BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20727_g1_i3 len=1275 path=[1319:0-450 @1770@!:451-830
2216:831-1274]

Length=1275
                                                                      Score     E

ref|XP_006338548.1|  PREDICTED: homeobox-leucine zipper protein H...    164   2e-43   
ref|XP_009622827.1|  PREDICTED: homeobox-leucine zipper protein HAT5    164   3e-43   
ref|XP_010496310.1|  PREDICTED: homeobox-leucine zipper protein H...    163   5e-43   
ref|XP_010550130.1|  PREDICTED: homeobox-leucine zipper protein H...    161   6e-43   
ref|XP_006299626.1|  hypothetical protein CARUB_v10015805mg             162   7e-43   
ref|NP_001234296.1|  homeodomain leucine zipper protein                 162   9e-43   
gb|EYU44734.1|  hypothetical protein MIMGU_mgv1a011727mg                162   1e-42   
ref|XP_002882180.1|  homeobox-leucine zipper protein hat5               160   4e-42   
emb|CDP02129.1|  unnamed protein product                                160   4e-42   
gb|AII99842.1|  homeodomain leucine zipper protein                      160   5e-42   
ref|XP_009777424.1|  PREDICTED: homeobox-leucine zipper protein HAT5    160   6e-42   
ref|NP_186796.1|  homeobox-leucine zipper protein HAT5                  159   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031433.1|  Homeobox-leucine zipper protein HAT5               158   4e-41   
ref|XP_010435620.1|  PREDICTED: homeobox-leucine zipper protein H...    157   8e-41   
ref|XP_010551895.1|  PREDICTED: homeobox-leucine zipper protein HAT5    156   1e-40   
ref|XP_010247931.1|  PREDICTED: homeobox-leucine zipper protein HAT5    157   1e-40   
gb|KHG04461.1|  Homeobox-leucine zipper HAT5 -like protein              156   1e-40   
ref|XP_010485418.1|  PREDICTED: homeobox-leucine zipper protein H...    155   3e-40   
ref|XP_011085824.1|  PREDICTED: homeobox-leucine zipper protein H...    154   5e-40   
gb|KFK37614.1|  hypothetical protein AALP_AA3G005800                    154   7e-40   
gb|KFK37613.1|  hypothetical protein AALP_AA3G005800                    154   7e-40   
ref|XP_002278872.1|  PREDICTED: homeobox-leucine zipper protein HAT5    154   1e-39   Vitis vinifera
gb|KDP45368.1|  hypothetical protein JCGZ_09617                         153   3e-39   
ref|XP_008458752.1|  PREDICTED: homeobox-leucine zipper protein H...    153   3e-39   
dbj|BAJ33940.1|  unnamed protein product                                152   3e-39   
ref|XP_004304607.1|  PREDICTED: homeobox-leucine zipper protein H...    152   1e-38   
dbj|BAG50054.1|  transcription factor Homeobox                          151   2e-38   Lotus japonicus
ref|XP_006446470.1|  hypothetical protein CICLE_v10017539mg             150   4e-38   
ref|XP_004159074.1|  PREDICTED: homeobox-leucine zipper protein H...    150   4e-38   
ref|XP_006470354.1|  PREDICTED: homeobox-leucine zipper protein H...    150   5e-38   
ref|XP_010029204.1|  PREDICTED: homeobox-leucine zipper protein HAT5    149   5e-38   
ref|XP_002517348.1|  homeobox protein, putative                         147   7e-38   Ricinus communis
ref|XP_004489298.1|  PREDICTED: homeobox-leucine zipper protein H...    149   8e-38   
ref|XP_010251293.1|  PREDICTED: homeobox-leucine zipper protein H...    149   9e-38   
ref|XP_010111761.1|  Homeobox-leucine zipper protein HAT5               149   1e-37   
ref|NP_001240210.1|  uncharacterized protein LOC100813420               147   3e-37   
gb|ADN88094.1|  homeodomain-leucine zipper protein HD3                  147   3e-37   
gb|AAL57495.1|AF443621_1  homeodomain leucine zipper protein CPHB-5     147   4e-37   Craterostigma plantagineum
gb|KEH24863.1|  homeobox associated leucine zipper protein              147   5e-37   
ref|XP_010033267.1|  PREDICTED: homeobox-leucine zipper protein H...    146   8e-37   
gb|KHN23555.1|  Homeobox-leucine zipper protein HAT5                    146   9e-37   
gb|KHN47180.1|  Homeobox-leucine zipper protein HAT5                    145   2e-36   
ref|XP_003542698.1|  PREDICTED: homeobox-leucine zipper protein H...    145   2e-36   
ref|XP_008781998.1|  PREDICTED: homeobox-leucine zipper protein H...    144   3e-36   
ref|XP_010913582.1|  PREDICTED: homeobox-leucine zipper protein H...    144   5e-36   
emb|CBI34940.3|  unnamed protein product                                143   6e-36   
ref|XP_009147435.1|  PREDICTED: homeobox-leucine zipper protein HAT5    143   7e-36   
emb|CDY49056.1|  BnaC05g48840D                                          143   8e-36   
emb|CDY28673.1|  BnaCnng05590D                                          142   3e-35   
ref|XP_009125018.1|  PREDICTED: homeobox-leucine zipper protein H...    141   4e-35   
ref|XP_009125019.1|  PREDICTED: homeobox-leucine zipper protein H...    141   5e-35   
ref|XP_006844229.1|  hypothetical protein AMTR_s00006p00267430          140   6e-35   
ref|XP_010485417.1|  PREDICTED: homeobox-leucine zipper protein H...    140   9e-35   
ref|XP_010928608.1|  PREDICTED: homeobox-leucine zipper protein H...    140   1e-34   
ref|XP_007151094.1|  hypothetical protein PHAVU_004G017500g             140   1e-34   
ref|XP_008793871.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...    136   3e-34   
gb|KEH24864.1|  homeobox associated leucine zipper protein              138   5e-34   
ref|XP_008230624.1|  PREDICTED: homeobox-leucine zipper protein HAT5    139   9e-34   
ref|XP_004167237.1|  PREDICTED: homeobox-leucine zipper protein H...    137   1e-33   
ref|XP_004141083.1|  PREDICTED: homeobox-leucine zipper protein H...    137   3e-33   
ref|XP_008443498.1|  PREDICTED: homeobox-leucine zipper protein HAT5    136   3e-33   
ref|XP_008390979.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...    137   8e-33   
gb|AAK84887.1|AF402606_1  homeodomain leucine zipper protein HDZ3       134   8e-33   Phaseolus vulgaris [French bean]
ref|XP_008348031.1|  PREDICTED: homeobox-leucine zipper protein H...    136   9e-33   
gb|AFJ23867.1|  HB-1                                                    136   9e-33   
ref|XP_010928609.1|  PREDICTED: homeobox-leucine zipper protein H...    134   9e-33   
ref|NP_001280808.1|  homeobox-leucine zipper protein HAT5               135   2e-32   
ref|XP_011028710.1|  PREDICTED: homeobox-leucine zipper protein H...    135   2e-32   
ref|XP_007215782.1|  hypothetical protein PRUPE_ppa009747mg             134   2e-32   
gb|AAA32816.1|  homeobox protein                                        127   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408508.1|  hypothetical protein EUTSA_v10022235mg             132   6e-32   
ref|XP_002321530.2|  hypothetical protein POPTR_0015s07640g             134   7e-32   Populus trichocarpa [western balsam poplar]
gb|KCW52861.1|  hypothetical protein EUGRSUZ_J02186                     130   2e-31   
ref|XP_009375094.1|  PREDICTED: homeobox-leucine zipper protein HAT5    132   2e-31   
ref|XP_009415373.1|  PREDICTED: homeobox-leucine zipper protein H...    131   2e-31   
gb|EPS69830.1|  hypothetical protein M569_04938                         126   3e-31   
ref|XP_009418017.1|  PREDICTED: homeobox-leucine zipper protein H...    130   3e-31   
ref|XP_004142356.1|  PREDICTED: homeobox-leucine zipper protein H...    129   8e-31   
ref|XP_002317992.2|  hypothetical protein POPTR_0012s07270g             128   5e-30   Populus trichocarpa [western balsam poplar]
ref|XP_011042611.1|  PREDICTED: homeobox-leucine zipper protein H...    128   5e-30   
gb|KDP31203.1|  hypothetical protein JCGZ_11579                         128   6e-30   
ref|XP_008367440.1|  PREDICTED: homeobox-leucine zipper protein H...    129   1e-29   
ref|XP_004973433.1|  PREDICTED: homeobox-leucine zipper protein H...    126   1e-29   
ref|XP_010235125.1|  PREDICTED: homeobox-leucine zipper protein H...    126   2e-29   
gb|ACF82904.1|  unknown                                                 125   2e-29   Zea mays [maize]
gb|ACG38607.1|  homeodomain leucine zipper protein CPHB-5               125   2e-29   Zea mays [maize]
ref|NP_001146068.1|  putative homeobox DNA-binding and leucine zi...    125   3e-29   Zea mays [maize]
ref|NP_001148520.1|  homeodomain leucine zipper protein CPHB-5          125   3e-29   Zea mays [maize]
ref|NP_001238458.1|  homeodomain-leucine zipper protein 57              125   3e-29   
ref|XP_009391261.1|  PREDICTED: homeobox-leucine zipper protein H...    125   4e-29   
ref|XP_006574472.1|  PREDICTED: homeodomain-leucine zipper protei...    125   7e-29   
ref|XP_010112600.1|  Homeobox-leucine zipper protein HAT5               125   8e-29   
ref|XP_009417556.1|  PREDICTED: homeobox-leucine zipper protein H...    122   2e-28   
gb|ADE76802.1|  unknown                                                 124   2e-28   
ref|XP_004953794.1|  PREDICTED: homeobox-leucine zipper protein H...    123   2e-28   
ref|NP_001175810.1|  Os09g0379600                                       123   2e-28   
ref|XP_009399661.1|  PREDICTED: homeobox-leucine zipper protein H...    123   2e-28   
ref|XP_002511518.1|  homeobox protein, putative                         123   2e-28   Ricinus communis
ref|XP_003517924.1|  PREDICTED: homeobox-leucine zipper protein H...    124   3e-28   
ref|XP_004953793.1|  PREDICTED: homeobox-leucine zipper protein H...    123   3e-28   
sp|A3BYC1.2|HOX25_ORYSJ  RecName: Full=Homeobox-leucine zipper pr...    123   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009408831.1|  PREDICTED: homeobox-leucine zipper protein H...    122   4e-28   
ref|XP_007157405.1|  hypothetical protein PHAVU_002G067200g             123   4e-28   
gb|KGN52379.1|  hypothetical protein Csa_5G630820                       120   5e-28   
ref|NP_001130421.1|  uncharacterized protein LOC100191517               122   6e-28   Zea mays [maize]
gb|ABL63115.1|  DNA-binding protein                                     121   6e-28   Catharanthus roseus [chatas]
ref|XP_006367068.1|  PREDICTED: homeobox-leucine zipper protein H...    122   8e-28   
ref|XP_006661183.1|  PREDICTED: homeobox-leucine zipper protein H...    122   8e-28   
pir||B44088  homeotic protein HAT5 - Arabidopsis thaliana (fragme...    116   9e-28
gb|ACN31143.1|  unknown                                                 122   1e-27   Zea mays [maize]
ref|XP_006659398.1|  PREDICTED: homeobox-leucine zipper protein H...    122   1e-27   
gb|ACG33646.1|  homeodomain leucine zipper protein CPHB-5               122   1e-27   Zea mays [maize]
gb|EMT01252.1|  hypothetical protein F775_52266                         121   1e-27   
ref|XP_009369353.1|  PREDICTED: homeobox-leucine zipper protein H...    121   1e-27   
emb|CAA64417.1|  homeobox                                               121   1e-27   Solanum lycopersicum
ref|NP_001234250.2|  homeobox                                           121   1e-27   
ref|XP_008677601.1|  PREDICTED: uncharacterized protein LOC100383...    120   2e-27   
gb|KHG19587.1|  Homeobox-leucine zipper HAT5 -like protein              120   2e-27   
ref|NP_001048008.1|  Os02g0729700                                       121   2e-27   Oryza sativa Japonica Group [Japonica rice]
sp|A2X980.1|HOX16_ORYSI  RecName: Full=Homeobox-leucine zipper pr...    121   2e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001169496.1|  uncharacterized protein LOC100383369               121   2e-27   Zea mays [maize]
gb|AFW63782.1|  putative homeobox DNA-binding and leucine zipper ...    121   2e-27   
ref|XP_010238133.1|  PREDICTED: homeobox-leucine zipper protein H...    120   2e-27   
ref|NP_001061807.1|  Os08g0416000                                       121   2e-27   Oryza sativa Japonica Group [Japonica rice]
sp|Q9XH36.1|HOX5_ORYSI  RecName: Full=Homeobox-leucine zipper pro...    121   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_006842102.1|  hypothetical protein AMTR_s00078p00085160          120   2e-27   
gb|KDO76041.1|  hypothetical protein CISIN_1g019954mg                   119   2e-27   
gb|KDO76039.1|  hypothetical protein CISIN_1g019954mg                   120   3e-27   
emb|CDP14863.1|  unnamed protein product                                120   3e-27   
gb|ABR16224.1|  unknown                                                 120   3e-27   Picea sitchensis
ref|XP_003524980.1|  PREDICTED: homeobox-leucine zipper protein H...    120   4e-27   
gb|KHN48659.1|  Homeobox-leucine zipper protein HAT5                    120   4e-27   
dbj|BAJ95209.1|  predicted protein                                      120   5e-27   
gb|AAS83417.1|  Hox16                                                   120   5e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915101.1|  PREDICTED: homeobox-leucine zipper protein H...    119   5e-27   
gb|AAS68137.1|  homeodomain leucine zipper protein 16                   120   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21095.1|  Homeobox-leucine zipper protein HOX16                   120   5e-27   
gb|KDO76038.1|  hypothetical protein CISIN_1g019954mg                   120   5e-27   
ref|XP_010096332.1|  Homeobox-leucine zipper protein HAT5               119   6e-27   
ref|XP_006476659.1|  PREDICTED: homeobox-leucine zipper protein H...    119   7e-27   
gb|AFW62173.1|  putative homeobox DNA-binding and leucine zipper ...    115   8e-27   
emb|CBI15277.3|  unnamed protein product                                117   8e-27   
ref|XP_008793499.1|  PREDICTED: homeobox-leucine zipper protein H...    118   8e-27   
ref|XP_010931687.1|  PREDICTED: homeobox-leucine zipper protein H...    118   1e-26   
gb|ADL36709.1|  HD domain class transcription factor                    119   1e-26   
ref|XP_008364621.1|  PREDICTED: homeobox-leucine zipper protein H...    119   1e-26   
ref|XP_010925063.1|  PREDICTED: homeobox-leucine zipper protein H...    118   1e-26   
ref|XP_003572981.1|  PREDICTED: homeobox-leucine zipper protein H...    119   1e-26   
ref|XP_010678585.1|  PREDICTED: homeobox-leucine zipper protein H...    119   1e-26   
gb|AGV54880.1|  homeobox-leucine zipper protein HAT5-like protein       117   2e-26   
ref|XP_007138213.1|  hypothetical protein PHAVU_009G190200g             117   2e-26   
ref|XP_009591685.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-26   
ref|XP_002978617.1|  hypothetical protein SELMODRAFT_108871             112   2e-26   
ref|XP_004299400.1|  PREDICTED: homeobox-leucine zipper protein H...    117   2e-26   
gb|KHN08860.1|  Homeobox-leucine zipper protein HAT5                    117   3e-26   
gb|KGN59652.1|  hypothetical protein Csa_3G835890                       115   3e-26   
ref|XP_004489987.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-26   
ref|XP_004299399.1|  PREDICTED: homeobox-leucine zipper protein H...    117   3e-26   
dbj|BAJ88065.1|  predicted protein                                      117   4e-26   
ref|XP_008786730.1|  PREDICTED: homeobox-leucine zipper protein H...    116   4e-26   
ref|XP_010256239.1|  PREDICTED: homeobox-leucine zipper protein H...    117   4e-26   
sp|A2Z0Q0.1|HOX25_ORYSI  RecName: Full=Homeobox-leucine zipper pr...    115   4e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009773747.1|  PREDICTED: homeobox-leucine zipper protein H...    117   5e-26   
emb|CDP00280.1|  unnamed protein product                                117   5e-26   
gb|KHN19374.1|  Homeobox-leucine zipper protein HAT5                    117   5e-26   
ref|XP_011086401.1|  PREDICTED: homeobox-leucine zipper protein HAT5    116   5e-26   
ref|XP_006647837.1|  PREDICTED: homeobox-leucine zipper protein H...    116   6e-26   
ref|NP_001237881.1|  HDZip I protein                                    115   6e-26   
ref|XP_007044377.1|  Homeobox-leucine zipper protein HAT5, putati...    116   6e-26   
ref|XP_002271692.1|  PREDICTED: homeobox-leucine zipper protein H...    116   6e-26   Vitis vinifera
ref|XP_007044376.1|  Homeobox-leucine zipper protein HAT5, putati...    116   7e-26   
ref|XP_003613578.1|  Homeobox-leucine zipper protein ATHB-16            116   7e-26   
ref|XP_007037211.1|  Homeobox protein, putative isoform 1               116   8e-26   
ref|XP_007037212.1|  Homeobox protein, putative isoform 2               116   8e-26   
emb|CAN83969.1|  hypothetical protein VITISV_039798                     116   8e-26   Vitis vinifera
ref|XP_002520146.1|  homeobox protein, putative                         115   9e-26   Ricinus communis
ref|XP_008437622.1|  PREDICTED: homeobox-leucine zipper protein H...    116   9e-26   
ref|XP_008437631.1|  PREDICTED: homeobox-leucine zipper protein H...    116   1e-25   
ref|XP_004152443.1|  PREDICTED: homeobox-leucine zipper protein H...    116   1e-25   
ref|XP_004152444.1|  PREDICTED: homeobox-leucine zipper protein H...    116   1e-25   
ref|XP_004157812.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...    116   1e-25   
gb|AAL57497.1|AF443623_1  homeodomain leucine zipper protein CPHB-7     115   1e-25   Craterostigma plantagineum
ref|XP_010238252.1|  PREDICTED: homeobox-leucine zipper protein HOX4    114   1e-25   
ref|XP_008239846.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-25   
ref|XP_010028877.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-25   
ref|XP_010242341.1|  PREDICTED: homeobox-leucine zipper protein H...    115   2e-25   
ref|XP_011087214.1|  PREDICTED: homeobox-leucine zipper protein H...    114   2e-25   
ref|XP_010925064.1|  PREDICTED: homeobox-leucine zipper protein A...    112   3e-25   
gb|KHG00570.1|  Homeobox-leucine zipper ATHB-6 -like protein            114   3e-25   
dbj|BAJ85282.1|  predicted protein                                      113   3e-25   
gb|KCW48809.1|  hypothetical protein EUGRSUZ_K02448                     113   3e-25   
ref|XP_004959426.1|  PREDICTED: homeobox-leucine zipper protein H...    114   3e-25   
ref|XP_010037142.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-25   
ref|XP_001758199.1|  predicted protein                                  115   4e-25   
ref|XP_009610614.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-25   
ref|XP_009381162.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-25   
ref|XP_007209345.1|  hypothetical protein PRUPE_ppa008495mg             114   4e-25   
ref|XP_009801495.1|  PREDICTED: homeobox-leucine zipper protein H...    113   4e-25   
ref|XP_008373110.1|  PREDICTED: homeobox-leucine zipper protein A...    113   4e-25   
ref|XP_009381161.1|  PREDICTED: homeobox-leucine zipper protein H...    114   4e-25   
ref|XP_007155341.1|  hypothetical protein PHAVU_003G192900g             114   5e-25   
dbj|BAA93465.1|  homeobox protein PpHB6                                 114   5e-25   Physcomitrella patens
ref|XP_001769007.1|  predicted protein                                  114   5e-25   
gb|KHG04733.1|  Homeobox-leucine zipper HAT5 -like protein              113   6e-25   
ref|XP_006439657.1|  hypothetical protein CICLE_v10024310mg             113   6e-25   
ref|XP_004238764.1|  PREDICTED: homeobox-leucine zipper protein HAT5    113   6e-25   
gb|EYU28699.1|  hypothetical protein MIMGU_mgv1a011043mg                113   7e-25   
ref|XP_003530679.1|  PREDICTED: homeobox-leucine zipper protein H...    113   7e-25   
ref|XP_006357259.1|  PREDICTED: homeobox-leucine zipper protein H...    113   7e-25   
ref|XP_004508776.1|  PREDICTED: homeobox-leucine zipper protein A...    113   8e-25   
ref|XP_003549660.1|  PREDICTED: homeobox-leucine zipper protein H...    113   8e-25   
ref|XP_009360370.1|  PREDICTED: homeobox-leucine zipper protein A...    112   8e-25   
ref|XP_010683271.1|  PREDICTED: homeobox-leucine zipper protein H...    113   9e-25   
ref|XP_010554014.1|  PREDICTED: homeobox-leucine zipper protein H...    110   9e-25   
ref|NP_001140555.1|  uncharacterized protein LOC100272620               112   9e-25   Zea mays [maize]
gb|ABQ57284.1|  hox20                                                   108   1e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010272979.1|  PREDICTED: homeobox-leucine zipper protein A...    113   1e-24   
ref|XP_010683269.1|  PREDICTED: homeobox-leucine zipper protein H...    113   1e-24   
gb|KHN13480.1|  Homeobox-leucine zipper protein HAT5                    112   1e-24   
ref|XP_002460380.1|  hypothetical protein SORBIDRAFT_02g027300          112   1e-24   Sorghum bicolor [broomcorn]
ref|XP_008797128.1|  PREDICTED: homeobox-leucine zipper protein H...    112   1e-24   
ref|XP_002970538.1|  hypothetical protein SELMODRAFT_18196              107   1e-24   
ref|XP_010925357.1|  PREDICTED: homeobox-leucine zipper protein H...    112   1e-24   
gb|KDP21235.1|  hypothetical protein JCGZ_21706                         112   1e-24   
ref|XP_007153855.1|  hypothetical protein PHAVU_003G070300g             112   1e-24   
gb|KHN19633.1|  Homeobox-leucine zipper protein HAT5                    111   2e-24   
ref|XP_006602336.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-24   
ref|XP_010554012.1|  PREDICTED: homeobox-leucine zipper protein H...    110   2e-24   
ref|NP_001280955.1|  homeobox-leucine zipper protein ATHB-13-like       112   2e-24   
ref|NP_001280996.1|  homeobox-leucine zipper protein ATHB-13-like       112   2e-24   
ref|XP_009391328.1|  PREDICTED: homeobox-leucine zipper protein H...    112   2e-24   
ref|XP_002462311.1|  hypothetical protein SORBIDRAFT_02g023650          112   2e-24   Sorghum bicolor [broomcorn]
ref|XP_006602335.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-24   
ref|XP_006344287.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-24   
ref|NP_001132844.1|  uncharacterized protein LOC100194336               111   2e-24   Zea mays [maize]
gb|ABC86566.1|  homeodomain-leucine zipper transcription factor T...    110   2e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010917010.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-24   
ref|XP_009766848.1|  PREDICTED: homeobox-leucine zipper protein H...    111   2e-24   
ref|XP_009373197.1|  PREDICTED: homeobox-leucine zipper protein A...    111   2e-24   
ref|XP_010470979.1|  PREDICTED: homeobox-leucine zipper protein A...    111   2e-24   
ref|XP_007146109.1|  hypothetical protein PHAVU_006G013200g             110   2e-24   
ref|XP_009348036.1|  PREDICTED: homeobox-leucine zipper protein A...    110   3e-24   
ref|XP_007225770.1|  hypothetical protein PRUPE_ppa009498mg             111   3e-24   
ref|XP_003553206.1|  PREDICTED: homeobox-leucine zipper protein H...    111   3e-24   
ref|XP_008667301.1|  PREDICTED: uncharacterized protein LOC100194...    110   3e-24   
ref|XP_001763968.1|  predicted protein                                  110   3e-24   
ref|XP_010415638.1|  PREDICTED: homeobox-leucine zipper protein A...    111   3e-24   
emb|CDY11680.1|  BnaC06g12880D                                          108   3e-24   
ref|XP_003608986.1|  Homeobox-leucine zipper protein ATHB-6             111   3e-24   
ref|NP_001062064.1|  Os08g0481400                                       110   3e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752384.1|  predicted protein                                  109   4e-24   
ref|XP_009343428.1|  PREDICTED: homeobox-leucine zipper protein H...    111   4e-24   
ref|XP_004957072.1|  PREDICTED: homeobox-leucine zipper protein H...    110   4e-24   
ref|XP_009389573.1|  PREDICTED: homeobox-leucine zipper protein H...    110   4e-24   
gb|KFK33134.1|  hypothetical protein AALP_AA6G335300                    108   4e-24   
ref|NP_001241886.1|  uncharacterized protein LOC100814080               110   4e-24   
ref|XP_010512033.1|  PREDICTED: homeobox-leucine zipper protein A...    110   4e-24   
dbj|BAA93466.2|  homeobox protein PpHB7                                 109   4e-24   Physcomitrella patens
dbj|BAC54164.1|  homeobox protein Pphb7 long form                       109   4e-24   Physcomitrella patens
ref|XP_004237002.1|  PREDICTED: homeobox-leucine zipper protein A...    110   4e-24   
ref|XP_004973728.1|  PREDICTED: homeobox-leucine zipper protein H...    110   4e-24   
ref|XP_006574451.1|  PREDICTED: uncharacterized protein LOC100808...    110   5e-24   
emb|CDX67451.1|  BnaA07g14910D                                          107   5e-24   
ref|XP_006572887.1|  PREDICTED: uncharacterized protein LOC100814...    110   5e-24   
gb|KHN08691.1|  Homeobox-leucine zipper protein ATHB-13                 110   5e-24   
ref|XP_007157668.1|  hypothetical protein PHAVU_002G088600g             110   5e-24   
gb|KEH19849.1|  homeobox leucine zipper family protein                  110   5e-24   
ref|XP_006574450.1|  PREDICTED: uncharacterized protein LOC100808...    110   5e-24   
ref|NP_001281037.1|  homeobox-leucine zipper protein ATHB-6-like        110   6e-24   
ref|XP_009125133.1|  PREDICTED: homeobox-leucine zipper protein H...    107   6e-24   
dbj|BAA05622.1|  DNA-binding protein                                    108   6e-24   Daucus carota [carrots]
ref|XP_006572886.1|  PREDICTED: uncharacterized protein LOC100814...    110   6e-24   
ref|XP_009594284.1|  PREDICTED: homeobox-leucine zipper protein A...    110   6e-24   
ref|XP_002972528.1|  hypothetical protein SELMODRAFT_97273              105   6e-24   
ref|NP_001242266.1|  uncharacterized protein LOC100808033               110   6e-24   
ref|XP_006572885.1|  PREDICTED: uncharacterized protein LOC100814...    110   7e-24   
ref|XP_010044703.1|  PREDICTED: homeobox-leucine zipper protein H...    110   7e-24   
gb|ABQ57267.1|  hox4                                                    106   7e-24   Oryza sativa Indica Group [Indian rice]
emb|CAA44513.1|  Athb-3                                                 106   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002964248.1|  hypothetical protein SELMODRAFT_81609              105   7e-24   
ref|XP_009360404.1|  PREDICTED: homeobox-leucine zipper protein HAT5    110   7e-24   
ref|XP_002971993.1|  hypothetical protein SELMODRAFT_19476              104   8e-24   
ref|XP_010278274.1|  PREDICTED: homeobox-leucine zipper protein A...    108   8e-24   
gb|EPS57454.1|  hypothetical protein M569_17363                         107   8e-24   
gb|AFK40234.1|  unknown                                                 108   8e-24   
tpg|DAA40309.1|  TPA: putative homeobox DNA-binding and leucine z...    106   9e-24   
dbj|BAA05624.1|  DNA-binding protein                                    109   9e-24   
ref|NP_001170401.1|  putative homeobox DNA-binding and leucine zi...    109   9e-24   
ref|XP_009130506.1|  PREDICTED: homeobox-leucine zipper protein A...    110   9e-24   
ref|XP_001753140.1|  predicted protein                                  110   1e-23   
ref|XP_003572308.1|  PREDICTED: homeobox-leucine zipper protein H...    109   1e-23   
gb|EAZ44560.1|  hypothetical protein OsJ_29180                          107   1e-23   
ref|XP_006390971.1|  hypothetical protein EUTSA_v10018944mg             109   1e-23   
ref|XP_004240025.1|  PREDICTED: homeobox-leucine zipper protein A...    109   1e-23   
ref|XP_011071034.1|  PREDICTED: homeobox-leucine zipper protein H...    109   1e-23   
ref|XP_007047860.1|  Alanine--glyoxylate aminotransferase 2 isofo...    109   1e-23   
dbj|BAA34240.1|  CRHB6                                                  107   1e-23   
ref|XP_002887257.1|  ATHB13                                             109   1e-23   
ref|XP_008339943.1|  PREDICTED: homeobox-leucine zipper protein H...    109   1e-23   
emb|CAN83612.1|  hypothetical protein VITISV_016259                     106   1e-23   
ref|XP_011071017.1|  PREDICTED: homeobox-leucine zipper protein A...    109   1e-23   
ref|XP_007047858.1|  Alanine--glyoxylate aminotransferase 2 isofo...    109   1e-23   
ref|NP_177136.1|  homeobox-leucine zipper protein ATHB-13               109   1e-23   
ref|XP_002312706.2|  hypothetical protein POPTR_0008s19900g             108   1e-23   
ref|XP_010106292.1|  Homeobox-leucine zipper protein ATHB-16            109   1e-23   
ref|XP_008221690.1|  PREDICTED: homeobox-leucine zipper protein H...    108   2e-23   
ref|XP_010942613.1|  PREDICTED: homeobox-leucine zipper protein H...    108   2e-23   
ref|XP_011016455.1|  PREDICTED: homeobox-leucine zipper protein A...    108   2e-23   
ref|XP_010681985.1|  PREDICTED: homeobox-leucine zipper protein A...    109   2e-23   
ref|XP_006366219.1|  PREDICTED: homeobox-leucine zipper protein A...    109   2e-23   
ref|XP_007225750.1|  hypothetical protein PRUPE_ppa009419mg             108   2e-23   
gb|KHN01193.1|  Homeobox-leucine zipper protein ATHB-13                 108   2e-23   
tpg|DAA40003.1|  TPA: putative homeobox DNA-binding and leucine z...    108   2e-23   
emb|CDY33967.1|  BnaC02g43700D                                          108   2e-23   
gb|AAL57496.1|AF443622_1  homeodomain leucine zipper protein CPHB-6     108   2e-23   
ref|NP_001242687.1|  uncharacterized protein LOC100801479               108   2e-23   
gb|KHN32882.1|  Homeobox-leucine zipper protein ATHB-13                 108   2e-23   
emb|CDY44091.1|  BnaA02g14550D                                          108   2e-23   
gb|EEE69885.1|  hypothetical protein OsJ_29706                          108   2e-23   
dbj|BAJ85184.1|  predicted protein                                      108   2e-23   
ref|XP_001764032.1|  predicted protein                                  109   3e-23   
ref|XP_006660223.1|  PREDICTED: homeobox-leucine zipper protein H...    107   3e-23   
ref|XP_011021609.1|  PREDICTED: homeobox-leucine zipper protein A...    108   3e-23   
ref|XP_004297340.1|  PREDICTED: uncharacterized protein LOC101291232    108   3e-23   
ref|XP_008219409.1|  PREDICTED: homeobox-leucine zipper protein A...    108   3e-23   
ref|XP_008780741.1|  PREDICTED: homeobox-leucine zipper protein H...    108   3e-23   
ref|XP_007225072.1|  hypothetical protein PRUPE_ppa018002mg             108   3e-23   
gb|KHG11542.1|  Homeobox-leucine zipper ATHB-13 -like protein           108   3e-23   
ref|XP_008221689.1|  PREDICTED: homeobox-leucine zipper protein H...    108   3e-23   
gb|ACJ84623.1|  unknown                                                 107   3e-23   
ref|NP_001063436.1|  Os09g0470500                                       107   3e-23   
ref|XP_002311597.1|  homeobox-leucine zipper family protein             108   3e-23   
ref|XP_008221688.1|  PREDICTED: homeobox-leucine zipper protein H...    108   4e-23   
dbj|BAA93461.1|  homeobox protein PpHB2                                 107   4e-23   
dbj|BAA05625.1|  DNA-binding protein                                    108   4e-23   
emb|CDP01514.1|  unnamed protein product                                108   4e-23   
ref|XP_002285743.1|  PREDICTED: homeobox-leucine zipper protein A...    107   4e-23   
ref|XP_009604802.1|  PREDICTED: homeobox-leucine zipper protein H...    108   4e-23   
ref|XP_003613642.1|  Homeobox-leucine zipper protein                    107   4e-23   
ref|XP_009388778.1|  PREDICTED: homeobox-leucine zipper protein A...    107   4e-23   
ref|XP_006302610.1|  hypothetical protein CARUB_v10020715mg             107   4e-23   
ref|XP_008805896.1|  PREDICTED: homeobox-leucine zipper protein H...    107   4e-23   
ref|XP_009604803.1|  PREDICTED: homeobox-leucine zipper protein H...    108   4e-23   
gb|KFK41389.1|  hypothetical protein AALP_AA2G124000                    107   4e-23   
dbj|BAA93464.1|  homeobox protein PpHB5                                 107   4e-23   
ref|XP_010498975.1|  PREDICTED: homeobox-leucine zipper protein A...    106   5e-23   
gb|AAA56906.1|  homeobox protein                                        107   5e-23   
ref|XP_010477777.1|  PREDICTED: homeobox-leucine zipper protein A...    106   5e-23   
gb|EYU22443.1|  hypothetical protein MIMGU_mgv1a012337mg                106   5e-23   
ref|XP_010528264.1|  PREDICTED: homeobox-leucine zipper protein H...    106   5e-23   
ref|XP_006838583.1|  hypothetical protein AMTR_s00002p00215130          106   5e-23   
ref|XP_010939547.1|  PREDICTED: homeobox-leucine zipper protein A...    107   5e-23   
gb|KEH19775.1|  homeobox leucine zipper ATHB-like protein               107   5e-23   
ref|XP_011031071.1|  PREDICTED: homeobox-leucine zipper protein A...    108   5e-23   
gb|KEH24992.1|  homeobox associated leucine zipper protein              107   5e-23   
ref|XP_011031070.1|  PREDICTED: homeobox-leucine zipper protein A...    108   6e-23   
ref|XP_011022832.1|  PREDICTED: homeobox-leucine zipper protein A...    108   6e-23   
ref|XP_008780736.1|  PREDICTED: homeobox-leucine zipper protein H...    107   6e-23   
ref|XP_002306291.2|  hypothetical protein POPTR_0005s07290g             108   6e-23   
emb|CBI19202.3|  unnamed protein product                                107   6e-23   
gb|KHF97400.1|  Homeobox-leucine zipper HOX4                            107   6e-23   
ref|XP_009365821.1|  PREDICTED: homeobox-leucine zipper protein A...    107   6e-23   
emb|CDY25596.1|  BnaA04g12880D                                          107   6e-23   
emb|CBI33148.3|  unnamed protein product                                107   6e-23   
ref|XP_009365820.1|  PREDICTED: homeobox-leucine zipper protein A...    107   7e-23   
ref|XP_011025872.1|  PREDICTED: homeobox-leucine zipper protein A...    107   7e-23   
emb|CAB89325.1|  homeobox-leucine zipper protein HAT7                   106   7e-23   
ref|XP_006660730.1|  PREDICTED: homeobox-leucine zipper protein H...    107   7e-23   
ref|XP_009624441.1|  PREDICTED: homeobox-leucine zipper protein A...    107   7e-23   
emb|CDY37819.1|  BnaAnng04800D                                          107   7e-23   
emb|CDY48391.1|  BnaA07g24100D                                          106   7e-23   
ref|XP_009121604.1|  PREDICTED: homeobox-leucine zipper protein H...    107   7e-23   
emb|CDX85054.1|  BnaC05g20010D                                          107   7e-23   
ref|XP_004511225.1|  PREDICTED: homeobox-leucine zipper protein A...    107   8e-23   
gb|KEH24993.1|  homeobox associated leucine zipper protein              106   8e-23   
ref|XP_006438651.1|  hypothetical protein CICLE_v10032279mg             107   8e-23   
ref|XP_002315797.1|  homeobox-leucine zipper family protein             107   8e-23   
gb|ADL36718.1|  HD domain class transcription factor                    107   8e-23   
ref|XP_010472232.1|  PREDICTED: homeobox-leucine zipper protein A...    107   8e-23   
ref|XP_002520111.1|  homeobox protein, putative                         107   9e-23   
gb|KHG06340.1|  Homeobox-leucine zipper ATHB-13 -like protein           106   9e-23   
ref|XP_008338560.1|  PREDICTED: homeobox-leucine zipper protein A...    107   9e-23   
ref|XP_003632476.1|  PREDICTED: homeobox-leucine zipper protein A...    107   9e-23   
ref|XP_006400032.1|  hypothetical protein EUTSA_v10014157mg             107   9e-23   
emb|CDY25597.1|  BnaA04g12890D                                          107   9e-23   
dbj|BAH30589.1|  hypothetical protein                                   106   9e-23   
gb|KDP29729.1|  hypothetical protein JCGZ_18664                         107   9e-23   
gb|EYU28726.1|  hypothetical protein MIMGU_mgv1a021435mg                106   9e-23   
ref|XP_007153821.1|  hypothetical protein PHAVU_003G067700g             106   1e-22   
ref|XP_009140353.1|  PREDICTED: homeobox-leucine zipper protein A...    106   1e-22   
gb|AFZ84531.1|  transcription factor HEX                                102   1e-22   
gb|EYU24419.1|  hypothetical protein MIMGU_mgv1a010726mg                107   1e-22   
ref|XP_008389534.1|  PREDICTED: homeobox-leucine zipper protein H...    107   1e-22   
ref|XP_010543827.1|  PREDICTED: homeobox-leucine zipper protein A...    106   1e-22   
ref|XP_010096374.1|  Homeobox-leucine zipper protein ATHB-13            107   1e-22   
ref|XP_001757575.1|  predicted protein                                  104   1e-22   
dbj|BAA93460.1|  homeobox protein PpHB1                                 106   1e-22   
emb|CDY70306.1|  BnaCnng67720D                                          106   1e-22   
ref|XP_008235150.1|  PREDICTED: homeobox-leucine zipper protein A...    107   1e-22   
ref|XP_001767703.1|  predicted protein                                  107   1e-22   
ref|XP_009409146.1|  PREDICTED: homeobox-leucine zipper protein H...    106   1e-22   
emb|CDP00303.1|  unnamed protein product                                106   1e-22   
ref|XP_002465782.1|  hypothetical protein SORBIDRAFT_01g045740          107   1e-22   
ref|XP_009409284.1|  PREDICTED: homeobox-leucine zipper protein H...    106   1e-22   
ref|XP_009409283.1|  PREDICTED: homeobox-leucine zipper protein H...    106   1e-22   
gb|AAM63933.1|  homeobox gene 13 protein                                106   1e-22   
ref|XP_009126033.1|  PREDICTED: homeobox-leucine zipper protein HAT7    106   1e-22   
ref|XP_010025416.1|  PREDICTED: homeobox-leucine zipper protein A...    107   1e-22   
ref|XP_010266919.1|  PREDICTED: homeobox-leucine zipper protein A...    107   1e-22   
ref|NP_568309.2|  homeobox-leucine zipper protein HAT7                  106   1e-22   
gb|KDO60667.1|  hypothetical protein CISIN_1g0195702mg                  106   1e-22   
ref|XP_004297322.1|  PREDICTED: homeobox-leucine zipper protein A...    106   1e-22   
gb|KDO60666.1|  hypothetical protein CISIN_1g0195702mg                  106   1e-22   
ref|XP_001784947.1|  predicted protein                                  107   1e-22   
ref|XP_001758925.1|  predicted protein                                  105   1e-22   
ref|XP_006288253.1|  hypothetical protein CARUB_v10001498mg             106   1e-22   
ref|XP_010420169.1|  PREDICTED: homeobox-leucine zipper protein H...    106   1e-22   
ref|XP_002873709.1|  ATHB-3                                             106   1e-22   
gb|KHG25678.1|  Homeobox-leucine zipper ATHB-16 -like protein           107   1e-22   
dbj|BAJ90252.1|  predicted protein                                      107   1e-22   
ref|XP_001782269.1|  predicted protein                                  106   1e-22   
dbj|BAD27254.1|  SlHDL1                                                 106   1e-22   
gb|KDP41166.1|  hypothetical protein JCGZ_15573                         106   1e-22   
gb|KDO60669.1|  hypothetical protein CISIN_1g0195702mg                  105   1e-22   
ref|XP_009112528.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_010453644.1|  PREDICTED: homeobox-leucine zipper protein HAT7    106   2e-22   
ref|XP_011097532.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_009800807.1|  PREDICTED: homeobox-leucine zipper protein H...    106   2e-22   
gb|KDO60668.1|  hypothetical protein CISIN_1g0195702mg                  105   2e-22   
emb|CDY23547.1|  BnaC06g25160D                                          105   2e-22   
gb|KDO60665.1|  hypothetical protein CISIN_1g0195702mg                  106   2e-22   
ref|XP_002467274.1|  hypothetical protein SORBIDRAFT_01g022420          107   2e-22   
ref|XP_004238780.1|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_007205506.1|  hypothetical protein PRUPE_ppa008318mg             106   2e-22   
ref|XP_007205507.1|  hypothetical protein PRUPE_ppa008318mg             106   2e-22   
ref|XP_010492339.1|  PREDICTED: homeobox-leucine zipper protein H...    106   2e-22   
ref|XP_009105645.1|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_003613643.1|  Homeobox-leucine zipper protein                    103   2e-22   
gb|ABU55425.1|  homeodomain-leucine zipper transcription factor         103   2e-22   
gb|AAR04932.1|  homeodomain-leucine zipper protein                      106   2e-22   
ref|XP_010420170.1|  PREDICTED: homeobox-leucine zipper protein H...    106   2e-22   
gb|KDP41421.1|  hypothetical protein JCGZ_15828                         105   2e-22   
ref|XP_009404404.1|  PREDICTED: homeobox-leucine zipper protein H...    106   2e-22   
ref|XP_001772735.1|  predicted protein                                  105   2e-22   
emb|CDY38759.1|  BnaA07g28310D                                          105   2e-22   
ref|XP_010552589.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_004238779.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_004983073.1|  PREDICTED: homeobox-leucine zipper protein H...    106   2e-22   
ref|XP_004983072.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-22   
gb|ABK25728.1|  unknown                                                 105   2e-22   
gb|KHN06836.1|  Homeobox-leucine zipper protein ATHB-13                 105   2e-22   
gb|ACZ67152.1|  transcription factor HEX                                101   2e-22   
ref|XP_008374197.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
gb|KFK25752.1|  hypothetical protein AALP_AA8G154900                    105   2e-22   
emb|CDX78614.1|  BnaA03g05260D                                          105   2e-22   
ref|XP_008804470.1|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_006466270.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_006426320.1|  hypothetical protein CICLE_v10026013mg             106   2e-22   
emb|CDY69034.1|  BnaCnng61510D                                          105   2e-22   
ref|XP_008374198.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_004232228.2|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_006363243.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
gb|AAT40518.2|  Homeobox-leucine zipper protein HAT7 , putative         105   2e-22   
gb|AAT40488.1|  putative DNA-binding protein                            105   2e-22   
emb|CDX90376.1|  BnaA08g16080D                                          105   2e-22   
emb|CDY69290.1|  BnaAnng29920D                                          104   2e-22   
ref|XP_004299676.1|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_007046168.1|  HD domain class transcription factor               105   2e-22   
ref|XP_009147412.1|  PREDICTED: homeobox-leucine zipper protein A...    105   2e-22   
ref|XP_004288161.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
ref|XP_009131444.1|  PREDICTED: homeobox-leucine zipper protein H...    105   2e-22   
ref|XP_004250119.1|  PREDICTED: homeobox-leucine zipper protein A...    106   2e-22   
gb|KDO60664.1|  hypothetical protein CISIN_1g0195702mg                  105   2e-22   
tpg|DAA43612.1|  TPA: putative homeobox DNA-binding and leucine z...    106   2e-22   
gb|AFK48276.1|  unknown                                                 103   3e-22   
dbj|BAA34245.1|  CRHB11                                                 103   3e-22   
emb|CDY11659.1|  BnaC06g30800D                                          105   3e-22   
ref|XP_006651083.1|  PREDICTED: homeobox-leucine zipper protein H...    103   3e-22   
ref|XP_006353200.1|  PREDICTED: homeobox-leucine zipper protein A...    106   3e-22   
ref|XP_009593379.1|  PREDICTED: homeobox-leucine zipper protein A...    105   3e-22   
gb|AAF73482.1|AF268422_1  hb-6-like protein                             105   3e-22   
ref|XP_004983144.1|  PREDICTED: homeobox-leucine zipper protein H...    106   3e-22   
ref|XP_009109426.1|  PREDICTED: homeobox-leucine zipper protein A...    105   3e-22   
ref|NP_001150309.1|  homeobox-leucine zipper protein HAT7               106   3e-22   
ref|XP_009130625.1|  PREDICTED: homeobox-leucine zipper protein A...    105   3e-22   
ref|XP_008644855.1|  PREDICTED: homeobox-leucine zipper protein H...    106   3e-22   
sp|Q6V9S9.1|HOX8_ORYSI  RecName: Full=Homeobox-leucine zipper pro...    105   3e-22   
ref|XP_009130694.1|  PREDICTED: homeobox-leucine zipper protein A...    105   3e-22   
emb|CBI31991.3|  unnamed protein product                                104   3e-22   
gb|AFZ84532.1|  transcription factor HEX                                100   3e-22   
sp|Q338Z7.1|HOX8_ORYSJ  RecName: Full=Homeobox-leucine zipper pro...    105   3e-22   
ref|XP_003538603.1|  PREDICTED: homeobox-leucine zipper protein A...    105   3e-22   
ref|XP_007027573.1|  Homeobox-leucine zipper protein ATHB-51            103   3e-22   
tpg|DAA50038.1|  TPA: putative homeobox DNA-binding and leucine z...    106   3e-22   
gb|EYU34578.1|  hypothetical protein MIMGU_mgv1a011234mg                105   3e-22   
ref|XP_006380403.1|  hypothetical protein POPTR_0007s05010g             105   3e-22   
ref|XP_009409197.1|  PREDICTED: homeobox-leucine zipper protein H...    105   3e-22   
gb|AAM08542.1|AC079935_14  Putative homeodomain leucine zipper pr...    105   3e-22   
dbj|BAA21017.1|  DNA-binding protein                                    102   3e-22   
ref|NP_001185103.1|  homeobox-leucine zipper protein ATHB-54            103   3e-22   



>ref|XP_006338548.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Solanum 
tuberosum]
Length=285

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/291 (41%), Positives = 162/291 (56%), Gaps = 33/291 (11%)
 Frame = +3

Query  387   FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
              FF+PSS H ++LFLG  DP+F G   +  KME+S KRR    FS P+   +    ++ S
Sbjct  6     IFFDPSSCHGNMLFLGNGDPVFRGPRSTMMKMEDSSKRRP--FFSSPEDLYDEDYYDEQS  63

Query  561   sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
              +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  64    PEKKRRLTPEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  123

Query  741   ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNC---------KEVDDDDE  893
             ERDYD+LKSS+D LLS ++ I K N KLK+EV  L +KL+G            +V + D 
Sbjct  124   ERDYDQLKSSYDSLLSDFDSIRKDNDKLKSEVVSLMEKLQGKVVGGAGVSEKSDVLEVDA  183

Query  894   GKNAPPSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYY-----YCVCGS  1058
                    ++KAE      R+ S  G    + E    +P+     D+Y++     Y   G 
Sbjct  184   MTATLQVKVKAED-----RLSSGSGGSAVVDEH---SPQLVDSGDSYFHTDHEEYPGPGG  235

Query  1059  GNTYNNLHNIDYeeeeeDMDHHVCNS------TPHAQTTTDDDEPLGWFWS  1193
              N   ++  +   EE++  D   C+           Q   + +EP+GWFWS
Sbjct  236   CNVPPHMDGLQ-SEEDDGSDDGSCHGYFSNVFVTEVQHHEEGEEPIGWFWS  285



>ref|XP_009622827.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Nicotiana tomentosiformis]
Length=285

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 162/287 (56%), Gaps = 25/287 (9%)
 Frame = +3

Query  387   FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss-  563
              FF+PS H ++LFLG +DP+F  G  S  KME+S KRR    FS P+   +       S 
Sbjct  6     IFFDPSCHGNMLFLGNSDPVF-RGPRSMMKMEDSSKRRP--FFSSPEELYDEEYYDEQSP  62

Query  564   dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
             +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K LE
Sbjct  63    EKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKTLE  122

Query  744   RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG----NCKEVDDDDEGKNAPP  911
             RDYD+LKSS+D LLS ++ I K N+KLKAEV  L +KL+G        +++  E      
Sbjct  123   RDYDQLKSSYDSLLSDFDSIRKDNEKLKAEVVSLMEKLQGKVVGEAGVINEKCEVLEVDA  182

Query  912   SRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYC-----VCGSGNTYN-  1073
               ++ + K +  R+ S  G    + E    +P+     D+Y++         G+G   N 
Sbjct  183   LTLQVKVKAE-DRLSSGSGGSAVVDEH---SPQLVDSGDSYFHTGHMEEYPLGAGGCNNI  238

Query  1074  -----NLHNIDYeeeeeDMDH-HVCNSTPHAQTTT-DDDEPLGWFWS  1193
                   L + + +  ++   H + CN    A+    ++ EP+GWFWS
Sbjct  239   PPPMDGLQSEEDDGSDDGGGHGYFCNVFVAAEEQQHEEGEPIGWFWS  285



>ref|XP_010496310.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Camelina 
sativa]
Length=274

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 133/213 (62%), Gaps = 18/213 (8%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSAT--KMEESLKRRASCMFSGPqsdeeyye-e  551
            F+F+PS+  H ++ FLG  +P+  GG+ S     MEE+ KRR    FS P+   +    +
Sbjct  6    FYFDPSASQHGNMFFLGNLNPVVQGGARSMMMMNMEETSKRRP--FFSSPEDLYDEEYYD  63

Query  552  qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLTS+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  64   DQLPEKKRRLTSEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKT  123

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP-  908
            KQLERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL G  +E ++   G+  P 
Sbjct  124  KQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLLGKDEEANELPPGRQVPE  183

Query  909  ----------PSRMKAEKKCDFTRIHSSIGHRD  977
                      P+ +K E +     + S++   D
Sbjct  184  PNQLDPVYLNPAAIKTEDRLSSGSVGSAVLDED  216



>ref|XP_010550130.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Tarenaya 
hassleriana]
 ref|XP_010550131.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Tarenaya 
hassleriana]
Length=237

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 127/199 (64%), Gaps = 11/199 (6%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
            FFF+PS+ H ++LFLG  +P+  GG  S   MEE+ KRR    FS P+   +    ++  
Sbjct  6    FFFDPSACHGNMLFLGNRNPVIQGGR-SVISMEETSKRRP--FFSSPEDLYDEEYYDEQL  62

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV++LE+SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTPEQVNLLEKSFEAENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
            E DYD LKS++D LL+ Y   +K+N KLK+EV  L++KL+G       ++ GK  P    
Sbjct  123  ETDYDLLKSTYDNLLADYQSTVKENDKLKSEVASLTEKLQGR------EEAGKEPPGEGE  176

Query  921  KAEKKCDFTRIHSSIGHRD  977
              ++K    R+ +  G  D
Sbjct  177  GPDQKAQEARLSTGSGVVD  195



>ref|XP_006299626.1| hypothetical protein CARUB_v10015805mg [Capsella rubella]
 gb|EOA32524.1| hypothetical protein CARUB_v10015805mg [Capsella rubella]
Length=272

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 132/213 (62%), Gaps = 18/213 (8%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSAT--KMEESLKRRASCMFSGPqsdeeyye-e  551
            FFF+PS+  H ++ FLG  +P+  GG+ S     MEE+ KRR    FS P+   +    +
Sbjct  6    FFFDPSASQHGNMFFLGNLNPVVQGGARSMMMMNMEETSKRRP--FFSSPEDLYDEEYYD  63

Query  552  qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  64   DQLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKT  123

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP-  908
            KQLERDYD LKS++D+LLS+Y+ I+K N KL++EV  L++KL+G  +E    +     P 
Sbjct  124  KQLERDYDLLKSTYDHLLSNYDSIVKDNDKLRSEVTSLTQKLQGKEEETTAKEPPGQVPD  183

Query  909  ----------PSRMKAEKKCDFTRIHSSIGHRD  977
                      P+ +K E +     + S++   D
Sbjct  184  SNLLDPVYINPAAIKTEDRLSSGSVGSAVLDED  216



>ref|NP_001234296.1| homeodomain leucine zipper protein [Solanum lycopersicum]
 emb|CAP16664.1| homeodomain leucine zipper protein [Solanum lycopersicum]
Length=285

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 161/294 (55%), Gaps = 39/294 (13%)
 Frame = +3

Query  387   FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
              FF+PSS H ++LFLG  DP+F G   +  KME+S KRR    FS P+   +    ++ S
Sbjct  6     IFFDPSSCHGNMLFLGSGDPVFRGPRSTMMKMEDSSKRRP--FFSSPEDLYDEEYYDEQS  63

Query  561   sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
              +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  64    PEKKRRLTPEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  123

Query  741   ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG------------NCKEVDD  884
             ERDYD+LKSS+D LLS ++ + K N KLK+EV  L +KL+G            +  EVD 
Sbjct  124   ERDYDQLKSSYDSLLSDFDSVRKDNDKLKSEVVSLMEKLQGKVVGGAGGNEKSDILEVD-  182

Query  885   DDEGKNAPPSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYY-----YCV  1049
                       ++KAE      R+ S  G    + E    +P+     D+Y++     Y  
Sbjct  183   ---AMTILQVKVKAED-----RLSSGSGGSAVVDEH---SPQLVDSGDSYFHTDHEEYPG  231

Query  1050  CGSGNTYNNLHNIDYeeeeeDMDHHVCNS------TPHAQTTTDDDEPLGWFWS  1193
              G  N    +  +  EE++   DH  C+           Q     +EP+GWFWS
Sbjct  232   PGGCNVPPPMDGLQSEEDDGSDDHGSCHGYFSNVFVAEEQHHEQGEEPIGWFWS  285



>gb|EYU44734.1| hypothetical protein MIMGU_mgv1a011727mg [Erythranthe guttata]
Length=272

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 124/181 (69%), Gaps = 8/181 (4%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsss  563
             FF+PS H+++LFLG  D  F G   S   MEE+ KR +   FS P+   +    ++   
Sbjct  6    IFFDPSCHSNMLFLGNGDSGFRGAR-SVMNMEETSKR-SRPFFSTPEELYDEDYFDEQLP  63

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT++QV +LE+SF  E K+E ER+ ELA NLGL PRQVAVWFQNRRARWK KQLE
Sbjct  64   EKKRRLTAEQVHLLEKSFETENKLEPERKTELAKNLGLQPRQVAVWFQNRRARWKTKQLE  123

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE-----GNCKEVDDDDEGKNAP  908
            RDYD+LKSS+D LLS+Y+ ILK+N KLK+E+  L++KL+     G   +  D    ++AP
Sbjct  124  RDYDQLKSSYDSLLSNYDSILKENDKLKSELLSLTEKLQPEGSAGEPGQKSDPVPPEDAP  183

Query  909  P  911
            P
Sbjct  184  P  184



>ref|XP_002882180.1| homeobox-leucine zipper protein hat5 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58439.1| homeobox-leucine zipper protein hat5 [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 131/211 (62%), Gaps = 16/211 (8%)
 Frame = +3

Query  387   FFFNPS-SHAD--VLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqs  557
             FFF PS SH +  + FLG  +P+  GG   A  MEE+ KRR    FS P+   +      
Sbjct  6     FFFGPSASHGNNNMFFLGNLNPVVQGGG--ARSMEETSKRRP--FFSSPEDLYDDDYYDD  61

Query  558   s-sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAK  734
                +KKRRLT++QV +LE+SF  E K+E +R+ +LA  LGL PRQVAVWFQNRRARWK K
Sbjct  62    QLPEKKRRLTTEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWKTK  121

Query  735   QLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPS  914
             QLERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL+G        +E  N PP 
Sbjct  122   QLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLQGK-------EETANEPPG  174

Query  915   RMKAEKKCDFTRIH-SSIGHRDKIPEEEYGN  1004
              +    + D   I+ ++I   D++     G+
Sbjct  175   LVPEPNQLDTVYINPAAIKTEDRLSSGSVGS  205



>emb|CDP02129.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssd  566
             +F+PS H ++LFLG  +P+FPG   S   +EE+LKRR   + S  +  +E Y E+  ++
Sbjct  6    IYFDPSCHGNMLFLGSGNPVFPGAR-SVLNVEETLKRRP-FLRSPEELFDEEYYEEQLAE  63

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  64   KKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  123

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            DYD++KSS+D L S Y+ ++K+N+KLK EV  L++KL+   KEV
Sbjct  124  DYDQVKSSYDSLRSDYDSVVKENEKLKTEVLSLTEKLQ-QGKEV  166



>gb|AII99842.1| homeodomain leucine zipper protein [Nicotiana tabacum]
Length=285

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsss  563
             FF PS H ++LFLG +DP+F G   S  KME+S KRR    FS P+   +    ++ S 
Sbjct  6    IFFEPSCHGNMLFLGNSDPVFRGPR-SMMKMEDSSKRRP--FFSSPEELYDEEYYDEQSP  62

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K LE
Sbjct  63   EKKRRLTPEQVHLLEKSFGTENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKTLE  122

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNC  869
            RDYD+LKSS+D LLS ++ + K N+KLKAEV  L +KL+G  
Sbjct  123  RDYDQLKSSYDSLLSDFDSMRKDNEKLKAEVVSLMEKLQGKV  164



>ref|XP_009777424.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Nicotiana sylvestris]
Length=285

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsss  563
             FF PS H ++LFLG +DP+F G   S  KME+S KRR    FS P+   +    ++ S 
Sbjct  6    IFFEPSCHGNMLFLGNSDPVFRGPR-SMMKMEDSSKRRP--FFSSPEELYDEEYYDEQSP  62

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K LE
Sbjct  63   EKKRRLTPEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKTLE  122

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNC  869
            RDYD+LKSS+D LLS ++ + K N+KLKAEV  L +KL+G  
Sbjct  123  RDYDQLKSSYDSLLSDFDSMRKDNEKLKAEVVSLMEKLQGKV  164



>ref|NP_186796.1| homeobox-leucine zipper protein HAT5 [Arabidopsis thaliana]
 sp|Q02283.1|HAT5_ARATH RecName: Full=Homeobox-leucine zipper protein HAT5; AltName: 
Full=HD-ZIP protein ATHB-1; AltName: Full=Homeodomain transcription 
factor ATHB-1; AltName: Full=Homeodomain-leucine zipper 
protein HAT5; Short=HD-ZIP protein 5 [Arabidopsis thaliana]
 gb|AAF01532.1|AC009325_2 homeobox-leucine zipper protein HAT5 (HD-ZIP protein 5) (HD-ZIP 
protein ATHB-1) [Arabidopsis thaliana]
 emb|CAA41625.1| Athb-1 protein [Arabidopsis thaliana]
 gb|AAL25601.1| AT3g01470/F4P13_2 [Arabidopsis thaliana]
 gb|AAM19982.1| AT3g01470/F4P13_2 [Arabidopsis thaliana]
 gb|AEE73670.1| homeobox-leucine zipper protein HAT5 [Arabidopsis thaliana]
Length=272

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 14/211 (7%)
 Frame = +3

Query  387   FFFNPS-SHAD-VLFLGKADPLFPGG-SWSATKMEESLKRRASCMFSGPqsdeeyyeeqs  557
             FFF+PS SH + + FLG  +P+  GG + S   MEE+ KRR    FS P+   +      
Sbjct  6     FFFDPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSKRRP--FFSSPEDLYDDDFYDD  63

Query  558   s-sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAK  734
                +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K
Sbjct  64    QLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTK  123

Query  735   QLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPS  914
             QLERDYD LKS++D LLS+Y+ I+  N KL++EV  L++KL+G         E  N PP 
Sbjct  124   QLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEKLQGK-------QETANEPPG  176

Query  915   RMKAEKKCDFTRIH-SSIGHRDKIPEEEYGN  1004
             ++    + D   I+ ++I   D++     G+
Sbjct  177   QVPEPNQLDPVYINAAAIKTEDRLSSGSVGS  207



>ref|XP_007031433.1| Homeobox-leucine zipper protein HAT5 [Theobroma cacao]
 gb|EOY02359.1| Homeobox-leucine zipper protein HAT5 [Theobroma cacao]
Length=276

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
             FFN S+ H ++LFLG  DP+F G   +   MEE+ KRR    FS P+   +    ++  
Sbjct  6    LFFNSSTCHGNMLFLGNCDPVFRGAR-TMISMEETSKRRP--FFSSPEDMYDEEYYDEQL  62

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTAEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            ERDYD LKSS+D L+S+Y+ I+++N+KLK+EV  L++KL+ 
Sbjct  123  ERDYDLLKSSYDSLVSNYDCIVQENEKLKSEVASLTEKLQA  163



>ref|XP_010435620.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Camelina 
sativa]
Length=272

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 134/214 (63%), Gaps = 22/214 (10%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSA--TKMEESLKRRASCMFSGPqsdeeyye-e  551
            F+F+PS+  H ++ FLG    L PGG+ S     +EE+ KRR    FS P+   +    +
Sbjct  6    FYFDPSASQHGNMFFLGN---LNPGGARSMMMINIEETSKRRP--FFSSPEDLYDEEYYD  60

Query  552  qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLTS+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  61   DQLPEKKRRLTSEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKT  120

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDD-DEGKNAP  908
            KQLERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL GN +E +++   G+  P
Sbjct  121  KQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLLGNEEEANNELTPGRQVP  180

Query  909  -----------PSRMKAEKKCDFTRIHSSIGHRD  977
                       P+ +K E +     + S++   D
Sbjct  181  ELNQLDPVYLNPAAIKTEDRLSSGSVGSAVLDED  214



>ref|XP_010551895.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Tarenaya hassleriana]
Length=264

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 125/195 (64%), Gaps = 9/195 (5%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
            FFF+PS+ H ++LFLG  + +  GG  S   MEE+ KRR    FS P+   +    ++  
Sbjct  6    FFFDPSACHDNMLFLGNRNRIIQGGR-SMMNMEETSKRRP--FFSSPEDLYDEEYYDEQL  62

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE+SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTPEQVHLLEKSFEAENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
            ERDYD LKS++D LL+ Y   +K+N  LK+EV  L++KL+G     ++  +    PP   
Sbjct  123  ERDYDLLKSTYDKLLADYESTVKENDNLKSEVASLTEKLKGK----EETAKEPMTPPCEP  178

Query  921  KAEKKCDFTRIHSSI  965
            K E+  + TR+   +
Sbjct  179  KQEEPVNATRLEEPV  193



>ref|XP_010247931.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Nelumbo nucifera]
Length=282

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssd  566
             FF+ SSH ++L LG A+PLF G   S   MEE+ KRR     +     +E + ++   +
Sbjct  6    LFFDTSSHGNMLLLGNANPLFRGMR-SVLNMEENPKRRPFFTLAD-DLIDEEFYDEQLPE  63

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV++LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  64   KKRRLTPEQVNLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  123

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            DYD LKSS+D LLS Y+ I+K+N+ LK+EV  L+ KL+ 
Sbjct  124  DYDVLKSSYDSLLSEYDSIVKENENLKSEVVSLTDKLQA  162



>gb|KHG04461.1| Homeobox-leucine zipper HAT5 -like protein [Gossypium arboreum]
Length=270

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 128/208 (62%), Gaps = 14/208 (7%)
 Frame = +3

Query  387  FFFNP-SSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
             FFNP ++H ++L LG  +P+F G   +   MEE+ K+R    FS P+   +        
Sbjct  6    LFFNPYTTHRNMLLLGNTEPIFRGAR-TMVSMEENPKKR--LFFSSPEDLYDEEYYDEQL  62

Query  564  -dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLTS+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTSEQVYLLEKSFEAENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVD----DDDEGKNAP  908
            ERDYD LKSS D L S+Y+ ILK+N+KLK+EV  L++KL+      +    + DEG  A 
Sbjct  123  ERDYDLLKSSFDSLQSNYDTILKENEKLKSEVASLTEKLQAKDVATEAIAGEKDEGLAAE  182

Query  909  PS-----RMKAEKKCDFTRIHSSIGHRD  977
             +      MK E +     + S++   D
Sbjct  183  MASALQFSMKVEDRLSSGSVGSAVVDED  210



>ref|XP_010485418.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSAT--KMEESLKRRASCMFSGPqsdeeyye-e  551
            F+F+PS+  H ++ FLG    L PGG+ S     MEE+ KRR    FS P+   +    +
Sbjct  6    FYFDPSASQHGNMFFLGN---LNPGGARSMMMMNMEETSKRRP--FFSSPEDLYDEEYYD  60

Query  552  qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLTS+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  61   DQLPEKKRRLTSEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKT  120

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPP  911
            KQLERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL G  +E +++      PP
Sbjct  121  KQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLLGKEEEANNE-----LPP  175

Query  912  SRMKAE  929
             R   E
Sbjct  176  GRQVPE  181



>ref|XP_011085824.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Sesamum 
indicum]
Length=259

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssd  566
             FF+ SS+ ++LFLG  D +F GGS     M ES KRR     +     +E Y ++   +
Sbjct  6    IFFDSSSNGNLLFLGNGDSIFRGGS-RVMNMGESSKRRP-FFGTAEDLYDEEYYDEQLPE  63

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV++LE+SF  E K+E ER+ ELA  LGL PRQVA+WFQNRRARWK KQLER
Sbjct  64   KKRRLTPDQVNLLEKSFEEENKLEPERKTELAKKLGLQPRQVAIWFQNRRARWKTKQLER  123

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            DYD LKSS+D L+S+Y+ I+K+N KLKAE+  L++KL+
Sbjct  124  DYDHLKSSYDSLVSNYDSIIKENNKLKAELLFLTEKLQ  161



>gb|KFK37614.1| hypothetical protein AALP_AA3G005800 [Arabis alpina]
Length=265

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqs  557
            FFF+PSS  + ++ FLG  +P+    + S   +EE+ KRR    FS P+   +    ++ 
Sbjct  6    FFFDPSSASNGNMFFLGNLNPVV--QARSMMNIEETSKRRP--FFSSPEDLYDEEYYDEQ  61

Query  558  ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQ  737
            + +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQ
Sbjct  62   TPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQ  121

Query  738  LERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSR  917
            LERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL+        ++E  N PP++
Sbjct  122  LERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLQAK------EEETANEPPAQ  175

Query  918  M  920
            +
Sbjct  176  V  176



>gb|KFK37613.1| hypothetical protein AALP_AA3G005800 [Arabis alpina]
Length=266

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 12/181 (7%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqs  557
            FFF+PSS  + ++ FLG  +P+      S   +EE+ KRR    FS P+   +    ++ 
Sbjct  6    FFFDPSSASNGNMFFLGNLNPVVQEAR-SMMNIEETSKRRP--FFSSPEDLYDEEYYDEQ  62

Query  558  ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQ  737
            + +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQ
Sbjct  63   TPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQ  122

Query  738  LERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSR  917
            LERDYD LKS++D LLS+Y+ I+K N KL++EV  L++KL+        ++E  N PP++
Sbjct  123  LERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTSLTEKLQAK------EEETANEPPAQ  176

Query  918  M  920
            +
Sbjct  177  V  177



>ref|XP_002278872.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Vitis vinifera]
Length=273

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 7/166 (4%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsd-eeyyeeqss  560
             FF+PSS H ++LFLG  D LF  G  S   +EE+ K+R    F+ P+   +E Y ++  
Sbjct  6    LFFDPSSGHGNMLFLGNGDSLF-RGPRSIMNIEETSKKRP--FFTSPEDMFDEEYYDEQM  62

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            ERDYD LKSS+D L+S Y+ ILK+ +KLK+EV  L++KL+   KEV
Sbjct  123  ERDYDLLKSSYDSLVSEYDSILKEKEKLKSEVVSLTEKLQ--AKEV  166



>gb|KDP45368.1| hypothetical protein JCGZ_09617 [Jatropha curcas]
Length=278

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 118/161 (73%), Gaps = 6/161 (4%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsd-eeyyeeqss  560
             FFNPSS H ++LFLG  DP+F G       ME++ K+R    FS P+   ++ Y ++  
Sbjct  6    LFFNPSSCHENMLFLGNCDPVFRGPR--LLNMEDTYKKRP--FFSSPEDLFDDDYYDEQL  61

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV++LE+SF  E K+E +R+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  62   PEKKRRLTPEQVNLLEKSFEEENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  121

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            ERDYD LK+S++ LLS+Y+ I+K+N+KLK+EV  L++KL+ 
Sbjct  122  ERDYDLLKASYESLLSNYDTIVKENEKLKSEVVGLTEKLQA  162



>ref|XP_008458752.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cucumis 
melo]
Length=278

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 110/166 (66%), Gaps = 7/166 (4%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
              FN S  HA++LF G +DP+ P G      MEE+ KRR+   FS P    +        
Sbjct  6    LIFNRSPGHANMLFFGSSDPI-PRGPSFMMGMEETSKRRS--FFSSPDDLFDDDYYDDQP  62

Query  564  -dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTQEQVHLLEISFESENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            ERDYD LKSS+D   S Y+FI K+N++LKAEV  L++KL+   KEV
Sbjct  123  ERDYDLLKSSYDSFRSSYDFIAKENERLKAEVASLTEKLQ--AKEV  166



>dbj|BAJ33940.1| unnamed protein product [Thellungiella halophila]
 dbj|BAJ34621.1| unnamed protein product [Thellungiella halophila]
Length=274

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 140/245 (57%), Gaps = 25/245 (10%)
 Frame = +3

Query  387   FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
             FFF+PS SH ++ FLG  +P+  G   S   M+E+ KRR    FS P+   E    +   
Sbjct  6     FFFDPSPSHGNMFFLGNLNPVVQGAK-SVLNMDETSKRRP--FFSSPEDLYEEEYYDDQM  62

Query  561   sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
              +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63    PEKKRRLTTEQVHLLEKSFEKENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741   ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
             ERD+D LKS++D LLS+Y+ I+K+N  L++++  L++KL+         +E    PP ++
Sbjct  123   ERDFDLLKSTYDQLLSNYDSIVKENDLLRSQMASLAEKLQAK-------EEAAIEPPGQV  175

Query  921   KAEKKCD---FTRIHSSIGHRDKIPEEEYGN-------PKQELLMDNYYYYCV---CGSG  1061
                 + D     R   +I   D++     G+       P+     D+Y+   V       
Sbjct  176   PEPNQLDPLNINRFEPAIKTEDRLSSGSVGSAVLDEDAPQLLDSCDSYFPIIVPIHSEDD  235

Query  1062  NTYNN  1076
             N YNN
Sbjct  236   NNYNN  240



>ref|XP_004304607.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 117/166 (70%), Gaps = 4/166 (2%)
 Frame = +3

Query  387  FFFNP--SSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqss  560
             FF+P      ++LFLG  D +F G S S   MEE+ +RR S   +  +  EE Y ++  
Sbjct  7    LFFDPQQGGGGNMLFLGSGDQVFRG-SRSMMGMEETSRRR-SFFSTQDELYEEEYYDEQM  64

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT++QV +LE+SF  E K+E +R+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  65   PEKKRRLTTEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  124

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            ERDYD LK+S+D LL++Y+ ILK+NQKLK+EV  +++KLE   +E 
Sbjct  125  ERDYDVLKASYDSLLANYDSILKENQKLKSEVVTITEKLEAKDQEA  170



>dbj|BAG50054.1| transcription factor Homeobox [Lotus japonicus]
Length=284

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 12/190 (6%)
 Frame = +3

Query  396  NPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss-dKK  572
            N  ++ +  FLG AD  F G S     MEE  KRR    FS P    +    +  S +KK
Sbjct  11   NRGNNMNTFFLGNADLGFRGRS--MMSMEEGSKRRP--FFSSPDELYDEEYYEEQSPEKK  66

Query  573  RRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDY  752
            RRLTS+QV++LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERDY
Sbjct  67   RRLTSEQVNLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDY  126

Query  753  DELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKAEK  932
            D LKSS+D LL+ Y+ I K+N+KLK+EV  L++KL+    E+  +      PPS  KA+ 
Sbjct  127  DVLKSSYDSLLATYDTIAKENEKLKSEVVSLNEKLQVQATEMPGE------PPSDKKADP  180

Query  933  -KCDFTRIHS  959
               D  +I S
Sbjct  181  LPVDMVQIFS  190



>ref|XP_006446470.1| hypothetical protein CICLE_v10017539mg [Citrus clementina]
 gb|ESR59710.1| hypothetical protein CICLE_v10017539mg [Citrus clementina]
 gb|KDO66233.1| hypothetical protein CISIN_1g023291mg [Citrus sinensis]
Length=284

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeey-yeeqsss  563
            FF   S   ++LFLG  D  F GG+ S   MEE+ KRR    FS P    +  Y ++   
Sbjct  7    FFDRSSCPGNMLFLGNGDSFF-GGARSMMSMEETSKRRP--FFSSPDDLFDDCYYDEQLP  63

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  64   EKKRRLTAEQVHLLEKSFEAENKLEPERKGQLAKKLGLQPRQVAVWFQNRRARWKTKQLE  123

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEV  836
            RDYD LKSS+D LLS Y+ ++K+NQKLK+EV
Sbjct  124  RDYDLLKSSYDALLSSYDSLVKENQKLKSEV  154



>ref|XP_004159074.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cucumis 
sativus]
Length=278

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 109/166 (66%), Gaps = 7/166 (4%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
              FN S  HA++LF G +D + P G      MEE+ KRR+   FS P    +        
Sbjct  6    LIFNRSPGHANMLFFGSSDSI-PRGPSFMMGMEETSKRRS--FFSSPDDLFDDDYYDDQP  62

Query  564  -dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  63   PEKKRRLTQEQVHLLEISFESENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQL  122

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            ERDYD LKSS+D   S Y+FI K+N++LKAEV  L++KL+   KEV
Sbjct  123  ERDYDLLKSSYDSFRSSYDFIAKENERLKAEVASLTEKLQ--AKEV  166



>ref|XP_006470354.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Citrus 
sinensis]
Length=284

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeey-yeeqsss  563
            FF   S   ++LFLG  D  F GG+ S   MEE+ KRR    FS P    +  Y ++   
Sbjct  7    FFDRSSCPGNMLFLGNGDSFF-GGTRSMMSMEETSKRRP--FFSSPDDLFDDCYYDEQLP  63

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  64   EKKRRLTAEQVHLLEKSFEAENKLEPERKGQLAKKLGLQPRQVAVWFQNRRARWKTKQLE  123

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEV  836
            RDYD LKSS+D LLS Y+ ++K+NQKLK+EV
Sbjct  124  RDYDLLKSSYDALLSSYDSLVKENQKLKSEV  154



>ref|XP_010029204.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Eucalyptus grandis]
 gb|KCW56063.1| hypothetical protein EUGRSUZ_I01817 [Eucalyptus grandis]
Length=267

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 126/204 (62%), Gaps = 22/204 (11%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsd-eeyyeeqss  560
            F F+P +   ++LFL K       GS S   MEES KRR    F  P    +E Y ++  
Sbjct  6    FLFDPPALQGNILFLDK-------GSRSMMGMEESPKRRR--FFCSPDELFDEEYYDEQM  56

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  57   PEKKRRLTPEQVLLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQL  116

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP---P  911
            ERDYD LKSS+D LLS Y+ ILK+N+KLK EV  L++KL+G  KEVD       AP   P
Sbjct  117  ERDYDYLKSSYDSLLSDYDSILKENEKLKLEVYSLTEKLQG--KEVD------GAPMTGP  168

Query  912  SRMKAEKKCDFTRIHSSIGHRDKI  983
            S     ++ D   +  S    D++
Sbjct  169  SEPAPLEEADVQAVQFSAKVEDRL  192



>ref|XP_002517348.1| homeobox protein, putative [Ricinus communis]
 gb|EEF44890.1| homeobox protein, putative [Ricinus communis]
Length=212

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 8/163 (5%)
 Frame = +3

Query  387  FFFNPSSHA----DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-e  551
              FNPS+ +    ++LFLG  D +F G   S  KME++ K+R    FS P+   +    +
Sbjct  7    LLFNPSASSCHGGNMLFLGNCDSVFRGPR-SMFKMEDTSKKRP--FFSSPEDFFDDEYYD  63

Query  552  qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
            +   +KKRRLTS+QV++LE+SF  E K+E ER+ +LA  LG+ PRQVAVWFQNRRARWK 
Sbjct  64   EQLPEKKRRLTSEQVNLLEKSFEEENKLEPERKTQLAKKLGMQPRQVAVWFQNRRARWKT  123

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            KQLERDYD LK+S+D LLS ++  +K+NQKLK+EV  L++KL+
Sbjct  124  KQLERDYDVLKASYDSLLSDFDNTVKENQKLKSEVVSLTEKLQ  166



>ref|XP_004489298.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cicer arietinum]
Length=286

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 109/156 (70%), Gaps = 5/156 (3%)
 Frame = +3

Query  414  DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss-dKKRRLTSQ  590
            ++L+LG AD  F G S     MEE  KRR    FS P    +    +  S +KKRRLTS+
Sbjct  21   NMLYLGNADLSFRGRS--MMSMEEGSKRRP--FFSSPDELYDEEYYEEQSPEKKRRLTSE  76

Query  591  QVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSS  770
            QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LKSS
Sbjct  77   QVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKSS  136

Query  771  HDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            +D LLS Y+ I+K+N+KLK+EV  L++KL+   KE+
Sbjct  137  YDSLLSTYDSIVKENEKLKSEVVSLNEKLQVQAKEM  172



>ref|XP_010251293.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nelumbo 
nucifera]
 ref|XP_010251294.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nelumbo 
nucifera]
Length=279

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 112/181 (62%), Gaps = 4/181 (2%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss-  563
             FF+ S H ++L LG ADP     S S   MEE+ +R     FS P    +         
Sbjct  6    LFFDASCHGNMLLLGSADPHLRE-SRSVLNMEENSRRH--LFFSSPDDLLDEEYYDEQLP  62

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  63   EKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLE  122

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMK  923
            RDYD LKSS+D LLS Y  ++K+N+KLK+EV  L+ KL+      +    G+ A P  + 
Sbjct  123  RDYDLLKSSYDSLLSDYESVVKENEKLKSEVIFLNDKLQAKEAAGEVVVVGQKADPPLLA  182

Query  924  A  926
            A
Sbjct  183  A  183



>ref|XP_010111761.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
 gb|EXC31623.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
Length=281

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 124/194 (64%), Gaps = 14/194 (7%)
 Frame = +3

Query  387  FFFNPSSH---ADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eq  554
             FF+P+S     ++LFLG  D +F G   S   MEES KRR    FS P+   +    ++
Sbjct  6    LFFDPTSACHGGNMLFLGNGDSVFRGPRSSIMSMEESSKRRP--FFSSPEDLYDEEYYDE  63

Query  555  sssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAK  734
               +KKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL  RQVAVWFQNRRARWK K
Sbjct  64   QLPEKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQSRQVAVWFQNRRARWKTK  123

Query  735  QLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPS  914
            QLERDYD LKS++D LL++++ I K+N+KLKAEV  L++KL+         +EG  APP 
Sbjct  124  QLERDYDLLKSTYDSLLANFDSIHKENEKLKAEVASLTEKLQAK-------EEGAGAPPP  176

Query  915  RMKAEK-KCDFTRI  953
              K+E    D T I
Sbjct  177  AQKSESLAGDMTEI  190



>ref|NP_001240210.1| uncharacterized protein LOC100813420 [Glycine max]
 gb|ACU18084.1| unknown [Glycine max]
Length=284

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%), Gaps = 5/168 (3%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsss  563
            F  + SS  ++LFLG  +  F G S     MEE+ KRR    F+ P    +    E+ S 
Sbjct  8    FGASASSGNNMLFLGNTELAFRGRS--IMSMEEASKRRP--FFTSPDELYDEEYYEKQSP  63

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KK RL+S+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  64   EKKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLE  123

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDD  887
            RDYD LKSS+D LLS Y+ I+K+N+KLK+EV  L++KL+   KEV ++
Sbjct  124  RDYDVLKSSYDTLLSSYDSIMKENEKLKSEVVSLNEKLQVQAKEVPEE  171



>gb|ADN88094.1| homeodomain-leucine zipper protein HD3 [Gossypium hirsutum]
Length=254

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 120/197 (61%), Gaps = 13/197 (7%)
 Frame = +3

Query  417  VLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss-dKKRRLTSQQ  593
            +L LG  +P+F G   +   MEE+ K+R    FS P+   +         +KKRRLTS+Q
Sbjct  1    MLLLGNTEPIFRGAR-TMVSMEENPKKR--LFFSSPEDLYDEEYYDEQLPEKKRRLTSEQ  57

Query  594  VDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSH  773
            V +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LKSS 
Sbjct  58   VYLLEKSFEAENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSF  117

Query  774  DYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVD----DDDEGKNAPPS-----RMKA  926
            D L S+Y+ ILK+N+KLK+EV  L++KL+      +    + DEG  A  +      MK 
Sbjct  118  DSLQSNYDTILKENEKLKSEVASLTEKLQAKDVATEAIAGEKDEGLAAEMASALQFSMKV  177

Query  927  EKKCDFTRIHSSIGHRD  977
            E +     + S++   D
Sbjct  178  EDRLSSGSVGSAVVDED  194



>gb|AAL57495.1|AF443621_1 homeodomain leucine zipper protein CPHB-5 [Craterostigma plantagineum]
Length=285

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 125/178 (70%), Gaps = 17/178 (10%)
 Frame = +3

Query  387  FFFNPSSHADVL-FLGKA---DPLFPGG-SWSATKMEES-LKRRASCMFSGPqsde----  536
             FF+PSSH ++L FLG A     +F G  S S   MEES LKR+   +FSG   DE    
Sbjct  6    IFFDPSSHGNMLQFLGNAGGDSSVFRGTRSSSVLNMEESSLKRQ---IFSGGGGDEFYDE  62

Query  537  eyyeeqsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRR  716
            EYY+EQ   +KKRRLT++QV +LE+SF  E K+E ER+ ELA  LGL PRQVA+WFQNRR
Sbjct  63   EYYDEQLLPEKKRRLTAEQVHLLEKSFEAENKLEPERKAELAKKLGLQPRQVAIWFQNRR  122

Query  717  ARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDD  890
            ARWK KQLERDYD+LKSS+D LLS Y+ I ++N KLKAE+  L++KL+      DDDD
Sbjct  123  ARWKTKQLERDYDKLKSSYDSLLSTYDSIRQENDKLKAELLSLNEKLQPK----DDDD  176



>gb|KEH24863.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=287

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 114/169 (67%), Gaps = 9/169 (5%)
 Frame = +3

Query  387  FFFNPSS----HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeq  554
             +F+ S+    + ++LFLG AD  F G S     MEE  KRR    FS P    +    +
Sbjct  6    LYFDSSACRGNNMNMLFLGNADLGFRGRS--MMSMEEGSKRRP--FFSSPDELYDEEYYE  61

Query  555  sss-dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
              S +KKRRLTS+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  62   EQSPEKKRRLTSEQVHMLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKT  121

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            KQLERDYD LKSS+D LLS Y+ I K+N+KLK+EV  L++KL+   K++
Sbjct  122  KQLERDYDVLKSSYDSLLSTYDSINKENEKLKSEVVSLNEKLQVQAKDM  170



>ref|XP_010033267.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Eucalyptus 
grandis]
Length=280

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = +3

Query  387  FFFNPSS-HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqss  560
            F F+ S+ H ++LFLG  D LF  G   A  +EE+ KR++  +FS P+        +  +
Sbjct  9    FLFDQSACHGNMLFLGNRDSLFGEGGL-AMGIEEATKRQS--IFSYPEDLYNEEYYDDQA  65

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE+SF  E K+E E++ +LA  LG+ PRQVAVWFQNRRARWK KQL
Sbjct  66   PEKKRRLTPEQVHLLEKSFEVENKLEPEKKTQLAKKLGMQPRQVAVWFQNRRARWKTKQL  125

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            ERDYD LKSS+D LL  Y+ I K+N+KLK+EVN L++KL
Sbjct  126  ERDYDVLKSSYDSLLLSYDSIKKENEKLKSEVNFLNEKL  164



>gb|KHN23555.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=284

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 5/168 (3%)
 Frame = +3

Query  387  FFFNPSSHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsss  563
            F  + SS  ++LFLG  +  F G S     MEE+ KRR    F+ P    +    E+ S 
Sbjct  8    FGASASSGNNMLFLGNTELAFRGRS--MMSMEEASKRRP--FFTSPDELYDEEYYEKQSP  63

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KK RL+S+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  64   EKKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLE  123

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDD  887
            RD+D LKSS+D LLS Y+ I+K+N+KLK+EV  L++KL+   KEV ++
Sbjct  124  RDFDVLKSSYDTLLSSYDSIMKENEKLKSEVVSLNEKLQVQAKEVPEE  171



>gb|KHN47180.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=285

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 8/171 (5%)
 Frame = +3

Query  387  FFFNPSSHA--DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyy--eeq  554
             FF+ S+    ++LFLG  +  F G S     MEE+ KRR    F+ P    +    E+Q
Sbjct  6    IFFDASASRGNNMLFLGNTELAFRGRS--IMSMEEASKRRP--FFTSPDELYDEEYYEKQ  61

Query  555  sssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAK  734
            S   KK RL+S+QV +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K
Sbjct  62   SPEKKKHRLSSEQVHLLEKNFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTK  121

Query  735  QLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDD  887
            QLERDYD LKSS+D LLS Y+ I+K+N+KLK+EV  L++KL+   KEV ++
Sbjct  122  QLERDYDVLKSSYDTLLSSYDSIMKENEKLKSEVVSLNEKLQVQAKEVPEE  172



>ref|XP_003542698.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
Length=285

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 114/168 (68%), Gaps = 8/168 (5%)
 Frame = +3

Query  387  FFFNPSSHA--DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyy--eeq  554
             FF+ S+    ++LFLG  +  F G S     MEE+ KRR    F+ P    +    ++Q
Sbjct  6    IFFDASASRGNNMLFLGNTELAFRGRS--MMSMEEASKRRP--FFTSPDELYDEEYYDKQ  61

Query  555  sssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAK  734
            S   KK RL+S+QV +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK K
Sbjct  62   SPEKKKHRLSSEQVHLLEKNFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTK  121

Query  735  QLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            QLERDYD LKSS+D LLS Y+ I+K+N+KLK+EV  L++KL+   KEV
Sbjct  122  QLERDYDVLKSSYDTLLSSYDSIMKENEKLKSEVVSLNEKLQVQAKEV  169



>ref|XP_008781998.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Phoenix 
dactylifera]
Length=283

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = +3

Query  387  FFFNPSSH-ADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
             F +PSSH   +LFLG  +P+F G   S   M+E   +R     S  +  EE Y ++   
Sbjct  7    IFDSPSSHHGQMLFLGGGNPIFRGAR-SVLGMDEGANKRRPFFTSPDELLEEEYYDEQLP  65

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLE
Sbjct  66   EKKRRLTPEQVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQLE  125

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            RD+D LKSS+D LL+ ++ +LK N +L+++V  L++KL+
Sbjct  126  RDFDRLKSSYDSLLADHDSLLKDNDRLRSQVISLTEKLQ  164



>ref|XP_010913582.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Elaeis 
guineensis]
Length=283

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqss  560
              F+ SS  H  +LFLG  +P+F G   S   MEE   +R     S  +  EE Y ++  
Sbjct  6    LIFDSSSSHHGQMLFLGGGNPIFRGAR-SVLGMEEGANKRRPFFTSPDELLEEEYYDEQL  64

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  65   PEKKRRLTPEQVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQL  124

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            ERD+D LKSS+D LL+ ++ +LK N +L+++V  L++KL+
Sbjct  125  ERDFDRLKSSYDSLLADHDSLLKDNDRLRSQVLSLTEKLQ  164



>emb|CBI34940.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 110/155 (71%), Gaps = 6/155 (4%)
 Frame = +3

Query  417  VLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsd-eeyyeeqsssdKKRRLTSQQ  593
            +LFLG  D LF  G  S   +EE+ K+R    F+ P+   +E Y ++   +KKRRLT +Q
Sbjct  1    MLFLGNGDSLF-RGPRSIMNIEETSKKRP--FFTSPEDMFDEEYYDEQMPEKKRRLTPEQ  57

Query  594  VDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSH  773
            V +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LKSS+
Sbjct  58   VHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSY  117

Query  774  DYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            D L+S Y+ ILK+ +KLK+EV  L++KL+   KEV
Sbjct  118  DSLVSEYDSILKEKEKLKSEVVSLTEKLQ--AKEV  150



>ref|XP_009147435.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Brassica rapa]
 emb|CDY37519.1| BnaA05g33840D [Brassica napus]
Length=260

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 109/162 (67%), Gaps = 6/162 (4%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRAS--CMFSGPqsdeeyyeeqs  557
            FFFNPS SH ++ FLG  +P+  G   S   MEES  +R    C       D+  Y +  
Sbjct  6    FFFNPSTSHGNMFFLGNLNPVVQG---SMMNMEESSSKRRPFFCSPDDLLYDDVDYYDDQ  62

Query  558  ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQ  737
            + DKKRRLT +QV +LE+SF  E K+E ER+ +LA  LGL PRQV+VWFQNRRARWK KQ
Sbjct  63   TPDKKRRLTHEQVHLLEKSFEKENKLEPERKTQLAKKLGLQPRQVSVWFQNRRARWKTKQ  122

Query  738  LERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            LERD++ LKSS+D LLS+Y+ ILK N  L+++V  L+ K++ 
Sbjct  123  LERDFNLLKSSYDQLLSNYDSILKDNHLLRSQVTSLAGKVQA  164



>emb|CDY49056.1| BnaC05g48840D [Brassica napus]
Length=263

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 109/168 (65%), Gaps = 9/168 (5%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqs--  557
            FFFNPS SH ++ FLG  +P+   GS     MEES  +R    F  P        +    
Sbjct  6    FFFNPSTSHGNMFFLGNLNPVVQAGS--MMNMEESSSKRRP-FFCSPDDLLYDDVDVDYY  62

Query  558  ---ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWK  728
               + DKKRRLT +QV +LE+SF  E K+E ER+ +LA+ LGL PRQV+VWFQNRRARWK
Sbjct  63   DDHTPDKKRRLTHEQVHLLEKSFEKENKLEPERKTQLANKLGLQPRQVSVWFQNRRARWK  122

Query  729  AKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
             KQLERD++ LKSS+D LLS+Y+ ILK N  L+++V  L+ K++   +
Sbjct  123  TKQLERDFNLLKSSYDQLLSNYDSILKDNHLLRSQVTSLAGKVQAKAE  170



>emb|CDY28673.1| BnaCnng05590D [Brassica napus]
Length=272

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 116/179 (65%), Gaps = 12/179 (7%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
            FFF+PS SH ++ FL   +P     + S    EES KRR     S     ++ Y +  + 
Sbjct  6    FFFDPSLSHGNMFFL---NPAAVQEAKSMMTTEESSKRRP-FFCSHEDLYDDDYYDDHTP  61

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KKRRLTSQQV +LE+SF  E K+E ER+ +LA+ LGL PRQVAVWFQNRRARWK KQLE
Sbjct  62   EKKRRLTSQQVHLLEKSFETENKLEPERKTQLANKLGLQPRQVAVWFQNRRARWKTKQLE  121

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
            RD++ LKSS+D LLS+Y+ ILK N  L++EV  L +KL+         ++  N PP ++
Sbjct  122  RDFNLLKSSYDQLLSNYDSILKDNHLLRSEVTSLVEKLQAK-------EDTTNKPPGQV  173



>ref|XP_009125018.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Brassica rapa]
Length=274

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 116/179 (65%), Gaps = 12/179 (7%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
            FFF+PS SH ++ FL   +P     + S    EES KRR     S     ++ Y +  + 
Sbjct  6    FFFDPSLSHGNMFFL---NPAAVQEAKSMMTTEESSKRRP-FFCSHEDLYDDDYYDDHTP  61

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            DKKRRLTSQQV +LE+SF  E K+E ER+ +LA+ LGL PRQVAVWFQNRRARWK KQLE
Sbjct  62   DKKRRLTSQQVHLLEKSFETENKLEPERKTQLANKLGLQPRQVAVWFQNRRARWKTKQLE  121

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
            RD++ LKSS+D LLS+Y+ ILK N  L++EV  L +KL+         ++  N PP ++
Sbjct  122  RDFNLLKSSYDQLLSNYDSILKDNHLLRSEVTSLVEKLQAK-------EDTTNKPPGQV  173



>ref|XP_009125019.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Brassica rapa]
Length=273

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 115/179 (64%), Gaps = 13/179 (7%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
            FFF+PS SH ++ FL  A       + S    EES KRR     S     ++ Y +  + 
Sbjct  6    FFFDPSLSHGNMFFLNPAA----VQAKSMMTTEESSKRRP-FFCSHEDLYDDDYYDDHTP  60

Query  564  dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            DKKRRLTSQQV +LE+SF  E K+E ER+ +LA+ LGL PRQVAVWFQNRRARWK KQLE
Sbjct  61   DKKRRLTSQQVHLLEKSFETENKLEPERKTQLANKLGLQPRQVAVWFQNRRARWKTKQLE  120

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRM  920
            RD++ LKSS+D LLS+Y+ ILK N  L++EV  L +KL+         ++  N PP ++
Sbjct  121  RDFNLLKSSYDQLLSNYDSILKDNHLLRSEVTSLVEKLQAK-------EDTTNKPPGQV  172



>ref|XP_006844229.1| hypothetical protein AMTR_s00006p00267430 [Amborella trichopoda]
 gb|ERN05904.1| hypothetical protein AMTR_s00006p00267430 [Amborella trichopoda]
Length=250

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  42   KKRRLTAEQVHLLERSFESENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  101

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMK  923
            DYD LKSS+D L S Y  ++K+ ++LK+EV  L +KL+   KE+ + D G ++PP  MK
Sbjct  102  DYDLLKSSYDSLRSDYETLVKEKERLKSEVASLVEKLQ--AKEIGESDIGSSSPPEEMK  158



>ref|XP_010485417.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Camelina sativa]
Length=251

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 104/152 (68%), Gaps = 8/152 (5%)
 Frame = +3

Query  477  MEESLKRRASCMFSGPqsdeeyye-eqsssdKKRRLTSQQVDVLERSFSGEKKVEAERRK  653
            MEE+ KRR    FS P+   +    +    +KKRRLTS+QV +LE+SF  E K+E ER+ 
Sbjct  16   MEETSKRRP--FFSSPEDLYDEEYYDDQLPEKKRRLTSEQVHLLEKSFETENKLEPERKT  73

Query  654  ELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAE  833
            +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LKS++D LLS+Y+ I+K N KL++E
Sbjct  74   QLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSE  133

Query  834  VNLLSKKLEGNCKEVDDDDEGKNAPPSRMKAE  929
            V  L++KL G  +E +++      PP R   E
Sbjct  134  VTSLTEKLLGKEEEANNE-----LPPGRQVPE  160



>ref|XP_010928608.1| PREDICTED: homeobox-leucine zipper protein HOX16-like isoform 
X1 [Elaeis guineensis]
Length=283

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqss  560
              F+ SS  H  +L LG   P+F G   S   MEE   +R     S  +  EE Y ++  
Sbjct  6    LIFDSSSSHHGRMLLLGGGSPIFQGAR-SVLGMEEGANKRRLFFTSPDELLEEEYYDEQL  64

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  65   PEKKRRLTPEQVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQL  124

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            ERD+D LKSS+D LL+ ++ +LK N +L+++V  L++KL+
Sbjct  125  ERDFDRLKSSYDSLLADHDSLLKDNDRLRSQVISLTEKLQ  164



>ref|XP_007151094.1| hypothetical protein PHAVU_004G017500g [Phaseolus vulgaris]
 gb|ESW23088.1| hypothetical protein PHAVU_004G017500g [Phaseolus vulgaris]
Length=284

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = +3

Query  408  HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye-eqsssdKKRRLT  584
            + ++LFLG  +  F G S     +EE+ KRR    F+ P    +    E+   +KK RL+
Sbjct  16   NTNMLFLGNTELAFRGRS--MMSLEEASKRRP--FFTSPDELYDEEYYEKQMPEKKHRLS  71

Query  585  SQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELK  764
            S+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERD+D LK
Sbjct  72   SEQVHLLEKSFEEENKLEPERKTQLAKMLGLQPRQVAVWFQNRRARWKTKQLERDFDVLK  131

Query  765  SSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDD  887
            SS+D LLS Y+ ++K N+KLK+EV  L++KL+   KEV ++
Sbjct  132  SSYDTLLSSYDSLMKDNEKLKSEVVSLNEKLQDQAKEVPEE  172



>ref|XP_008793871.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
HOX16-like [Phoenix dactylifera]
Length=164

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 4/153 (3%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqss  560
              F+ SS  H  +L LG   P+F G + S   ME + KRR     S  +  EE Y ++  
Sbjct  6    LIFDSSSFHHGRMLLLGGGSPIFRGAT-SVLGMEXAEKRRP-FFTSSDELLEEEYYDEQL  63

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLTS+QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  64   PEKKRRLTSEQVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQL  123

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVN  839
            ERDYD LK+S+D LL+ ++ +LK N +L+++V+
Sbjct  124  ERDYDCLKASYDSLLADHDSLLKDNDRLRSQVS  156



>gb|KEH24864.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=253

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = +3

Query  477  MEESLKRRASCMFSGPqsdeeyyeeqsss-dKKRRLTSQQVDVLERSFSGEKKVEAERRK  653
            MEE  KRR    FS P    +    +  S +KKRRLTS+QV +LE+SF  E K+E ER+ 
Sbjct  4    MEEGSKRRP--FFSSPDELYDEEYYEEQSPEKKRRLTSEQVHMLEKSFEEENKLEPERKT  61

Query  654  ELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAE  833
            +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LKSS+D LLS Y+ I K+N+KLK+E
Sbjct  62   QLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKSSYDSLLSTYDSINKENEKLKSE  121

Query  834  VNLLSKKLEGNCKEV  878
            V  L++KL+   K++
Sbjct  122  VVSLNEKLQVQAKDM  136



>ref|XP_008230624.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Prunus mume]
Length=320

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 113/170 (66%), Gaps = 11/170 (6%)
 Frame = +3

Query  387  FFFNPSSHA--------DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeey  542
            FFF+PS+ +        ++LFLG AD +F G       M++   RR S   S    DE +
Sbjct  6    FFFDPSTTSSACQQGGGNMLFLGNADHVFRGPRSVMGLMDQESSRRRSFFSSSSSQDELF  65

Query  543  yee---qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNR  713
             EE   +   +KKRRLT  QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNR
Sbjct  66   DEEYYDEQLPEKKRRLTPDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNR  125

Query  714  RARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            RARWK KQLERDYD LKSS+D LLS+Y+ ILK+N KLK+EV  +++KLE 
Sbjct  126  RARWKTKQLERDYDLLKSSYDSLLSNYDSILKENHKLKSEVVSINQKLEA  175



>ref|XP_004167237.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cucumis 
sativus]
Length=285

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 147/272 (54%), Gaps = 35/272 (13%)
 Frame = +3

Query  387   FFFNPSSHA-DVLFLGKA--DPLFPGG-SWSATKMEESLKRRASCMFSGPqsdeeyyeeq  554
             F FNP  +  ++L+LG A  DP   GG +  +  M ES K R    F  P    +     
Sbjct  6     FLFNPPPYGGNMLYLGGAGGDPCLRGGRTMMSMTMNESPKGRP--FFRSPDDLYDDEYYD  63

Query  555   s-ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                 +KKRRLT  QV +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  64    EFYPEKKRRLTHDQVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKT  123

Query  732   KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPP  911
             KQLERDYD LK+S+D L+S+Y+ I+K+N  LK+EV  L++K     KE+     G+   P
Sbjct  124   KQLERDYDVLKASYDLLVSNYDSIVKENAVLKSEVASLTEKCL--AKELGG---GEATIP  178

Query  912   SRMKAEK--KCDFTRIHSSIGHRDKIPEEEY--GNPKQELLMDNYYYYC--VCGSGNTYN  1073
             S     +    D T I  S+ H  +  E+    G+    ++ DN    C  +  SG++Y 
Sbjct  179   SITSTSELLLADITNI--SVPHSGRKAEDRLSSGSDSSAVIDDN----CPQLIDSGDSY-  231

Query  1074  NLHNIDYeeeeeDMDHHVCNSTPHAQTTTDDD  1169
                NI+Y +         C++ P+     DDD
Sbjct  232   -FPNIEYPQ---------CSNLPNGLQMEDDD  253



>ref|XP_004141083.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cucumis 
sativus]
Length=285

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 104/161 (65%), Gaps = 7/161 (4%)
 Frame = +3

Query  387  FFFNPSSHA-DVLFLGKA--DPLFPGG-SWSATKMEESLKRRASCMFSGPqsdeeyyeeq  554
            F FNP  +  ++L+LG A  DP   GG +  +  M ES K R    F  P    +     
Sbjct  6    FLFNPPPYGGNMLYLGGAGGDPCLRGGRTMMSMTMNESPKGRP--FFRSPDDLYDDEYYD  63

Query  555  s-ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLT  QV +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  64   EFYPEKKRRLTHDQVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKT  123

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKK  854
            KQLERDYD LK+S+D L+S+Y+ I+K+N  LK+EV  L++K
Sbjct  124  KQLERDYDVLKASYDLLVSNYDSIVKENAVLKSEVASLTEK  164



>ref|XP_008443498.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Cucumis melo]
Length=283

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 115/194 (59%), Gaps = 12/194 (6%)
 Frame = +3

Query  387  FFFNPSSHA-DVLFLGKA--DPLFPGG-SWSATKMEESLKRRASCMFSGPqsdeeyyeeq  554
            F FNP  +  ++L+LG A  DP   GG +  +  M ES K R    F  P    +     
Sbjct  6    FLFNPPPYGGNMLYLGGAGGDPCLRGGRTMMSMSMNESPKGRP--FFRSPDDLYDDEYYD  63

Query  555  s-ssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKA  731
                +KKRRLT  QV +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK 
Sbjct  64   EFYPEKKRRLTHDQVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKT  123

Query  732  KQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPP  911
            KQLERDYD LK+S+D L+S+Y+ I+K+N  LK+EV  L++K     KE+D    G+   P
Sbjct  124  KQLERDYDVLKASYDSLVSNYDAIVKENAVLKSEVASLTEKCL--AKELDG---GEATIP  178

Query  912  SRMKAEKKCDFTRI  953
            S        D T I
Sbjct  179  SITSELLLADITNI  192



>ref|XP_008390979.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
HAT5-like [Malus domestica]
Length=353

 Score =   137 bits (345),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 108/171 (63%), Gaps = 12/171 (7%)
 Frame = +3

Query  387  FFFNPSSHADV---------LFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdee  539
            FFF PS  + V         LFLG  D +F G       M++   RR     S    DE 
Sbjct  7    FFFEPSPSSAVCQPGGGGNMLFLGNPDHVFRGPRSMMGLMDQESSRRRPFFSSSSSQDEL  66

Query  540  yyee---qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQN  710
            + EE   +   +KKRRLT  QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQN
Sbjct  67   FDEEYYDEQLPEKKRRLTPDQVHMLEKSFETENKLELERKTQLAKKLGLQPRQVAVWFQN  126

Query  711  RRARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            RRARWK KQLERDYD LKSS+D LLS Y+ ILK+NQKLK++V  ++KKL G
Sbjct  127  RRARWKTKQLERDYDLLKSSYDTLLSDYDSILKENQKLKSQVVSINKKLGG  177



>gb|AAK84887.1|AF402606_1 homeodomain leucine zipper protein HDZ3 [Phaseolus vulgaris]
Length=224

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KK RL+S+QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  6    KKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  65

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            D+D LKSS+D LLS Y+ ++K N+KLK+EV  L++KL+   KEV
Sbjct  66   DFDVLKSSYDTLLSSYDSLMKDNEKLKSEVVSLNEKLQDQAKEV  109



>ref|XP_008348031.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Malus domestica]
Length=336

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 87/123 (71%), Gaps = 9/123 (7%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  79   KKRRLTSDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  138

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG---------NCKEVDDDDEGK  899
            DYD LKSS+D LLS Y+ ILK+NQKLK++V  +++KL G              DD D+ K
Sbjct  139  DYDLLKSSYDTLLSDYDSILKENQKLKSQVVSINEKLGGKEQASSTKATAFAADDHDDEK  198

Query  900  NAP  908
              P
Sbjct  199  RGP  201



>gb|AFJ23867.1| HB-1 [Malus domestica]
Length=336

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 87/123 (71%), Gaps = 9/123 (7%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  79   KKRRLTSDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  138

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG---------NCKEVDDDDEGK  899
            DYD LKSS+D LLS Y+ ILK+NQKLK++V  +++KL G              DD D+ K
Sbjct  139  DYDLLKSSYDTLLSDYDSILKENQKLKSQVVSINEKLGGKEQASSTKATAFAADDHDDEK  198

Query  900  NAP  908
              P
Sbjct  199  RGP  201



>ref|XP_010928609.1| PREDICTED: homeobox-leucine zipper protein HOX16-like isoform 
X2 [Elaeis guineensis]
Length=241

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = +3

Query  387  FFFNPSS--HADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqss  560
              F+ SS  H  +L LG   P+F G   S   MEE   +R     S  +  EE Y ++  
Sbjct  6    LIFDSSSSHHGRMLLLGGGSPIFQGAR-SVLGMEEGANKRRLFFTSPDELLEEEYYDEQL  64

Query  561  sdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQL
Sbjct  65   PEKKRRLTPEQVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQL  124

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAE  833
            ERD+D LKSS+D LL+ ++ +LK N +L+++
Sbjct  125  ERDFDRLKSSYDSLLADHDSLLKDNDRLRSQ  155



>ref|NP_001280808.1| homeobox-leucine zipper protein HAT5 [Malus domestica]
 gb|AHA53962.1| homeobox-leucine zipper protein [Malus domestica]
Length=331

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 115/193 (60%), Gaps = 23/193 (12%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT  QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  76    KKRRLTPDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  135

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG----------NCKEVDDDDEG  896
             DYD LKSS+D LLS+Y+ ILK+NQKLK++V  +++KL G               D DDE 
Sbjct  136   DYDLLKSSYDTLLSNYDSILKENQKLKSQVVSINEKLGGKEEANSTKAATFAGADHDDE-  194

Query  897   KNAP--PSRMKAEKKCDFTRIHSS--IGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGN  1064
             K  P  P+  +  +    T +  S  I   D++     G+     ++D         SG+
Sbjct  195   KRGPLLPAGDQMTEVVPITSLQHSCTIKAEDRLSSGSGGS----AVVDEAEGAQPVDSGD  250

Query  1065  TY---NNLHNIDY  1094
             +Y   NN+HN DY
Sbjct  251   SYNFPNNIHN-DY  262



>ref|XP_011028710.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Populus 
euphratica]
 ref|XP_011028711.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Populus 
euphratica]
Length=314

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LERSF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  86   KKRRLTVDQVQFLERSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DYD L+SS++ L + Y+ +LK+ +KLKAEVNLL+ KL     E    E+ D D     PP
Sbjct  146  DYDVLQSSYNSLKAGYDDLLKEKEKLKAEVNLLTDKLLLKEKEKGSSELSDKDAFSQEPP  205

Query  912  SRMKAE  929
             R  A+
Sbjct  206  KRAIAD  211



>ref|XP_007215782.1| hypothetical protein PRUPE_ppa009747mg [Prunus persica]
 gb|EMJ16981.1| hypothetical protein PRUPE_ppa009747mg [Prunus persica]
Length=279

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  37   KKRRLTPDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  96

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            DYD LKSS+D LLS+Y+ ILK+N KLK+EV  +++KLE
Sbjct  97   DYDLLKSSYDSLLSNYDSILKENHKLKSEVVSINQKLE  134



>gb|AAA32816.1| homeobox protein, partial [Arabidopsis thaliana]
Length=100

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  5    KKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  64

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKK  854
            DYD LKS++D LLS+Y+ I+  N KL++EV  L++K
Sbjct  65   DYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEK  100



>ref|XP_006408508.1| hypothetical protein EUTSA_v10022235mg [Eutrema salsugineum]
 gb|ESQ49961.1| hypothetical protein EUTSA_v10022235mg [Eutrema salsugineum]
Length=239

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 122/214 (57%), Gaps = 23/214 (11%)
 Frame = +3

Query  477   MEESLKRRASCMFSGPqsdeeyye-eqsssdKKRRLTSQQVDVLERSFSGEKKVEAERRK  653
             M+E+ KRR    FS P+   E    +    +KKRRLT++QV +LE+SF  E K+E ER+ 
Sbjct  1     MDETSKRRP--FFSSPEDLYEEEYYDDQMPEKKRRLTTEQVHLLEKSFEKENKLEPERKT  58

Query  654   ELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAE  833
             +LA  LGL PRQVAVWFQNRRARWK KQLERD+D LKS++D LLS+Y+ I+K+N  L+++
Sbjct  59    QLAKKLGLQPRQVAVWFQNRRARWKTKQLERDFDLLKSTYDQLLSNYDSIVKENDLLRSQ  118

Query  834   VNLLSKKLEGNCKEVDDDDEGKNAPPSRMKAEKKCD---FTRIHSSIGHRDKIPEEEYGN  1004
             +  L++KL+         +E    PP ++    + D     R   +I   D++     G+
Sbjct  119   MASLAEKLQAK-------EEAAIEPPGQVPEPNQLDPLNINRFEPAIKTEDRLSSGSVGS  171

Query  1005  -------PKQELLMDNYYYYCV---CGSGNTYNN  1076
                    P+     D+Y+   V       N YNN
Sbjct  172   AVLDEDAPQLLDSCDSYFPIIVPIHSEDDNNYNN  205



>ref|XP_002321530.2| hypothetical protein POPTR_0015s07640g [Populus trichocarpa]
 gb|ABK95823.1| unknown [Populus trichocarpa]
 gb|EEF05657.2| hypothetical protein POPTR_0015s07640g [Populus trichocarpa]
Length=314

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  86   KKRRLTVDQVQFLEKSFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DYD L+SS++ L + Y+ +LK+ +KLKAEVNLL+ KL     E    E+ D D     PP
Sbjct  146  DYDVLQSSYNSLKADYDNLLKEKEKLKAEVNLLTDKLLLKEKEKGISELSDKDALSQEPP  205

Query  912  SRMKAE  929
             R  A+
Sbjct  206  KRAIAD  211



>gb|KCW52861.1| hypothetical protein EUGRSUZ_J02186 [Eucalyptus grandis]
Length=244

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LE+SF  E K+E E++ +LA  LG+ PRQVAVWFQNRRARWK KQLER
Sbjct  32   KKRRLTPEQVHLLEKSFEVENKLEPEKKTQLAKKLGMQPRQVAVWFQNRRARWKTKQLER  91

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LKSS+D LL  Y+ I K+N+KLK+EVN L++KL
Sbjct  92   DYDVLKSSYDSLLLSYDSIKKENEKLKSEVNFLNEKL  128



>ref|XP_009375094.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Pyrus x bretschneideri]
Length=333

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 143/263 (54%), Gaps = 32/263 (12%)
 Frame = +3

Query  387   FFFNPSSHA--------DVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeey  542
              FF+PS  A        ++LFLG  D +F G       M++   RR     S    DE +
Sbjct  7     LFFDPSPSAVCQQGGGGNMLFLGNPDHVFRGPRSMMGLMDQESSRRRPFFSSSSSQDELF  66

Query  543   yee---qsssdKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNR  713
              EE   +   +KKRRLT  QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQ R
Sbjct  67    DEEYYDEQLPEKKRRLTPDQVHMLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQTR  126

Query  714   RARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK-------  872
             RARWK KQLERDYD LKSS+D LL +Y+ ILK+NQKLK+E+  +++KL G  +       
Sbjct  127   RARWKTKQLERDYDLLKSSYDTLLYNYDSILKENQKLKSEMVSINEKLGGKEEANSTKPA  186

Query  873   --EVDDDDEGKNAP--PSRMKAEKKCDFTRIHSS--IGHRDKIPEEEYGNPKQELLMDNY  1034
                 DD D+ K  P  P+  +  +    T +  S  I   D++     G+     ++D  
Sbjct  187   TFAGDDHDDEKRGPLLPAGDQMTEVVPITSLQHSCTIKAEDRLSSGSGGS----AVVDEA  242

Query  1035  YYYCVCGSGNTY---NNLHNIDY  1094
                    SG++Y   NN+HN DY
Sbjct  243   EGPQPVDSGDSYNFPNNIHN-DY  264



>ref|XP_009415373.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Musa acuminata 
subsp. malaccensis]
Length=287

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 5/151 (3%)
 Frame = +3

Query  417  VLFLGKADPLFPGGSWSATKMEE---SLKRRASCMFSGPqsdeeyyeeqsssdKKRRLTS  587
            +L  G  +P+    S     + E   + KRR    F+ P    E Y E+   +KKRRLTS
Sbjct  20   LLLWGGGNPVLRAVSPVVVGVAEKGGASKRRP--FFTSPDEVYEEYYEEQLPEKKRRLTS  77

Query  588  QQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKS  767
            +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLERD+D+LKS
Sbjct  78   EQVHLLERSFKEENKLEPERKSELAQMLGLQPRQVAVWFQNRRARWKNKQLERDFDQLKS  137

Query  768  SHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            S+D LL  ++ +LK N +L+++++ L++KLE
Sbjct  138  SYDALLFDHDALLKDNHRLRSQLSTLAEKLE  168



>gb|EPS69830.1| hypothetical protein M569_04938, partial [Genlisea aurea]
Length=126

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  + K+E ER+ ELA  LGL PRQVA+WFQNRRARWKAKQLE+
Sbjct  31   KKRRLTAEQVHLLERSFEEDNKLEPERKSELAKGLGLQPRQVAIWFQNRRARWKAKQLEK  90

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKK  854
            DYD+LKSS+  LLS Y  IL QN KLK+E+  L +K
Sbjct  91   DYDDLKSSYHSLLSDYESILLQNGKLKSEIVWLREK  126



>ref|XP_009418017.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +3

Query  417  VLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssdKKRRLTSQQV  596
            +L LG   P+F G   S    E+    +    F+ P    E Y E+   +KKRRLT +Q+
Sbjct  20   LLVLGGGSPIFQGVR-SVVAGEDGGASKRRPFFTSPDEIYEEYYEEQLPEKKRRLTLEQI  78

Query  597  DVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHD  776
             +LERSF  + K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER++D+L+SS+D
Sbjct  79   HLLERSFEEDNKLEPERKSELARKLGLQPRQVAVWFQNRRARWKNKQLEREFDQLRSSYD  138

Query  777  YLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
             LL++++ +LK N +L+++VN L ++L+ 
Sbjct  139  ALLANHDALLKDNDRLRSQVNSLIEQLQA  167



>ref|XP_004142356.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cucumis 
sativus]
Length=273

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 104/166 (63%), Gaps = 12/166 (7%)
 Frame = +3

Query  387  FFFNPS-SHADVLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsss  563
              FN S  HA++LF G +D + P G      MEE+ KRR+   FS P    +        
Sbjct  6    LIFNRSPGHANMLFFGSSDSI-PRGPSFMMGMEETSKRRS--FFSSPDDLFDDDYYDDQP  62

Query  564  -dKKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQL  740
             +KKRRLT +QV +LE SF  E K+E ER+ ELA  LGL PRQ     +NRRARWK KQL
Sbjct  63   PEKKRRLTQEQVHLLEISFESENKLEPERKTELAKKLGLQPRQ-----KNRRARWKTKQL  117

Query  741  ERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            ERDYD LKSS+D   S Y+FI K+N++LKAEV  L++KL+   KEV
Sbjct  118  ERDYDLLKSSYDSFRSSYDFIAKENERLKAEVASLTEKLQ--AKEV  161



>ref|XP_002317992.2| hypothetical protein POPTR_0012s07270g [Populus trichocarpa]
 gb|EEE96212.2| hypothetical protein POPTR_0012s07270g [Populus trichocarpa]
Length=317

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LERSF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  89   KKRRLTVDQVQFLERSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+ L+SS++ L + Y+ + K+ +KLKAEVNLL+ +L     E    E+ D D     PP
Sbjct  149  DYEVLQSSYNGLKADYDNLFKEKEKLKAEVNLLTNELLLKEKEKGSSELSDKDALSQEPP  208

Query  912  SRMKAE  929
             +  A+
Sbjct  209  KKAIAD  214



>ref|XP_011042611.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Populus 
euphratica]
Length=322

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LERSF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  94   KKRRLTVDQVQFLERSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  153

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+ L+SS++ L + Y+ + K+ +KLKAEVNLL+ +L     E    E+ D D     PP
Sbjct  154  DYEVLQSSYNGLKADYDNLFKEKEKLKAEVNLLTSELLLKEKEKGSSELSDKDALSQEPP  213

Query  912  SRMKAE  929
             +  A+
Sbjct  214  KKAIAD  219



>gb|KDP31203.1| hypothetical protein JCGZ_11579 [Jatropha curcas]
Length=309

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  + K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  86   KKRRLTVDQVQFLEKSFEVDNKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-EGNCKEVDDDDEGKNAPPSRM  920
            DY+ L++S + L + Y+ +LK+  KLKAEVNLL++K+ E    E+ D D     PP ++
Sbjct  146  DYEALQTSFNTLKADYDTLLKEKDKLKAEVNLLAEKVKERGDSELSDKDTTSQEPPKKL  204



>ref|XP_008367440.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Malus domestica]
Length=421

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV +LE+SF  + K++ ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  164  KKRRLTLDQVHMLEKSFETDNKLKPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLER  223

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            DYD LKSS+D LLS Y+ I+K+NQKLK++V  +++KL G
Sbjct  224  DYDLLKSSYDTLLSDYDSIIKENQKLKSQVVSINEKLGG  262



>ref|XP_004973433.1| PREDICTED: homeobox-leucine zipper protein HOX5-like [Setaria 
italica]
Length=280

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  83   KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK+++D L + +  +L  N  L+A+V  L++KL           +GK   PS   A
Sbjct  143  DYDRLKAAYDALAADHQGLLADNDSLRAQVVTLTEKL-----------QGKETSPSATNA  191

Query  927  EKKCDFTRIHSSIGHRDKI  983
             ++ D    H++    +K+
Sbjct  192  AQEADDLDEHTAASGTEKL  210



>ref|XP_010235125.1| PREDICTED: homeobox-leucine zipper protein HOX5-like [Brachypodium 
distachyon]
Length=305

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 90/132 (68%), Gaps = 10/132 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE+
Sbjct  76   KKRRLTAEQVQMLERSFGEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKNKQLEQ  135

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN----------CKEVDDDDEG  896
            D+D LK+++D L + ++ +L  N +L+A+V  L+ KLEGN           +EVD  D+ 
Sbjct  136  DFDRLKAAYDALAADHHGLLSDNDRLRAQVISLTDKLEGNETSPSATATMAQEVDQPDDH  195

Query  897  KNAPPSRMKAEK  932
                 + + A++
Sbjct  196  TVGATATVPAQQ  207



>gb|ACF82904.1| unknown [Zea mays]
 gb|AIB05225.1| HB transcription factor, partial [Zea mays]
Length=272

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 100/170 (59%), Gaps = 19/170 (11%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  77    KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  136

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
             DYD LK+++D L + +  +L  N  L+A+V  L++KL           +GK   PS   A
Sbjct  137   DYDRLKAAYDALAADHQGLLADNDNLRAQVISLTEKL-----------QGKETYPSATTA  185

Query  927   EKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNN  1076
              ++ D    H+++   +++  ++        L DN +    C    T ++
Sbjct  186   AQEVDQPDEHTAVSGTEELLAQQ--------LKDNLHSSGDCTGHGTLSS  227



>gb|ACG38607.1| homeodomain leucine zipper protein CPHB-5 [Zea mays]
Length=270

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 9/155 (6%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  77    KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  136

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN---------CKEVDDDDEGK  899
             DYD LK++++ L + +  +L  N  L+A+V  L++KL+G           +EVD  +E  
Sbjct  137   DYDRLKAAYNALAADHQGLLADNDSLRAQVICLTEKLQGKETSLSATIAAQEVDQPNEHT  196

Query  900   NAPPSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGN  1004
                   +  + K D        GH     EEE G 
Sbjct  197   TGTEKXLAQQLKDDLHSSCGCTGHGALSSEEEDGG  231



>ref|NP_001146068.1| putative homeobox DNA-binding and leucine zipper domain family 
protein [Zea mays]
 gb|ACL53148.1| unknown [Zea mays]
 tpg|DAA49126.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
 gb|AIB05101.1| HB transcription factor, partial [Zea mays]
Length=270

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 9/155 (6%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  77    KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  136

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN---------CKEVDDDDEGK  899
             DYD LK++++ L + +  +L  N  L+A+V  L++KL+G           +EVD  +E  
Sbjct  137   DYDRLKAAYNALAADHQGLLADNDSLRAQVICLTEKLQGKETSLSATIAAQEVDQPNEHT  196

Query  900   NAPPSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGN  1004
                   +  + K D        GH     EEE G 
Sbjct  197   TGTEKLLAQQLKDDLHSSCGCTGHGALSSEEEDGG  231



>ref|NP_001148520.1| homeodomain leucine zipper protein CPHB-5 [Zea mays]
 gb|ACG31819.1| homeodomain leucine zipper protein CPHB-5 [Zea mays]
 gb|AFW62174.1| putative homeobox DNA-binding and leucine zipper domain family 
protein [Zea mays]
Length=272

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 100/170 (59%), Gaps = 19/170 (11%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  77    KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  136

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
             DYD LK+++D L + +  +L  N  L+A+V  L++KL           +GK   PS   A
Sbjct  137   DYDRLKAAYDALAADHQGLLADNDNLRAQVISLTEKL-----------QGKETYPSATTA  185

Query  927   EKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNN  1076
              ++ D    H+++   +++  ++        L DN +    C    T ++
Sbjct  186   AQEVDQPDEHTAVSGTEELLAQQ--------LKDNLHSSGDCTGHGTLSS  227



>ref|NP_001238458.1| homeodomain-leucine zipper protein 57 [Glycine max]
 gb|AAF01765.1|AF184278_1 homeodomain-leucine zipper protein 57 [Glycine max]
Length=288

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  29   KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  88

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP  908
            DY  LK+S+D L S Y  ++++N KLKAEVN L  KL    KE +++ + K++P
Sbjct  89   DYGVLKASYDRLKSDYESLVQENDKLKAEVNSLESKLILRDKEKEENSDDKSSP  142



>ref|XP_009391261.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 4/144 (3%)
 Frame = +3

Query  435  ADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssd--KKRRLTSQQVDVLE  608
            + P+F G   +    E + KRR    F+ P+   E           KKRRL+ +QV +LE
Sbjct  32   SSPVFGGARSALAAAEGANKRRP--FFTSPEELLEEEYYYDEQQPDKKRRLSPEQVRLLE  89

Query  609  RSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHDYLLS  788
            RSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLE D+D LKSS+  LLS
Sbjct  90   RSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQLEHDFDRLKSSYGSLLS  149

Query  789  HYNFILKQNQKLKAEVNLLSKKLE  860
             ++ +LK+N +L+++V  L++KL+
Sbjct  150  DHDSLLKENDRLRSQVISLTEKLQ  173



>ref|XP_006574472.1| PREDICTED: homeodomain-leucine zipper protein 57 isoform X1 [Glycine 
max]
 gb|KHN28720.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=345

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  86   KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP  908
            DY  LK+S+D L S Y  ++++N KLKAEVN L  KL    KE +++ + K++P
Sbjct  146  DYGVLKASYDRLKSDYESLVQENDKLKAEVNSLESKLILRDKEKEENSDDKSSP  199



>ref|XP_010112600.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
 gb|EXC34235.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
Length=325

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  98   KKRRLSVEQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  157

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNA------P  908
            DYD L+++H+ L   Y  + K+  KLKAEV++LS+KL+   KE ++ +  +N+      P
Sbjct  158  DYDVLQATHNTLKDDYESLRKETDKLKAEVHVLSEKLQEREKEKENLELSENSNKLSQEP  217

Query  909  PSRMKAEKKCDFTRIHS  959
            P +  A+ + + +++ +
Sbjct  218  PEKPIADSEGEVSKVSA  234



>ref|XP_009417556.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Musa acuminata 
subsp. malaccensis]
Length=263

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 103/168 (61%), Gaps = 6/168 (4%)
 Frame = +3

Query  417  VLFLGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyye--eqsssdKKRRLTSQ  590
            +L  G   P+F GG+ SA   E + KRR    F+ P    E     ++   +KKRRL   
Sbjct  23   LLGSGGVSPVF-GGAISALA-EGANKRRP--FFTSPDEILEEEYYYDEQLPEKKRRLMPD  78

Query  591  QVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSS  770
            QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLE D+D LKSS
Sbjct  79   QVHLLERSFEAENKLEPERKSELARKLGLQPRQVAVWFQNRRARWKTKQLEHDFDRLKSS  138

Query  771  HDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPS  914
            ++ LLS ++ +LK+N  L+++V  L++KL+     +       N P S
Sbjct  139  YNSLLSDHDSLLKENDGLRSQVISLTEKLQSKAAALMAAAASVNDPAS  186



>gb|ADE76802.1| unknown [Picea sitchensis]
Length=328

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LERSF  E K+E ER+ +LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  82   KKRRLTADQVQFLERSFEIENKLEPERKIQLAKDLGLQPRQVAVWFQNRRARWKTKQLER  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LKS ++ L   Y+ +LK+  KL+AEV  L+ KL
Sbjct  142  DYDILKSRYENLRVDYDSLLKEKDKLRAEVTFLTGKL  178



>ref|XP_004953794.1| PREDICTED: homeobox-leucine zipper protein HOX16-like isoform 
X2 [Setaria italica]
Length=287

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  35   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  94

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDD  884
            D+D LK S D L + ++ +L+ N +L+++V  L++KL+   KEV D
Sbjct  95   DFDRLKDSFDALRADHDVLLQDNHRLRSQVASLTEKLQE--KEVTD  138



>ref|NP_001175810.1| Os09g0379600 [Oryza sativa Japonica Group]
 dbj|BAH94538.1| Os09g0379600 [Oryza sativa Japonica Group]
Length=286

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE
Sbjct  48   RKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKTKQLE  107

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMK  923
             D+D L+++HD LL+    +   N+ L+++V LL++KL+ N         GK+  PS   
Sbjct  108  LDFDRLRAAHDELLAGRTALAADNESLRSQVILLTEKLQAN---------GKSPSPSPAP  158

Query  924  AEKKC  938
            AE+  
Sbjct  159  AEQTA  163



>ref|XP_009399661.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Musa acuminata 
subsp. malaccensis]
Length=285

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  72   KKRRLTPEQVHLLERSFEAENKLEPERKGELARKLGMQPRQVAVWFQNRRARWKNKQLEH  131

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN  866
            D+D LKSS++ LL+ ++ +L++N +L+++V  L++KL+ N
Sbjct  132  DFDRLKSSYNTLLADHDSLLRENDRLRSQVISLTEKLQIN  171



>ref|XP_002511518.1| homeobox protein, putative [Ricinus communis]
 gb|EEF52120.1| homeobox protein, putative [Ricinus communis]
Length=319

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  91   KKRRLTVDQVQFLEKSFEVENKLEPERKLQLAKDLGLQPRQVAIWFQNRRARWKTKQMEK  150

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD L++S++ L + Y+ +L++  +LKAEVNLL+ KL
Sbjct  151  DYDVLQTSYNSLKADYDALLQEKDRLKAEVNLLTDKL  187



>ref|XP_003517924.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
 gb|KHN01166.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=345

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  86   KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP  908
            DY  LK+S+D L   Y  ++++N KLKAEVN L  KL    KE +++ + K++P
Sbjct  146  DYGVLKASYDRLKGDYESLVQENDKLKAEVNSLESKLILRDKEKEENSDDKSSP  199



>ref|XP_004953793.1| PREDICTED: homeobox-leucine zipper protein HOX16-like isoform 
X1 [Setaria italica]
Length=324

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  72   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  131

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDD  884
            D+D LK S D L + ++ +L+ N +L+++V  L++KL+   KEV D
Sbjct  132  DFDRLKDSFDALRADHDVLLQDNHRLRSQVASLTEKLQE--KEVTD  175



>sp|A3BYC1.2|HOX25_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX25; AltName: 
Full=HD-ZIP protein HOX25; AltName: Full=Homeodomain transcription 
factor HOX25; AltName: Full=OsHox25 [Oryza sativa Japonica 
Group]
Length=320

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE
Sbjct  82   RKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKTKQLE  141

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMK  923
             D+D L+++HD LL+    +   N+ L+++V LL++KL+ N         GK+  PS   
Sbjct  142  LDFDRLRAAHDELLAGRTALAADNESLRSQVILLTEKLQAN---------GKSPSPSPAP  192

Query  924  AEKKC  938
            AE+  
Sbjct  193  AEQTA  197



>ref|XP_009408831.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV+ LE++F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWKAKQLE+
Sbjct  77   KKRRLTADQVEFLEKNFEVENKLEPERKLQLAKDLGLKPRQVAIWFQNRRARWKAKQLEK  136

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
             Y+ LKSS+D L   ++ +LK+N+KL+AEV LL+ KL
Sbjct  137  GYESLKSSYDSLKLDHDNLLKENEKLQAEVVLLTNKL  173



>ref|XP_007157405.1| hypothetical protein PHAVU_002G067200g [Phaseolus vulgaris]
 gb|AAK84886.1|AF402605_1 homeodomain leucine zipper protein HDZ2 [Phaseolus vulgaris]
 gb|ESW29399.1| hypothetical protein PHAVU_002G067200g [Phaseolus vulgaris]
Length=327

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  86   KKRRLTSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP  908
            DY  LK+S+D L   Y  +L++N KLKAEVN L  KL    KE ++ D+ K++P
Sbjct  146  DYGTLKASYDRLKGDYESLLQENDKLKAEVNSLESKLILRDKEKENSDD-KSSP  198



>gb|KGN52379.1| hypothetical protein Csa_5G630820 [Cucumis sativus]
Length=211

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = +3

Query  594  VDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSH  773
            V +LE SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLERDYD LKSS+
Sbjct  7    VHLLEISFESENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSY  66

Query  774  DYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            D   S Y+FI K+N++LKAEV  L++KL+   KEV
Sbjct  67   DSFRSSYDFIAKENERLKAEVASLTEKLQA--KEV  99



>ref|NP_001130421.1| uncharacterized protein LOC100191517 [Zea mays]
 gb|ACF78621.1| unknown [Zea mays]
 gb|ACF84227.1| unknown [Zea mays]
 gb|ACR36802.1| unknown [Zea mays]
Length=290

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  34   KKRRLTPEQVLLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  93

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL+
Sbjct  94   DFDRLKASFDALRADHDALLQDNNRLRSQVVSLTEKLQ  131



>gb|ABL63115.1| DNA-binding protein [Catharanthus roseus]
Length=282

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  41   KKRRLTADQVQFLEKSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARYKTKQLEK  100

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +YD LKSS D L + Y+ + K+N+KLK EV LL++KL
Sbjct  101  EYDSLKSSFDKLNADYDSLFKENEKLKNEVKLLTEKL  137



>ref|XP_006367068.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Solanum 
tuberosum]
Length=328

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  90   KKRRLTDNQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEK  149

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL---EGNCKEVDDDDEGKNA  905
            DYDEL++ +D L S+YN +LK+ + L+ EV  L+ KL   E    ++D  DE K++
Sbjct  150  DYDELRNRYDALKSNYNNLLKEKEDLRTEVFHLTDKLFVKEKGNGQIDLRDENKHS  205



>ref|XP_006661183.1| PREDICTED: homeobox-leucine zipper protein HOX25-like [Oryza 
brachyantha]
Length=331

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +3

Query  570  KRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQL+ 
Sbjct  95   KRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKTKQLKL  154

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPS  914
            D+D L+++HD LL+  + +L  N+ L+++V LL++KL+ N K        + A P+
Sbjct  155  DFDRLRAAHDELLAGRDALLADNESLRSQVILLTEKLQANGKSPSPAPANQTAVPT  210



>pir||B44088 homeotic protein HAT5 - Arabidopsis thaliana (fragments)
Length=116

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 17/113 (15%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNR-----------  713
            KKRRLT++QV +LE+SF  E K+E ER+ +LA  LGL PRQVAVWFQNR           
Sbjct  4    KKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQQVA  63

Query  714  ------RARWKAKQLERDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKK  854
                  RARWK KQLERDYD LKS++D LLS+Y+ I+  N KL++EV  L++K
Sbjct  64   VWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSLTEK  116



>gb|ACN31143.1| unknown [Zea mays]
 gb|ACN31228.1| unknown [Zea mays]
 gb|ACR36939.1| unknown [Zea mays]
Length=330

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  74   KKRRLTPEQVLLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  133

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL+
Sbjct  134  DFDRLKASFDALRADHDALLQDNNRLRSQVVSLTEKLQ  171



>ref|XP_006659398.1| PREDICTED: homeobox-leucine zipper protein HOX5-like [Oryza brachyantha]
Length=341

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  81   KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEH  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+++D L + +  +L  N +L+A+V  L++KL+
Sbjct  141  DFDRLKAAYDALAADHQVLLSDNDRLRAQVISLTEKLQ  178



>gb|ACG33646.1| homeodomain leucine zipper protein CPHB-5 [Zea mays]
 gb|ACG34067.1| homeodomain leucine zipper protein CPHB-5 [Zea mays]
Length=331

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  74   KKRRLTPEQVLLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  133

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL+
Sbjct  134  DFDRLKASFDALRADHDALLQDNNRLRSQVVSLTEKLQ  171



>gb|EMT01252.1| hypothetical protein F775_52266 [Aegilops tauschii]
Length=296

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWKAKQLE
Sbjct  76   RKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKAKQLE  135

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            +D+D L+++HD LL+  + +L  N +L+++V  L++KL+
Sbjct  136  QDFDALRAAHDELLAGRDALLADNHRLRSQVTSLTEKLQ  174



>ref|XP_009369353.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Pyrus x 
bretschneideri]
Length=324

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  89   KKRRLTADQVQFLEKSFDVENKLEPERKVLLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+EL+++++ L +    + K+N KLKAEV +LS KL     EG   E+ D +     PP
Sbjct  149  DYEELQANYNNLKADCESLSKENDKLKAEVTVLSDKLHLKEKEGGNSELSDTNRLSQEPP  208

Query  912  SRMKAE  929
             +  A+
Sbjct  209  QKPIAD  214



>emb|CAA64417.1| homeobox [Solanum lycopersicum]
Length=323

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  90   KKRRLTDNQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEK  149

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYDEL++ +D L S+YN +LK+ + L+ EV  L+ KL
Sbjct  150  DYDELRNRYDTLKSNYNNLLKEKEDLRTEVFRLTGKL  186



>ref|NP_001234250.2| homeobox [Solanum lycopersicum]
Length=324

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  91   KKRRLTDNQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEK  150

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYDEL++ +D L S+YN +LK+ + L+ EV  L+ KL
Sbjct  151  DYDELRNRYDTLKSNYNNLLKEKEDLRTEVFRLTGKL  187



>ref|XP_008677601.1| PREDICTED: uncharacterized protein LOC100383369 isoform X1 [Zea 
mays]
 gb|AFW63783.1| putative homeobox DNA-binding and leucine zipper domain family 
protein isoform 1 [Zea mays]
 gb|AFW63784.1| putative homeobox DNA-binding and leucine zipper domain family 
protein isoform 2 [Zea mays]
Length=299

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  34   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  93

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL
Sbjct  94   DFDRLKASFDALRADHDALLQDNHRLRSQVVSLTEKL  130



>gb|KHG19587.1| Homeobox-leucine zipper HAT5 -like protein [Gossypium arboreum]
Length=287

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 85/135 (63%), Gaps = 8/135 (6%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  96   KKRRLTVDQVQFLEKSFEVENKLEPERKTQLAKELGLQPRQVAIWFQNRRARWKTKQLEK  155

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL---EGNCKEVDDDDEGKNAPPSR  917
            DYD L++S + L + Y  +LK+  KLK EV  L+ KL   E N  E+ D +     PP  
Sbjct  156  DYDTLQASFNTLKADYGNLLKEKDKLKQEVLQLTDKLVMKEKNNSELSDVNTVCQEPP--  213

Query  918  MKAEKKCDFTRIHSS  962
               +K  D    HSS
Sbjct  214  ---QKPVDSDSPHSS  225



>ref|NP_001048008.1| Os02g0729700 [Oryza sativa Japonica Group]
 sp|Q6YWR4.1|HOX16_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX16; AltName: 
Full=HD-ZIP protein HOX16; AltName: Full=Homeodomain transcription 
factor HOX16; AltName: Full=OsHox16 [Oryza sativa Japonica 
Group]
 dbj|BAD15915.1| putative homeodomain leucine zipper protein [Oryza sativa Japonica 
Group]
 dbj|BAD16354.1| putative homeodomain leucine zipper protein [Oryza sativa Japonica 
Group]
 dbj|BAF09922.1| Os02g0729700 [Oryza sativa Japonica Group]
 gb|EAZ24491.1| hypothetical protein OsJ_08251 [Oryza sativa Japonica Group]
 dbj|BAG99707.1| unnamed protein product [Oryza sativa Japonica Group]
Length=343

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  77   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  136

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L ++V  L++KL+
Sbjct  137  DFDRLKASFDALRADHDALLQDNHRLHSQVMSLTEKLQ  174



>sp|A2X980.1|HOX16_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX16; AltName: 
Full=HD-ZIP protein HOX16; AltName: Full=Homeodomain transcription 
factor HOX16; AltName: Full=OsHox16 [Oryza sativa Indica 
Group]
 gb|EAY87390.1| hypothetical protein OsI_08797 [Oryza sativa Indica Group]
Length=345

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  79   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  138

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L ++V  L++KL+
Sbjct  139  DFDRLKASFDALRADHDALLQDNHRLHSQVMSLTEKLQ  176



>ref|NP_001169496.1| uncharacterized protein LOC100383369 [Zea mays]
 gb|ACN33914.1| unknown [Zea mays]
 gb|AIB05066.1| HB transcription factor, partial [Zea mays]
Length=339

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  74   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  133

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL
Sbjct  134  DFDRLKASFDALRADHDALLQDNHRLRSQVVSLTEKL  170



>gb|AFW63782.1| putative homeobox DNA-binding and leucine zipper domain family 
protein [Zea mays]
Length=339

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  74   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  133

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            D+D LK+S D L + ++ +L+ N +L+++V  L++KL
Sbjct  134  DFDRLKASFDALRADHDALLQDNHRLRSQVVSLTEKL  170



>ref|XP_010238133.1| PREDICTED: homeobox-leucine zipper protein HOX25-like [Brachypodium 
distachyon]
Length=308

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (80%), Gaps = 1/98 (1%)
 Frame = +3

Query  570  KRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWKAKQLER
Sbjct  87   KRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGMAPRQVAVWFQNRRARWKAKQLER  146

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D L+++HD+LL+  + +L  N  L+++V  L+++L+
Sbjct  147  DFDALRAAHDHLLASRDALLADNDSLRSQVISLTEELQ  184



>ref|NP_001061807.1| Os08g0416000 [Oryza sativa Japonica Group]
 sp|Q6ZA74.1|HOX5_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX5; AltName: 
Full=HD-ZIP protein HOX5; AltName: Full=Homeodomain transcription 
factor HOX5; AltName: Full=OsHox5 [Oryza sativa Japonica 
Group]
 dbj|BAC98578.1| homeodomain leucine zipper protein [Oryza sativa Japonica Group]
 dbj|BAF23721.1| Os08g0416000 [Oryza sativa Japonica Group]
 gb|EAZ42740.1| hypothetical protein OsJ_27319 [Oryza sativa Japonica Group]
Length=349

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  86   KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEH  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+++D L + ++ +L  N +L+A+V  L++KL+
Sbjct  146  DFDRLKAAYDALAADHHALLSDNDRLRAQVISLTEKLQ  183



>sp|Q9XH36.1|HOX5_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX5; AltName: 
Full=HD-ZIP protein HOX5; AltName: Full=Homeodomain transcription 
factor HOX5; AltName: Full=OsHox5 [Oryza sativa Indica 
Group]
 gb|AAD37698.1|AF145729_1 homeodomain leucine zipper protein [Oryza sativa Indica Group]
 gb|EAZ06995.1| hypothetical protein OsI_29241 [Oryza sativa Indica Group]
Length=350

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  86   KKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEH  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+++D L + ++ +L  N +L+A+V  L++KL+
Sbjct  146  DFDRLKAAYDALAADHHALLSDNDRLRAQVISLTEKLQ  183



>ref|XP_006842102.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda]
 gb|ERN03777.1| hypothetical protein AMTR_s00078p00085160 [Amborella trichopoda]
Length=305

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 94/159 (59%), Gaps = 10/159 (6%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL+  QV  LE++F  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  70    KKRRLSPDQVQFLEKNFEVENKLEPERKIQLARELGLQPRQVAIWFQNRRARWKTKQLEK  129

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
             DY  LKSS+D L + Y  +LK+ +KLK EV LL+ KL    KE D      N P    K 
Sbjct  130   DYGVLKSSYDALKADYENLLKEKEKLKTEVVLLTDKLLS--KERDCQVPATNWP---EKL  184

Query  927   EKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYY  1043
             E KC  T    ++   D +      N KQE L  N   +
Sbjct  185   ELKCQTTPKTETVKDSDLL-----LNCKQEDLSSNSSVF  218



>gb|KDO76041.1| hypothetical protein CISIN_1g019954mg [Citrus sinensis]
Length=278

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  41   KKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  100

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L++S++ L + Y+ + K+ +KLKAEV  L+ KL+   KE
Sbjct  101  DYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKE  143



>gb|KDO76039.1| hypothetical protein CISIN_1g019954mg [Citrus sinensis]
 gb|KDO76040.1| hypothetical protein CISIN_1g019954mg [Citrus sinensis]
Length=289

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  52   KKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  111

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L++S++ L + Y+ + K+ +KLKAEV  L+ KL+   KE
Sbjct  112  DYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKE  154



>emb|CDP14863.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+ ELA  LGL PRQ+AVWFQNRRARWK KQLE+
Sbjct  96   KKRRLTADQVLFLEKSFEDENKLEPERKAELAKELGLQPRQIAVWFQNRRARWKTKQLEK  155

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L++S+D L + Y+ +LK+ ++LKAEV  +++KL
Sbjct  156  DYETLQASYDKLKADYDNLLKEKEQLKAEVVHITEKL  192



>gb|ABR16224.1| unknown [Picea sitchensis]
Length=327

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ QV  LE+SF  + K+E ER+ +LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  71   KKRRLSADQVHFLEKSFEVDNKLEPERKTQLARDLGLQPRQVAVWFQNRRARWKTKQLER  130

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +YD LKSS+D L   Y+ +LK+ +KL++EV  L+ KL
Sbjct  131  EYDILKSSYDTLRVDYDNLLKEKEKLRSEVICLTDKL  167



>ref|XP_003524980.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
Length=331

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 16/150 (11%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  83   KKRRLSASQVQFLEKSFEEENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWKNKQLEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL------EGNCKEVDDDDE-----  893
            DY+ L +S + L S+Y+ +LK+  KLKAEV  L++K+      EG+ K+ + + E     
Sbjct  143  DYETLHASFESLKSNYDCLLKEKDKLKAEVASLTEKVLARGKQEGHMKQAESESEETKGL  202

Query  894  ---GKNAPPSR--MKAEKKCDFTRIHSSIG  968
                +  PP R  +++  + + +++ S +G
Sbjct  203  LHLQEQEPPQRLLLQSVSEGEGSKVSSVVG  232



>gb|KHN48659.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=331

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 16/150 (11%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  83   KKRRLSASQVQFLEKSFEEENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWKNKQLEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL------EGNCKEVDDDDE-----  893
            DY+ L +S + L S+Y+ +LK+  KLKAEV  L++K+      EG+ K+ + + E     
Sbjct  143  DYETLHASFESLKSNYDCLLKEKDKLKAEVASLTEKVLARGKQEGHMKQAESESEETKGL  202

Query  894  ---GKNAPPSR--MKAEKKCDFTRIHSSIG  968
                +  PP R  +++  + + +++ S +G
Sbjct  203  LHLQEQEPPQRLLLQSVSEGEGSKVSSVVG  232



>dbj|BAJ95209.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK K LER
Sbjct  72   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLER  131

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++K++
Sbjct  132  DFDRLKASFDALRADHDALLQDNHRLRSQVVTLTEKMQ  169



>gb|AAS83417.1| Hox16 [Oryza sativa Japonica Group]
Length=353

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  32   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  91

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L ++V  L++KL+
Sbjct  92   DFDRLKASFDALRADHDALLQDNHRLHSQVMSLTEKLQ  129



>ref|XP_010915101.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Elaeis 
guineensis]
Length=305

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LERSF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  82   KKRRLTADQVQFLERSFELENKLEPERKVQLARDLGLQPRQVAIWFQNRRARWKTKQLEK  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+D L + Y+ +L + +KL+AEV  L+ K+
Sbjct  142  DYEALRSSYDALKTDYDNLLDEKEKLQAEVLSLTNKV  178



>gb|AAS68137.1| homeodomain leucine zipper protein 16 [Oryza sativa Japonica 
Group]
Length=353

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  32   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLER  91

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L ++V  L++KL+
Sbjct  92   DFDRLKASFDALRADHDALLQDNHRLHSQVMSLTEKLQ  129



>gb|EMT21095.1| Homeobox-leucine zipper protein HOX16 [Aegilops tauschii]
Length=340

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK K LER
Sbjct  76   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLER  135

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++K++
Sbjct  136  DFDRLKASFDALRADHDALLQDNHRLRSQVVTLTEKMQ  173



>gb|KDO76038.1| hypothetical protein CISIN_1g019954mg [Citrus sinensis]
Length=333

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  96   KKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  155

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L++S++ L + Y+ + K+ +KLKAEV  L+ KL+   KE
Sbjct  156  DYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKE  198



>ref|XP_010096332.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
 gb|EXB63807.1| Homeobox-leucine zipper protein HAT5 [Morus notabilis]
Length=292

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV+ LE++F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  56   KKRRLTANQVEFLEKNFDRENKLEPERKIQLAKELGLEPRQVAIWFQNRRARYKTKQLEK  115

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S+D L   Y+ +LK+++ LK EVN L +KL
Sbjct  116  DYDALKASYDSLKCDYDNLLKESETLKNEVNSLKEKL  152



>ref|XP_006476659.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Citrus 
sinensis]
Length=339

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  102  KKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  161

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L++S++ L + Y+ + K+ +KLKAEV  L+ KL+   KE
Sbjct  162  DYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKE  204



>gb|AFW62173.1| putative homeobox DNA-binding and leucine zipper domain family 
protein [Zea mays]
Length=154

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV +LERSF  E K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE 
Sbjct  63   KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLET  122

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEV  836
            DYD LK+++D L + +  +L  N  L+A+V
Sbjct  123  DYDRLKAAYDALAADHQGLLADNDNLRAQV  152



>emb|CBI15277.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 9/164 (5%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRLT+ QV  LER+F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  71    KKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  130

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL------EGNCKEVDDDDEGKNAP  908
             D+  L++S++ L + Y  +LK+  +LK EV LL+ KL       GN  EV + D      
Sbjct  131   DFGALQASYNSLKAEYENLLKEKDELKTEVILLTDKLLVKEKERGNL-EVSNTDTLSQEL  189

Query  909   PSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYY  1040
             P  + A+   D + +      +  + ++E  N  + LL  +Y +
Sbjct  190   PQVVVADSPGDSSYVFE--ADQSDVSQDEEDNFSKSLLPPSYIF  231



>ref|XP_008793499.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Phoenix 
dactylifera]
Length=295

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  72   KKRRLTADQVQFLESSFELENKLEPERKAQLARDLGLQPRQVAIWFQNRRARWKTKQLEK  131

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAP  908
            DY+ LKSS+D L + Y+ +L + +KL+AEV  L+ K+    K++     G +AP
Sbjct  132  DYEALKSSYDVLKADYDNLLDEKEKLQAEVLSLTNKVFLKEKDI-----GSSAP  180



>ref|XP_010931687.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Elaeis 
guineensis]
Length=297

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE++F+ + K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  82   KKRRLTADQVQFLEKNFAFDNKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQMEK  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ LKSS+D L +    +L++N+KLKAEV  L+++L
Sbjct  142  DYEVLKSSYDVLKADCENLLRENEKLKAEVLFLTEEL  178



>gb|ADL36709.1| HD domain class transcription factor [Malus domestica]
Length=324

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  89   KKRRLTADQVQFLEKSFDVENKLEPERKVLLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+EL+++++ L ++   + K+N KLKAEV +LS KL     E    E+ D +     PP
Sbjct  149  DYEELQANYNNLKANCESLSKENDKLKAEVTVLSDKLHLKEKERGNSELSDTNRLSQEPP  208

Query  912  SRMKAE  929
             +  A+
Sbjct  209  QKPIAD  214



>ref|XP_008364621.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Malus domestica]
Length=324

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  89   KKRRLTADQVQFLEKSFDVENKLEPERKVLLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+EL+++++ L ++   + K+N KLKAEV +LS KL     E    E+ D +     PP
Sbjct  149  DYEELQANYNNLKANCESLSKENDKLKAEVTVLSDKLHLKEKERGNSELSDTNRLSQEPP  208

Query  912  SRMKAE  929
             +  A+
Sbjct  209  QKPIAD  214



>ref|XP_010925063.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Elaeis guineensis]
Length=306

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 6/122 (5%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV++LE +F+ + K+E ER+ +LA +LGL PRQVA+WFQNRRAR K KQ+E+
Sbjct  83   KKRRLTADQVELLEENFALDNKLELERKIQLAKDLGLQPRQVAIWFQNRRARLKTKQMEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEG---KNAPPSR  917
            DY+ LKSS+D L + Y  +L++ +KLKAEV  L+ KL   CK    D E    KN+PP  
Sbjct  143  DYEVLKSSYDVLKADYENLLEEKEKLKAEVLFLTDKL---CKWEKGDLETHKIKNSPPLL  199

Query  918  MK  923
            ++
Sbjct  200  LQ  201



>ref|XP_003572981.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Brachypodium 
distachyon]
Length=340

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LE+SF  E K+E ER+ ELA  LGL PRQVAVWFQNRRARWK K LER
Sbjct  80   KKRRLTPEQVHLLEKSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKTLER  139

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+D LK+S D L + ++ +L+ N +L+++V  L++K++
Sbjct  140  DFDRLKASFDALRADHDALLQDNHRLRSQVVTLTEKMQ  177



>ref|XP_010678585.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Beta vulgaris 
subsp. vulgaris]
Length=336

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  91   KKRRLSVEQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  150

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNA  905
            D+D L+S+ + L S Y+ +L++ +KL+AEV  LS KL    K+  D+ E  N 
Sbjct  151  DFDSLQSNFNNLKSDYDNLLQEKEKLQAEVVHLSDKLLSKEKKQGDESEPSNT  203



>gb|AGV54880.1| homeobox-leucine zipper protein HAT5-like protein [Phaseolus 
vulgaris]
Length=275

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER+  LA  LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  38   KKRRLSVEQVQFLEKSFDEENKLEPERKIRLAKELGLQPRQVAIWFQNRRARWKTKQMEK  97

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
            DYD L++ +D L ++Y+ +L++  KLKAEV  L++K+ G  K
Sbjct  98   DYDSLQACYDDLKTNYDDLLREKDKLKAEVAKLTEKVLGREK  139



>ref|XP_007138213.1| hypothetical protein PHAVU_009G190200g [Phaseolus vulgaris]
 gb|ESW10207.1| hypothetical protein PHAVU_009G190200g [Phaseolus vulgaris]
Length=321

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER+  LA  LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  84   KKRRLSVEQVQFLEKSFDEENKLEPERKIRLAKELGLQPRQVAIWFQNRRARWKTKQMEK  143

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
            DYD L++ +D L ++Y+ +L++  KLKAEV  L++K+ G  K
Sbjct  144  DYDSLQACYDDLKTNYDDLLREKDKLKAEVAKLTEKVLGREK  185



>ref|XP_009591685.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
tomentosiformis]
Length=327

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  93   KKRRLTENQVQFLEKSFGEENKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEK  152

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            +Y+ L++ +D L S YN +LK+ + L+AEV  L+ KL  N KE
Sbjct  153  EYEALRNQYDNLKSDYNNLLKEKENLRAEVFQLNDKLLLNEKE  195



>ref|XP_002978617.1| hypothetical protein SELMODRAFT_108871 [Selaginella moellendorffii]
 gb|EFJ20603.1| hypothetical protein SELMODRAFT_108871 [Selaginella moellendorffii]
Length=128

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE++F  E K+E +R+ +LA  LGL PRQVAVWFQNRRARWK KQLE+
Sbjct  35   KKRRLSVEQVKALEKNFEIENKLEPDRKIQLAKELGLQPRQVAVWFQNRRARWKTKQLEK  94

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLS  848
            DYD LKS +D L + Y  + K+  KL+AEV+LLS
Sbjct  95   DYDLLKSEYDDLKASYVDLAKERDKLQAEVDLLS  128



>ref|XP_004299400.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=287

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  91   KKRRLTADQVQFLEKSFDLENKLEPERKILLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  150

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L+++++ L +  + + K+N KLKAEV LLS++L+   KE
Sbjct  151  DYDVLQANYNSLKADCDSLCKENDKLKAEVLLLSERLQLKDKE  193



>gb|KHN08860.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=315

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 128/250 (51%), Gaps = 32/250 (13%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL+ +QV  LE+SF  E K+E ER+  LA  LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  80    KKRRLSVEQVRFLEKSFDEENKLEPERKIRLAKELGLQPRQVAIWFQNRRARWKTKQMEK  139

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL------EGNCKEVDDDDEGKNAP  908
             DYD L++S++ L ++Y+ +L++  KLKAEV  L++K+      EGN ++ + +  G   P
Sbjct  140   DYDSLQASYNDLKANYDNLLREKVKLKAEVARLTEKVLGRKKNEGNLEQAETN--GLQEP  197

Query  909   PSRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNNLHNI  1088
               +  A+   +      SIG      +E+  + K ++   +   +C  G  +      + 
Sbjct  198   LQKSLADSASEGEGSKVSIG---ACKQEDINSAKSDIFDSSESPHCTDGIHSALLETGDS  254

Query  1089  DYeeeeeDMDHHVCNSTPHAQTTTDDDEPLGWFWS*LPTYLLPQLHIYIYGVVRVGT---  1259
              Y  E +             Q+    DE      + LP Y+ P+L    Y  +  G+   
Sbjct  255   SYVFEPD-------------QSDVSQDEEDNLSKTLLPHYIFPKLEDVDYSDLPHGSCNF  301

Query  1260  -----EQCIW  1274
                  +Q IW
Sbjct  302   GIPEEDQAIW  311



>gb|KGN59652.1| hypothetical protein Csa_3G835890 [Cucumis sativus]
Length=211

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 114/199 (57%), Gaps = 28/199 (14%)
 Frame = +3

Query  591   QVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSS  770
             +V +LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLERDYD LK+S
Sbjct  3     KVQMLEKNFEEENKLEPERKSQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKAS  62

Query  771   HDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKAEK--KCDF  944
             +D L+S+Y+ I+K+N  LK+EV  L++K     KE+     G+   PS     +    D 
Sbjct  63    YDLLVSNYDSIVKENAVLKSEVASLTEKCLA--KELGG---GEATIPSITSTSELLLADI  117

Query  945   TRIHSSIGHRDKIPEEEY--GNPKQELLMDNYYYYC--VCGSGNTYNNLHNIDYeeeeeD  1112
             T I  S+ H  +  E+    G+    ++ DN    C  +  SG++Y    NI+Y +    
Sbjct  118   TNI--SVPHSGRKAEDRLSSGSDSSAVIDDN----CPQLIDSGDSY--FPNIEYPQ----  165

Query  1113  MDHHVCNSTPHAQTTTDDD  1169
                  C++ P+     DDD
Sbjct  166   -----CSNLPNGLHMEDDD  179



>ref|XP_004489987.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Cicer arietinum]
Length=330

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+S+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  89   KKRRLSSEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDE-----GKNAP  908
            DY  LK+S D L   Y  ++++N KLK EVN L  KL    +E ++ D+     G N+P
Sbjct  149  DYGTLKASFDKLKDDYEHLVQENDKLKEEVNSLKNKLNPRDEEKENSDDKSSPNGVNSP  207



>ref|XP_004299399.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=326

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  91   KKRRLTADQVQFLEKSFDLENKLEPERKILLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  150

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DYD L+++++ L +  + + K+N KLKAEV LLS++L+   KE
Sbjct  151  DYDVLQANYNSLKADCDSLCKENDKLKAEVLLLSERLQLKDKE  193



>dbj|BAJ88065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=296

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWKAKQLE
Sbjct  79   RKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKAKQLE  138

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            +D+D L+++H  LL+  + +L  N  L+++V  L++KL+
Sbjct  139  QDFDALRAAHAELLAGRDALLADNHHLRSQVTSLTEKLQ  177



>ref|XP_008786730.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Phoenix 
dactylifera]
Length=264

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LER+F  E K+E E + +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  41   KKRRLTADQVQFLERTFELENKLEPETKVQLARDLGLKPRQVAIWFQNRRARWKTKQLEK  100

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ LKS +D L + Y+ +LK+ +KL+ EV  L+  L
Sbjct  101  DYEALKSRYDALTADYDILLKEKEKLRTEVLSLTNML  137



>ref|XP_010256239.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nelumbo 
nucifera]
Length=325

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  87   KKRRLTAEQVQFLERNFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARWKTKQLEK  146

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ LK+S++ L  +Y+ ++K+ +KLK EV LL  + 
Sbjct  147  DYEGLKASYNSLKVNYDNLVKEKEKLKTEVLLLKDRF  183



>sp|A2Z0Q0.1|HOX25_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX25; AltName: 
Full=HD-ZIP protein HOX25; AltName: Full=Homeodomain transcription 
factor HOX25; AltName: Full=OsHox25 [Oryza sativa Indica 
Group]
 gb|EAZ08911.1| hypothetical protein OsI_31176 [Oryza sativa Indica Group]
Length=260

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            +KRRLT++QV  LERSF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWK KQLE
Sbjct  22   RKRRLTAEQVRALERSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKTKQLE  81

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMK  923
             D+D L+++HD LL+    +   N+ L+++V LL++KL+ N         GK+  PS   
Sbjct  82   LDFDRLRAAHDELLAGRAALAADNESLRSQVILLTEKLQAN---------GKSPSPSPAP  132

Query  924  AEKKC  938
            AE+  
Sbjct  133  AEQTA  137



>ref|XP_009773747.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
sylvestris]
Length=333

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  95   KKRRLTENQVQFLEKSFGEESKLEPERKVQLAKELGLQPRQIAIWFQNRRARWKTKQLEK  154

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +Y+ L++ +D L S YN +LK+ + L+AEV  L+ KL
Sbjct  155  EYEALRNQYDNLKSDYNNLLKEKENLRAEVFQLTDKL  191



>emb|CDP00280.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV  LERSF  E K++ ER+ +LA +L L PRQVA+WFQNRRAR+K KQLE+
Sbjct  87   KKRRLTAEQVQFLERSFELENKLDPERKVQLAKDLSLQPRQVAIWFQNRRARYKTKQLEK  146

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +YD LKSS+D L + Y+ + K+N+ LK EV+ L++KL
Sbjct  147  EYDCLKSSYDKLRADYDTLFKENESLKNEVHSLAEKL  183



>gb|KHN19374.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=323

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER+  LA  LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  88   KKRRLSVEQVKFLEKSFDEENKLEPERKIWLAKELGLQPRQVAIWFQNRRARWKTKQMEK  147

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
            DYD L++S++ L ++Y+ +L++  KLKAEV  L++K+ G  K
Sbjct  148  DYDSLQASYNDLKANYDNLLREKDKLKAEVARLTEKVLGREK  189



>ref|XP_011086401.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Sesamum indicum]
Length=318

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K K LE+
Sbjct  86   KKRRLTPNQVQFLEKSFDEENKLEPERKLQLAKELGLQPRQVAIWFQNRRARYKTKLLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKK  854
            ++D LKSS+D L + Y+ + K+N+KLK EVN L++K
Sbjct  146  EFDSLKSSYDRLKADYDTLYKENEKLKTEVNSLAEK  181



>ref|XP_006647837.1| PREDICTED: homeobox-leucine zipper protein HOX16-like [Oryza 
brachyantha]
Length=327

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV +LERSF  E K+E ER+ ELA  LGL PRQVAVWFQ+RRARWK KQLER
Sbjct  76   KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQSRRARWKTKQLER  135

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            D+  LK+S D L + ++ +L+ N +L ++V  L++KL+
Sbjct  136  DFARLKASFDALRADHDALLQDNNRLHSQVMSLTEKLQ  173



>ref|NP_001237881.1| HDZip I protein [Glycine max]
 gb|AAX98670.1| HDZip I protein [Glycine max]
Length=245

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE+SF  E K+E ER   LA  LGL PRQVA+WFQNRRARWK KQ+E+
Sbjct  10   KKRRLSVEQVKFLEKSFDEENKLEPERMIWLAKELGLQPRQVAIWFQNRRARWKTKQMEK  69

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
            DYD L++S++ L ++Y+ +L++  KLKAEV  L++K+ G  K
Sbjct  70   DYDSLQTSYNDLKANYDNLLREKDKLKAEVARLTEKVLGREK  111



>ref|XP_007044377.1| Homeobox-leucine zipper protein HAT5, putative isoform 2 [Theobroma 
cacao]
 gb|EOY00209.1| Homeobox-leucine zipper protein HAT5, putative isoform 2 [Theobroma 
cacao]
Length=302

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LERSF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  68   KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKNKQLEK  127

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S+D L + Y+ +LK+ + L+ EV  L +KL
Sbjct  128  DYDSLKASYDELKTDYDNLLKEKEDLENEVLALKEKL  164



>ref|XP_002271692.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Vitis vinifera]
Length=317

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LER+F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  81   KKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            D+  L++S++ L + Y  +LK+  +LK EV LL+ KL
Sbjct  141  DFGALQASYNSLKAEYENLLKEKDELKTEVILLTDKL  177



>ref|XP_007044376.1| Homeobox-leucine zipper protein HAT5, putative isoform 1 [Theobroma 
cacao]
 gb|EOY00208.1| Homeobox-leucine zipper protein HAT5, putative isoform 1 [Theobroma 
cacao]
Length=319

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LERSF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  85   KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKNKQLEK  144

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S+D L + Y+ +LK+ + L+ EV  L +KL
Sbjct  145  DYDSLKASYDELKTDYDNLLKEKEDLENEVLALKEKL  181



>ref|XP_003613578.1| Homeobox-leucine zipper protein ATHB-16 [Medicago truncatula]
 gb|AES96536.1| homeobox leucine zipper family protein [Medicago truncatula]
Length=324

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+S+QV  LE+SF  E K+E +R+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  87   KKRRLSSEQVQFLEKSFEVENKLEPDRKVQLAKELGLQPRQVAIWFQNRRARFKTKQLEK  146

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  LK+S D L   Y+ +L++N KLK EVN L  KL
Sbjct  147  DYGTLKASFDSLKDDYDNLLQENDKLKEEVNSLKNKL  183



>ref|XP_007037211.1| Homeobox protein, putative isoform 1 [Theobroma cacao]
 gb|EOY21712.1| Homeobox protein, putative isoform 1 [Theobroma cacao]
Length=332

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LE+SF  E K+E ER+ +LA +LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  94   KKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQIAIWFQNRRARWKTKQLEK  153

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEV-----NLLSKKLEGNCKEVDDDDEGKNAPP  911
            DY+ L++S++ L + Y+ +LK+  KLK EV      LL K+ E    E+ D ++    PP
Sbjct  154  DYEALQASYNSLKADYDNLLKEKDKLKEEVLQLTDKLLVKEKEKGNSELSDVNKLSQEPP  213

Query  912  SRM  920
             ++
Sbjct  214  QKL  216



>ref|XP_007037212.1| Homeobox protein, putative isoform 2 [Theobroma cacao]
 gb|EOY21713.1| Homeobox protein, putative isoform 2 [Theobroma cacao]
Length=334

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LE+SF  E K+E ER+ +LA +LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  96   KKRRLSVDQVQFLEKSFEVENKLEPERKVQLAKDLGLQPRQIAIWFQNRRARWKTKQLEK  155

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEV-----NLLSKKLEGNCKEVDDDDEGKNAPP  911
            DY+ L++S++ L + Y+ +LK+  KLK EV      LL K+ E    E+ D ++    PP
Sbjct  156  DYEALQASYNSLKADYDNLLKEKDKLKEEVLQLTDKLLVKEKEKGNSELSDVNKLSQEPP  215

Query  912  SRM  920
             ++
Sbjct  216  QKL  218



>emb|CAN83969.1| hypothetical protein VITISV_039798 [Vitis vinifera]
Length=333

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LER+F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  97   KKRRLTADQVQFLERNFEVENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  156

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            D+  L++S++ L + Y  +LK+  +LK EV LL+ KL
Sbjct  157  DFGALQASYNSLKAEYENLLKEKDELKTEVILLTDKL  193



>ref|XP_002520146.1| homeobox protein, putative [Ricinus communis]
 gb|EEF42201.1| homeobox protein, putative [Ricinus communis]
Length=305

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  82   KKRRLTATQVQFLERNFEVENKLEPERKIQLAKELGLQPRQVAIWFQNRRARFKNKQLEK  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S+D L + Y+ +LK+N+ LK E   L  KL
Sbjct  142  DYDSLKASYDKLKADYDNLLKENENLKNEFVSLKDKL  178



>ref|XP_008437622.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Cucumis melo]
Length=338

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  104  KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  163

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+  L   Y  +LK+   LKAE+ LL+ KL
Sbjct  164  DYEALQSSYGSLKVDYENLLKEKDSLKAEILLLTDKL  200



>ref|XP_008437631.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Cucumis melo]
Length=333

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  99   KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  158

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+  L   Y  +LK+   LKAE+ LL+ KL
Sbjct  159  DYEALQSSYGSLKVDYENLLKEKDSLKAEILLLTDKL  195



>ref|XP_004152443.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
1 [Cucumis sativus]
Length=339

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  104  KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  163

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+  L   Y  +LK+   LKAE+ LL+ KL
Sbjct  164  DYEALQSSYGSLKVDYENLLKEKDSLKAEILLLTDKL  200



>ref|XP_004152444.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
2 [Cucumis sativus]
 gb|KGN64257.1| hypothetical protein Csa_1G045550 [Cucumis sativus]
Length=334

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  99   KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  158

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+  L   Y  +LK+   LKAE+ LL+ KL
Sbjct  159  DYEALQSSYGSLKVDYENLLKEKDSLKAEILLLTDKL  195



>ref|XP_004157812.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
HAT5-like [Cucumis sativus]
Length=334

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  99   KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  158

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+SS+  L   Y  +LK+   LKAE+ LL+ KL
Sbjct  159  DYEALQSSYGSLKVDYENLLKEKDSLKAEILLLTDKL  195



>gb|AAL57497.1|AF443623_1 homeodomain leucine zipper protein CPHB-7 [Craterostigma plantagineum]
 gb|ABA39174.1| HDZip transcription factor HB-7 [Craterostigma plantagineum]
Length=309

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+S QV  L++SF  + K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K K LE+
Sbjct  92   KKRRLSSDQVRFLDKSFEVDNKLEPERKVQLAKELGLQPRQVAIWFQNRRARYKTKLLEK  151

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVD----------DDDEG  896
            DYD LKS++D L   ++ +  +N+KLK EVN L++KL G     D          DDD  
Sbjct  152  DYDALKSNYDRLKEDFDALYSENEKLKTEVNTLAEKLLGKADHGDHRPIKEEPPFDDDVN  211

Query  897  KNAPPSRMKAE  929
            K    S  K++
Sbjct  212  KQTKASSAKSD  222



>ref|XP_010238252.1| PREDICTED: homeobox-leucine zipper protein HOX4 [Brachypodium 
distachyon]
Length=250

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 107/214 (50%), Gaps = 20/214 (9%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  36    KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  95

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
             DY+ L+ S+D L   ++ + +    L AE+  L  KL       +   V ++    + PP
Sbjct  96    DYNALRHSYDALRLDHDALRRDKDALLAEIKELKGKLGDEDAAASFTSVKEEPAASDGPP  155

Query  912   SRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNNLHNID  1091
                      D + + +        P  E   P+   L+      C   +G+     H  +
Sbjct  156   PAGMGYSDSDSSAVVNDTDATGATPPAELPAPEVGTLL---VAPCAAAAGHGEVFFHG-N  211

Query  1092  YeeeeeDMDHHVCNSTPHAQTTTDDDEPLGWFWS  1193
             + + EED    +           DDDEP G F++
Sbjct  212   FLKVEEDETGFL-----------DDDEPCGGFFA  234



>ref|XP_008239846.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Prunus 
mume]
Length=329

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 94/146 (64%), Gaps = 7/146 (5%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  94   KKRRLTVDQVQFLEKSFDMENKLEPERKILLAKDLGLQPRQVAIWFQNRRARWKNKQLEK  153

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+ L+++++ L +    + K+N+KLKAEV +LS+KL     E    E+ D ++    P 
Sbjct  154  DYEVLQANYNSLKADCESLAKENEKLKAEVLVLSEKLPHKEKESGTSELSDTNKVSQEPT  213

Query  912  SRMKAE--KKCDFTRIHSSIGHRDKI  983
                A+   +C+ +++ +    ++ +
Sbjct  214  QNPTADSLSECEVSKVSAVASKQEDL  239



>ref|XP_010028877.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Eucalyptus 
grandis]
 gb|KCW83517.1| hypothetical protein EUGRSUZ_B00423 [Eucalyptus grandis]
Length=315

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV  LE+SF  E K+E +R+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  83   KKRRLTVEQVQFLEKSFEVENKLEPDRKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L++S + L S Y+ ++K+   LKAEV  L+ KL
Sbjct  143  DYETLQASFNTLKSDYDTLIKERNDLKAEVLNLTDKL  179



>ref|XP_010242341.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nelumbo 
nucifera]
Length=325

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (70%), Gaps = 0/122 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  86   KKRRLTTDQVQFLEKSFEMENKLEPERKVQLARDLGLQPRQVAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY+ L++ ++ L + Y+ ++K+ +KLK EV  L+++L    KE  +        PS ++ 
Sbjct  146  DYEALRAKYNNLKADYDNLVKEKEKLKTEVLSLTERLLLKEKEKGNSGTSDVNKPSDLQP  205

Query  927  EK  932
            +K
Sbjct  206  QK  207



>ref|XP_011087214.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Sesamum 
indicum]
Length=293

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ Q+  LE+SF  E K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK +QLE 
Sbjct  89   KKRRLSADQIQFLEKSFEAENKLEPERKIQLAKELGLPPRQIAIWFQNRRARWKTRQLET  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVD  881
            DYD L +S+  L ++Y+ +LK+N+KLKAEV  L  K  G  ++ D
Sbjct  149  DYDTLHASYMSLKTNYDNLLKENEKLKAEV--LRLKDNGLARDTD  191



>ref|XP_010925064.1| PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform 
X2 [Elaeis guineensis]
Length=202

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV++LE +F+ + K+E ER+ +LA +LGL PRQVA+WFQNRRAR K KQ+E+
Sbjct  83   KKRRLTADQVELLEENFALDNKLELERKIQLAKDLGLQPRQVAIWFQNRRARLKTKQMEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEV  836
            DY+ LKSS+D L + Y  +L++ +KLKAEV
Sbjct  143  DYEVLKSSYDVLKADYENLLEEKEKLKAEV  172



>gb|KHG00570.1| Homeobox-leucine zipper ATHB-6 -like protein [Gossypium arboreum]
Length=277

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 91/149 (61%), Gaps = 0/149 (0%)
 Frame = +3

Query  426  LGKADPLFPGGSWSATKMEESLKRRASCMFSGPqsdeeyyeeqsssdKKRRLTSQQVDVL  605
            L   +P+FP      +K ++   R    M  G + ++   E   +++KKRRL+  QV  L
Sbjct  10   LDALNPIFPPKEEKNSKKKQIYSREFQAMLDGLEEEDSLEEADQTTEKKRRLSMNQVKAL  69

Query  606  ERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDELKSSHDYLL  785
            E++F  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+DY  LK+++  L 
Sbjct  70   EKNFELENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLEKDYGVLKANYSALK  129

Query  786  SHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
              Y+ + ++ Q L AE+  L  KLE N +
Sbjct  130  LDYDNLEQEKQALTAELRELKAKLEENSE  158



>dbj|BAJ85282.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95292.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 105/214 (49%), Gaps = 14/214 (7%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  53    KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  112

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
             DY+ L+ S+D L   ++ + +  + L AE+  L  KL       +   V ++    + PP
Sbjct  113   DYNALRHSYDALRLDHDALRRDKEALLAEIKDLKGKLGDEEAAASFTSVKEEPAASDGPP  172

Query  912   SRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTY--NNLHN  1085
                      D + + +        P EE   P+   L+       V G G  +   N   
Sbjct  173   PAGMGSSDSDSSGVLNDTDATGATPAEEAPAPEMGELLGG-PGAAVAGHGQMFLQGNFLK  231

Query  1086  IDYeeeeeDMDHHVCNSTPHAQTTTDDDEPLGWF  1187
             ++ +E     D   C           D+ PL W+
Sbjct  232   VEEDETGFLDDEEPCGG------FFADEPPLAWW  259



>gb|KCW48809.1| hypothetical protein EUGRSUZ_K02448 [Eucalyptus grandis]
Length=267

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV  LE++F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK K LE+
Sbjct  40   KKRRLTTEQVHFLEKNFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKHLEK  99

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +Y++L++S++ L +  + +LK+N KLK EV +L+ KL
Sbjct  100  EYEDLQASYNSLKADCDGLLKENDKLKTEVLVLTDKL  136



>ref|XP_004959426.1| PREDICTED: homeobox-leucine zipper protein HOX25-like [Setaria 
italica]
Length=303

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  570  KRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KRRLT++QV  LE SF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARWKAKQLE+
Sbjct  93   KRRLTAEQVRELELSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWKAKQLEQ  152

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            D+D L+++HD LL+  + +L  N +L+++V  L++KL+   +    D E +     R  A
Sbjct  153  DFDRLRAAHDELLAGRDALLADNDRLRSQVITLTEKLQAKEESSAPDPEEQTVAALREGA  212



>ref|XP_010037142.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Eucalyptus 
grandis]
 gb|KCW48808.1| hypothetical protein EUGRSUZ_K02448 [Eucalyptus grandis]
Length=308

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT++QV  LE++F  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK K LE+
Sbjct  81   KKRRLTTEQVHFLEKNFELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKHLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +Y++L++S++ L +  + +LK+N KLK EV +L+ KL
Sbjct  141  EYEDLQASYNSLKADCDGLLKENDKLKTEVLVLTDKL  177



>ref|XP_001758199.1| predicted protein [Physcomitrella patens]
 gb|EDQ77021.1| predicted protein [Physcomitrella patens]
Length=380

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LER+F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  133  KKRRLTFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLER  192

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            DY+ L S ++ L S +  +L++ Q+L+ E+  L+ KL+
Sbjct  193  DYEVLTSDYNRLKSEFEAVLQEKQELQGEIECLTGKLQ  230



>ref|XP_009610614.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
tomentosiformis]
Length=302

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (69%), Gaps = 2/122 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL   QV  LE+SF  + K+E ER+ +LA  LGL PRQ+A+WFQNRRAR+K K LE+
Sbjct  81   KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYKTKLLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK+S D L   Y+ + K+N+ L+ EV+LL +K+    +E   ++ G+N P S + A
Sbjct  141  DYDVLKASFDKLKDDYDSLFKENENLRNEVDLLKEKMLR--REKGKENSGQNEPISPVDA  198

Query  927  EK  932
            E+
Sbjct  199  EE  200



>ref|XP_009381162.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=297

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+ ++A  LGL PRQ+AVWFQNRRARWK KQ+E+
Sbjct  77   KKRRLTTCQVQFLEKSFELENKLEPERKLQIAKVLGLKPRQIAVWFQNRRARWKTKQIEK  136

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ LKSS+D L   ++ ++K+ + LKAEV  L+K+L
Sbjct  137  DYESLKSSYDALKMDHDSLVKEKEDLKAEVLSLTKRL  173



>ref|XP_007209345.1| hypothetical protein PRUPE_ppa008495mg [Prunus persica]
 gb|EMJ10544.1| hypothetical protein PRUPE_ppa008495mg [Prunus persica]
Length=329

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE+SF  E K+E ER+  LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  94   KKRRLTVDQVQFLEKSFDMENKLEPERKILLAKDLGLQPRQVAIWFQNRRARWKNKQLEK  153

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
            DY+ L+++++ L +    + K+N+KLK+EV +LS+KL     E    E+ D ++    P 
Sbjct  154  DYEVLQANYNSLKADCESLAKENEKLKSEVLVLSEKLPHKEKESGTSELSDTNKVSQEPT  213

Query  912  SRMKAE--KKCDFTRIHS  959
                A+   +C+ +++ +
Sbjct  214  QNPTADSLSECEVSKVSA  231



>ref|XP_009801495.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
sylvestris]
Length=295

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE+SF  E K+E ER+ +LA   GL PRQVA+WFQNRRAR+K+KQLE+
Sbjct  75   KKRRLLPKQVQFLEKSFEVENKLEPERKIQLAKETGLQPRQVAIWFQNRRARYKSKQLEK  134

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S D L   Y+ + K+N  L+ EV+LL +KL
Sbjct  135  DYDVLKASFDKLKDEYDSLFKENDNLRNEVHLLKEKL  171



>ref|XP_008373110.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Malus 
domestica]
Length=279

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+S+QV  LERSF  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLER
Sbjct  55   KKRRLSSEQVKALERSFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLER  114

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  LK+ +D L  +Y+ + +QN+ L  +++ L  KL
Sbjct  115  DYSALKADYDGLKHNYDSLERQNKALAEKLSQLKAKL  151



>ref|XP_009381161.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=303

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT+ QV  LE+SF  E K+E ER+ ++A  LGL PRQ+AVWFQNRRARWK KQ+E+
Sbjct  83   KKRRLTTCQVQFLEKSFELENKLEPERKLQIAKVLGLKPRQIAVWFQNRRARWKTKQIEK  142

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ LKSS+D L   ++ ++K+ + LKAEV  L+K+L
Sbjct  143  DYESLKSSYDALKMDHDSLVKEKEDLKAEVLSLTKRL  179



>ref|XP_007155341.1| hypothetical protein PHAVU_003G192900g [Phaseolus vulgaris]
 gb|ESW27335.1| hypothetical protein PHAVU_003G192900g [Phaseolus vulgaris]
Length=328

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARW+ KQLE+
Sbjct  82   KKRRLSANQVQFLEKSFEEENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWRTKQLEK  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DY+ L  S + L ++Y  +LK+  KLK+EV  LS+K+    KE
Sbjct  142  DYEILHDSFESLKANYESLLKEKDKLKSEVAHLSEKVVAREKE  184



>dbj|BAA93465.1| homeobox protein PpHB6 [Physcomitrella patens]
Length=345

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LER+F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  99   KKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLRPRQVAVWFQNRRARWKTKQLER  158

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN-CKEVDDDDEGKNAPPSRMK  923
            DY+ L + +  L   Y+ +L +   LKAEV  LS K   + C + +    G++A    + 
Sbjct  159  DYEALAADYKSLKHDYDLVLAEKNNLKAEVQRLSGKAPTSPCADGNQIVAGESAQTPEVD  218

Query  924  AEKKCDFTRIHSS  962
             E      R H+S
Sbjct  219  VETSELVARQHTS  231



>ref|XP_001769007.1| predicted protein [Physcomitrella patens]
 gb|EDQ66205.1| predicted protein [Physcomitrella patens]
Length=345

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LER+F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  99   KKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLRPRQVAVWFQNRRARWKTKQLER  158

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN-CKEVDDDDEGKNAPPSRMK  923
            DY+ L + +  L   Y+ +L +   LKAEV  LS K   + C + +    G++A    + 
Sbjct  159  DYEALAADYKSLKHDYDLVLAEKNNLKAEVQRLSGKAPTSPCADGNQIVAGESAQTPEVD  218

Query  924  AEKKCDFTRIHSS  962
             E      R H+S
Sbjct  219  VETSELVARQHTS  231



>gb|KHG04733.1| Homeobox-leucine zipper HAT5 -like protein [Gossypium arboreum]
Length=290

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  Q+  LE+SF  + K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  89   KKRRLTVDQIQFLEKSFEVDNKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  148

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLE  860
            DYD L + ++ L + Y+ +LK+  KLK EV  L+ KL+
Sbjct  149  DYDTLLAKYNSLKADYDDLLKEKDKLKEEVLQLTDKLQ  186



>ref|XP_006439657.1| hypothetical protein CICLE_v10024310mg [Citrus clementina]
 gb|ESR52897.1| hypothetical protein CICLE_v10024310mg [Citrus clementina]
Length=310

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  579  LTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLERDYDE  758
            LT  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+DYD 
Sbjct  74   LTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDV  133

Query  759  LKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            L++S++ L + Y+ + K+ +KLKAEV  L+ KL+   KE
Sbjct  134  LQNSYNSLKADYDNLFKEKEKLKAEVLTLTDKLQVKEKE  172



>ref|XP_004238764.1| PREDICTED: homeobox-leucine zipper protein HAT5 [Solanum lycopersicum]
Length=288

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL   QV  LE+SF  + K+E ER+ +LA+ LGL PRQ+A+WFQNRRAR+K K LE+
Sbjct  70   KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLANELGLQPRQIAIWFQNRRARYKTKVLEK  129

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S D L + Y+ + K+N+ L+ EV+LL++KL
Sbjct  130  DYDALKASFDKLKADYDTLFKENEDLRNEVHLLTQKL  166



>gb|EYU28699.1| hypothetical protein MIMGU_mgv1a011043mg [Erythranthe guttata]
Length=294

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE+SF  E K+E +R+ +LA  LGL PRQVA+WFQNRRAR K K LER
Sbjct  85   KKRRLMPEQVLFLEKSFDVENKLEPDRKTQLAKQLGLQPRQVAIWFQNRRARSKTKVLER  144

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            +Y  LK+S+D L   Y+ + KQN+ +KAEV+LL++KL
Sbjct  145  EYGSLKASYDKLKEDYDTLFKQNEAMKAEVDLLTEKL  181



>ref|XP_003530679.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
Length=320

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LE +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE+
Sbjct  81   KKRRLTSKQVQFLESNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDD-DDEGKNAPPSRMK  923
            DY  LK+S+D L   Y+ +L+++ KLK EVN L  +L    +E  + DD   +A  S+ K
Sbjct  141  DYGVLKASYDVLKRDYDNLLQESDKLKEEVNSLKTRLIPREQEEQNLDDTSCDAVNSQHK  200

Query  924  AEKKCDFTRIHSSIGHRDKIP  986
             +K    T   S  G +  +P
Sbjct  201  EQKDL-ITNTVSENGSKVPLP  220



>ref|XP_006357259.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Solanum 
tuberosum]
Length=301

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL   QV  LE+SF  + K+E ER+ +LA+ LGL PRQ+A+WFQNRRAR+K K LE+
Sbjct  80   KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLANELGLQPRQIAIWFQNRRARYKTKVLEK  139

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S D L + Y+ + K+N+ L+ EV+LL++KL
Sbjct  140  DYDVLKASFDKLKADYDTLFKENEDLRNEVHLLTQKL  176



>ref|XP_004508776.1| PREDICTED: homeobox-leucine zipper protein ATHB-16-like [Cicer 
arietinum]
Length=324

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  87   KKRRLSIDQVQFLEKSFEVENKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  146

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE--VDDDDEGKNA  905
            DY+ L  S+  L + Y+ +LK+  +LKAEV  L++K+    +E  +D+ +  KN 
Sbjct  147  DYESLHHSYQSLQTDYDNLLKEKDRLKAEVARLTEKVAREKQEGKLDESESEKNG  201



>ref|XP_003549660.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Glycine 
max]
 gb|KHN18524.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=329

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 95/150 (63%), Gaps = 16/150 (11%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LE+SF  E K+E ER+ +LA +LGL PRQVA+WFQNRRARWK K LE+
Sbjct  82   KKRRLSMNQVQFLEKSFEEENKLEPERKTKLAKDLGLRPRQVAIWFQNRRARWKTKTLEK  141

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL------EGNCKEVDDDDE-----  893
            DY+ L +S + L S+Y+ +LK+   LKAEV  L++K+      EG+ K+  + +E     
Sbjct  142  DYEALHASFENLKSNYDSLLKEKDNLKAEVASLNEKVLARGKQEGHMKQQAESEEETKRL  201

Query  894  ---GKNAPPSRMKAE--KKCDFTRIHSSIG  968
                +  PP R+  E   + + +++ S +G
Sbjct  202  LHLQEQEPPQRLLLESVSEGEGSKVSSVVG  231



>ref|XP_009360370.1| PREDICTED: homeobox-leucine zipper protein ATHB-13 [Pyrus x bretschneideri]
Length=286

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 81/129 (63%), Gaps = 0/129 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  81   KKRRLSMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK   D + +  + +  QNQKL+AE+  L  +       ++ D EG  +  S   +
Sbjct  141  DYDLLKRQFDAIKADNDALQSQNQKLQAEIMALKNREPAESINLNKDTEGSCSNRSENNS  200

Query  927  EKKCDFTRI  953
            + K D +R 
Sbjct  201  DIKLDISRT  209



>ref|XP_010683271.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=319

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV+ LE+SF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQ+E+
Sbjct  73   KKRRLKSEQVEYLEKSFEVENKLEPERKVQLAQQLGLQPRQVAIWFQNRRARYKTKQIEK  132

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-EGNCKEVD  881
            ++D LK+S+D L   Y+ +  + + LK EV LL KKL +   KE+D
Sbjct  133  EFDSLKASYDSLKIDYDSLNNEKENLKNEVELLKKKLTQKEGKEID  178



>ref|XP_010554014.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X2 [Tarenaya hassleriana]
Length=203

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            +K RLT++QV++LE++F  E K+E  R+ +LA NLGL PRQVAVWFQNRRAR K KQ+E+
Sbjct  31   RKHRLTAEQVNLLEKNFQEENKLEPLRKSQLAKNLGLPPRQVAVWFQNRRARSKVKQIEK  90

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN  866
             YD LKS +D L   +  +L+ N+KLKAEV  L++KL+ +
Sbjct  91   QYDLLKSLYDSLREKHELVLEANEKLKAEVLTLTEKLQAS  130



>ref|NP_001140555.1| uncharacterized protein LOC100272620 [Zea mays]
 gb|ACF79262.1| unknown [Zea mays]
 gb|ACF84067.1| unknown [Zea mays]
 gb|ACL53981.1| unknown [Zea mays]
 gb|AFU81592.1| HB-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA61885.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
Length=261

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+S+QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  48   KKRRLSSEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  107

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  L+ S+D L   ++ + +    L AE+  L  KL
Sbjct  108  DYSALRQSYDALRHDHDALRRDKDALLAEIKELKAKL  144



>gb|ABQ57284.1| hox20, partial [Oryza sativa Indica Group]
Length=152

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  39   KKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  98

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  L+ S+D L + ++ + +    L AE+  L  KL
Sbjct  99   DYAALRQSYDALRADHDALRRDKDALLAEIKELKGKL  135



>ref|XP_010272979.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nelumbo 
nucifera]
Length=337

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT  QV  LE++F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  58   KKRRLTVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLER  117

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKE  875
            DY  LKS++D L  +YN + ++ + L  E+  L  KL G   E
Sbjct  118  DYSLLKSNYDTLKDNYNALQREKEALLVELAELKSKLGGENTE  160



>ref|XP_010683269.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=331

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV+ LE+SF  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQ+E+
Sbjct  85   KKRRLKSEQVEYLEKSFEVENKLEPERKVQLAQQLGLQPRQVAIWFQNRRARYKTKQIEK  144

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-EGNCKEVD  881
            ++D LK+S+D L   Y+ +  + + LK EV LL KKL +   KE+D
Sbjct  145  EFDSLKASYDSLKIDYDSLNNEKENLKNEVELLKKKLTQKEGKEID  190



>gb|KHN13480.1| Homeobox-leucine zipper protein HAT5 [Glycine soja]
Length=320

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LE +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE+
Sbjct  81   KKRRLTSKQVQFLESNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  LK+S+D L   Y+ +L+++ KLK EVN L  +L
Sbjct  141  DYGVLKASYDVLKRDYDNLLQESDKLKEEVNSLKTRL  177



>ref|XP_002460380.1| hypothetical protein SORBIDRAFT_02g027300 [Sorghum bicolor]
 gb|EER96901.1| hypothetical protein SORBIDRAFT_02g027300 [Sorghum bicolor]
Length=273

 Score =   112 bits (279),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 106/214 (50%), Gaps = 14/214 (7%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  51    KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  110

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL-----EGNCKEVDDDDEGKNAPP  911
             DY  L+ S+D L   ++ + +    L AE+  L  KL       +   V  +    + PP
Sbjct  111   DYAALRHSYDALRHDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVKAEPAASDGPP  170

Query  912   SRMKAEKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNNLHNID  1091
                    + D + + +  G    +PE +     Q  L+D+     V G+     N   + 
Sbjct  171   PVGVGSSESDSSAVLNDAG--PPVPEAQPVPEVQGTLLDDAPCAVVAGASAAAANHGGVF  228

Query  1092  YeeeeeDMDHHVCNSTPHAQTTTDDDEPLGWFWS  1193
             +      ++              DDDEP G F++
Sbjct  229   FHGSFLKVEEDETG-------LLDDDEPCGGFFA  255



>ref|XP_008797128.1| PREDICTED: homeobox-leucine zipper protein HOX21 [Phoenix dactylifera]
Length=289

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 3/143 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV  LE++F    K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  88   KKRRLNSEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEK  147

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK   + + S  + +  QN+KL+AE+ +L  +       ++ + EG  +  S   +
Sbjct  148  DYDVLKRQFEAIRSENDALQAQNKKLQAEILVLKGRETSELINLNKETEGSCSNRSENSS  207

Query  927  EKKCDFTR---IHSSIGHRDKIP  986
            E   D +R   I S +     IP
Sbjct  208  EINLDISRTSAIESPLNPHQSIP  230



>ref|XP_002970538.1| hypothetical protein SELMODRAFT_18196, partial [Selaginella moellendorffii]
 gb|EFJ28668.1| hypothetical protein SELMODRAFT_18196, partial [Selaginella moellendorffii]
Length=104

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LE++F  E K+E +R+ +LA  LGL PRQVAVWFQNRRARWK KQLE+
Sbjct  15   KKRRLSVEQVKALEKNFEIENKLEPDRKIQLAKELGLQPRQVAVWFQNRRARWKTKQLEK  74

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEV  836
            DYD LKS +D L + Y  + K+  KL+AEV
Sbjct  75   DYDLLKSEYDDLKASYVDLAKERDKLQAEV  104



>ref|XP_010925357.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Elaeis 
guineensis]
Length=306

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 1/105 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLE  743
            KKRRLT+ QV  LER+F  E  K+E ER+ +LA +LG+ PRQVA+WFQNRRARWK KQLE
Sbjct  83   KKRRLTADQVQFLERNFELENMKLEPERKVQLARDLGIQPRQVAIWFQNRRARWKTKQLE  142

Query  744  RDYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEV  878
            +DY+ LKSS+D L + Y+ +L + +KL+A+V  L+  L    K+V
Sbjct  143  KDYEALKSSYDALTADYDNLLNEKEKLQAKVLSLTNMLLLKGKDV  187



>gb|KDP21235.1| hypothetical protein JCGZ_21706 [Jatropha curcas]
Length=307

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL++ QV+ LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRAR+K KQLE+
Sbjct  80   KKRRLSAGQVEFLERNFEVENKLEPERKIQLAKELGLQPRQVAIWFQNRRARFKNKQLEK  139

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S+D L S Y  +LK+   LK ++  L +K+
Sbjct  140  DYDSLKASYDKLKSDYAILLKEKDNLKNQIVSLKEKM  176



>ref|XP_007153855.1| hypothetical protein PHAVU_003G070300g [Phaseolus vulgaris]
 gb|ESW25849.1| hypothetical protein PHAVU_003G070300g [Phaseolus vulgaris]
Length=319

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLTS+QV  LE +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE+
Sbjct  81   KKRRLTSEQVQFLESNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  LK+ +D L   Y+ ++++N KLK EV  L K +    +E + DD    A  S  K 
Sbjct  141  DYGMLKAGYDILRRDYDNLVQENDKLKEEVYSLMKVIPREKEEQNLDDTSCGAVNSEHKE  200

Query  927  EKKCDFTR  950
            EK     R
Sbjct  201  EKDLIIYR  208



>gb|KHN19633.1| Homeobox-leucine zipper protein HAT5, partial [Glycine soja]
Length=283

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 0/123 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            K RRLTS+QV  L+ +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE 
Sbjct  40   KTRRLTSEQVQFLQSNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLET  99

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  LK+S+  L   Y+ +L++N KLK EVN L++ +    +E + DD   +   SR K 
Sbjct  100  DYGMLKASYHVLKRDYDNLLQENDKLKEEVNSLNRLIPREQEEQNSDDTSCDTVNSRHKE  159

Query  927  EKK  935
             K+
Sbjct  160  HKE  162



>ref|XP_006602336.1| PREDICTED: homeobox-leucine zipper protein HOX5-like isoform 
X3 [Glycine max]
Length=249

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            K RRLTS+QV  L+ +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE 
Sbjct  81   KTRRLTSEQVQFLQSNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLET  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  LK+S+  L   Y+ +L++N KLK EVN L++ +    +E + DD   +   SR K 
Sbjct  141  DYGMLKASYHVLKRDYDNLLQENDKLKEEVNSLNRLIPREQEEQNSDDTSCDTVNSRHKE  200

Query  927  EKKCDFTRIHSSIGHRDKIP  986
             K+     I++   +  ++P
Sbjct  201  HKEHKDLIINTGSENGSEVP  220



>ref|XP_010554012.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 
X1 [Tarenaya hassleriana]
Length=236

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            +K RLT++QV++LE++F  E K+E  R+ +LA NLGL PRQVAVWFQNRRAR K KQ+E+
Sbjct  64   RKHRLTAEQVNLLEKNFQEENKLEPLRKSQLAKNLGLPPRQVAVWFQNRRARSKVKQIEK  123

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGN  866
             YD LKS +D L   +  +L+ N+KLKAEV  L++KL+ +
Sbjct  124  QYDLLKSLYDSLREKHELVLEANEKLKAEVLTLTEKLQAS  163



>ref|NP_001280955.1| homeobox-leucine zipper protein ATHB-13-like [Malus domestica]
 ref|XP_008352991.1| PREDICTED: homeobox-leucine zipper protein ATHB-13-like [Malus 
domestica]
 gb|ADL36711.1| HD domain class transcription factor [Malus domestica]
Length=286

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  81   KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK   D + +  + +  QNQKL+AE+  L  +       ++ D EG  +  S   +
Sbjct  141  DYDLLKRQFDAIKADNDALQSQNQKLQAEIMALKNREPAESINLNKDTEGSCSNRSENNS  200

Query  927  EKKCDFTRI  953
            + K D +R 
Sbjct  201  DIKLDISRT  209



>ref|NP_001280996.1| homeobox-leucine zipper protein ATHB-13-like [Malus domestica]
 gb|ADL36715.1| HD domain class transcription factor [Malus domestica]
Length=289

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  81   KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK   D + +  + +  QNQKL+AE+  L  +       ++ D EG  +  S   +
Sbjct  141  DYDLLKRQFDAIKADNDALQSQNQKLQAEIMALKNREPAESINLNKDTEGSCSNRSENNS  200

Query  927  EKKCDFTRI  953
            + K D +R 
Sbjct  201  DIKLDISRT  209



>ref|XP_009391328.1| PREDICTED: homeobox-leucine zipper protein HOX4-like [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  53   KKRRLSVEQVRALERSFEVENKLEPERKLRLAQDLGLQPRQVAVWFQNRRARWKTKQLER  112

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            DY  LK+S++ L   Y+ + +  + L A++  L  KL G
Sbjct  113  DYTTLKASYEALRLDYDSLHRDKESLLAQIEELKAKLTG  151



>ref|XP_002462311.1| hypothetical protein SORBIDRAFT_02g023650 [Sorghum bicolor]
 gb|EER98832.1| hypothetical protein SORBIDRAFT_02g023650 [Sorghum bicolor]
Length=317

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = +3

Query  570  KRRLTSQQVDVLERSFSGEK-KVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KRRLT++QV  LE SF  EK K+E ER+ ELA  LG+ PRQVAVWFQNRRARW+ KQLE+
Sbjct  101  KRRLTAEQVRELELSFEEEKRKLEPERKSELARRLGIAPRQVAVWFQNRRARWRTKQLEQ  160

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEG  863
            D+D L+++HD LL+  + +L  N +L+++V  L++KL+ 
Sbjct  161  DFDRLRAAHDDLLAGRDALLADNDRLRSQVITLTEKLQA  199



>ref|XP_006602335.1| PREDICTED: homeobox-leucine zipper protein HOX5-like isoform 
X2 [Glycine max]
Length=288

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 0/140 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            K RRLTS+QV  L+ +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE 
Sbjct  45   KTRRLTSEQVQFLQSNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLET  104

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  LK+S+  L   Y+ +L++N KLK EVN L++ +    +E + DD   +   SR K 
Sbjct  105  DYGMLKASYHVLKRDYDNLLQENDKLKEEVNSLNRLIPREQEEQNSDDTSCDTVNSRHKE  164

Query  927  EKKCDFTRIHSSIGHRDKIP  986
             K+     I++   +  ++P
Sbjct  165  HKEHKDLIINTGSENGSEVP  184



>ref|XP_006344287.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Solanum 
tuberosum]
Length=296

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV+ LE+SF  E K+E ER+ +LA   GL PRQVA+WFQNRRAR K KQLE+
Sbjct  80   KKRRLLPKQVEFLEKSFEVENKLEPERKVQLAKETGLQPRQVAIWFQNRRARCKTKQLEK  139

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCK  872
            +YD LK+S D L + Y+ + K+N+ L+ EV+LL  KL  + K
Sbjct  140  NYDVLKASFDKLKTQYDCLFKENESLRNEVHLLKDKLINSVK  181



>ref|NP_001132844.1| uncharacterized protein LOC100194336 [Zea mays]
 gb|ACF81861.1| unknown [Zea mays]
 gb|ACL53107.1| unknown [Zea mays]
 gb|AFU81595.1| HB-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA40308.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein [Zea mays]
Length=273

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 80/134 (60%), Gaps = 8/134 (6%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  51   KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  110

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  L+ S+D L   ++ + +    L AE+  L  KL         DDE   A  + +KA
Sbjct  111  DYAALRRSYDALRLDHDALRRDKDALLAEIRELKAKL--------GDDEDAAASFTSVKA  162

Query  927  EKKCDFTRIHSSIG  968
            E         + +G
Sbjct  163  EPAASDGPAPAGVG  176



>gb|ABC86566.1| homeodomain-leucine zipper transcription factor TaHDZipI-1 [Triticum 
aestivum]
Length=247

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  53   KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  112

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY+ L+ S+D L   ++ + +  + L AE+  L  KL
Sbjct  113  DYNALRHSYDALRVDHDALRRDKEALLAEIKDLKGKL  149



>ref|XP_010917010.1| PREDICTED: homeobox-leucine zipper protein HOX21 [Elaeis guineensis]
Length=289

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 85/143 (59%), Gaps = 3/143 (2%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV  LE++F    K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  88   KKRRLNSEQVRTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEK  147

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DYD LK   + + S  + +  QN+KL+AE+  L  +       ++ + EG  +  S   +
Sbjct  148  DYDVLKRQFEAIKSENDALQAQNKKLQAEILALKGRETSELINLNKETEGSCSNRSENSS  207

Query  927  EKKCDFTR---IHSSIGHRDKIP  986
            E   D +R   I S +     IP
Sbjct  208  ENNLDISRTSAIESPLNPHQSIP  230



>ref|XP_009766848.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Nicotiana 
sylvestris]
Length=289

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL   QV  LE+SF  + K+E ER+ +LA  LGL PRQ+A+WFQNRRAR+K K LE+
Sbjct  70   KKRRLLPNQVQFLEKSFEVDNKLEPERKVQLAQELGLQPRQIAIWFQNRRARYKTKLLEK  129

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD LK+S D L   Y+ + K+N+ L+ EV+LL +KL
Sbjct  130  DYDVLKASFDKLKDDYDTLFKENENLRNEVDLLKEKL  166



>ref|XP_009373197.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Pyrus 
x bretschneideri]
Length=274

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLER
Sbjct  55   KKRRLNSEQVKALERNFDVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLER  114

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDD  884
            DY  LK+ +D L  +++ + +QN+ L  +++ L  KL G   + +D
Sbjct  115  DYSILKTDYDGLKLNFDSLERQNKALAEKLSQLKAKLYGESAQRND  160



>ref|XP_010470979.1| PREDICTED: homeobox-leucine zipper protein ATHB-13-like [Camelina 
sativa]
Length=296

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  86   KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEG  896
            DYD LK   D L S  + +   NQKL+AE+  L  + +     ++ D EG
Sbjct  146  DYDTLKRQFDALKSENDLLQTHNQKLQAEIMGLKSREQTESINLNKDTEG  195



>ref|XP_007146109.1| hypothetical protein PHAVU_006G013200g [Phaseolus vulgaris]
 gb|ESW18103.1| hypothetical protein PHAVU_006G013200g [Phaseolus vulgaris]
Length=252

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LER+F  + K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLER
Sbjct  57   KKRRLSLDQVKALERNFELDNKLEPERKSKLAQQLGLQPRQVAIWFQNRRARWKTKQLER  116

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  LKS++D L   YN + + N+ L  +V+ L +KL
Sbjct  117  DYGILKSNYDVLKVEYNNLEQDNEALTVQVSELKEKL  153



>ref|XP_009348036.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Pyrus 
x bretschneideri]
Length=274

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL S+QV  LER+F  E K+E ER+ +LA  LGL PRQVA+WFQNRRARWK KQLER
Sbjct  55   KKRRLNSEQVKALERNFEVENKLEPERKVKLAEELGLQPRQVAIWFQNRRARWKTKQLER  114

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDD  884
            DY  LK+ +D L  +++ + +QN+ L  +++ L  KL G   + +D
Sbjct  115  DYSILKTDYDGLKLNFDSLERQNKALAEKLSQLKAKLYGESAQRND  160



>ref|XP_007225770.1| hypothetical protein PRUPE_ppa009498mg [Prunus persica]
 ref|XP_008221655.1| PREDICTED: homeobox-leucine zipper protein ATHB-13 [Prunus mume]
 gb|EMJ26969.1| hypothetical protein PRUPE_ppa009498mg [Prunus persica]
Length=290

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 91/170 (54%), Gaps = 5/170 (3%)
 Frame = +3

Query  567   KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
             KKRRL  +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  81    KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  140

Query  747   DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
             DYD LK   + + +  + +  QNQKL+AE+  L  +       ++ + EG  +  S   +
Sbjct  141   DYDVLKRQFEAIKADNDALQAQNQKLQAEILALKSREPAESINLNKETEGSCSNRSENNS  200

Query  927   EKKCDFTRIHSSIGHRDKIPEEEYGNPKQELLMDNYYYYCVCGSGNTYNN  1076
             + K D +R  +        P+  + NP    L  +       G    + N
Sbjct  201   DIKLDISRTPAI-----DSPQSTHPNPTSRTLFSSSLIRPPSGVAQLFQN  245



>ref|XP_003553206.1| PREDICTED: homeobox-leucine zipper protein HOX5-like isoform 
X1 [Glycine max]
Length=324

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 0/123 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            K RRLTS+QV  L+ +F  E K+E ER+ +LA  LG+ PRQVA+WFQNRRAR+K KQLE 
Sbjct  81   KTRRLTSEQVQFLQSNFEVENKLEPERKVQLAKELGMQPRQVAIWFQNRRARFKTKQLET  140

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  LK+S+  L   Y+ +L++N KLK EVN L++ +    +E + DD   +   SR K 
Sbjct  141  DYGMLKASYHVLKRDYDNLLQENDKLKEEVNSLNRLIPREQEEQNSDDTSCDTVNSRHKE  200

Query  927  EKK  935
             K+
Sbjct  201  HKE  203



>ref|XP_008667301.1| PREDICTED: uncharacterized protein LOC100194336 isoform X1 [Zea 
mays]
 gb|AFT92045.1| homeodomain leucine zipper protein 10 [Zea mays]
 tpg|DAA40310.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein isoform 1 [Zea mays]
 tpg|DAA40311.1| TPA: putative homeobox DNA-binding and leucine zipper domain 
family protein isoform 2 [Zea mays]
Length=274

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 80/134 (60%), Gaps = 8/134 (6%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+++QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  52   KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  111

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGKNAPPSRMKA  926
            DY  L+ S+D L   ++ + +    L AE+  L  KL         DDE   A  + +KA
Sbjct  112  DYAALRRSYDALRLDHDALRRDKDALLAEIRELKAKL--------GDDEDAAASFTSVKA  163

Query  927  EKKCDFTRIHSSIG  968
            E         + +G
Sbjct  164  EPAASDGPAPAGVG  177



>ref|XP_001763968.1| predicted protein [Physcomitrella patens]
 gb|EDQ71107.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LER+F  E K+E ER+ +LA  LGL PRQVAVWFQNRRARWK KQLER
Sbjct  92   KKRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKIKQLER  151

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGK--NAPPSRM  920
            DY+ L   ++ L S +  +LK  + LK EVN L        K VD  +  +  + P S  
Sbjct  152  DYETLTQDYNRLKSDFEAVLKDKKNLKDEVNRLKGITTEEEKNVDASEPTQCSSQPASPA  211

Query  921  KAEKKCDFTRIHSSIGHRDKIP  986
            ++EK    T    S    D +P
Sbjct  212  QSEKSDIVTSKVRSTPTIDVLP  233



>ref|XP_010415638.1| PREDICTED: homeobox-leucine zipper protein ATHB-13-like [Camelina 
sativa]
Length=301

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL  +QV  LE++F    K+E ER+ +LA  LGL PRQ+A+WFQNRRARWK KQLE+
Sbjct  86   KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEK  145

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEG  896
            DYD LK   D L S  + +   NQKL+AE+  L  + +     ++ D EG
Sbjct  146  DYDTLKRQFDALKSENDLLQTHNQKLQAEIMGLKSREQTESINLNKDTEG  195



>emb|CDY11680.1| BnaC06g12880D [Brassica napus]
Length=178

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRLT +QV++LE+SF  E K+E ER+ ELA  LGL  RQVAVWFQNR+AR K K++ER
Sbjct  26   KKRRLTVEQVNMLEKSFEEENKLEPERKTELAKMLGLPQRQVAVWFQNRKARCKIKKIER  85

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKLEGNCKEVDDDDEGK  899
            DYD LK+ +D LL+ +  ++ +N+KLK++V  L++ L     +   + +GK
Sbjct  86   DYDVLKACYDSLLAKHESVISENEKLKSKVFTLTEMLLPAAHQTQRNLQGK  136



>ref|XP_003608986.1| Homeobox-leucine zipper protein ATHB-6 [Medicago truncatula]
 gb|ACJ85107.1| unknown [Medicago truncatula]
 gb|AES91183.1| homeobox leucine zipper family protein [Medicago truncatula]
 gb|AFK37983.1| unknown [Medicago truncatula]
Length=337

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+  QV  LE+SF  + K+E ER+ +LA +LGL PRQVA+WFQNRRARWK KQLE+
Sbjct  95   KKRRLSVDQVQFLEKSFEEDNKLEPERKTKLAKDLGLQPRQVAIWFQNRRARWKTKQLEK  154

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DYD L   ++ L + Y+ +LK+  +L++EV  L++K+
Sbjct  155  DYDSLNDGYESLKTEYDNLLKEKDRLQSEVASLTEKV  191



>ref|NP_001062064.1| Os08g0481400 [Oryza sativa Japonica Group]
 sp|Q6Z248.1|HOX20_ORYSJ RecName: Full=Homeobox-leucine zipper protein HOX20; AltName: 
Full=HD-ZIP protein HOX20; AltName: Full=Homeodomain transcription 
factor HOX20; AltName: Full=OsHox20 [Oryza sativa Japonica 
Group]
 sp|A2YWC0.1|HOX20_ORYSI RecName: Full=Homeobox-leucine zipper protein HOX20; AltName: 
Full=HD-ZIP protein HOX20; AltName: Full=Homeodomain transcription 
factor HOX20; AltName: Full=OsHox20 [Oryza sativa Indica 
Group]
 dbj|BAD10283.1| putative homeodomain leucine zipper protein [Oryza sativa Japonica 
Group]
 dbj|BAF23978.1| Os08g0481400 [Oryza sativa Japonica Group]
 gb|EAZ07381.1| hypothetical protein OsI_29633 [Oryza sativa Indica Group]
 dbj|BAG90822.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97844.1| unnamed protein product [Oryza sativa Japonica Group]
Length=269

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  567  KKRRLTSQQVDVLERSFSGEKKVEAERRKELASNLGLHPRQVAVWFQNRRARWKAKQLER  746
            KKRRL+ +QV  LERSF  E K+E ER+  LA +LGL PRQVAVWFQNRRARWK KQLER
Sbjct  43   KKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLER  102

Query  747  DYDELKSSHDYLLSHYNFILKQNQKLKAEVNLLSKKL  857
            DY  L+ S+D L + ++ + +    L AE+  L  KL
Sbjct  103  DYAALRQSYDALRADHDALRRDKDALLAEIKELKGKL  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3261434872332