sbjct  8    SYTIKFPCCLKVDAAHKQNHGEAL-------KIVKSDGKVLEFTTPTLVKDVLVNFTGFV  60

Query  195  ISDSLPVVQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVK  374
            I  S  V  H     E           LP P+P        F     +   +     RV+
Sbjct  61   IGSSQDVSHHHHLSPEFELKMGQVYYMLPSPQPTALPPPHSFI----QDSHKSRSTRRVR  116

Query  375  IIISKQELQALLSKDQISVDDMVRH-LQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            I+++K+ELQ LL+K Q+S++D++ H LQ       L   +         WKP L +IPE
Sbjct  117  IVLTKKELQHLLAK-QVSIEDLIMHQLQHTTLYSNLESSST--------WKPALAAIPE  166



>ref|XP_010940858.1| PREDICTED: uncharacterized protein LOC105059304 [Elaeis guineensis]
Length=166

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 28/174 (16%)
 Frame = +3

Query  72   MGNCLVLQA--------------NVIRVMKTDGKILEYKA-PMKVYQVLSEFANHAISDS  206
            MGNC+ L                  +R++KTDGK+LEY    + V  +L +F  + +  S
Sbjct  1    MGNCIALSKPNREILWDDYLEDHRTLRIVKTDGKVLEYYGESILVRDLLLDFHGYGVGVS  60

Query  207  LPVVQHLRADTEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIIS  386
                QHL  D E+  G +YYLLPL         +        E+ +  G+   R+K++I 
Sbjct  61   QQASQHLPPDHELRTGSVYYLLPLGATSLTSKDE----GPLSEDTNVLGSSCKRIKVVIK  116

Query  387  KQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +QELQ LLSK  ISV++ +  + K +     N        + + WKP L +I E
Sbjct  117  RQELQELLSK-TISVEEALSRILKMEDHSFHN--------SPRSWKPQLETILE  161



>ref|XP_011047269.1| PREDICTED: uncharacterized protein LOC105141672 [Populus euphratica]
Length=146

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 51/81 (63%), Gaps = 5/81 (6%)
 Frame = +3

Query  321  ADQVEEADQQGTGVVRVKIIISKQELQALLS-KDQI---SVDDMVRHLQ-KEKSSDELNR  485
             D  +E   +G G VR++++++K+EL+ +L+ ++ I   SV+ +V  L+ +E+S  +   
Sbjct  64   GDLGDETASKGGGAVRIRVVVTKEELKQILNFRENINYSSVEQLVSALRLRERSRPDEGG  123

Query  486  CAADEEANCKGWKPMLGSIPE  548
             + D    C GWKP+LGSIPE
Sbjct  124  TSTDGRIMCGGWKPLLGSIPE  144



>ref|XP_003578896.1| PREDICTED: uncharacterized protein LOC100842698 [Brachypodium 
distachyon]
Length=139

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 10/79 (13%)
 Frame = +3

Query  321  ADQVEEADQQGTGVVRVKIIISKQELQALLSKD---QISVDDMVRHLQKEKSSDELNRCA  491
            A     AD  G  +VRVK++ISKQEL+ +L KD    +S+DDM+  +++    +E     
Sbjct  60   APSAAAADVPGA-MVRVKLVISKQELRRMLGKDDQASLSLDDMMALMRRRAEQEE-----  113

Query  492  ADEEANCKGWKPMLGSIPE  548
              E + C+GW+P L SIPE
Sbjct  114  -QESSCCRGWRPALHSIPE  131



>ref|XP_004502739.1| PREDICTED: uncharacterized protein LOC101508248 [Cicer arietinum]
Length=150

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 74/164 (45%), Gaps = 36/164 (22%)
 Frame = +3

Query  75   GNCLVLQA------NVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRAD  236
            G+C +  A       V+RV K DGK+LE+  P+ V  +L+ F  + I  S    + L  D
Sbjct  13   GSCYIFDAMEKHDFEVVRVAKEDGKMLEFSTPIHVKDILTNFPANDIGVSNNATEILSQD  72

Query  237  TEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSK  416
             E+ GG                 +        +E +     + R+K++I+KQ+LQ L++K
Sbjct  73   YELKGG-----------------RLYYLLPHNKETEANSGEIKRIKVLITKQQLQQLVTK  115

Query  417  DQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
             QI++ D++  ++        +R            KP+L SIPE
Sbjct  116  -QITLQDLLSVVKTVGVHLPTDR------------KPILDSIPE  146



>ref|XP_010251991.1| PREDICTED: uncharacterized protein LOC104593728 [Nelumbo nucifera]
Length=184

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 79/153 (52%), Gaps = 14/153 (9%)
 Frame = +3

Query  102  VIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyy---ll  272
            V+R++K+DGKILEY+A + V  VL  F++  I  S    ++L  + E+  G +YY     
Sbjct  24   VLRIVKSDGKILEYRASILVKDVLLNFSDCGIGISQEAFRYLPPNYELKIGHMYYLLPSS  83

Query  273  plpvprpkpakkkvkFADQVEEADQQGTGVV-RVKIIISKQELQALLSKDQISVDDMVRH  449
                     +            AD    G + R+K++I+KQ+LQ LLSK  +S+++++  
Sbjct  84   SSSSSSACLSPSAAPPPVSPSSADAHRPGCLKRIKVVITKQQLQLLLSK-TVSLEELL--  140

Query  450  LQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            L ++K + +      D   N   WKP L +IPE
Sbjct  141  LARDKPAWD----GVDSTTN---WKPKLETIPE  166



>gb|EMT14345.1| hypothetical protein F775_28063 [Aegilops tauschii]
Length=158

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 81/167 (49%), Gaps = 27/167 (16%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKT-DGKILE---YKAPMKVYQVLSEFANHAISDSLPVVQHLRAD  236
            MGNCLV+Q    I+VM   DG+IL+     +P       S+ A   +SDS      LR  
Sbjct  1    MGNCLVIQDRREIKVMSVVDGEILKALPVPSP-------SKGALAPVSDSSDAEDALRPQ  53

Query  237  TEMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSK  416
             + + GR   +  L    P  A      A   E A      VVRVK++ISKQEL+ +L K
Sbjct  54   KQGLDGRAGGMGQLHRLFPSDANAPSAAAADPEGA------VVRVKLVISKQELRRMLGK  107

Query  417  DQ--ISVDDMVRHLQKEKSSDELNRCAADEEANC-KGWKPMLGSIPE  548
            D   +S+DDMV  L+      +       E+  C +GW+P L SIPE
Sbjct  108  DDEAVSLDDMVALLRGGPEHQK------QEDVGCYRGWRPALHSIPE  148



>gb|AFG47069.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47072.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEAD---------QQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPLKPPGGKVLLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S+DDM+   Q
Sbjct  122  SNKKTSIDDMIVAFQ  136



>ref|XP_011044744.1| PREDICTED: uncharacterized protein LOC105139834 [Populus euphratica]
Length=160

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (48%), Gaps = 24/163 (15%)
 Frame = +3

Query  72   MGNCLVL----QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            +G+C+      +  V+ V+KTDGK+LE+ AP+ V  +   F    I  +   ++HL    
Sbjct  15   IGSCIGFPRAKREKVLHVVKTDGKVLEFSAPILVKDIAVNFPGSGIGLTNEAIEHLPPSY  74

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            E+  G              P        D+ EEA     GV R+K++I+KQ+    L K 
Sbjct  75   ELKLG-------NVYHVLPPPPGTSPVVDREEEASSG--GVKRIKVVITKQQ-LQQLLKK  124

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +IS+++++  L+K+ SS +  R           WKP L SIPE
Sbjct  125  EISLEEVLLGLEKKSSSLDSPR----------NWKPKLESIPE  157



>ref|XP_011012587.1| PREDICTED: uncharacterized protein LOC105116802 [Populus euphratica]
Length=168

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (48%), Gaps = 24/163 (15%)
 Frame = +3

Query  72   MGNCLVL----QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            +G+C+      +  V+ V+KTDGK+LE+ AP+ V  +   F    I  +   ++HL    
Sbjct  23   IGSCIGFPRAKREKVLHVVKTDGKVLEFSAPILVKDIAVNFPGSGIGLTNEAIEHLPPSY  82

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            E+  G              P        D+ EEA     GV R+K++I+KQ+    L K 
Sbjct  83   ELKLG-------NVYHVLPPPPGTSPVVDREEEASSG--GVKRIKVVITKQQ-LQQLLKK  132

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +IS+++++  L+K+ SS +  R           WKP L SIPE
Sbjct  133  EISLEEVLLGLEKKSSSLDSPR----------NWKPKLESIPE  165



>gb|AFG47066.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEADQ---------QGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPPKPPGGKVLLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>gb|EMT11383.1| hypothetical protein F775_05371 [Aegilops tauschii]
Length=145

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 77/163 (47%), Gaps = 29/163 (18%)
 Frame = +3

Query  72   MGNCLVLQ-ANVIRVMKT-DGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEM  245
            MGNCLV+Q    I+VM   DG+IL+   P      LS+ A   +S S P    LRA  + 
Sbjct  1    MGNCLVIQDRKEIKVMSVVDGEILKALPP-----PLSKGAPARVSGSDPD-DELRAQKQH  54

Query  246  VGGrlyyllplpvprpkpakkkvkFADQVE--EADQQGTGVVRVKIIISKQELQALLSKD  419
            +           V      +    F   V+   A      V+RVK++ISKQEL+ +L K 
Sbjct  55   LN---------HVRVGDLGQLHRLFPSDVKAPSAAADPGAVMRVKLVISKQELRRMLGK-  104

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
                DDMV  +++   + +      +E   C+GW+P L SIPE
Sbjct  105  ----DDMVALMRRGSEAQQ-----QEEIGCCRGWRPALHSIPE  138



>dbj|BAJ99189.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=151

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 8/66 (12%)
 Frame = +3

Query  360  VVRVKIIISKQELQALLSKDQ--ISVDDMVRHLQKEKSSDELNRCAADEEANC-KGWKPM  530
            VVRVK++ISKQEL+ +L KD    S+DDMV  L +    D+       E+ +C +GW+P 
Sbjct  81   VVRVKLVISKQELRRMLGKDDEAGSMDDMVVALMRRGLEDQ-----KQEDVSCYRGWRPA  135

Query  531  LGSIPE  548
            L SIPE
Sbjct  136  LHSIPE  141



>gb|AFG47068.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEAD---------QQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPLKPPGGKVLLENNGVVRVKLVITKRQLEKMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>gb|AFG47064.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47065.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47073.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47075.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47076.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47078.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47080.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEAD---------QQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPLKPPGGKVLLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>gb|AFG47077.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47079.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEADQ---------QGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPLKPPGGKVLFENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>gb|AFG47067.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47070.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
 gb|AFG47074.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEAD---------QQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGGIMFNEKAQEGPLKPPGGKVLLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>gb|AFG47071.1| hypothetical protein 0_11217_01, partial [Pinus taeda]
Length=157

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLFVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEAD---------QQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSRVVSSNDGGIMFNEKAQEGPLKPPGGKVLLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIVAFQ  136



>tpg|DAA39157.1| TPA: hypothetical protein ZEAMMB73_577204 [Zea mays]
Length=114

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
 Frame = +3

Query  366  RVKIIISKQELQALLSKDQISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIP  545
            RVK++ISKQEL+ +L ++ +S+DD+V  L        + R    EE  C GW+P L SIP
Sbjct  58   RVKLVISKQELKKMLDREGVSLDDVVSSL--------VLRNRELEEVCCGGWRPALESIP  109

Query  546  E  548
            E
Sbjct  110  E  110



>gb|AEW07767.1| hypothetical protein 0_11217_01, partial [Pinus radiata]
Length=157

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 70/135 (52%), Gaps = 13/135 (10%)
 Frame = +3

Query  90   LQANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADTEMVGGrlyyl  269
            ++   I++ K DGKILE + P+ V  +L +   HA+ +      +L  + E++ G +Y+L
Sbjct  2    IEEQFIKIRKADGKILECRGPLLVKDLLLDHDFHAVVNCENSCHNLSPEYELLPGHIYFL  61

Query  270  lplpvprpkpakkkvkFADQVEEA---------DQQGTGVVRVKIIISKQELQALLSKD-  419
            +P            + F ++ +E            +  GVVRVK++I+K++L+ +LSK  
Sbjct  62   VPNNSSVVSSNDGDIMFNEKAQEGPLKPPGGKVPLENNGVVRVKLVITKRQLEEMLSKSL  121

Query  420  ---QISVDDMVRHLQ  455
               + S++DM+   Q
Sbjct  122  SNKKTSIEDMIIAFQ  136



>ref|XP_002321369.2| hypothetical protein POPTR_0015s00810g [Populus trichocarpa]
 gb|EEF05496.2| hypothetical protein POPTR_0015s00810g [Populus trichocarpa]
Length=168

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 24/163 (15%)
 Frame = +3

Query  72   MGNCLVL----QANVIRVMKTDGKILEYKAPMKVYQVLSEFANHAISDSLPVVQHLRADT  239
            +G+C+         V+ V+KTDGK+LE+ AP+ V  +   F    I  +   ++HL    
Sbjct  23   IGSCIGFPQAKHEKVLHVVKTDGKVLEFSAPILVKDIAVNFPGSGIGLTNEAIEHLPPSY  82

Query  240  EMVGGrlyyllplpvprpkpakkkvkFADQVEEADQQGTGVVRVKIIISKQELQALLSKD  419
            E+  G              P        D+ EEA     GV R+K++I+KQ+    L K 
Sbjct  83   ELKLG-------NVYHVLPPPPGTSPVVDREEEASS--GGVKRIKVVITKQQ-LQQLLKK  132

Query  420  QISVDDMVRHLQKEKSSDELNRCAADEEANCKGWKPMLGSIPE  548
            +IS+++++  L+++ SS +  R           WKP L SIPE
Sbjct  133  EISLEEVLLGLEQKSSSLDSPR----------NWKPKLESIPE  165



>ref|XP_002320460.1| hypothetical protein POPTR_0014s15150g [Populus trichocarpa]
 gb|EEE98775.1| hypothetical protein POPTR_0014s15150g [Populus trichocarpa]
Length=148

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (59%), Gaps = 6/82 (7%)
 Frame = +3

Query  321  ADQVEEADQQGTGVVRVKIIISKQELQALLSK----DQISVDDMVRHLQ-KEKSS-DELN  482
             D  +E   +G G VR++++++++EL+ +L+     +  SV+ +V  L+ +E+S  DE  
Sbjct  65   GDLGDETASKGGGAVRIRVVVTREELKQILNFRKNINYSSVEQLVSALRLRERSRPDEGG  124

Query  483  RCAADEEANCKGWKPMLGSIPE  548
              + D    C  WKP LGSIPE
Sbjct  125  TASTDGGIMCGSWKPRLGSIPE  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1409449224512