BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20704_g2_i1 len=1570 path=[1141:0-290 1432:291-1218 2360:1219-1242
3704:1243-1263 4483:1264-1266 3727:1267-1569]

Length=1570
                                                                      Score     E

ref|XP_009604550.1|  PREDICTED: uncharacterized protein LOC104099302    276   2e-80   
gb|AAM34765.1|AF509865_1  nam-like protein 2                            271   2e-80   Petunia x hybrida [garden petunia]
ref|XP_009762029.1|  PREDICTED: NAC domain-containing protein 78-...    275   3e-80   
ref|XP_006355149.1|  PREDICTED: NAC domain-containing protein 78-...    265   4e-78   
ref|XP_006355148.1|  PREDICTED: NAC domain-containing protein 78-...    265   4e-78   
ref|XP_006355147.1|  PREDICTED: NAC domain-containing protein 78-...    265   8e-78   
ref|XP_004249904.1|  PREDICTED: uncharacterized protein LOC101248635    266   2e-76   
ref|XP_004235079.1|  PREDICTED: NAC domain-containing protein 78-...    251   1e-73   
emb|CDP04701.1|  unnamed protein product                                250   3e-72   
ref|XP_006351034.1|  PREDICTED: uncharacterized protein LOC102602510    251   2e-70   
ref|XP_011099748.1|  PREDICTED: uncharacterized protein LOC105178089    211   4e-57   
ref|XP_003523228.1|  PREDICTED: NAC domain-containing protein 74-...    190   4e-50   
gb|EPS72463.1|  nam-like protein 2                                      182   2e-48   
ref|XP_003631915.2|  PREDICTED: NAC domain-containing protein 45        185   8e-48   
emb|CBI37545.3|  unnamed protein product                                185   8e-48   
gb|EYU23774.1|  hypothetical protein MIMGU_mgv1a007138mg                182   9e-48   
gb|EYU23773.1|  hypothetical protein MIMGU_mgv1a007138mg                181   1e-47   
ref|XP_010090859.1|  NAC domain-containing protein 78                   180   2e-47   
ref|XP_007137718.1|  hypothetical protein PHAVU_009G150100g             180   1e-46   
gb|KDO58324.1|  hypothetical protein CISIN_1g036240mg                   178   2e-46   
ref|XP_006432239.1|  hypothetical protein CICLE_v10001200mg             178   2e-46   
ref|XP_006432238.1|  hypothetical protein CICLE_v10001200mg             178   3e-46   
gb|KDP42610.1|  hypothetical protein JCGZ_24384                         178   6e-46   
gb|AGL39698.1|  NAC transcription factor 042                            178   6e-46   
ref|XP_006581767.1|  PREDICTED: NAC domain-containing protein 74 ...    177   7e-46   
ref|XP_008813044.1|  PREDICTED: NAC domain-containing protein 74-...    176   9e-46   
gb|KEH19942.1|  plant NAC domain protein                                174   1e-45   
gb|KHN31143.1|  NAC domain-containing protein 78                        177   2e-45   
ref|XP_008813045.1|  PREDICTED: NAC domain-containing protein 74-...    175   2e-45   
gb|AET03169.2|  plant NAC domain protein                                176   3e-45   
gb|AAF68626.1|AF254124_1  NAC1                                          174   3e-45   Medicago truncatula
gb|KEH19941.1|  plant NAC domain protein                                175   4e-45   
ref|XP_003628693.1|  NAC domain-containing protein                      174   4e-45   
gb|ACD39370.1|  NAC domain protein                                      174   6e-45   Glycine max [soybeans]
ref|XP_002517259.1|  transcription factor, putative                     173   7e-45   Ricinus communis
ref|XP_006581768.1|  PREDICTED: NAC domain-containing protein 74 ...    174   9e-45   
ref|XP_003630260.1|  NAC domain-containing protein                      174   1e-44   
ref|XP_003526861.1|  PREDICTED: NAC domain-containing protein 74 ...    173   4e-44   
gb|KHN09607.1|  NAC domain-containing protein 78                        173   5e-44   
gb|EAY96181.1|  hypothetical protein OsI_18065                          171   5e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_007048346.1|  NAC domain containing protein 82, putative         169   5e-44   
ref|XP_002448842.1|  hypothetical protein SORBIDRAFT_06g034210          171   5e-44   Sorghum bicolor [broomcorn]
ref|XP_009382939.1|  PREDICTED: NAC domain-containing protein 100...    171   8e-44   
ref|XP_007204688.1|  hypothetical protein PRUPE_ppa007785mg             169   9e-44   
ref|XP_009382937.1|  PREDICTED: NAC domain-containing protein 100...    171   1e-43   
ref|NP_001169920.1|  uncharacterized protein LOC100383817               170   1e-43   Zea mays [maize]
gb|AIZ68168.1|  NAC domain-containing protein 74-like isoform X1        171   1e-43   
ref|XP_008441051.1|  PREDICTED: NAC domain-containing protein 19        171   1e-43   
ref|XP_010521054.1|  PREDICTED: NAC domain-containing protein 2-like    169   2e-43   
ref|XP_008779162.1|  PREDICTED: uncharacterized protein LOC103698888    173   2e-43   
ref|XP_007159836.1|  hypothetical protein PHAVU_002G271700g             167   2e-43   
ref|XP_008656268.1|  PREDICTED: NAC domain-containing protein 55-...    170   3e-43   
ref|XP_007023902.1|  NAC domain containing protein 82, putative         166   4e-43   
ref|XP_011022982.1|  PREDICTED: NAC domain-containing protein 72-...    168   5e-43   
ref|XP_009376546.1|  PREDICTED: NAC domain-containing protein 55-...    167   7e-43   
ref|XP_006858416.1|  hypothetical protein AMTR_s00071p00055960          170   1e-42   
ref|XP_006843116.1|  hypothetical protein AMTR_s00140p00087970          171   1e-42   
emb|CDY21575.1|  BnaC09g47170D                                          167   2e-42   
ref|XP_010270428.1|  PREDICTED: NAC domain-containing protein 89-...    168   2e-42   
ref|XP_010270427.1|  PREDICTED: NAC domain-containing protein 78-...    169   2e-42   
ref|XP_004165784.1|  PREDICTED: uncharacterized LOC101203420            168   2e-42   
ref|XP_004148655.1|  PREDICTED: uncharacterized protein LOC101203420    168   2e-42   
ref|XP_002310505.1|  hypothetical protein POPTR_0007s03840g             167   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010260495.1|  PREDICTED: NAC domain-containing protein 78-...    169   2e-42   
ref|XP_004959911.1|  PREDICTED: uncharacterized protein LOC101776162    168   2e-42   
ref|XP_004962024.1|  PREDICTED: NAC domain-containing protein 55-...    167   2e-42   
gb|KEH35593.1|  NAC domain class transcription factor                   163   2e-42   
ref|XP_010911663.1|  PREDICTED: NAC domain-containing protein 89-...    166   3e-42   
ref|XP_006399410.1|  hypothetical protein EUTSA_v10013785mg             164   3e-42   
ref|XP_010909878.1|  PREDICTED: NAC domain-containing protein 2-like    166   3e-42   
ref|XP_008787444.1|  PREDICTED: NAC domain-containing protein 78        169   3e-42   
ref|XP_010911657.1|  PREDICTED: NAC domain-containing protein 48-...    166   4e-42   
gb|AGL39700.1|  NAC transcription factor 044                            168   5e-42   
ref|XP_010935813.1|  PREDICTED: NAC domain-containing protein 78-...    169   6e-42   
ref|XP_010935812.1|  PREDICTED: NAC domain-containing protein 78-...    169   6e-42   
ref|XP_008456549.1|  PREDICTED: NAC domain-containing protein 78-...    168   7e-42   
ref|XP_008456548.1|  PREDICTED: NAC domain-containing protein 78-...    168   7e-42   
ref|XP_010485308.1|  PREDICTED: NAC domain-containing protein 74-...    163   7e-42   
ref|XP_004150380.1|  PREDICTED: NAC domain-containing protein 78-...    167   8e-42   
ref|XP_006280680.1|  hypothetical protein CARUB_v10026643mg             164   9e-42   
ref|XP_002873395.1|  hypothetical protein ARALYDRAFT_487745             165   9e-42   
ref|XP_006399407.1|  hypothetical protein EUTSA_v10013785mg             164   1e-41   
ref|XP_006287905.1|  hypothetical protein CARUB_v10001139mg             164   1e-41   
ref|XP_010461360.1|  PREDICTED: NAC domain-containing protein 18-...    164   1e-41   
ref|XP_004290501.1|  PREDICTED: uncharacterized protein LOC101314425    164   1e-41   
gb|KEH35592.1|  NAC domain class transcription factor                   163   1e-41   
emb|CDX69911.1|  BnaA10g22600D                                          165   1e-41   
gb|EMT22201.1|  NAC domain-containing protein 78                        165   1e-41   
ref|XP_003602603.1|  NAC domain protein                                 163   2e-41   
ref|XP_009122507.1|  PREDICTED: protein CUP-SHAPED COTYLEDON 2          165   2e-41   
ref|XP_008649658.1|  PREDICTED: uncharacterized protein LOC103630378    165   2e-41   
ref|XP_007010051.1|  NAC domain containing protein 2, putative is...    164   2e-41   
ref|XP_010491550.1|  PREDICTED: NAC domain-containing protein 89-...    164   2e-41   
gb|EMS46324.1|  NAC domain-containing protein 78                        164   2e-41   
ref|XP_010674451.1|  PREDICTED: NAC domain-containing protein 78-...    162   3e-41   
ref|XP_003568407.1|  PREDICTED: NAC domain-containing protein 74-...    165   3e-41   
gb|AHN60146.1|  NAC transcription factor 82                             164   3e-41   
ref|XP_010423010.1|  PREDICTED: NAC domain-containing protein 2-like    164   3e-41   
ref|XP_007048341.1|  NAC domain containing protein 82, putative         161   4e-41   
ref|XP_010452909.1|  PREDICTED: NAC domain-containing protein 2-like    162   5e-41   
ref|XP_007010050.1|  NAC domain protein, IPR003441, putative isof...    166   5e-41   
emb|CDX81124.1|  BnaC03g03780D                                          161   5e-41   
ref|XP_011032332.1|  PREDICTED: NAC transcription factor 29-like        162   5e-41   
gb|ADZ55681.1|  NAC transcription factor                                164   6e-41   
dbj|BAG32519.1|  transcription factor                                   163   6e-41   Hordeum vulgare subsp. vulgare [barley]
dbj|BAJ86914.1|  predicted protein                                      163   7e-41   
gb|ABR18034.1|  unknown                                                 166   7e-41   Picea sitchensis
ref|NP_196495.1|  NAC domain containing protein 82                      164   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446811.1|  PREDICTED: NAC domain-containing protein 78-...    165   7e-41   
ref|XP_009150476.1|  PREDICTED: NAC domain-containing protein 78        160   8e-41   
ref|XP_011024334.1|  PREDICTED: NAC domain-containing protein 78-...    165   8e-41   
ref|XP_011024333.1|  PREDICTED: NAC domain-containing protein 78-...    165   8e-41   
ref|XP_007201392.1|  hypothetical protein PRUPE_ppa007941mg             160   9e-41   
ref|XP_002315338.2|  hypothetical protein POPTR_0010s23650g             164   9e-41   Populus trichocarpa [western balsam poplar]
ref|XP_009418629.1|  PREDICTED: NAC domain-containing protein 78 ...    165   9e-41   
ref|XP_002532627.1|  conserved hypothetical protein                     164   1e-40   Ricinus communis
ref|XP_006378789.1|  NAC domain-containing protein 78                   164   1e-40   
ref|XP_009418630.1|  PREDICTED: NAC domain-containing protein 78 ...    165   1e-40   
ref|XP_004502932.1|  PREDICTED: NAC domain-containing protein 78-...    160   1e-40   
emb|CDX84485.1|  BnaC03g50150D                                          160   1e-40   
emb|CDY44793.1|  BnaC02g00940D                                          160   1e-40   
ref|XP_002866590.1|  ANAC103                                            160   2e-40   
ref|XP_010243195.1|  PREDICTED: NAC domain-containing protein 78-...    164   2e-40   
ref|XP_010243196.1|  PREDICTED: NAC domain-containing protein 78-...    164   2e-40   
ref|XP_004142444.1|  PREDICTED: NAC domain-containing protein 78-...    163   2e-40   
ref|XP_010444332.1|  PREDICTED: NAC domain-containing protein 78-...    160   2e-40   
ref|NP_201211.1|  NAC domain containing protein 103                     160   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940544.1|  PREDICTED: uncharacterized protein LOC105059077    164   2e-40   
emb|CDO99814.1|  unnamed protein product                                164   2e-40   
ref|XP_004502931.1|  PREDICTED: NAC domain-containing protein 78-...    160   2e-40   
gb|KDO47588.1|  hypothetical protein CISIN_1g007598mg                   161   2e-40   
ref|XP_008381837.1|  PREDICTED: NAC domain-containing protein 67-...    160   3e-40   
gb|KGN52230.1|  hypothetical protein Csa_5G622470                       163   3e-40   
ref|XP_004970791.1|  PREDICTED: NAC domain-containing protein 68-...    161   4e-40   
ref|XP_009383926.1|  PREDICTED: NAC domain-containing protein 78-...    163   4e-40   
ref|XP_010267268.1|  PREDICTED: NAC domain-containing protein 78-...    163   4e-40   
ref|XP_010547665.1|  PREDICTED: uncharacterized protein LOC104819339    160   4e-40   
ref|XP_008348770.1|  PREDICTED: NAC domain-containing protein 78-...    159   4e-40   
ref|XP_009383919.1|  PREDICTED: NAC domain-containing protein 78-...    163   4e-40   
ref|XP_011031619.1|  PREDICTED: NAC domain-containing protein 78-...    162   5e-40   
gb|AGC97442.1|  NAC protein 12                                          158   6e-40   
gb|KHG06113.1|  NAC domain-containing 78 -like protein                  158   6e-40   
ref|XP_009420175.1|  PREDICTED: NAC domain-containing protein 74-...    159   6e-40   
gb|AGC27316.1|  NAC domain protein 13                                   162   6e-40   
gb|KDO47585.1|  hypothetical protein CISIN_1g007598mg                   162   6e-40   
gb|KDO47584.1|  hypothetical protein CISIN_1g007598mg                   162   7e-40   
gb|KDO47586.1|  hypothetical protein CISIN_1g007598mg                   162   7e-40   
ref|XP_007144249.1|  hypothetical protein PHAVU_007G140500g             162   7e-40   
ref|XP_006436536.1|  hypothetical protein CICLE_v10031147mg             162   7e-40   
ref|XP_006436535.1|  hypothetical protein CICLE_v10031147mg             162   8e-40   
ref|XP_006654429.1|  PREDICTED: NAC domain-containing protein 43-...    160   8e-40   
gb|AHA84185.1|  NAC domain-containing protein 78                        162   8e-40   
ref|XP_006585360.1|  PREDICTED: NAC domain-containing protein 78-...    157   8e-40   
ref|XP_004173168.1|  PREDICTED: NAC domain-containing protein 78-...    162   9e-40   
ref|XP_006849894.1|  hypothetical protein AMTR_s00022p00094930          162   1e-39   
ref|XP_006382846.1|  hypothetical protein POPTR_0005s06040g             159   1e-39   
ref|XP_003531450.1|  PREDICTED: NAC domain-containing protein 78-...    157   1e-39   
ref|XP_010261099.1|  PREDICTED: NAC domain-containing protein 89-...    161   1e-39   
ref|XP_006654428.1|  PREDICTED: NAC domain-containing protein 43-...    160   1e-39   
ref|XP_011031618.1|  PREDICTED: NAC domain-containing protein 78-...    161   1e-39   
ref|XP_011076897.1|  PREDICTED: NAC domain-containing protein 78-...    161   1e-39   
ref|XP_003556302.1|  PREDICTED: NAC domain-containing protein 78-...    161   2e-39   
emb|CDY58437.1|  BnaC03g71220D                                          160   2e-39   
gb|AHJ79209.1|  NAC domain protein NAC68                                157   2e-39   
emb|CAN70406.1|  hypothetical protein VITISV_021988                     160   2e-39   Vitis vinifera
ref|XP_002265345.2|  PREDICTED: NAC domain-containing protein 78        160   2e-39   Vitis vinifera
ref|XP_010032131.1|  PREDICTED: NAC domain-containing protein 78        160   2e-39   
ref|XP_009339471.1|  PREDICTED: NAC domain-containing protein 7-like    157   3e-39   
gb|KCW54236.1|  hypothetical protein EUGRSUZ_I00213                     159   3e-39   
ref|XP_007201045.1|  hypothetical protein PRUPE_ppa006028mg             158   3e-39   
ref|XP_010027672.1|  PREDICTED: NAC domain-containing protein 19-...    159   4e-39   
ref|XP_002311983.2|  NAC domain-containing protein 78                   160   4e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010090439.1|  NAC domain-containing protein 78                   160   4e-39   
ref|XP_006379522.1|  hypothetical protein POPTR_0008s03170g             160   4e-39   
ref|XP_008237527.1|  PREDICTED: NAC domain-containing protein 78-...    158   4e-39   
gb|KCW54237.1|  hypothetical protein EUGRSUZ_I00213                     159   4e-39   
ref|XP_009125756.1|  PREDICTED: NAC domain-containing protein 89-...    157   4e-39   
ref|XP_010027671.1|  PREDICTED: NAC domain-containing protein 19-...    159   5e-39   
gb|AGV29475.1|  putative NAC domain class transcription factor          155   6e-39   
ref|XP_006394207.1|  hypothetical protein EUTSA_v10004501mg             155   6e-39   
ref|XP_008369167.1|  PREDICTED: NAC domain-containing protein 68-...    156   6e-39   
gb|EMT06613.1|  NAC domain-containing protein 78                        157   7e-39   
ref|XP_010543581.1|  PREDICTED: NAC domain-containing protein 78-...    159   7e-39   
emb|CDY11289.1|  BnaA03g01250D                                          159   8e-39   
ref|XP_009130822.1|  PREDICTED: NAC domain-containing protein 78-...    159   9e-39   
ref|XP_009130821.1|  PREDICTED: NAC domain-containing protein 78-...    159   9e-39   
gb|EEC79258.1|  hypothetical protein OsI_20033                          155   1e-38   Oryza sativa Indica Group [Indian rice]
gb|EMS50266.1|  NAC domain-containing protein 78                        155   1e-38   
ref|XP_009386218.1|  PREDICTED: NAC domain-containing protein 78-...    159   1e-38   
ref|XP_011044815.1|  PREDICTED: NAC domain-containing protein 69 ...    157   1e-38   
ref|XP_008232319.1|  PREDICTED: NAC domain-containing protein 78 ...    158   1e-38   
ref|XP_010027667.1|  PREDICTED: uncharacterized protein LOC104418...    159   1e-38   
ref|XP_008232318.1|  PREDICTED: NAC domain-containing protein 78 ...    158   2e-38   
ref|XP_006398899.1|  hypothetical protein EUTSA_v10013110mg             158   2e-38   
ref|NP_001055600.1|  Os05g0426200                                       156   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006345843.1|  PREDICTED: NAC domain-containing protein 78-...    157   2e-38   
ref|XP_010027670.1|  PREDICTED: uncharacterized protein LOC104418...    158   2e-38   
gb|KFK38438.1|  hypothetical protein AALP_AA3G113300                    157   2e-38   
gb|KDO47587.1|  hypothetical protein CISIN_1g007598mg                   157   2e-38   
ref|XP_010027668.1|  PREDICTED: uncharacterized protein LOC104418...    158   2e-38   
ref|XP_009410688.1|  PREDICTED: NAC domain-containing protein 67-...    155   2e-38   
ref|XP_010486664.1|  PREDICTED: NAC domain-containing protein 78        157   2e-38   
ref|XP_011044813.1|  PREDICTED: NAC domain-containing protein 69 ...    157   2e-38   
ref|XP_007218872.1|  hypothetical protein PRUPE_ppa003239mg             157   2e-38   
gb|EYU39671.1|  hypothetical protein MIMGU_mgv1a003896mg                157   2e-38   
ref|XP_004290500.1|  PREDICTED: NAC domain-containing protein 78-...    155   2e-38   
gb|AFU61114.1|  NAC domain class transcription factor                   155   3e-38   
ref|XP_004307017.1|  PREDICTED: NAC domain-containing protein 78-...    157   3e-38   
ref|XP_002882677.1|  ANAC053                                            157   3e-38   
ref|XP_006297351.1|  hypothetical protein CARUB_v10013370mg             157   3e-38   
ref|XP_010423583.1|  PREDICTED: NAC domain-containing protein 78 ...    157   3e-38   
ref|XP_004239710.1|  PREDICTED: NAC domain-containing protein 78-...    157   3e-38   
ref|XP_010490950.1|  PREDICTED: NAC domain-containing protein 78-...    157   4e-38   
ref|XP_010552948.1|  PREDICTED: NAC domain-containing protein 78-...    157   4e-38   
ref|XP_009619467.1|  PREDICTED: NAC domain-containing protein 78-...    154   4e-38   
ref|XP_010452337.1|  PREDICTED: NAC domain-containing protein 78-...    157   4e-38   
ref|XP_010243336.1|  PREDICTED: NAC domain-containing protein 74-...    157   4e-38   
ref|XP_009599412.1|  PREDICTED: NAC domain-containing protein 78-...    157   4e-38   
ref|XP_009418258.1|  PREDICTED: uncharacterized protein LOC103998499    157   4e-38   
ref|XP_009780872.1|  PREDICTED: NAC domain-containing protein 78-...    154   5e-38   
ref|XP_002871092.1|  hypothetical protein ARALYDRAFT_908325             156   5e-38   
ref|XP_011101544.1|  PREDICTED: NAC domain-containing protein 78-...    156   5e-38   
emb|CDY44853.1|  BnaC09g50530D                                          156   5e-38   
ref|XP_011101543.1|  PREDICTED: NAC domain-containing protein 78-...    156   5e-38   
ref|XP_009771992.1|  PREDICTED: NAC domain-containing protein 78-...    155   6e-38   
ref|XP_010464726.1|  PREDICTED: NAC domain-containing protein 78-...    156   8e-38   
ref|XP_004173925.1|  PREDICTED: NAC domain-containing protein 78-...    149   8e-38   
gb|AAG51388.1|AC011560_20  unknown protein; 75639-73470                 155   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306731.1|  no apical meristem family protein                  156   9e-38   Populus trichocarpa [western balsam poplar]
ref|NP_566376.1|  NAC domain containing protein 53                      155   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003581627.1|  PREDICTED: NAC domain-containing protein 102...    153   9e-38   
gb|KHN00770.1|  NAC domain-containing protein 78                        155   1e-37   
gb|EYU32441.1|  hypothetical protein MIMGU_mgv1a002437mg                156   1e-37   
ref|XP_004496134.1|  PREDICTED: NAC domain-containing protein 78-...    155   1e-37   
gb|KEH43609.1|  NAC transcription factor-like protein                   155   1e-37   
gb|AAM34772.1|AF509872_1  nam-like protein 9                            154   1e-37   Petunia x hybrida [garden petunia]
ref|XP_009771991.1|  PREDICTED: NAC domain-containing protein 78-...    155   1e-37   
emb|CDY41354.1|  BnaA01g31650D                                          155   1e-37   
ref|XP_009346652.1|  PREDICTED: NAC domain-containing protein 78-...    155   2e-37   
ref|XP_010490948.1|  PREDICTED: NAC domain-containing protein 78-...    155   2e-37   
ref|XP_010423582.1|  PREDICTED: NAC domain-containing protein 78 ...    155   2e-37   
ref|XP_009122853.1|  PREDICTED: NAC domain-containing protein 78        155   2e-37   
emb|CDO99813.1|  unnamed protein product                                153   2e-37   
ref|XP_010452336.1|  PREDICTED: NAC domain-containing protein 78-...    155   2e-37   
ref|NP_196061.1|  NAC family transcriptional activator                  155   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250028.1|  PREDICTED: NAC domain-containing protein 78        154   2e-37   
gb|AAM65338.1|  NAC, putative                                           155   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24891.1|  hypothetical protein AALP_AA8G038000                    155   2e-37   
ref|XP_006407560.1|  hypothetical protein EUTSA_v10020438mg             155   2e-37   
ref|XP_009122601.1|  PREDICTED: NAC domain-containing protein 78-...    155   2e-37   
emb|CDX70227.1|  BnaA10g25760D                                          154   2e-37   
ref|XP_003556180.1|  PREDICTED: uncharacterized protein LOC100787...    154   2e-37   
gb|KHN17058.1|  NAC domain-containing protein 78                        154   2e-37   
ref|NP_001274375.1|  uncharacterized protein LOC100794925               154   2e-37   
ref|XP_002527114.1|  transcription factor, putative                     148   2e-37   Ricinus communis
ref|XP_006361710.1|  PREDICTED: NAC domain-containing protein 78-...    154   2e-37   
ref|NP_001280771.1|  uncharacterized LOC103400464                       154   3e-37   
ref|XP_009625486.1|  PREDICTED: NAC domain-containing protein 78-...    154   3e-37   
gb|KEH17171.1|  NAC transcription factor-like protein                   154   3e-37   
ref|XP_008339779.1|  PREDICTED: NAC domain-containing protein 78-...    154   3e-37   
gb|AAM34767.1|AF509867_1  nam-like protein 4                            152   3e-37   Petunia x hybrida [garden petunia]
ref|XP_006361711.1|  PREDICTED: NAC domain-containing protein 78-...    154   3e-37   
ref|XP_007201824.1|  hypothetical protein PRUPE_ppa009242mg             149   4e-37   
gb|AFN55267.2|  NAC domain protein                                      154   4e-37   
gb|AHJ79186.1|  NAC domain protein NAC45                                154   4e-37   
ref|XP_009341181.1|  PREDICTED: NAC domain-containing protein 78-...    153   4e-37   
ref|XP_009385171.1|  PREDICTED: uncharacterized protein LOC103972538    154   5e-37   
ref|XP_010694513.1|  PREDICTED: NAC domain-containing protein 78        153   6e-37   
ref|XP_002444576.1|  hypothetical protein SORBIDRAFT_07g023900          154   6e-37   Sorghum bicolor [broomcorn]
gb|ADL36811.1|  NAC domain class transcription factor                   154   6e-37   
ref|XP_008345397.1|  PREDICTED: NAC domain-containing protein 78-...    153   7e-37   
gb|AFK44385.1|  unknown                                                 145   8e-37   
ref|XP_009764398.1|  PREDICTED: NAC domain-containing protein 78-...    152   8e-37   
ref|XP_008677550.1|  PREDICTED: uncharacterized protein LOC100382...    152   8e-37   
ref|XP_009346650.1|  PREDICTED: NAC domain-containing protein 78-...    153   8e-37   
ref|XP_009346651.1|  PREDICTED: NAC domain-containing protein 78-...    153   8e-37   
gb|KHG10038.1|  NAC domain-containing 78 -like protein                  153   8e-37   
dbj|BAK01976.1|  predicted protein                                      150   9e-37   
ref|XP_004496404.1|  PREDICTED: NAC domain-containing protein 89-...    152   1e-36   
ref|XP_008796590.1|  PREDICTED: uncharacterized protein LOC103712002    152   1e-36   
ref|XP_008447750.1|  PREDICTED: uncharacterized protein LOC103490150    152   1e-36   
gb|EPS65703.1|  nam-like protein 9                                      152   1e-36   
ref|XP_004139781.1|  PREDICTED: uncharacterized protein LOC101221991    152   1e-36   
ref|XP_010908788.1|  PREDICTED: NAC domain-containing protein 86-...    151   1e-36   
ref|XP_009361439.1|  PREDICTED: NAC domain-containing protein 78-...    152   1e-36   
ref|XP_008339778.1|  PREDICTED: NAC domain-containing protein 78-...    152   2e-36   
ref|XP_010696509.1|  PREDICTED: NAC domain-containing protein 74-...    151   2e-36   
ref|NP_001168544.1|  uncharacterized protein LOC100382324               152   2e-36   
ref|XP_010270698.1|  PREDICTED: NAC domain-containing protein 45 ...    152   2e-36   
ref|XP_010270697.1|  PREDICTED: NAC domain-containing protein 45 ...    152   2e-36   
ref|XP_009625487.1|  PREDICTED: NAC domain-containing protein 78-...    149   3e-36   
gb|AGY49287.1|  putative membrane bound NAC transcription factor 2      152   3e-36   
ref|XP_009796718.1|  PREDICTED: NAC domain-containing protein 78-...    149   3e-36   
ref|XP_004237849.1|  PREDICTED: uncharacterized protein LOC101260636    151   3e-36   
gb|AFP93563.1|  NAC                                                     149   3e-36   
ref|XP_007143604.1|  hypothetical protein PHAVU_007G085600g             151   3e-36   
ref|XP_004496133.1|  PREDICTED: NAC domain-containing protein 78-...    151   3e-36   
gb|ADE34584.1|  NAC transcription factor NTL5                           151   4e-36   
gb|EPS59231.1|  nam-like protein 7                                      142   4e-36   
ref|XP_004974231.1|  PREDICTED: uncharacterized protein LOC101754925    151   4e-36   
ref|XP_010485001.1|  PREDICTED: NAC domain-containing protein 78-...    150   4e-36   
ref|NP_001062518.1|  Os08g0562200                                       151   4e-36   
gb|EAZ08024.1|  hypothetical protein OsI_30288                          151   5e-36   
dbj|BAJ91676.1|  predicted protein                                      151   5e-36   
ref|XP_006434567.1|  hypothetical protein CICLE_v10000612mg             150   5e-36   
dbj|BAD09612.1|  putative NAC2 protein                                  150   5e-36   
ref|XP_008778272.1|  PREDICTED: uncharacterized protein LOC103698082    151   5e-36   
ref|XP_009390804.1|  PREDICTED: NAC transcription factor 29-like        147   5e-36   
ref|XP_010908787.1|  PREDICTED: NAC domain-containing protein 86-...    151   5e-36   
ref|XP_010094888.1|  NAC domain-containing protein 78                   150   6e-36   
ref|XP_006434569.1|  hypothetical protein CICLE_v10000612mg             150   6e-36   
ref|XP_006434568.1|  hypothetical protein CICLE_v10000612mg             150   6e-36   
gb|KEH43317.1|  NAC transcription factor-like protein                   150   6e-36   
gb|KEH43319.1|  NAC transcription factor-like protein                   150   6e-36   
gb|AGY49285.1|  putative membrane bound NAC transcription factor 2      150   7e-36   
ref|XP_004290458.1|  PREDICTED: uncharacterized protein LOC101301547    150   7e-36   
ref|XP_009786294.1|  PREDICTED: uncharacterized protein LOC104234432    150   9e-36   
ref|XP_009599075.1|  PREDICTED: NAC domain-containing protein 74-...    150   9e-36   
ref|NP_001288459.1|  uncharacterized LOC103630963                       150   9e-36   
ref|XP_006473160.1|  PREDICTED: uncharacterized protein LOC102615...    149   9e-36   
ref|XP_011026293.1|  PREDICTED: NAC domain-containing protein 74-...    150   9e-36   
ref|XP_006473159.1|  PREDICTED: uncharacterized protein LOC102615...    150   1e-35   
ref|XP_011026292.1|  PREDICTED: uncharacterized protein LOC105126...    150   1e-35   
ref|XP_007144247.1|  hypothetical protein PHAVU_007G140300g             143   1e-35   
gb|EMS53104.1|  NAC domain-containing protein 78                        151   1e-35   
ref|XP_007020194.1|  NAC domain protein, IPR003441, putative isof...    149   1e-35   
ref|XP_007020195.1|  NAC domain protein, IPR003441, putative isof...    149   1e-35   
ref|XP_008796459.1|  PREDICTED: uncharacterized protein LOC103711919    149   1e-35   
tpg|DAA42981.1|  TPA: putative NAC domain transcription factor su...    150   1e-35   
ref|XP_002468623.1|  hypothetical protein SORBIDRAFT_01g049240          150   1e-35   
gb|EMT24735.1|  NAC domain-containing protein 78                        146   1e-35   
ref|XP_002265611.1|  PREDICTED: uncharacterized protein LOC100249427    149   1e-35   
ref|XP_007020198.1|  NAC domain protein, IPR003441, putative isof...    149   1e-35   
gb|KDO47589.1|  hypothetical protein CISIN_1g007598mg                   148   2e-35   
ref|XP_004985948.1|  PREDICTED: uncharacterized protein LOC101753...    150   2e-35   
ref|XP_006436534.1|  hypothetical protein CICLE_v10031147mg             148   2e-35   
ref|NP_001146336.1|  putative NAC domain transcription factor sup...    150   2e-35   
ref|XP_007020196.1|  NAC domain protein, IPR003441, putative isof...    149   2e-35   
gb|ABR16648.1|  unknown                                                 150   2e-35   
ref|XP_004985947.1|  PREDICTED: uncharacterized protein LOC101753...    149   2e-35   
ref|XP_009613292.1|  PREDICTED: NAC domain-containing protein 19-...    148   2e-35   
ref|XP_008237396.1|  PREDICTED: uncharacterized protein LOC103336146    149   2e-35   
ref|XP_007201176.1|  hypothetical protein PRUPE_ppa003410mg             149   2e-35   
ref|XP_006386288.1|  hypothetical protein POPTR_0002s06210g             147   2e-35   
gb|EPS65704.1|  nam-like protein 4                                      142   2e-35   
gb|EMT21706.1|  NAC domain-containing protein 78                        151   2e-35   
ref|XP_002302150.1|  no apical meristem family protein                  149   2e-35   
ref|XP_006386287.1|  hypothetical protein POPTR_0002s06210g             148   2e-35   
ref|XP_006386290.1|  hypothetical protein POPTR_0002s06210g             149   3e-35   
gb|AIA57516.1|  NAC domain-containing protein                           149   3e-35   
ref|XP_010932189.1|  PREDICTED: NAC domain-containing protein 45-...    148   3e-35   
ref|XP_007020193.1|  NAC domain protein, IPR003441, putative isof...    148   3e-35   
gb|AAM34770.1|AF509870_1  nam-like protein 7                            148   3e-35   
gb|EYU36536.1|  hypothetical protein MIMGU_mgv1a003672mg                148   3e-35   
emb|CDP01144.1|  unnamed protein product                                148   3e-35   
ref|XP_009613291.1|  PREDICTED: uncharacterized protein LOC104106...    149   3e-35   
ref|XP_010530139.1|  PREDICTED: NAC domain-containing protein 86-...    148   3e-35   
ref|XP_006660391.1|  PREDICTED: uncharacterized protein LOC102710047    149   3e-35   
gb|KHG15925.1|  NAC domain-containing 78 -like protein                  149   3e-35   
ref|XP_008381037.1|  PREDICTED: uncharacterized protein LOC103443912    148   3e-35   
ref|XP_009386703.1|  PREDICTED: NAC domain-containing protein 69-...    148   3e-35   
ref|XP_011076898.1|  PREDICTED: NAC domain-containing protein 78-...    146   3e-35   
ref|XP_010932188.1|  PREDICTED: uncharacterized protein LOC105052...    148   4e-35   
ref|XP_009339761.1|  PREDICTED: uncharacterized protein LOC103931956    148   4e-35   
ref|XP_006386289.1|  hypothetical protein POPTR_0002s06210g             147   4e-35   
ref|XP_004496132.1|  PREDICTED: NAC domain-containing protein 7-l...    146   5e-35   
ref|XP_004252556.1|  PREDICTED: uncharacterized protein LOC101255476    147   5e-35   
gb|EMT23614.1|  NAC domain-containing protein 78                        147   6e-35   
ref|XP_010543143.1|  PREDICTED: uncharacterized protein LOC104816153    147   6e-35   
gb|AAM34771.1|AF509871_1  nam-like protein 8                            145   6e-35   
gb|KEH43321.1|  NAC transcription factor-like protein                   147   6e-35   
ref|XP_010478849.1|  PREDICTED: uncharacterized protein LOC104757765    147   6e-35   
ref|XP_010461249.1|  PREDICTED: uncharacterized protein LOC104741...    147   6e-35   
ref|XP_011101541.1|  PREDICTED: NAC domain-containing protein 78 ...    145   7e-35   
ref|XP_010694507.1|  PREDICTED: NAC domain-containing protein 2         145   7e-35   
ref|XP_011101542.1|  PREDICTED: NAC domain-containing protein 78 ...    145   7e-35   
ref|XP_009775199.1|  PREDICTED: NAC domain-containing protein 74-...    146   7e-35   
ref|XP_004496131.1|  PREDICTED: NAC domain-containing protein 7-l...    146   7e-35   
ref|XP_008779619.1|  PREDICTED: uncharacterized protein LOC103699374    147   7e-35   
ref|XP_010461248.1|  PREDICTED: uncharacterized protein LOC104741...    147   8e-35   
gb|EYU32440.1|  hypothetical protein MIMGU_mgv1a007979mg                144   8e-35   
gb|AGL39705.1|  NAC transcription factor 049                            147   9e-35   
ref|XP_010499959.1|  PREDICTED: uncharacterized protein LOC104777408    146   9e-35   
ref|XP_003536286.1|  PREDICTED: NAC domain-containing protein 7-like    145   1e-34   
gb|ADL36802.1|  NAC domain class transcription factor                   144   1e-34   
gb|KHN00952.1|  NAC domain-containing protein 78                        145   1e-34   
gb|KHN37882.1|  NAC domain-containing protein 78                        145   1e-34   
ref|XP_002891082.1|  ANAC017                                            146   1e-34   
ref|XP_008813657.1|  PREDICTED: NAC domain-containing protein 74-...    145   1e-34   
ref|XP_009415577.1|  PREDICTED: uncharacterized protein LOC103996378    146   1e-34   
ref|XP_006649289.1|  PREDICTED: uncharacterized protein LOC102717876    147   1e-34   
ref|NP_001173241.1|  Os03g0119966                                       147   1e-34   
ref|XP_003556303.1|  PREDICTED: NAC transcription factor NAM-B2-like    145   1e-34   
ref|XP_003573214.1|  PREDICTED: NAC domain-containing protein 78-...    147   1e-34   
gb|EAY88306.1|  hypothetical protein OsI_09763                          147   1e-34   
ref|XP_009775198.1|  PREDICTED: uncharacterized protein LOC104225...    147   1e-34   
ref|XP_008227899.1|  PREDICTED: uncharacterized protein LOC103327366    147   1e-34   
gb|KCW69271.1|  hypothetical protein EUGRSUZ_F02771                     145   1e-34   
ref|NP_564440.1|  NAC domain containing protein 17                      146   1e-34   
ref|XP_006307171.1|  hypothetical protein CARUB_v10008761mg             146   2e-34   
gb|KCW69274.1|  hypothetical protein EUGRSUZ_F02771                     145   2e-34   
ref|XP_004289565.1|  PREDICTED: uncharacterized protein LOC101298842    147   2e-34   
ref|XP_006396080.1|  hypothetical protein EUTSA_v10007221mg             145   2e-34   
ref|XP_010062193.1|  PREDICTED: uncharacterized protein LOC104449658    145   2e-34   
gb|KCW69273.1|  hypothetical protein EUGRSUZ_F02771                     145   2e-34   
ref|XP_007215001.1|  hypothetical protein PRUPE_ppa002384mg             147   2e-34   
ref|XP_009370574.1|  PREDICTED: uncharacterized protein LOC103959...    147   2e-34   
gb|AAF09254.1|AF201456_1  NAC2                                          145   2e-34   
gb|KCW69275.1|  hypothetical protein EUGRSUZ_F02771                     144   2e-34   
ref|XP_006345842.1|  PREDICTED: NAC domain-containing protein 78-...    143   3e-34   
ref|XP_007032209.1|  NAC domain protein, IPR003441, putative isof...    146   3e-34   
ref|XP_011074131.1|  PREDICTED: protein FEZ-like                        145   3e-34   
ref|XP_008343143.1|  PREDICTED: uncharacterized protein LOC103405...    146   3e-34   
ref|XP_004239709.1|  PREDICTED: NAC domain-containing protein 78        143   3e-34   
ref|XP_003562178.1|  PREDICTED: uncharacterized protein LOC100843938    146   3e-34   
gb|EYU36537.1|  hypothetical protein MIMGU_mgv1a005759mg                144   4e-34   
ref|XP_008446812.1|  PREDICTED: NAC domain-containing protein 77-...    144   4e-34   
ref|XP_009367106.1|  PREDICTED: uncharacterized protein LOC103956792    146   4e-34   
ref|XP_006415017.1|  hypothetical protein EUTSA_v10007196mg             145   4e-34   
ref|XP_006855594.1|  hypothetical protein AMTR_s00044p00058960          147   5e-34   
ref|XP_010090441.1|  NAC domain-containing protein 78                   144   5e-34   
ref|XP_006360295.1|  PREDICTED: uncharacterized protein LOC102591848    144   5e-34   
ref|XP_009145146.1|  PREDICTED: uncharacterized protein LOC103868845    144   6e-34   
ref|XP_010940742.1|  PREDICTED: NAC domain-containing protein 86-...    144   6e-34   
ref|XP_002267333.1|  PREDICTED: NAC domain-containing protein 86        145   7e-34   
emb|CDX73304.1|  BnaC05g28020D                                          144   7e-34   
ref|XP_008456695.1|  PREDICTED: uncharacterized protein LOC103496564    144   7e-34   
ref|XP_002891081.1|  ANAC016                                            144   7e-34   
emb|CBI27341.3|  unnamed protein product                                144   7e-34   
gb|AGV29534.1|  putative NAC domain class transcription factor          134   8e-34   
ref|XP_009370573.1|  PREDICTED: uncharacterized protein LOC103959...    145   8e-34   
gb|AAM67294.1|  NAM-like protein                                        144   9e-34   
ref|XP_006307119.1|  hypothetical protein CARUB_v10008706mg             143   9e-34   
ref|NP_564439.1|  NAC domain containing protein 16                      144   9e-34   
ref|NP_001077648.1|  NAC domain containing protein 16                   144   1e-33   
ref|XP_009114751.1|  PREDICTED: uncharacterized protein LOC103840...    143   1e-33   
ref|XP_008343142.1|  PREDICTED: uncharacterized protein LOC103405...    145   1e-33   
ref|XP_009114752.1|  PREDICTED: uncharacterized protein LOC103840...    143   1e-33   
gb|AIA57527.1|  NAC domain-containing protein                           143   1e-33   
ref|XP_010927489.1|  PREDICTED: LOW QUALITY PROTEIN: NAC domain-c...    143   1e-33   
gb|KFK45123.1|  hypothetical protein AALP_AA1G347100                    143   1e-33   
ref|XP_004142442.1|  PREDICTED: uncharacterized protein LOC101210923    141   2e-33   
ref|XP_006307120.1|  hypothetical protein CARUB_v10008706mg             142   2e-33   
ref|XP_004307019.1|  PREDICTED: uncharacterized protein LOC101300663    143   2e-33   
ref|XP_010241796.1|  PREDICTED: factor of DNA methylation 1-like        142   2e-33   
gb|EYU38937.1|  hypothetical protein MIMGU_mgv1a0250772mg               140   2e-33   
ref|XP_008381391.1|  PREDICTED: uncharacterized protein LOC103444...    144   2e-33   
ref|XP_010538911.1|  PREDICTED: uncharacterized protein LOC104813091    142   3e-33   
gb|KFK45122.1|  hypothetical protein AALP_AA1G347000                    142   3e-33   
emb|CDY48632.1|  BnaC06g08090D                                          142   3e-33   
ref|XP_009413063.1|  PREDICTED: uncharacterized protein LOC103994...    140   3e-33   
dbj|BAJ34165.1|  unnamed protein product                                141   4e-33   
emb|CDY46459.1|  BnaA08g06490D                                          138   4e-33   
gb|AGV29504.1|  putative NAC domain class transcription factor          136   4e-33   
ref|XP_002265550.1|  PREDICTED: NAC domain-containing protein 77-...    140   4e-33   
emb|CAN70405.1|  hypothetical protein VITISV_021987                     140   4e-33   
emb|CDX93723.1|  BnaA09g23230D                                          141   5e-33   
ref|XP_009383033.1|  PREDICTED: NAC domain-containing protein 67-...    139   6e-33   
ref|XP_010105605.1|  NAC domain-containing protein 78                   140   7e-33   
emb|CDP01698.1|  unnamed protein product                                142   7e-33   
ref|XP_010423584.1|  PREDICTED: NAC domain-containing protein 78 ...    140   8e-33   
ref|XP_008381390.1|  PREDICTED: uncharacterized protein LOC103444...    142   8e-33   
ref|XP_008375621.1|  PREDICTED: uncharacterized protein LOC103438860    142   9e-33   
emb|CDY70627.1|  BnaAnng34420D                                          132   9e-33   
ref|XP_002526579.1|  hypothetical protein RCOM_1603380                  142   9e-33   
ref|XP_008232317.1|  PREDICTED: uncharacterized protein LOC103331477    141   9e-33   
emb|CDX73305.1|  BnaC05g28010D                                          140   1e-32   
emb|CBI31390.3|  unnamed protein product                                138   1e-32   
ref|XP_010658329.1|  PREDICTED: NAC domain-containing protein 77-...    138   1e-32   
emb|CDY28401.1|  BnaA05g18390D                                          140   1e-32   
gb|AGV29495.1|  putative NAC domain class transcription factor          133   1e-32   
ref|XP_009145145.1|  PREDICTED: NAC domain-containing protein 74-...    140   1e-32   
ref|XP_009107934.1|  PREDICTED: NAC domain-containing protein 74-...    140   1e-32   
ref|XP_004140940.1|  PREDICTED: uncharacterized protein LOC101217428    140   1e-32   
ref|XP_009588904.1|  PREDICTED: protein BEARSKIN1-like                  140   1e-32   
tpg|DAA62620.1|  TPA: putative NAC domain transcription factor su...    132   1e-32   
ref|XP_010067201.1|  PREDICTED: uncharacterized protein LOC104454139    138   2e-32   
emb|CDY12515.1|  BnaC07g13550D                                          139   2e-32   
gb|KDO57313.1|  hypothetical protein CISIN_1g0079381mg                  137   2e-32   
ref|XP_006441340.1|  hypothetical protein CICLE_v10024520mg             134   2e-32   
gb|AGL39703.1|  NAC transcription factor 047                            140   2e-32   
ref|XP_009103221.1|  PREDICTED: NAC domain-containing protein 78 ...    139   2e-32   
ref|XP_009103220.1|  PREDICTED: NAC domain-containing protein 78 ...    139   2e-32   
ref|XP_006350487.1|  PREDICTED: NAC domain-containing protein 78-...    137   2e-32   
ref|XP_004159441.1|  PREDICTED: uncharacterized LOC101217428            139   3e-32   
ref|XP_011074130.1|  PREDICTED: NAC domain-containing protein 86-...    139   3e-32   
gb|AGL39699.1|  NAC transcription factor 043                            138   3e-32   
ref|XP_011096933.1|  PREDICTED: NAC domain-containing protein 45        139   3e-32   
gb|EAY88066.1|  hypothetical protein OsI_09496                          140   3e-32   
ref|XP_009413062.1|  PREDICTED: uncharacterized protein LOC103994...    139   3e-32   
ref|NP_001048559.1|  Os02g0822400                                       140   3e-32   
ref|XP_010461247.1|  PREDICTED: uncharacterized protein LOC104741989    139   4e-32   
ref|XP_001765136.1|  predicted protein                                  131   4e-32   
ref|XP_009765145.1|  PREDICTED: NAC domain-containing protein 78-...    138   5e-32   
ref|XP_009386284.1|  PREDICTED: NAC domain-containing protein 78-...    135   6e-32   
gb|AHJ79210.1|  NAC domain protein NAC69                                136   6e-32   
ref|XP_009361440.1|  PREDICTED: uncharacterized protein LOC103951718    139   6e-32   
ref|XP_010499958.1|  PREDICTED: uncharacterized protein LOC104777407    139   6e-32   
gb|KHG27497.1|  NAC domain-containing 78 -like protein                  137   6e-32   
ref|XP_006855593.1|  hypothetical protein AMTR_s00044p00058470          131   6e-32   



>ref|XP_009604550.1| PREDICTED: uncharacterized protein LOC104099302 [Nicotiana tomentosiformis]
 ref|XP_009604551.1| PREDICTED: uncharacterized protein LOC104099302 [Nicotiana tomentosiformis]
Length=693

 Score =   276 bits (707),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 246/468 (53%), Gaps = 84/468 (18%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SG RMNRATETGYWKTTG+DR + Y+E+ VG VKTLVFH+GH P
Sbjct  58    KDLEWYFFCPRERKYASGARMNRATETGYWKTTGKDRSINYDEKIVGSVKTLVFHQGHPP  117

Query  182   KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             +G+RTDWVIHEY+ ED+        QDSYVLCKVF+KSGPGPKNGAQYGAPF E DWED 
Sbjct  118   RGQRTDWVIHEYKFEDKGLADAGFAQDSYVLCKVFQKSGPGPKNGAQYGAPFKEADWEDD  177

Query  347   encdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVA  526
                     IP  P    C+S     D  C+              P + PD  N +    A
Sbjct  178   -------EIPAEP----CTS-----DVLCA--------------PPRRPDNKNYSIESEA  207

Query  527   DMIDPGCS---------------SRQPSNEPGPS-LSRLHADEVRPNNQNCS------VF  640
              M++PG +                R P +EP    L   H   V P N   S        
Sbjct  208   SMVNPGSTSGLPSSQPSPSLSSIQRMPLDEPNIEVLGEPHPSNVSPINWMPSDKLDDEGV  267

Query  641   TGTIDPGNTCS-------------RSLAN--PGPSLAVPHSSEVPPD--DDDISQFFASF  769
             TG  +P N  S              S+ N  PGPS A+  ++++P D  DD+I    A F
Sbjct  268   TGESNPSNIFSALPVLPEKQSLIDTSMINRGPGPSNALLCTNKMPLDEQDDEIIGLLAHF  327

Query  770   LEDTDLLPI--ENNENVNCCNQGLNVDMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGS  943
              EDT LL    ENN+N+   NQ +N    P  DGND++   G  +N+  L   RS  S S
Sbjct  328   TEDTTLLSDGNENNQNLENFNQDMNALPDPFTDGNDIFDGLGNIENWEGLGQSRSDLSAS  387

Query  944   LVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRTSEADPLVEENLYSSNASFLRMEHFNY  1123
                ++  N +   +DA ++ELNDL IP+DH   T E   L   N      S + ++ F +
Sbjct  388   WRANYSLNPMILPEDAAYMELNDLEIPLDHSAGTFETGRLALSNFCVPYKSNIDVQQFCF  447

Query  1124  GGNFSGGNQFIPTQSQLQVLPQHYTQQVTGIGF-------NASQGYNA  1246
             G N  G NQ    ++QL +LP+ YTQQV            N SQGYNA
Sbjct  448   GNNSLGINQDF-CENQLPMLPESYTQQVNHSDMVYNYYQNNVSQGYNA  494



>gb|AAM34765.1|AF509865_1 nam-like protein 2 [Petunia x hybrida]
Length=487

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 185/432 (43%), Positives = 243/432 (56%), Gaps = 43/432 (10%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SG RMNRATETGYWKTTG+DR V+Y+E+ VG VKTL+FH GH P
Sbjct  58    KDLEWYFFCPRERKYASGARMNRATETGYWKTTGKDRSVIYDEKVVGSVKTLIFHRGHPP  117

Query  182   KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             KG+RTDWVIHEYR ED+       +QD+YVLC+VF+K+G GPKNGAQYGAPF E+DWED 
Sbjct  118   KGQRTDWVIHEYRFEDKGLADAGFVQDAYVLCRVFQKNGLGPKNGAQYGAPFKEDDWEDD  177

Query  347   encdI-PFAI------PMHPSNQNCSSVTGMIDPECssrqpssepgssAIP--------P  481
             E     PF +      P  P NQ+ S V+ ++DP  +S   S EP   +I         P
Sbjct  178   EVPAAEPFTLDVFSAPPGLPENQSYSIVSSLVDPGSTSGWHSGEPSQPSIQRIPSDERDP  237

Query  482   AKLP-DPINQNCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDP  658
              +LP +P   N + +  M        +   E  PS + L A  V P+ ++ S+ +  I+P
Sbjct  238   GELPAEPNPSNVSSMNWMPSDKLDDEEVPGESNPS-NILSALLVLPDKESYSIGSSMINP  296

Query  659   GNTCSRSLANPGPSLAVPHSSEVPPD--DDDISQFFASFLEDTDLLPI--ENNENVNCCN  826
             G         PGPS A+  ++E+  D  DD+I    A F +D  LL    EN++N+   N
Sbjct  297   G---------PGPSNALLCTNEMHLDEQDDEIIGLLAHFTDDPSLLSAGNENSQNMENFN  347

Query  827   QGLNVDMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLEL  1006
             Q LN  + P   GND++   G  DN+A L   RS  S S   ++  N +   DD  F+EL
Sbjct  348   QDLNA-LTPFTGGNDIFDGLGDIDNWAGLGQSRSNISASWGANYSFNHMIVPDDVAFMEL  406

Query  1007  NDLVIPVDHCTRTSEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLP  1186
             NDL  P+ H   T E       N Y+   S + M+  ++  N          ++QL +LP
Sbjct  407   NDLETPLYHSAETIETGQFGLGNFYAPYNSNVDMQQLSFASNHV-------LENQLPMLP  459

Query  1187  QHYTQQVTGIGF  1222
               YTQQV   G 
Sbjct  460   VSYTQQVNHSGM  471



>ref|XP_009762029.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
 ref|XP_009762030.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=676

 Score =   275 bits (704),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 248/447 (55%), Gaps = 44/447 (10%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SG RMNRATETGYWKTTG+DR + Y+E+ VG VKTLVFH+GH P
Sbjct  58    KDLEWYFFCPRERKYASGARMNRATETGYWKTTGKDRSITYDEKIVGSVKTLVFHQGHPP  117

Query  182   KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             +G+RTDWVIHEY+ ED+        QDSYVLCKVF+KSGPGPKNGAQYGAPF E DWED 
Sbjct  118   RGQRTDWVIHEYKFEDKGLADAGFAQDSYVLCKVFQKSGPGPKNGAQYGAPFKEADWEDD  177

Query  347   encdIP------FAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLP-----  493
             E    P       A P  P N+N S  T MI+P  +S  PSS+   S     ++P     
Sbjct  178   EIPAEPCTSDVLCAPPQRPDNKNYSIETSMINPGSTSGWPSSQRSLSLSSIQRMPLDEPN  237

Query  494   -----DPINQNCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDP  658
                  +P   N + +  M          + E  PS +   A  V P  Q+  + T  I+ 
Sbjct  238   IEVPGEPRPSNVSPINWMPSDKLGDVGVTGESSPS-NIFSALPVLPEKQSL-IDTSMINS  295

Query  659   GNTCSRSLANPGPSLAVPHSSEVPPD--DDDISQFFASFLEDTDLLPI--ENNENVNCCN  826
             G         PGPS     ++++P D  DD+I    A F EDT LL    ENN+N+   N
Sbjct  296   G---------PGPSNTRLCTNKMPLDEQDDEIIGLLAHFTEDTTLLSAGNENNQNLENFN  346

Query  827   QGLNVDMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLEL  1006
               +N    P  DGND++   G  +++  L   RS  S +   ++  N +   +DA ++EL
Sbjct  347   PDMNALPDPFADGNDIFDGLGNIESWEGLGQSRSDLSANWRANYSLNPMILPEDAAYMEL  406

Query  1007  NDLVIPVDHCTRTSEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLP  1186
             NDL IP+DH   T E   L   NL +   S + ++ F +G N  G NQ    ++QL +LP
Sbjct  407   NDLEIPLDHSAGTIETGRLALSNLCAPYKSNIDVQEFCFGNNSLGINQDF-CENQLPMLP  465

Query  1187  QHYTQQVTGIGF-------NASQGYNA  1246
             + YTQQV            N SQGYNA
Sbjct  466   ESYTQQVNYSDMVYNYYQNNVSQGYNA  492



>ref|XP_006355149.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Solanum 
tuberosum]
Length=467

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 171/433 (39%), Positives = 235/433 (54%), Gaps = 68/433 (16%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCP +RKY SG RMNR TETG+WK TG+DR V+Y+E+ VG VKTLVFH+G AP
Sbjct  58    KDLEWYFFCPSKRKYASGFRMNRTTETGFWKITGKDRRVLYDEKFVGSVKTLVFHQGKAP  117

Query  182   KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPFneedw---  337
             +G+RTDWVIHEYR ED++        D+YVLCKVFKKSG GPKNGAQYGAPF EEDW   
Sbjct  118   RGQRTDWVIHEYRFEDKDIADAGFSLDAYVLCKVFKKSGSGPKNGAQYGAPFKEEDWEDN  177

Query  338   ---edcencdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQ  508
                       IP ++P+ P N+ CS VT     E     P+      AI    +PD  N 
Sbjct  178   ETPAKHNQSSIP-SLPL-PDNETCSIVTQPYIHEM----PAEPNSYGAISVPAMPD--NL  229

Query  509   NCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLAN  688
             +C+ +  M+DPG  S     EPGPS + L                               
Sbjct  230   SCSVITTMVDPGNKSLWHLTEPGPSSAEL-------------------------------  258

Query  689   PGPSLAVPHSSEVPPDDDD-ISQFFASFLEDTDLLPIENNENVNCCNQGLNVDMMPCMDG  865
                     +S ++P +++D + Q F +F+ED  +L   N +N+   +  +NV++    +G
Sbjct  259   --------YSKKMPQEEEDYMIQLFDNFIEDPAILFAGNEDNLGTND--MNVEVASFTNG  308

Query  866   NDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRT  1045
             N ++ + G  DN+ +L       S     D+  + +F Q D P+LELNDL IP+ H    
Sbjct  309   NAMHNSLGNLDNYVELDQTTFDLSVFQGTDYSHDSIFFQ-DVPYLELNDLKIPLSHSAEA  367

Query  1046  SEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQHYTQQVTGIGF-  1222
              E  P++  +    ++S + M  F +G N S  +Q +  Q+Q+ VLP+H+ QQV G    
Sbjct  368   IETTPVMMGDFCVPHSSDVDMRQFCFGSNSSARSQQVAGQNQIHVLPEHHIQQVIGYDLV  427

Query  1223  -----NASQGYNA  1246
                  N +Q YNA
Sbjct  428   NSDAANVNQAYNA  440



>ref|XP_006355148.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Solanum 
tuberosum]
Length=471

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 171/433 (39%), Positives = 235/433 (54%), Gaps = 68/433 (16%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCP +RKY SG RMNR TETG+WK TG+DR V+Y+E+ VG VKTLVFH+G AP
Sbjct  58    KDLEWYFFCPSKRKYASGFRMNRTTETGFWKITGKDRRVLYDEKFVGSVKTLVFHQGKAP  117

Query  182   KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPFneedw---  337
             +G+RTDWVIHEYR ED++        D+YVLCKVFKKSG GPKNGAQYGAPF EEDW   
Sbjct  118   RGQRTDWVIHEYRFEDKDIADAGFSLDAYVLCKVFKKSGSGPKNGAQYGAPFKEEDWEDN  177

Query  338   ---edcencdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQ  508
                       IP ++P+ P N+ CS VT     E     P+      AI    +PD  N 
Sbjct  178   ETPAKHNQSSIP-SLPL-PDNETCSIVTQPYIHEM----PAEPNSYGAISVPAMPD--NL  229

Query  509   NCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLAN  688
             +C+ +  M+DPG  S     EPGPS + L                               
Sbjct  230   SCSVITTMVDPGNKSLWHLTEPGPSSAEL-------------------------------  258

Query  689   PGPSLAVPHSSEVPPDDDD-ISQFFASFLEDTDLLPIENNENVNCCNQGLNVDMMPCMDG  865
                     +S ++P +++D + Q F +F+ED  +L   N +N+   +  +NV++    +G
Sbjct  259   --------YSKKMPQEEEDYMIQLFDNFIEDPAILFAGNEDNLGTND--MNVEVASFTNG  308

Query  866   NDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRT  1045
             N ++ + G  DN+ +L       S     D+  + +F Q D P+LELNDL IP+ H    
Sbjct  309   NAMHNSLGNLDNYVELDQTTFDLSVFQGTDYSHDSIFFQ-DVPYLELNDLKIPLSHSAEA  367

Query  1046  SEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQHYTQQVTGIGF-  1222
              E  P++  +    ++S + M  F +G N S  +Q +  Q+Q+ VLP+H+ QQV G    
Sbjct  368   IETTPVMMGDFCVPHSSDVDMRQFCFGSNSSARSQQVAGQNQIHVLPEHHIQQVIGYDLV  427

Query  1223  -----NASQGYNA  1246
                  N +Q YNA
Sbjct  428   NSDAANVNQAYNA  440



>ref|XP_006355147.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Solanum 
tuberosum]
Length=525

 Score =   265 bits (678),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 171/433 (39%), Positives = 234/433 (54%), Gaps = 68/433 (16%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCP +RKY SG RMNR TETG+WK TG+DR V+Y+E+ VG VKTLVFH+G AP
Sbjct  58    KDLEWYFFCPSKRKYASGFRMNRTTETGFWKITGKDRRVLYDEKFVGSVKTLVFHQGKAP  117

Query  182   KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPFneedw---  337
             +G+RTDWVIHEYR ED++        D+YVLCKVFKKSG GPKNGAQYGAPF EEDW   
Sbjct  118   RGQRTDWVIHEYRFEDKDIADAGFSLDAYVLCKVFKKSGSGPKNGAQYGAPFKEEDWEDN  177

Query  338   ---edcencdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQ  508
                       IP ++P+ P N+ CS VT     E     P+      AI    +PD  N 
Sbjct  178   ETPAKHNQSSIP-SLPL-PDNETCSIVTQPYIHE----MPAEPNSYGAISVPAMPD--NL  229

Query  509   NCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLAN  688
             +C+ +  M+DPG  S     EPGPS + L                               
Sbjct  230   SCSVITTMVDPGNKSLWHLTEPGPSSAEL-------------------------------  258

Query  689   PGPSLAVPHSSEVPPDDDD-ISQFFASFLEDTDLLPIENNENVNCCNQGLNVDMMPCMDG  865
                     +S ++P +++D + Q F +F+ED  +L   N +N+      +NV++    +G
Sbjct  259   --------YSKKMPQEEEDYMIQLFDNFIEDPAILFAGNEDNLG--TNDMNVEVASFTNG  308

Query  866   NDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRT  1045
             N ++ + G  DN+ +L       S     D+  + +F Q D P+LELNDL IP+ H    
Sbjct  309   NAMHNSLGNLDNYVELDQTTFDLSVFQGTDYSHDSIFFQ-DVPYLELNDLKIPLSHSAEA  367

Query  1046  SEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQHYTQQVTGIGF-  1222
              E  P++  +    ++S + M  F +G N S  +Q +  Q+Q+ VLP+H+ QQV G    
Sbjct  368   IETTPVMMGDFCVPHSSDVDMRQFCFGSNSSARSQQVAGQNQIHVLPEHHIQQVIGYDLV  427

Query  1223  -----NASQGYNA  1246
                  N +Q YNA
Sbjct  428   NSDAANVNQAYNA  440



>ref|XP_004249904.1| PREDICTED: uncharacterized protein LOC101248635 [Solanum lycopersicum]
 ref|XP_010312481.1| PREDICTED: uncharacterized protein LOC101248635 [Solanum lycopersicum]
Length=687

 Score =   266 bits (679),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 198/472 (42%), Positives = 262/472 (56%), Gaps = 41/472 (9%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SG RMNRAT+TGYWKTTG+DRPV Y E+ VG VKTLVFH GH P
Sbjct  58    KDLEWYFFCPRERKYASGARMNRATDTGYWKTTGKDRPVTYCEKIVGSVKTLVFHLGHPP  117

Query  182   KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             +GKRTDWVIHEY+ ED+E++     QDSYVLCKVF+KSGPGPKNGAQYGAPF EEDWED 
Sbjct  118   RGKRTDWVIHEYKFEDKESIDAGFAQDSYVLCKVFQKSGPGPKNGAQYGAPFKEEDWEDD  177

Query  347   encdIPFAIPMHPS------NQNCSSVTGMIDPECssrqpssepgssAIPPA--KLP--D  496
             +    P    + P+        + S+   M+DP  +S   SSE   S I P+  KLP  +
Sbjct  178   KIPAEPCTSDVFPAPPGRTDKPSGSNAIRMVDPRSTSDWTSSEQSPSPIQPSVQKLPLDE  237

Query  497   PINQNCTYVADMIDPGCSSRQPSNEPGPSLSR-LHADEVRPNNQNCSVFTGTIDPGNTCS  673
             P ++      ++ +    + +PS++     S    A  + P  Q+CSV TG ++PG    
Sbjct  238   PDDEELPGEPNLSNVSSINWRPSDQLKAKPSNTFSALPILPEEQSCSVDTGLVNPG----  293

Query  674   RSLANPGPSLAVPHSSEVPPD--DDDISQFFASFLEDTDLLP--IENNENVNCCNQGLNV  841
                  PGPS A   ++E+  D  DD++   FA F EDT LL    E N+ ++  +Q +N 
Sbjct  294   -----PGPSNAQMCTNEMALDDIDDEMIGLFAPFTEDTSLLSGGSEPNQKLDNFHQEVNA  348

Query  842   DMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPN-LLFPQD---DAPFLELN  1009
                 C DGND++   G  + +A +       + S   +H  N ++ PQ+   DA ++ELN
Sbjct  349   PPAACTDGNDIFDGLGDIEFWAGVGQLEPDLTASGGANHSLNPVILPQEAPQDAAYMELN  408

Query  1010  DLVIPVDHCTRTSEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQ  1189
             DL IP++H   T     LV     +   S   M+   +G N  G  Q    +  L  LP+
Sbjct  409   DLDIPLNHPAETIGTGQLVPGYFCTPYNSNNGMQQLCFGSNSLGIVQDF-GEHHLPALPE  467

Query  1190  HYTQQV----TGIGF--NASQGYNAMQVSGIEFNASQGFDYGFDTMMHEHGM  1327
              YTQQV        F  N +QGYNA     +  +  Q  D   DT   E G+
Sbjct  468   SYTQQVNHPDMAYNFLNNPNQGYNAATNFSVS-SYKQPEDRRLDTQNLERGV  518



>ref|XP_004235079.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=426

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 165/416 (40%), Positives = 225/416 (54%), Gaps = 62/416 (15%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCP ERKY SG +MNR T+ G+WK TGRDR V+Y+E+ VG VKTLVFH+G AP
Sbjct  58    KDLEWYFFCPSERKYASGFKMNRTTDIGFWKITGRDRRVLYDEKFVGSVKTLVFHQGKAP  117

Query  182   KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPFneedw---  337
             + +RTDWVIHEYR ED++T       D+YVLCKVFKKSGPGPKNGAQYGAPF EEDW   
Sbjct  118   RVQRTDWVIHEYRFEDKDTADAGFSLDAYVLCKVFKKSGPGPKNGAQYGAPFKEEDWEDN  177

Query  338   ---edcencdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQ  508
                 +     IP ++P+ P N+  S VT    P             +   PA +PD  NQ
Sbjct  178   ETPAEHNQSSIP-SLPL-PDNETRSIVT---QPYIHEMPVEPNSYGATSVPA-MPD--NQ  229

Query  509   NCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLAN  688
             +C+ +  M+DPG        EPGPS + L                               
Sbjct  230   SCSVITTMVDPGNKYLWHLTEPGPSSAEL-------------------------------  258

Query  689   PGPSLAVPHSSEVPPDDDD-ISQFFASFLEDTDLLPIENNENVNCCNQGLNVDMMPCMDG  865
                     +S ++P ++DD + Q F +F+ED  +L   N +N+      +NV++   + G
Sbjct  259   --------YSKKMPQEEDDYMIQLFDNFIEDPAILFAGNEDNLG--TNDMNVEVASFITG  308

Query  866   NDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRT  1045
             N ++   G  DN  +L       S     D+  + +F Q D P+LELNDL IP+ H    
Sbjct  309   NVMHHNLGNLDNCVELDQTTFDLSVFQGTDYSHDSIFFQ-DVPYLELNDLKIPLSHSAEA  367

Query  1046  SEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQHYTQQVTG  1213
              E  P++  N    ++S + +  F +G N S  +Q +  Q+QL VLP+++ QQV G
Sbjct  368   IETAPVMMGNFCVPHSSDVDLRQFCFGSNSSARSQQVAGQNQLHVLPEYHNQQVIG  423



>emb|CDP04701.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   250 bits (638),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 164/375 (44%), Positives = 210/375 (56%), Gaps = 41/375 (11%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SG RMNR+TETGYWKTTG+DRPV YN+ +VGMVKTLVFH+G AP
Sbjct  60    KDLEWYFFCPRERKYASGSRMNRSTETGYWKTTGKDRPVTYNKNSVGMVKTLVFHKGCAP  119

Query  182   KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             +G+RTDWVIHEYRIED         QD+YVLCK+F KSGPGPKNGA YGAPF EEDW+D 
Sbjct  120   RGQRTDWVIHEYRIEDRNLADMGDAQDAYVLCKLFHKSGPGPKNGASYGAPFREEDWDDD  179

Query  347   encdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVA  526
             E   +   +P  PS                            + P +   P N N +   
Sbjct  180   EEIPVDSLLPGGPS---------------------------TVEPVQ---PENDNSSAAI  209

Query  527   DMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLANPGPSLA  706
              ++D G +     NEPGPS  +   D V  N QN S+ T  +D G+    SL+  G + A
Sbjct  210   SLVDLGNAPLMRPNEPGPSFVQPSKDTVLSNGQNSSMVTRVVDAGSASGWSLSEAGLTSA  269

Query  707   VPHSSE---VPPDDDDISQFFASFLEDTDLLPIEN-NENVNCCNQGLNVDMMPCMDGNDV  874
               HS     + P DDDI    A+F ED+ LLP  N N  +    QG   + +P  DG D+
Sbjct  270   -SHSGNGMDMDPPDDDILHLLAAFSEDSPLLPTVNGNIELGDLGQGRAAEAIPHSDGGDL  328

Query  875   YTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRTSEA  1054
             +       N A+L+GG      +    +  N +  Q+D+ FLELNDL  P++   ++   
Sbjct  329   FGGLEDLSNLAELNGGGLNLFDNYQIGYTTNNMRLQEDSGFLELNDLDAPLNFTAQSCGP  388

Query  1055  DPLVEENLYS-SNAS  1096
             + +    LY  SN+S
Sbjct  389   EQMHTGGLYRPSNSS  403



>ref|XP_006351034.1| PREDICTED: uncharacterized protein LOC102602510 [Solanum tuberosum]
Length=783

 Score =   251 bits (642),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 185/442 (42%), Positives = 247/442 (56%), Gaps = 37/442 (8%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEWYFFCPRERKY SGGRMNRAT++GYWKTTG+DR V Y+E+ VG VKTLVFH GH P
Sbjct  58    KDLEWYFFCPRERKYASGGRMNRATDSGYWKTTGKDRYVTYDEKIVGSVKTLVFHLGHPP  117

Query  182   KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             +G+RTDW+IHEY+ ED+E++     QDSYVL KVF+KSGPGPKNGAQYGAPF EEDWED 
Sbjct  118   RGQRTDWLIHEYKFEDKESIDAGFAQDSYVLYKVFQKSGPGPKNGAQYGAPFKEEDWEDD  177

Query  347   encdIPF------AIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPA--KLP--D  496
             +    P       A P  P   + S+ T ++DP  +S  PSSE   S I P+  KLP  +
Sbjct  178   KIPAEPCTSDVFPAPPGRPDKPSTSNATRVVDPGSTSVWPSSELSPSPIQPSVQKLPLDE  237

Query  497   PINQNCTYVADMIDPGCSSRQPSNE-PGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCS  673
             P ++       + +    +  PS++    S +   A  + P  Q+CSV T   +PG    
Sbjct  238   PDDEELPGEPKLSNVSSINWMPSDQLKAKSSNIFSALPILPEKQSCSVDTSLANPG----  293

Query  674   RSLANPGPSLAVPHSSEVPPD--DDDISQFFASFLEDTDLLPIENNEN---VNCCNQGLN  838
                  PGPS     ++E+ PD  DD++   F  F EDT LL   N  N   +   +Q +N
Sbjct  294   -----PGPSNDQMCTNEMAPDELDDEMIGLFTQFTEDTSLLSGGNETNQQKLENFHQDVN  348

Query  839   VDMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLV  1018
                    DGND++   G  + +A +       + S   ++  N +    DA ++ELNDL 
Sbjct  349   APSAAFTDGNDIFDDLGDIEVWARVGQLEPDLTASGGANYSLNPVILPQDAAYMELNDLD  408

Query  1019  IPVDHCTRTSEADPLVEENLYSSNASFLRMEHFNYGGNFSGGNQFIPTQSQLQVLPQHYT  1198
             IP++H   T     LV  +  +   S + M+   +G N  G  Q    + +L  LP+ YT
Sbjct  409   IPLNHPAETIGTGQLVPGHFCTPYNSNIGMQQLCFGSNSLGIVQDF-GEHRLPTLPESYT  467

Query  1199  QQV----TGIGF--NASQGYNA  1246
             QQV        F  NA+ GYNA
Sbjct  468   QQVNHPDMAYNFQNNANHGYNA  489



>ref|XP_011099748.1| PREDICTED: uncharacterized protein LOC105178089 [Sesamum indicum]
Length=564

 Score =   211 bits (536),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 149/388 (38%), Positives = 195/388 (50%), Gaps = 77/388 (20%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             KDLEW+FFCPRE+KY SG R+ RATE GYWKTTG+DR + YN++TVG VKTLVFH GHAP
Sbjct  60    KDLEWFFFCPREKKYASGVRVKRATENGYWKTTGKDRSICYNDKTVGTVKTLVFHLGHAP  119

Query  182   KGKRTDWVIHEYRIEDEET----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
             +G+RTDWVIHEYRI D++     +QD+YVLCKVFKK+GPGPKNGAQYGAPFNE DW D  
Sbjct  120   QGERTDWVIHEYRILDDQLAAAGVQDTYVLCKVFKKNGPGPKNGAQYGAPFNEADWAD--  177

Query  350   ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
                         +  + +SV              S+  S ++ P KL  P+       A 
Sbjct  178   ------DDDDAATKTHAASVA-------------SDGLSVSVLPKKLICPLG------AG  212

Query  530   MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLANPGPSLAV  709
                PG +S  P  E GP                                 L + G S   
Sbjct  213   QFGPGSTSVVPLTEEGP---------------------------------LPSAGRS---  236

Query  710   PHSSEVPPD--DDDISQFFASFLEDTDLLPIENNENVNCCNQGLNVDMMPCMDGNDVYTA  883
               + EV  D  DD++ +  A F ++  LL   N  N N          + C DG D+Y  
Sbjct  237   --TGEVLEDENDDEMVRLLAPFTDEATLLFNNNEINQNDLGGKGKDKSLTCADGYDIYNG  294

Query  884   FGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDLVIPVDHCTRTSEADPL  1063
              G  D++  ++ G+   SG    D+  + +  QD+  ++EL+DL+ P+D C     A   
Sbjct  295   LGELDSWVQMNEGKLDFSGVQKDDYSMDNMISQDNLAYIELDDLLTPLD-C-----ASEE  348

Query  1064  VEENLYSSNASFLRMEHFNYGGNFSGGN  1147
             V  N  S    F    H N    +SGG 
Sbjct  349   VVTNQSSVGGIFGSRNHENVEQFYSGGT  376



>ref|XP_003523228.1| PREDICTED: NAC domain-containing protein 74-like [Glycine max]
Length=483

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 146/414 (35%), Positives = 200/414 (48%), Gaps = 78/414 (19%)
 Frame = +2

Query  5     DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
             DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DR + +N R VGM+KTLVFH G APK
Sbjct  60    DLNWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRAIEHNNRVVGMIKTLVFHTGRAPK  119

Query  185   GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc-  346
             G RTDWV+HE+R++     DE  LQDSYV+C+V++K GPGP+NGAQYG P+ E++WE   
Sbjct  120   GDRTDWVMHEFRLDDKVLADEGVLQDSYVICRVYQKEGPGPRNGAQYGKPYEEKEWETDE  179

Query  347   ---------------------encdIPFAIPMHPSNQNCSSVTGM-----IDPECssrqp  448
                                      I  A  +HPS   C+ +T +     + P CS+   
Sbjct  180   EIDSVQSAPVAAVCAPVPIQPSESHISVANYIHPSTSGCAGLTSVSCVSELMPSCSTHPS  239

Query  449   s-------sepgssAIP----PAKLPDPINQNCTYVADMIDPGCSSR--QPSNEPGPSLS  589
             +           S  IP    P  LP               P CS+    P+++ G S+S
Sbjct  240   APSNPVGTVSCVSELIPSCSEPHHLPSNNQVGSVSCVSEFMPSCSAHPSAPNSQVG-SVS  298

Query  590   RLH----ADEVRPNNQNCSVFTGTIDPGNTCSRSLAN--PGPSLAVPHSSEVP-------  730
             R+     +    P+  NC V  G++   +    S ++    PS  V   S VP       
Sbjct  299   RVSEFMPSCSAHPSAPNCQV--GSVSSASELMPSFSDHPSAPSNQVGSVSCVPELMTSCS  356

Query  731   -----PD---DDDISQFFASFLEDTDLLPIENN---ENVNCCNQGLNVDMMPCMDGNDVY  877
                  P+   D+DI      F ED D L ++ N   EN++  +Q  N D   C D N ++
Sbjct  357   AHPSAPNNQVDNDILSLLDCFFEDDDTLAVKENNRIENIDDPDQANNADGALCSDPNAIF  416

Query  878   TAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQD-----DAPFLELNDLVIP  1024
                G  ++   L  G S+  G         +L+  D     D  FLEL DL  P
Sbjct  417   EELGDLNSLVGLGEG-SFSCGQKNEYTTSEMLYTVDIFGSCDHDFLELLDLETP  469



>gb|EPS72463.1| nam-like protein 2 [Genlisea aurea]
Length=352

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPRE+KY SG R+ RAT+ GYWKTTG+DRP+ YN   VG VKTLVFH G+AP
Sbjct  60   KDLEWFFFCPREKKYASGTRVKRATKNGYWKTTGKDRPISYNAAIVGTVKTLVFHMGNAP  119

Query  182  KGKRTDWVIHEYRIEDEET----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RTDWVIHEYRI D+      L+D+YVLCK+FKKSGPGPKNGAQYGAPF
Sbjct  120  RGERTDWVIHEYRILDKHLAASGLEDAYVLCKLFKKSGPGPKNGAQYGAPF  170



>ref|XP_003631915.2| PREDICTED: NAC domain-containing protein 45 [Vitis vinifera]
Length=580

 Score =   185 bits (470),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFFCPR RKY SGGRMNR TE+GYWKTTG+DR VVY  RTVG ++TL+FH+G AP
Sbjct  60   RDREWYFFCPRARKYASGGRMNRTTESGYWKTTGKDRQVVYENRTVGQIRTLIFHQGRAP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV+HEYR+ED+       +QD++VLCK+F+KSGPGPKNGAQYGAPF
Sbjct  120  KGDRTDWVMHEYRLEDKVLVDRGIVQDAFVLCKIFQKSGPGPKNGAQYGAPF  171



>emb|CBI37545.3| unnamed protein product [Vitis vinifera]
Length=560

 Score =   185 bits (469),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFFCPR RKY SGGRMNR TE+GYWKTTG+DR VVY  RTVG ++TL+FH+G AP
Sbjct  60   RDREWYFFCPRARKYASGGRMNRTTESGYWKTTGKDRQVVYENRTVGQIRTLIFHQGRAP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV+HEYR+ED+       +QD++VLCK+F+KSGPGPKNGAQYGAPF
Sbjct  120  KGDRTDWVMHEYRLEDKVLVDRGIVQDAFVLCKIFQKSGPGPKNGAQYGAPF  171



>gb|EYU23774.1| hypothetical protein MIMGU_mgv1a007138mg [Erythranthe guttata]
Length=412

 Score =   182 bits (461),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPRE+KY SG R+ RATE GYWKTTG+DRP+ +N+R VG VKTLVFH G AP
Sbjct  60   KDLEWFFFCPREKKYASGVRVKRATENGYWKTTGKDRPISHNDRKVGSVKTLVFHLGTAP  119

Query  182  KGKRTDWVIHEYRIEDEET----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RTDWVIHEY+I D +     +QD++VLCKVFKK+GPGPKNGAQYGAPF
Sbjct  120  KGERTDWVIHEYKIVDAQLAAAGVQDTFVLCKVFKKNGPGPKNGAQYGAPF  170



>gb|EYU23773.1| hypothetical protein MIMGU_mgv1a007138mg [Erythranthe guttata]
Length=418

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPRE+KY SG R+ RATE GYWKTTG+DRP+ +N+R VG VKTLVFH G AP
Sbjct  60   KDLEWFFFCPREKKYASGVRVKRATENGYWKTTGKDRPISHNDRKVGSVKTLVFHLGTAP  119

Query  182  KGKRTDWVIHEYRIEDEET----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RTDWVIHEY+I D +     +QD++VLCKVFKK+GPGPKNGAQYGAPF
Sbjct  120  KGERTDWVIHEYKIVDAQLAAAGVQDTFVLCKVFKKNGPGPKNGAQYGAPF  170



>ref|XP_010090859.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB40984.1| NAC domain-containing protein 78 [Morus notabilis]
Length=381

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDL+WYFFCPRE+KY SG RM RATE GYWKTTG+DRPV YN   VGM+KTLVFH G AP
Sbjct  60   KDLKWYFFCPREKKYASGARMKRATEFGYWKTTGKDRPVNYNGEVVGMIKTLVFHTGRAP  119

Query  182  KGKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV+HEY ++     D   +QDSYVLC VFKK GPGP+NGAQYGAPF
Sbjct  120  KGDRTDWVMHEYMLQEKNLADRGVVQDSYVLCMVFKKEGPGPRNGAQYGAPF  171



>ref|XP_007137718.1| hypothetical protein PHAVU_009G150100g [Phaseolus vulgaris]
 gb|ESW09712.1| hypothetical protein PHAVU_009G150100g [Phaseolus vulgaris]
Length=481

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 125/371 (34%), Positives = 180/371 (49%), Gaps = 70/371 (19%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP+ +KY++GGR NR+TE GYWKTTG+DR V +  R VGMVKTLVFH G APK
Sbjct  61   DLEWYFFCPKGKKYSTGGRFNRSTEVGYWKTTGKDRAVEHKNRVVGMVKTLVFHTGKAPK  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc-  346
            G RTDWV+HE+R++D+E +     QDSYV+C++F+K GPGP+NGAQYG P++E++W+   
Sbjct  121  GDRTDWVMHEFRVDDKEMVDEGSSQDSYVICRIFRKEGPGPRNGAQYGKPYDEKEWDTDE  180

Query  347  ---------------------encdIPFAIPMHPSNQNCSSVTGM-----IDPECssrqp  448
                                     I  A  ++PS   C+ +T +     + P CS+   
Sbjct  181  EIDSVQSERVASMSTPVPIQPSESHISIANDINPSTSGCAGLTSVSCASKLMPSCSAYCV  240

Query  449  ssepgssAIP------PAKLPDPINQNCTYVADMIDPGCSSRQPSNEPGPSLSRLHADEV  610
             S     ++       P+    P + NC +  D +  G S   PS    P       D V
Sbjct  241  PSNNQIDSVSCVSELMPSCSALPFSPNCAF--DSVS-GLSKVTPSCSTVPLTPNYDVDSV  297

Query  611  RPNNQ---NCSVFTGT----ID----------------PGNTCS--RSLANPGPSLAVPH  715
               ++   +CS F+      +D                P N      S++   PS   P 
Sbjct  298  SCVSKLMPSCSAFSSAPNSEVDSVSVSKMPSCLPLASAPNNLVDTLSSVSELMPSCTAPS  357

Query  716  SSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCC--NQGLNVDMMPCMDGNDVYTAFG  889
             +    DD++I      F ED D + +  N  +     +Q  N +  PC+D N ++   G
Sbjct  358  PNH--QDDENILSLLDYFKEDDDTMAVNENNGIKKVDPDQANNAECAPCLDPNVIFENLG  415

Query  890  GRDNFADLSGG  922
              D+   L  G
Sbjct  416  DLDSLVGLGEG  426



>gb|KDO58324.1| hypothetical protein CISIN_1g036240mg [Citrus sinensis]
Length=434

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY +G RMNRATE GYWKTTG+DRPV YN   VGM+KTLVFH G AP+
Sbjct  61   DLKWYFFCPREKKYANGARMNRATEFGYWKTTGKDRPVQYNNEVVGMIKTLVFHRGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYRI+     +   +QD+YVLC VF+K GPGP+NGAQYGAPF
Sbjct  121  GDRTDWVMHEYRIDEPGLSERGVVQDAYVLCIVFQKDGPGPRNGAQYGAPF  171



>ref|XP_006432239.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006432240.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006432241.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006432242.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006432243.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006432244.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 ref|XP_006464643.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Citrus 
sinensis]
 gb|ESR45479.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45480.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45481.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45482.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45483.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45484.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
Length=434

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY +G RMNRATE GYWKTTG+DRPV YN   VGM+KTLVFH G AP+
Sbjct  61   DLKWYFFCPREKKYANGARMNRATEFGYWKTTGKDRPVQYNNEVVGMIKTLVFHRGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYRI+     +   +QD+YVLC VF+K GPGP+NGAQYGAPF
Sbjct  121  GDRTDWVMHEYRIDEPGLSERGVVQDAYVLCIVFQKDGPGPRNGAQYGAPF  171



>ref|XP_006432238.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
 gb|ESR45478.1| hypothetical protein CICLE_v10001200mg [Citrus clementina]
Length=433

 Score =   178 bits (451),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY +G RMNRATE GYWKTTG+DRPV YN   VGM+KTLVFH G AP+
Sbjct  61   DLKWYFFCPREKKYANGARMNRATEFGYWKTTGKDRPVQYNNEVVGMIKTLVFHRGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYRI+     +   +QD+YVLC VF+K GPGP+NGAQYGAPF
Sbjct  121  GDRTDWVMHEYRIDEPGLSERGVVQDAYVLCIVFQKDGPGPRNGAQYGAPF  171



>gb|KDP42610.1| hypothetical protein JCGZ_24384 [Jatropha curcas]
Length=474

 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY SG RMNRAT+ GYWKTTG+DR V YN   VGM+KTLVFH G APK
Sbjct  61   DLKWYFFCPREKKYASGTRMNRATDLGYWKTTGKDRTVQYNNEVVGMIKTLVFHRGKAPK  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV++EYR++++E       QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMYEYRLKEKELDAKGVAQDAYVLCSIFKKDGPGPRNGAQYGAPF  171



>gb|AGL39698.1| NAC transcription factor 042 [Jatropha curcas]
Length=473

 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY SG RMNRAT+ GYWKTTG+DR V YN   VGM+KTLVFH G APK
Sbjct  61   DLKWYFFCPREKKYASGTRMNRATDLGYWKTTGKDRTVQYNNEVVGMIKTLVFHRGKAPK  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV++EYR++++E       QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMYEYRLKEKELDAKGVAQDAYVLCSIFKKDGPGPRNGAQYGAPF  171



>ref|XP_006581767.1| PREDICTED: NAC domain-containing protein 74 isoform X2 [Glycine 
max]
Length=455

 Score =   177 bits (450),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 140/396 (35%), Positives = 201/396 (51%), Gaps = 71/396 (18%)
 Frame = +2

Query  5     DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
             DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DRP+ +N   VGM+KTLVFH G AP+
Sbjct  60    DLSWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRPIEHNNTVVGMIKTLVFHTGRAPR  119

Query  185   GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneed----w  337
             G RTDWV+HE+R++D     E   QD+YV+C+V++K GPGP+NGAQYG P++E++     
Sbjct  120   GDRTDWVMHEFRLDDKVLADEAVSQDAYVICRVYQKEGPGPRNGAQYGKPYDEKEWETDE  179

Query  338   edcencdIPFA-----IPMHPSNQNCSSV----------TGMIDPECssrqpssepgssA  472
             E       P A     +P+ PS  + S             G+    C S    S      
Sbjct  180   EIDSVQSAPVAAVCAPVPIQPSESHISVANYTHPSTSGCAGLTSVSCVSELMPSFS----  235

Query  473   IPPAKLPDPINQNCTYVADMIDPGC------SSRQPSNEPGPS--LSRLHADEVRPNNQN  628
              PP+   +P+  + + V++++ P C      S+ Q  + P  S  +    A    PN+Q 
Sbjct  236   -PPSTPKNPV-YSVSCVSELM-PSCLAHLLASNNQVDSVPCVSEFMPSCSAHPSAPNSQV  292

Query  629   CSVFTGTIDPGNTCSRSLANPGPSLAVPHSSEVPPD------------DDDISQFFASFL  772
              SV +G I   +  + S A+     +VP   E+ P             D  I  F    +
Sbjct  293   GSV-SGLIP--SFLAHSSASNNQVGSVPCVPELVPSCLAHPSAPNNQADVGILPFLDCSI  349

Query  773   EDTDLLPI-ENN--ENVNCCNQGLNVDMMPCMDGNDVYTAFGGRDNFADLSGGR------  925
             ED D L + ENN  ENV+  +Q  N +  PC D + ++   G  ++   L  G       
Sbjct  350   EDDDTLAVNENNSIENVDDPDQANNAERGPCSDPHAIFEDLGDLNSLVGLGEGSFSCGQK  409

Query  926   -SYPSGSLV--GDHPPNLLFPQDDAPFLELNDLVIP  1024
               Y + +++  GD     +F   D  FLEL DL  P
Sbjct  410   NEYTTSAMLYTGD-----IFRSCDHDFLELIDLETP  440



>ref|XP_008813044.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Phoenix 
dactylifera]
Length=402

 Score =   176 bits (446),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR+RKY +G R NRATE GYWKTTG+DR +++N  TVGM KTL+FH G AP
Sbjct  61   KDLEWYFFCPRDRKYANGSRTNRATEIGYWKTTGKDRAIIHNSHTVGMKKTLIFHVGKAP  120

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED+E +      D+YVLCK+F+KSGPGPK G QYGAPF
Sbjct  121  RGDRTDWVMYEYRLEDKELVVAGYSLDAYVLCKIFQKSGPGPKIGEQYGAPF  172



>gb|KEH19942.1| plant NAC domain protein [Medicago truncatula]
Length=340

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY +G RMNRATE G+WK TG+DR V  N +TVGM+KTL+FH G AP+
Sbjct  61   DLEWYFFCPIEKKYGNGSRMNRATEIGFWKATGKDRAVQQNNQTVGMIKTLIFHTGKAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED++      +QDSYV+CKVF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGIVQDSYVICKVFQKEGPGPRNGAQYGRPF  171



>gb|KHN31143.1| NAC domain-containing protein 78 [Glycine soja]
Length=507

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 92/111 (83%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DR + +N R VGM+KTLVFH G APK
Sbjct  60   DLNWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRAIEHNNRVVGMIKTLVFHTGRAPK  119

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R++     DE  LQDSYV+C+V++K GPGP+NGAQYG P+
Sbjct  120  GDRTDWVMHEFRLDDKVLADEGVLQDSYVICRVYQKEGPGPRNGAQYGKPY  170



>ref|XP_008813045.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008813046.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008813047.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Phoenix 
dactylifera]
Length=402

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR+RKY +G R NRATE GYWKTTG+DR +++N  TVGM KTL+FH G AP
Sbjct  61   KDLEWYFFCPRDRKYANGSRTNRATEIGYWKTTGKDRAIIHNSHTVGMKKTLIFHVGKAP  120

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED+E +     Q  YVLCK+F+KSGPGPK G QYGAPF
Sbjct  121  RGDRTDWVMYEYRLEDKELVVAGYSQGMYVLCKIFQKSGPGPKIGEQYGAPF  172



>gb|AET03169.2| plant NAC domain protein [Medicago truncatula]
Length=444

 Score =   176 bits (445),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY +G RMNRATE G+WK TG+DR V  N +TVGM+KTL+FH G AP+
Sbjct  61   DLEWYFFCPIEKKYGNGSRMNRATEIGFWKATGKDRAVQQNNQTVGMIKTLIFHTGKAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED++      +QDSYV+CKVF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGIVQDSYVICKVFQKEGPGPRNGAQYGRPF  171



>gb|AAF68626.1|AF254124_1 NAC1 [Medicago truncatula]
Length=409

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY +G RMNRATE G+WK TG+DR V  N +TVGM+KTL+FH G AP+
Sbjct  61   DLEWYFFCPIEKKYGNGSRMNRATEIGFWKATGKDRAVQQNNQTVGMIKTLIFHTGKAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED++      +QDSYV+CKVF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGIVQDSYVICKVFQKEGPGPRNGAQYGRPF  171



>gb|KEH19941.1| plant NAC domain protein [Medicago truncatula]
Length=433

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY +G RMNRATE G+WK TG+DR V  N +TVGM+KTL+FH G AP+
Sbjct  61   DLEWYFFCPIEKKYGNGSRMNRATEIGFWKATGKDRAVQQNNQTVGMIKTLIFHTGKAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED++      +QDSYV+CKVF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGIVQDSYVICKVFQKEGPGPRNGAQYGRPF  171



>ref|XP_003628693.1| NAC domain-containing protein [Medicago truncatula]
Length=426

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY +G RMNRATE G+WK TG+DR V  N +TVGM+KTL+FH G AP+
Sbjct  61   DLEWYFFCPIEKKYGNGSRMNRATEIGFWKATGKDRAVQQNNQTVGMIKTLIFHTGKAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED++      +QDSYV+CKVF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGIVQDSYVICKVFQKEGPGPRNGAQYGRPF  171



>gb|ACD39370.1| NAC domain protein [Glycine max]
Length=436

 Score =   174 bits (442),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DRP+ +N   VGM+KTLVFH G AP+
Sbjct  10   DLSWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRPIEHNNTVVGMIKTLVFHTGRAPR  69

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R++     DE   QD+YV+C+V++K GPGP+NGAQYG P+
Sbjct  70   GDRTDWVMHEFRLDDKVLADEAVSQDAYVICRVYQKEGPGPRNGAQYGKPY  120



>ref|XP_002517259.1| transcription factor, putative [Ricinus communis]
 gb|EEF45159.1| transcription factor, putative [Ricinus communis]
Length=398

 Score =   173 bits (439),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFC RE+KY SG RM RATE GYWKTTG+DRPV Y+++ VG +KTLVFH+G APK
Sbjct  60   DLKWYFFCSREKKYASGFRMKRATEFGYWKTTGKDRPVRYDDQVVGSIKTLVFHQGKAPK  119

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EY++E     D   +QDSYVLC +FKK GPGPKNGAQYGAPF
Sbjct  120  GNRTDWVMYEYKLEEQGLADRGVVQDSYVLCSIFKKDGPGPKNGAQYGAPF  170



>ref|XP_006581768.1| PREDICTED: NAC domain-containing protein 74 isoform X3 [Glycine 
max]
Length=432

 Score =   174 bits (440),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 174/337 (52%), Gaps = 48/337 (14%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DRP+ +N   VGM+KTLVFH G AP+
Sbjct  60   DLSWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRPIEHNNTVVGMIKTLVFHTGRAPR  119

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneed----w  337
            G RTDWV+HE+R++     DE   QD+YV+C+V++K GPGP+NGAQYG P++E++     
Sbjct  120  GDRTDWVMHEFRLDDKVLADEAVSQDAYVICRVYQKEGPGPRNGAQYGKPYDEKEWETDE  179

Query  338  edcencdIPFA-----IPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPI  502
            E       P A     +P+ PS  + S               +S    S + P+ L   +
Sbjct  180  EIDSVQSAPVAAVCAPVPIQPSESHISVANYTHPSTSGCAGLTSVSCVSELMPSCLAHLL  239

Query  503  NQNCTYVADMID--PGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSR  676
              N     + +D  P  S   PS    PS          PN+Q  SV +G I   +  + 
Sbjct  240  ASN-----NQVDSVPCVSEFMPSCSAHPS---------APNSQVGSV-SGLIP--SFLAH  282

Query  677  SLANPGPSLAVPHSSEVPPD------------DDDISQFFASFLEDTDLLPI-ENN--EN  811
            S A+     +VP   E+ P             D  I  F    +ED D L + ENN  EN
Sbjct  283  SSASNNQVGSVPCVPELVPSCLAHPSAPNNQADVGILPFLDCSIEDDDTLAVNENNSIEN  342

Query  812  VNCCNQGLNVDMMPCMDGNDVYTAFGGRDNFADLSGG  922
            V+  +Q  N +  PC D + ++   G  ++   L  G
Sbjct  343  VDDPDQANNAERGPCSDPHAIFEDLGDLNSLVGLGEG  379



>ref|XP_003630260.1| NAC domain-containing protein [Medicago truncatula]
 gb|AET04736.1| plant NAC domain protein [Medicago truncatula]
Length=489

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 104/145 (72%), Gaps = 11/145 (8%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFFCP E+KY SG RM RATE G+WK TG+DR V  N +TVGM+KTL+FH G +P+
Sbjct  61   DLEWYFFCPIEKKYRSGPRMKRATEIGFWKATGQDRAVQQNNQTVGMIKTLIFHTGKSPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            G RTDWV+HEYR+ED++     T+QDSYV+CKVF+K GPGP+NGAQYG PF  E+    +
Sbjct  121  GDRTDWVMHEYRLEDKDLADKGTVQDSYVICKVFQKEGPGPRNGAQYGRPF-NEEDWSDD  179

Query  350  ncdIPFA-----IPMHPSNQNCSSV  409
               IPFA     +P  P   N S +
Sbjct  180  EVGIPFAESAALVPSLPVTSNSSVL  204



>ref|XP_003526861.1| PREDICTED: NAC domain-containing protein 74 isoform X1 [Glycine 
max]
Length=503

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DRP+ +N   VGM+KTLVFH G AP+
Sbjct  60   DLSWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRPIEHNNTVVGMIKTLVFHTGRAPR  119

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R++     DE   QD+YV+C+V++K GPGP+NGAQYG P+
Sbjct  120  GDRTDWVMHEFRLDDKVLADEAVSQDAYVICRVYQKEGPGPRNGAQYGKPY  170



>gb|KHN09607.1| NAC domain-containing protein 78 [Glycine soja]
Length=506

 Score =   173 bits (439),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR +KY++GGR+NRATE GYWKTTG+DRP+ +N   VGM+KTLVFH G AP+
Sbjct  60   DLSWYFFCPRGKKYSTGGRLNRATEAGYWKTTGKDRPIEHNNTVVGMIKTLVFHTGRAPR  119

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R++     DE   QD+YV+C+V++K GPGP+NGAQYG P+
Sbjct  120  GDRTDWVMHEFRLDDKVLADEAVSQDAYVICRVYQKEGPGPRNGAQYGKPY  170



>gb|EAY96181.1| hypothetical protein OsI_18065 [Oryza sativa Indica Group]
Length=400

 Score =   171 bits (433),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KD EWYFFCPR+RKY+SG R NR+TE GYWK TG+DRPV+YN +TVGM +TLVFH G  P
Sbjct  60   KDREWYFFCPRDRKYSSGSRTNRSTEAGYWKATGKDRPVIYNSQTVGMKRTLVFHLGKPP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED+E        D+ VLCK+F+KSGPGPK G QYGAPF
Sbjct  120  RGDRTDWVMYEYRLEDKELSASGVKLDACVLCKIFQKSGPGPKIGEQYGAPF  171



>ref|XP_007048346.1| NAC domain containing protein 82, putative [Theobroma cacao]
 gb|EOX92503.1| NAC domain containing protein 82, putative [Theobroma cacao]
Length=348

 Score =   169 bits (429),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCP E+KY  G R+NRAT  GYWKTTG+DR V Y +  VGM+KTLVFH+G AP 
Sbjct  61   DLKWFFFCPIEKKYARGARLNRATMYGYWKTTGKDRTVTYKDAVVGMIKTLVFHQGKAPH  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E++E      +QD+YVLC VFKK G GP+NGAQYGAPF
Sbjct  121  GDRTDWVMHEYRLEEKELADRGVVQDTYVLCVVFKKDGMGPRNGAQYGAPF  171



>ref|XP_002448842.1| hypothetical protein SORBIDRAFT_06g034210 [Sorghum bicolor]
 gb|EES13170.1| hypothetical protein SORBIDRAFT_06g034210 [Sorghum bicolor]
Length=401

 Score =   171 bits (433),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR+RKY+SG R NR+T  GYWK TG+DRPVVYN RTVGM +TLVFH G  P+
Sbjct  61   DLVWYFFCPRDRKYSSGLRTNRSTGVGYWKATGKDRPVVYNARTVGMKRTLVFHLGKPPR  120

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+EDEE        D+ VLCK+F+KSGPGPK GAQYGAPF
Sbjct  121  GDRTDWVMYEYRLEDEELAASGVKLDACVLCKIFQKSGPGPKTGAQYGAPF  171



>ref|XP_009382939.1| PREDICTED: NAC domain-containing protein 100-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=421

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR++KY SG R NRAT+ GYWK TG+DRP+++N  TVGM KTL+FHEG   
Sbjct  60   KDLEWYFFCPRDKKYPSGSRSNRATDIGYWKATGKDRPIIHNTSTVGMKKTLIFHEGKPL  119

Query  182  KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
            KG RTDWV++EYR+E+ E      +QD++VLCK+F+KSG GPK G QYGAPFNEEDWED 
Sbjct  120  KGSRTDWVMYEYRLENREMADAGLVQDTFVLCKIFQKSGAGPKIGEQYGAPFNEEDWEDE  179

Query  347  encdIPFAIP  376
             + + PF +P
Sbjct  180  ASTENPFPLP  189



>ref|XP_007204688.1| hypothetical protein PRUPE_ppa007785mg [Prunus persica]
 gb|EMJ05887.1| hypothetical protein PRUPE_ppa007785mg [Prunus persica]
Length=356

 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 121/348 (35%), Positives = 175/348 (50%), Gaps = 69/348 (20%)
 Frame = +2

Query  5     DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
             DL+WYFFCP  RKY +G R+ RA E GYWK TG+DR V+YN    G +KTL+FH G APK
Sbjct  60    DLKWYFFCPTSRKYPTGARVKRANECGYWKATGKDRSVLYNGEVSGWIKTLIFHRGRAPK  119

Query  185   GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
             G+RTDWV+HEYR+E     D + LQDSYV+C +F+K GPGP+NGA+YGAPF EEDW D E
Sbjct  120   GERTDWVMHEYRLEAKNLADSDVLQDSYVICMIFQKDGPGPRNGAEYGAPFKEEDWTDDE  179

Query  350   ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
                           + CS                      A+P A +P+P         +
Sbjct  180   A-------------EICSE---------------------AVPHANMPEP---------N  196

Query  530   MIDPGCSSRQPSNEPGPSLSRLHADE---VRPNNQNCSVFTGTIDPGNTCSRSLANPGPS  700
             ++ P       SN     ++  H+ E   + P++++C   +  + P     + +++   +
Sbjct  197   LVVP-------SNYNSSIITSTHSPEGIHIGPSSESC--ISDALPPSCNVLQLVSSNHVT  247

Query  701   LAVPHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCNQ--GLNVDMMPCMDGNDV  874
             +  PH S     +DDI      F E +  L  EN++N    N     N    P ++ +D+
Sbjct  248   MEKPHVS-----NDDILSMLNCFTEGSTSLMKENDKNEELGNVIPSGNACATPHVNSDDI  302

Query  875   YTAFGGRDNFADLS-GGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDL  1015
             Y   G     A +S  G ++ +       P  +L   +D  FLEL+DL
Sbjct  303   YEDLGDLGKLARVSEDGYNFSTVHNSVCAPAQMLLGDNDQ-FLELDDL  349



>ref|XP_009382937.1| PREDICTED: NAC domain-containing protein 100-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009382938.1| PREDICTED: NAC domain-containing protein 100-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=438

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 103/130 (79%), Gaps = 5/130 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR++KY SG R NRAT+ GYWK TG+DRP+++N  TVGM KTL+FHEG   
Sbjct  60   KDLEWYFFCPRDKKYPSGSRSNRATDIGYWKATGKDRPIIHNTSTVGMKKTLIFHEGKPL  119

Query  182  KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
            KG RTDWV++EYR+E+ E      +QD++VLCK+F+KSG GPK G QYGAPFNEEDWED 
Sbjct  120  KGSRTDWVMYEYRLENREMADAGLVQDTFVLCKIFQKSGAGPKIGEQYGAPFNEEDWEDE  179

Query  347  encdIPFAIP  376
             + + PF +P
Sbjct  180  ASTENPFPLP  189



>ref|NP_001169920.1| uncharacterized protein LOC100383817 [Zea mays]
 ref|XP_008668453.1| PREDICTED: uncharacterized protein LOC100383817 isoform X1 [Zea 
mays]
 ref|XP_008668454.1| PREDICTED: uncharacterized protein LOC100383817 isoform X1 [Zea 
mays]
 gb|ACN35268.1| unknown [Zea mays]
 gb|ACN35429.1| unknown [Zea mays]
 gb|ACR34254.1| unknown [Zea mays]
 tpg|DAA36815.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 1 [Zea mays]
 tpg|DAA36816.1| TPA: putative NAC domain transcription factor superfamily protein 
isoform 2 [Zea mays]
 gb|AIB05443.1| NAC transcription factor, partial [Zea mays]
Length=408

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR+RKY+SG R NR+T  GYWK TG+DRPVVYN RTVGM +TLVFH G  P+
Sbjct  61   DLVWYFFCPRDRKYSSGLRTNRSTGVGYWKATGKDRPVVYNSRTVGMKRTLVFHLGKPPR  120

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+EDEE        D+ VLCK+F+KSGPGPK GAQYGAPF
Sbjct  121  GDRTDWVMYEYRLEDEEIAASGVKLDACVLCKIFQKSGPGPKIGAQYGAPF  171



>gb|AIZ68168.1| NAC domain-containing protein 74-like isoform X1 [Galtonia saundersiae]
Length=428

 Score =   171 bits (432),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 93/112 (83%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCPR+RKY+ G R NRAT+ GYWKTTGRDR +V+N +TVGM KTL+FH G +P
Sbjct  60   RDLEWYFFCPRDRKYSQGSRTNRATDIGYWKTTGRDRSIVHNSQTVGMKKTLIFHLGKSP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++E+R+E ++ +     QD+YVLCK+F+KSG GPKNG QYGAPF
Sbjct  120  QGSRTDWVMYEFRLESKDLVNAGYAQDAYVLCKIFQKSGLGPKNGEQYGAPF  171



>ref|XP_008441051.1| PREDICTED: NAC domain-containing protein 19 [Cucumis melo]
Length=457

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRERKY SG RMNRATE GYWK+TG+DRPV Y +  VG +KTL F  G APK
Sbjct  61   DLKWYFFCPRERKYASGARMNRATEFGYWKSTGKDRPVHYEKEEVGQIKTLTFFRGKAPK  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G +TDWV+HEYR++D     E+  QD+YVLC +F+K GPGP+NGAQYGAPF
Sbjct  121  GDQTDWVMHEYRLDDKNLSLEDVAQDAYVLCVIFQKDGPGPRNGAQYGAPF  171



>ref|XP_010521054.1| PREDICTED: NAC domain-containing protein 2-like [Tarenaya hassleriana]
 ref|XP_010521060.1| PREDICTED: NAC domain-containing protein 2-like [Tarenaya hassleriana]
Length=394

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRERKY +G RMNRATE GYWK TG+DR V+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWYFFCPRERKYGNGVRMNRATEYGYWKMTGKDRAVLCNNEVVGKIKTLVYHCGKSPR  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED     ++ +QDSYVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKGLAQKDVVQDSYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_008779162.1| PREDICTED: uncharacterized protein LOC103698888 [Phoenix dactylifera]
Length=688

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 94/112 (84%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  RMNR+T  GYWKTTG+DRPV +N R +GM KTLV+H G AP
Sbjct  83   RDLEWYFFTPVDRKYSNRSRMNRSTAQGYWKTTGKDRPVRHNNRVIGMKKTLVYHAGRAP  142

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ED+E      LQD+YV+C++FKK+GPGP+NGAQYGAPF
Sbjct  143  RGERSNWVMHEYRLEDQELAGTGILQDTYVVCRIFKKNGPGPQNGAQYGAPF  194



>ref|XP_007159836.1| hypothetical protein PHAVU_002G271700g [Phaseolus vulgaris]
 gb|ESW31830.1| hypothetical protein PHAVU_002G271700g [Phaseolus vulgaris]
Length=335

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 99/132 (75%), Gaps = 6/132 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            +LEWYFFCP E+KY SG RM R+TE GYWK TG DR V +N RTVGM++TLVFH G +PK
Sbjct  61   ELEWYFFCPLEKKYGSGSRMKRSTEIGYWKATGNDRVVQHNNRTVGMIRTLVFHLGKSPK  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            GKRTDWV+HE+R+ED++      +QDSYV+CKVF+K G GP+NGAQY  PF  E+  +  
Sbjct  121  GKRTDWVMHEHRLEDKDLADKGIVQDSYVVCKVFQKDGVGPRNGAQYARPF-NEEEWNDV  179

Query  350  ncdIPFAIPMHP  385
              +IPF+  + P
Sbjct  180  ELEIPFSASIAP  191



>ref|XP_008656268.1| PREDICTED: NAC domain-containing protein 55-like [Zea mays]
 gb|AFW81879.1| putative NAC domain transcription factor superfamily protein 
isoform 1 [Zea mays]
 gb|AFW81880.1| putative NAC domain transcription factor superfamily protein 
isoform 2 [Zea mays]
 gb|AIB05468.1| NAC transcription factor, partial [Zea mays]
Length=445

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 92/112 (82%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY +G R NRAT  GYWKT+G+DR ++ N RTVGM KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPNGSRTNRATPNGYWKTSGKDRIIMLNSRTVGMKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EYR+EDE+ +     +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGDRTDWVMYEYRMEDEDLVSAGFSKDAYVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_007023902.1| NAC domain containing protein 82, putative [Theobroma cacao]
 gb|EOY26524.1| NAC domain containing protein 82, putative [Theobroma cacao]
Length=301

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP ++KY  G R NRAT  G+WKTTG+DRPV YN++ VG ++TLVFH G AP+
Sbjct  61   DLKWYFFCPMKKKYGKGSRFNRATPYGFWKTTGKDRPVRYNDKVVGSIRTLVFHRGKAPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+EDE  L     QD YVLC +F K GPG +NGAQYGAPF
Sbjct  121  GDRTDWVLHEYRLEDEHLLDEGVVQDDYVLCVIFCKDGPGHRNGAQYGAPF  171



>ref|XP_011022982.1| PREDICTED: NAC domain-containing protein 72-like [Populus euphratica]
Length=403

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 182/367 (50%), Gaps = 55/367 (15%)
 Frame = +2

Query  2     KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
             +DL+W+FFCP E+KY SG R  RAT+ GYWKTTG+DR V Y    VGM+KTLVFH G AP
Sbjct  61    RDLKWFFFCPTEKKYASGVRKKRATDIGYWKTTGKDRSVQYKNEVVGMIKTLVFHIGKAP  120

Query  182   KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
             KG RTDWV++EYR+E++E       QD YVLC +FKK GPGPKNGAQYGAPF+E++W+D 
Sbjct  121   KGDRTDWVMYEYRLEEKELTDKGIAQDEYVLCVIFKKDGPGPKNGAQYGAPFDEDEWDDG  180

Query  347   encdI------PFAIP--------MHPSNQNCSSVTGMIDPE--CssrqpssepgssAIP  478
             ++         P  +P        M P+N N S  T    PE  C+    S    + +  
Sbjct  181   DDEVEKEVNAQPAILPALMDAPAFMLPNNPNMSIATSSCVPESTCTGPLISCPSRAPSTA  240

Query  479   PAKLPDPINQNC--TYVADMIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVF--TG  646
                LP   N +   T    ++  G +  +  +   P+         +P N N  +   + 
Sbjct  241   CTTLPRVSNDDVASTEALQVVHGGVNGGEADSSDMPAFQ-------QPCNPNSFILASSS  293

Query  647   TIDPGNTCSRSLANPGPSLAVPHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCN  826
             +  P NTCS  + + G +     + ++  ++DDI    A F          +N+N    +
Sbjct  294   SYVPENTCSAYIPSVGATQV--EAPQIVDENDDILSLLAMF----------DNDNTKSVD  341

Query  827   QGLNVDMMPCMDGNDVYTAFGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLEL  1006
              G   +        D++       N  DL+       G  +  +  + + P  +A FLEL
Sbjct  342   FGGIAE-----PETDIF------QNLGDLATPEGGGDGIPISQYFMDPMLPGGNADFLEL  390

Query  1007  NDLVIPV  1027
              DL  P+
Sbjct  391   MDLDTPL  397



>ref|XP_009376546.1| PREDICTED: NAC domain-containing protein 55-like [Pyrus x bretschneideri]
 ref|XP_009376547.1| PREDICTED: NAC domain-containing protein 55-like [Pyrus x bretschneideri]
 ref|XP_009376548.1| PREDICTED: NAC domain-containing protein 55-like [Pyrus x bretschneideri]
 ref|XP_009376549.1| PREDICTED: NAC domain-containing protein 55-like [Pyrus x bretschneideri]
Length=387

 Score =   167 bits (424),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 125/351 (36%), Positives = 171/351 (49%), Gaps = 74/351 (21%)
 Frame = +2

Query  5     DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
             DL+WYFFCP ERKY +G R  R TE GYWK TG DR V+YN    G +KTL+FH G APK
Sbjct  63    DLKWYFFCPTERKYPTGARAKRTTECGYWKATGNDRSVLYNGEVAGKIKTLIFHTGRAPK  122

Query  185   GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
             G+RTDWV+HEYR+E ++       Q+SYVLC +F+K GPGPKNGAQYGAP  EEDW D E
Sbjct  123   GERTDWVMHEYRLESKDLANRGVPQESYVLCTIFQKEGPGPKNGAQYGAPLMEEDWSDDE  182

Query  350   ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
                           +NCS                      A+P A + +P         +
Sbjct  183   A-------------ENCSE---------------------AVPHANMREP---------N  199

Query  530   MIDPGCSSRQPSNEPGPSLSRLHADE---VRPNNQNCSVFTGTIDPGNTCSRSLANPGPS  700
             ++        PSN  G   +  ++ E   +RP++++C   +  +       + +++   +
Sbjct  200   LV-------LPSNYNGSITTSTYSHESIHIRPSSESC--ISDAVPLSCHVPQLVSSNHAT  250

Query  701   LAVPHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCNQG--LNVDMMPCMDGNDV  874
             +  PH+S    +DDDI    A F E++  L  EN +N    N     N    P +  +DV
Sbjct  251   VEEPHTS----NDDDILSILACFSEESPSLIKENEKNEELGNVVPIGNDSAAPHVVSDDV  306

Query  875   YTAFGGRDNFA----DLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDL  1015
             Y A G     A    D     S P+        P      DD  +LEL+DL
Sbjct  307   YVALGDLGKVARVGEDGCSFSSLPNSVCATGQMP----LGDDGQYLELDDL  353



>ref|XP_006858416.1| hypothetical protein AMTR_s00071p00055960 [Amborella trichopoda]
 gb|ERN19883.1| hypothetical protein AMTR_s00071p00055960 [Amborella trichopoda]
Length=588

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYF+CPR+RKY++G R NRATETGYWKTTG+DRPV    R VGM KTLVFH G AP
Sbjct  60   RDREWYFYCPRDRKYSNGPRTNRATETGYWKTTGKDRPVCLASRKVGMKKTLVFHIGRAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ED   +     QD++VLC++FKKSG GPKNGAQYGAPF
Sbjct  120  NGERTNWVMHEYRLEDANMVDPSISQDAFVLCRLFKKSGSGPKNGAQYGAPF  171



>ref|XP_006843116.1| hypothetical protein AMTR_s00140p00087970 [Amborella trichopoda]
 gb|ERN04791.1| hypothetical protein AMTR_s00140p00087970 [Amborella trichopoda]
Length=637

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P ++K+  G R NRATE G+WKTTG+DRP+  N RTVGM KTLVFH G AP
Sbjct  60   RDLEWYFFSPLDKKHGKGSRTNRATEIGFWKTTGKDRPIRRNGRTVGMKKTLVFHVGRAP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ED+E      +QD+YVLC++F+K+GPGP+NGAQYGAPF
Sbjct  120  NGERTNWVMHEYRLEDKELNDKGIVQDAYVLCRIFQKNGPGPRNGAQYGAPF  171



>emb|CDY21575.1| BnaC09g47170D [Brassica napus]
Length=434

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/285 (39%), Positives = 147/285 (52%), Gaps = 45/285 (16%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++R V+ N  +VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERAVLCNGESVGKIKTLVYHVGKSPR  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            G+RTDWV+HEYR+ED     +   QD+YVLC +FKK GPGP+NGAQYGAPF EEDW D E
Sbjct  121  GERTDWVMHEYRLEDNVLTQKNIPQDTYVLCVLFKKDGPGPRNGAQYGAPFKEEDWSDEE  180

Query  350  ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
            +          PS  N S     ++ E             A+ P+      + N      
Sbjct  181  HRTDV------PSTSNASIFLHGLNAET----------RLAVAPSH-----DSNKACFGG  219

Query  530  MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNT-CSRSLANPGPSLA  706
            M+   C S  P                 P     SV     D  N     SL +P  S +
Sbjct  220  MMSESCVSDFP-----------------PATATASVAAHLTDAANAPMPASLLDPSSSAS  262

Query  707  VPHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCNQGLNV  841
            +  + + P DDDD+      F+++ + LP  +  N N      NV
Sbjct  263  LAQTLQAPNDDDDLYAMLDLFVDEDEFLPF-SEPNTNEARHDPNV  306



>ref|XP_010270428.1| PREDICTED: NAC domain-containing protein 89-like isoform X2 [Nelumbo 
nucifera]
Length=461

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCPR++KY +G R NRATE GYWKTTG+DR + +N + VGM KTL+FH G AP
Sbjct  59   RDLEWYFFCPRDKKYANGPRTNRATEIGYWKTTGKDRAICHNSQIVGMKKTLIFHTGRAP  118

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV+HEYR+ED + +     Q +YVLCK+F+KSG GPKNG QYGAPF
Sbjct  119  RGNRTDWVMHEYRLEDRDLVNAGISQGAYVLCKIFQKSGIGPKNGEQYGAPF  170



>ref|XP_010270427.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nelumbo 
nucifera]
Length=545

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCPR++KY +G R NRATE GYWKTTG+DR + +N + VGM KTL+FH G AP
Sbjct  59   RDLEWYFFCPRDKKYANGPRTNRATEIGYWKTTGKDRAICHNSQIVGMKKTLIFHTGRAP  118

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV+HEYR+ED + +     Q +YVLCK+F+KSG GPKNG QYGAPF
Sbjct  119  RGNRTDWVMHEYRLEDRDLVNAGISQGAYVLCKIFQKSGIGPKNGEQYGAPF  170



>ref|XP_004165784.1| PREDICTED: uncharacterized LOC101203420 [Cucumis sativus]
Length=463

 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL++YFFCPRERKY SG RMNRATE GYWK+TGRDR V Y  + VG +KTL F  G APK
Sbjct  61   DLKYYFFCPRERKYASGARMNRATEFGYWKSTGRDRTVHYENKEVGQIKTLTFFRGKAPK  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G +TDWV+HEYR++D     E+  QD+YVLC +F+K GPGP+NGAQYGAPF
Sbjct  121  GAQTDWVMHEYRLDDKNLSLEDAAQDAYVLCVIFQKDGPGPRNGAQYGAPF  171



>ref|XP_004148655.1| PREDICTED: uncharacterized protein LOC101203420 [Cucumis sativus]
 gb|KGN48354.1| hypothetical protein Csa_6G483360 [Cucumis sativus]
Length=463

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL++YFFCPRERKY SG RMNRATE GYWK+TGRDR V Y  + VG +KTL F  G APK
Sbjct  61   DLKYYFFCPRERKYASGARMNRATEFGYWKSTGRDRTVHYENKEVGQIKTLTFFRGKAPK  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G +TDWV+HEYR++D     E+  QD+YVLC +F+K GPGP+NGAQYGAPF
Sbjct  121  GAQTDWVMHEYRLDDKNLSLEDAAQDAYVLCVIFQKDGPGPRNGAQYGAPF  171



>ref|XP_002310505.1| hypothetical protein POPTR_0007s03840g [Populus trichocarpa]
 gb|EEE90955.1| hypothetical protein POPTR_0007s03840g [Populus trichocarpa]
Length=431

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCP E+KY SG R  RAT+ GYWKTTG+DR V Y    VGM+KTLVFH G  P
Sbjct  61   RDLKWYFFCPTEKKYASGVRKKRATDIGYWKTTGKDRSVQYKNEVVGMIKTLVFHIGKPP  120

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RTDWV++EYR+E++E       QD YVLC++FKK GPGPKNGAQYGAPF
Sbjct  121  RGERTDWVMYEYRLEEKELADKGIAQDEYVLCQIFKKDGPGPKNGAQYGAPF  172



>ref|XP_010260495.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=577

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 109/150 (73%), Gaps = 12/150 (8%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCPR++KY SG R NR TE GYWKTTG+DR V +N + VGM KTLVFH G +P
Sbjct  60   RDLEWYFFCPRDKKYASGPRTNRTTEIGYWKTTGKDRTVRHNSQIVGMKKTLVFHTGRSP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
            +G RTDWV+HEYR+ED++       Q +YVLC++F+KSGPGP+NG QYGAPF EEDWED 
Sbjct  120  RGIRTDWVMHEYRLEDKDLATAGIFQGAYVLCRIFQKSGPGPRNGEQYGAPFREEDWEDD  179

Query  347  en--cdIPFAIPMHPS-----NQNCSSVTG  415
             N    +P A P  PS     +QN S V G
Sbjct  180  VNDPFSLPLADPGSPSILLDDDQNVSIVPG  209



>ref|XP_004959911.1| PREDICTED: uncharacterized protein LOC101776162 [Setaria italica]
Length=467

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCPR+RKY+SG R NR+T  GYWK TG+DRPV YN RTVGM +TLVFH G  P+
Sbjct  124  DLVWYFFCPRDRKYSSGLRTNRSTGVGYWKATGKDRPVFYNSRTVGMKRTLVFHLGKPPR  183

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+EDEE        D+ VLCK+F+KSGPGPK GAQYGAPF
Sbjct  184  GDRTDWVMYEYRLEDEELAASGVKLDACVLCKIFQKSGPGPKIGAQYGAPF  234



>ref|XP_004962024.1| PREDICTED: NAC domain-containing protein 55-like [Setaria italica]
Length=453

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY +G R NRAT  GYWKT+G+DR ++ N R VGM KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPNGSRTNRATPNGYWKTSGKDRTIMLNSRIVGMKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++EDEE +     +D++VLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGDRTDWVMYEYKMEDEELVSAGFSKDAFVLCKIFKKSGLGPRIGEQYGAPF  171



>gb|KEH35593.1| NAC domain class transcription factor [Medicago truncatula]
Length=278

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFF P  +KY +GGRMNRATE GYWKTTG+DR + +  + VGM++TLVFH G APK
Sbjct  62   DLQWYFFTPVGKKYCTGGRMNRATEVGYWKTTGKDRSIEHRNQVVGMIRTLVFHTGKAPK  121

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E+++       Q+SYV+C+VF+K GPGP+NGAQYG PF
Sbjct  122  GDRTDWVMHEYRLENKDLADNGVPQNSYVICRVFQKEGPGPRNGAQYGKPF  172



>ref|XP_010911663.1| PREDICTED: NAC domain-containing protein 89-like isoform X2 [Elaeis 
guineensis]
Length=391

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KD EWYFFCPR+RKY +G R NRAT+ GYWKTTG+DR V++   TVGM +TL+FH G AP
Sbjct  61   KDQEWYFFCPRDRKYPNGSRTNRATDVGYWKTTGKDRTVIHKSHTVGMKRTLIFHVGKAP  120

Query  182  KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED+E L      D+YVLCK+F+KSG GPK G QYGAPF
Sbjct  121  RGNRTDWVMYEYRLEDKELLNAGYSLDAYVLCKIFQKSGRGPKIGEQYGAPF  172



>ref|XP_006399410.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 gb|ESQ40863.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
Length=310

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERPVLCNAEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLTQKNVPQDTYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_010909878.1| PREDICTED: NAC domain-containing protein 2-like [Elaeis guineensis]
 ref|XP_010909880.1| PREDICTED: NAC domain-containing protein 2-like [Elaeis guineensis]
 ref|XP_010909881.1| PREDICTED: NAC domain-containing protein 2-like [Elaeis guineensis]
Length=403

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 120/184 (65%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR+RKY  G R NRAT+ GYWK TG+D+ +++N  TVG  KTLVFH G  P
Sbjct  61   KDLEWYFFCPRDRKYPKGSRANRATDIGYWKPTGKDKAIIHNSHTVGKRKTLVFHVGKPP  120

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedc  346
            +G RT+WV++EYR+ED+E +     QD YVLCK+F+KSGPGPK G QYGAPFNE+DWED 
Sbjct  121  QGNRTEWVMYEYRLEDKELVDAGSSQDMYVLCKIFQKSGPGPKIGEQYGAPFNEDDWEDD  180

Query  347  encdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVA  526
               +  F+ P  P++        +++P C     S     S+ P   LPD        +A
Sbjct  181  TIIENAFSFPCAPTSIPLDDHPVLLEPICQQSVASGHCEVSSTP--DLPDADGMLLEQLA  238

Query  527  DMID  538
            ++++
Sbjct  239  ELLN  242



>ref|XP_008787444.1| PREDICTED: NAC domain-containing protein 78 [Phoenix dactylifera]
Length=661

 Score =   169 bits (429),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 92/116 (79%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  RMNR+T  GYWKTTG+DR V +N R VGM KTLV+H G AP
Sbjct  76   RDLEWYFFSPLDRKYSNRSRMNRSTAQGYWKTTGKDRSVRHNNRVVGMKKTLVYHAGRAP  135

Query  182  KGKRTDWVIHEYRIEDEETL---------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ED+E           QD+YV+C++FKKSGPGP+NGAQYGAPF
Sbjct  136  RGERTNWVMHEYRLEDQELAGTVTCTGIPQDAYVVCRIFKKSGPGPQNGAQYGAPF  191



>ref|XP_010911657.1| PREDICTED: NAC domain-containing protein 48-like isoform X1 [Elaeis 
guineensis]
Length=426

 Score =   166 bits (421),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KD EWYFFCPR+RKY +G R NRAT+ GYWKTTG+DR V++   TVGM +TL+FH G AP
Sbjct  61   KDQEWYFFCPRDRKYPNGSRTNRATDVGYWKTTGKDRTVIHKSHTVGMKRTLIFHVGKAP  120

Query  182  KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED+E L      D+YVLCK+F+KSG GPK G QYGAPF
Sbjct  121  RGNRTDWVMYEYRLEDKELLNAGYSLDAYVLCKIFQKSGRGPKIGEQYGAPF  172



>gb|AGL39700.1| NAC transcription factor 044 [Jatropha curcas]
 gb|KDP45077.1| hypothetical protein JCGZ_01577 [Jatropha curcas]
Length=563

 Score =   168 bits (426),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   +RKY +G + NRATE GYWKTTG+DRP+ +N RTVGM KTLV+H G AP
Sbjct  64   RDLEWYFFSMLDRKYGNGSKTNRATEKGYWKTTGKDRPIQWNSRTVGMKKTLVYHLGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+      +QDS+VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLADEDLQKAGIVQDSFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_010935813.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  RMNR+T  GYWKTTG+DRP+ +N R VGM KTLV+H G AP
Sbjct  79   RDLEWYFFSPLDRKYSNRSRMNRSTAQGYWKTTGKDRPIRHNHRVVGMKKTLVYHAGRAP  138

Query  182  KGKRTDWVIHEYRIEDEETL---------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ED+E           QD+YV+C++FKKSG GP+NGAQYGAPF
Sbjct  139  RGERTNWVMHEYRLEDQELAGTVTCTGIPQDAYVVCRIFKKSGQGPQNGAQYGAPF  194



>ref|XP_010935812.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Elaeis 
guineensis]
Length=689

 Score =   169 bits (428),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  RMNR+T  GYWKTTG+DRP+ +N R VGM KTLV+H G AP
Sbjct  79   RDLEWYFFSPLDRKYSNRSRMNRSTAQGYWKTTGKDRPIRHNHRVVGMKKTLVYHAGRAP  138

Query  182  KGKRTDWVIHEYRIEDEETL---------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ED+E           QD+YV+C++FKKSG GP+NGAQYGAPF
Sbjct  139  RGERTNWVMHEYRLEDQELAGTVTCTGIPQDAYVVCRIFKKSGQGPQNGAQYGAPF  194



>ref|XP_008456549.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cucumis 
melo]
Length=555

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P ++KY +  R NRATE GYWKTTG+DRPV +N R VGM KTLV+H G AP
Sbjct  63   RDLEWYFFSPLDKKYGNSSRTNRATEHGYWKTTGKDRPVRHNSRVVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G R++WV+HEYR+ DE+      +QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARSNWVMHEYRLTDEDLEKAGVVQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_008456548.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cucumis 
melo]
Length=556

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P ++KY +  R NRATE GYWKTTG+DRPV +N R VGM KTLV+H G AP
Sbjct  63   RDLEWYFFSPLDKKYGNSSRTNRATEHGYWKTTGKDRPVRHNSRVVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G R++WV+HEYR+ DE+      +QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARSNWVMHEYRLTDEDLEKAGVVQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_010485308.1| PREDICTED: NAC domain-containing protein 74-like, partial [Camelina 
sativa]
Length=313

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V+YN + VG ++TLV+H G  P+
Sbjct  17   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVLYNNQVVGKIRTLVYHFGKTPR  76

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWVIHEYR+ED+        QDSYVLC +FKK+G GP++G+QYGAP+
Sbjct  77   GDRTDWVIHEYRLEDQVLAQKNVPQDSYVLCVLFKKNGLGPRHGSQYGAPY  127



>ref|XP_004150380.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 ref|XP_004164210.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
 gb|KGN62198.1| hypothetical protein Csa_2G327500 [Cucumis sativus]
Length=555

 Score =   167 bits (424),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P ++KY +  R NRATE GYWKTTG+DRPV +N R VGM KTLV+H G AP
Sbjct  63   RDLEWYFFSPLDKKYGNSSRTNRATEHGYWKTTGKDRPVRHNSRVVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G R++WV+HEYR+ DE+      +QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARSNWVMHEYRLTDEDLEKAGVVQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_006280680.1| hypothetical protein CARUB_v10026643mg [Capsella rubella]
 gb|EOA13578.1| hypothetical protein CARUB_v10026643mg [Capsella rubella]
Length=364

 Score =   164 bits (415),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V YN++ VG ++TL++H G  P+
Sbjct  61   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVSYNDQVVGKIRTLIYHFGKIPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWVIHEYR+ED+        QDSYVLC +FKK+G GP++G+QYGAPF
Sbjct  121  GDRTDWVIHEYRLEDQVLAQKNVPQDSYVLCVLFKKNGLGPRHGSQYGAPF  171



>ref|XP_002873395.1| hypothetical protein ARALYDRAFT_487745 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49654.1| hypothetical protein ARALYDRAFT_487745 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   165 bits (417),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRATE GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATECGYWKTTGKERPVLCNSEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLTQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_006399407.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 ref|XP_006399408.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 ref|XP_006399409.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 gb|ESQ40860.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 gb|ESQ40861.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
 gb|ESQ40862.1| hypothetical protein EUTSA_v10013785mg [Eutrema salsugineum]
Length=387

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERPVLCNAEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLTQKNVPQDTYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_006287905.1| hypothetical protein CARUB_v10001139mg [Capsella rubella]
 gb|EOA20803.1| hypothetical protein CARUB_v10001139mg [Capsella rubella]
Length=393

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRATE GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATECGYWKTTGKERPVLCNSEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLTQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_010461360.1| PREDICTED: NAC domain-containing protein 18-like [Camelina sativa]
Length=367

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V+YN + VG ++TLV+H G  P+
Sbjct  61   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVLYNNQVVGKIRTLVYHFGKTPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWVIHEYR+ED+        QDSYVLC +FKK+G GP++G+QYGAP+
Sbjct  121  GDRTDWVIHEYRLEDQVLAQKNVPQDSYVLCVLFKKNGLGPRHGSQYGAPY  171



>ref|XP_004290501.1| PREDICTED: uncharacterized protein LOC101314425 [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   164 bits (416),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY SGGR+NRAT+ GYWKTTG+DR V+YN   VG +KTL+FH G AP+
Sbjct  61   DLKWYFFCPREKKYASGGRVNRATDCGYWKTTGKDRSVLYNSEVVGWIKTLIFHGGRAPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RT+WV+HEYR+ED+        QDS+VLC +F+K G GPK+  QYGAPF
Sbjct  121  GERTNWVLHEYRLEDKNLAEKGVAQDSHVLCLIFQKDGIGPKSSKQYGAPF  171



>gb|KEH35592.1| NAC domain class transcription factor [Medicago truncatula]
Length=336

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFF P  +KY +GGRMNRATE GYWKTTG+DR + +  + VGM++TLVFH G APK
Sbjct  41   DLQWYFFTPVGKKYCTGGRMNRATEVGYWKTTGKDRSIEHRNQVVGMIRTLVFHTGKAPK  100

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E+++       Q+SYV+C+VF+K GPGP+NGAQYG PF
Sbjct  101  GDRTDWVMHEYRLENKDLADNGVPQNSYVICRVFQKEGPGPRNGAQYGKPF  151



>emb|CDX69911.1| BnaA10g22600D [Brassica napus]
Length=438

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/270 (40%), Positives = 147/270 (54%), Gaps = 42/270 (16%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++R V+ N  +VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERAVLCNGESVGKIKTLVYHVGKSPR  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            G+RTDWV+HEYR+ED     +   QD+YVLC +FKK GPGP+NGAQYGAPF EEDW D E
Sbjct  121  GERTDWVMHEYRLEDNVLTQKNIPQDTYVLCVLFKKDGPGPRNGAQYGAPFKEEDWSDEE  180

Query  350  ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
            +      + + PS  N S      + E       S   + ++PP       N++C     
Sbjct  181  HRT---GVDV-PSTSNASIFLHGPNAET------SLSMAPSLPP-------NKDC--FGG  221

Query  530  MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNT-CSRSLANPGPSLA  706
            MI   C S  P                 P     S+     D  N      L +P  S +
Sbjct  222  MISESCVSDFP-----------------PATATASMTAHLTDAANAPVPAPLLDPSSSTS  264

Query  707  VPHSSEVPPDDDDISQFFASFLEDTDLLPI  796
            +  + + P DDDD+      F+++ + LP+
Sbjct  265  LAQTLQAPNDDDDLYAMLDLFVDEDEFLPL  294



>gb|EMT22201.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=429

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY  G R NRAT  GYWKT+G+DR +  N R VG+ KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRTIELNSRIVGLKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++EDE  +     +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYKMEDETLVSAGFSKDAYVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_003602603.1| NAC domain protein [Medicago truncatula]
 gb|AES72854.1| NAC domain class transcription factor [Medicago truncatula]
Length=357

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFF P  +KY +GGRMNRATE GYWKTTG+DR + +  + VGM++TLVFH G APK
Sbjct  62   DLQWYFFTPVGKKYCTGGRMNRATEVGYWKTTGKDRSIEHRNQVVGMIRTLVFHTGKAPK  121

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E+++       Q+SYV+C+VF+K GPGP+NGAQYG PF
Sbjct  122  GDRTDWVMHEYRLENKDLADNGVPQNSYVICRVFQKEGPGPRNGAQYGKPF  172



>ref|XP_009122507.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2 [Brassica rapa]
 ref|XP_009122509.1| PREDICTED: protein CUP-SHAPED COTYLEDON 2 [Brassica rapa]
Length=454

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 107/270 (40%), Positives = 147/270 (54%), Gaps = 42/270 (16%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++R V+ N  +VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERAVLCNGESVGKIKTLVYHVGKSPR  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            G+RTDWV+HEYR+ED     +   QD+YVLC +FKK GPGP+NGAQYGAPF EEDW D E
Sbjct  121  GERTDWVMHEYRLEDNVLTQKNIPQDTYVLCVLFKKDGPGPRNGAQYGAPFKEEDWSDEE  180

Query  350  ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
            +      + + PS  N S      + E       S   + ++PP       N++C     
Sbjct  181  HRT---GVDV-PSTSNASIFLHGPNAET------SLSMAPSLPP-------NKDC--FGG  221

Query  530  MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNT-CSRSLANPGPSLA  706
            MI   C S  P                 P     S+     D  N      L +P  S +
Sbjct  222  MISESCVSDFP-----------------PATATASMTAHLTDAANAPVPAPLLDPSSSTS  264

Query  707  VPHSSEVPPDDDDISQFFASFLEDTDLLPI  796
            +  + + P DDDD+      F+++ + LP+
Sbjct  265  LAQTLQAPNDDDDLYAMLDLFVDEDEFLPL  294



>ref|XP_008649658.1| PREDICTED: uncharacterized protein LOC103630378 [Zea mays]
 gb|AFW78062.1| putative NAC domain transcription factor superfamily protein 
isoform 1 [Zea mays]
 gb|AFW78063.1| putative NAC domain transcription factor superfamily protein 
isoform 2 [Zea mays]
Length=452

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY +G R NRAT  GYWKT+G+DR ++ N RTVGM KTL+FHEG  P
Sbjct  60   KDLEWFFFCPRDKKYPNGSRTNRATPNGYWKTSGKDRIIMLNSRTVGMKKTLIFHEGKPP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++EDE  +     +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGDRTDWVMYEYKMEDEYLVSTGFSKDTYVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_007010051.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18861.1| NAC domain containing protein 2, putative isoform 2 [Theobroma 
cacao]
Length=423

 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DRP+ Y ER VGM KTLV+H+G AP
Sbjct  62   RDLEWYFFSALDKKYGNGSRTNRATERGYWKTTGKDRPIRYRERVVGMKKTLVYHKGRAP  121

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       Q ++VLC+VF+KSG GPKNG QYGAPF
Sbjct  122  RGERTNWVMHEYRLIDEELEKSGIQQGAFVLCRVFQKSGSGPKNGEQYGAPF  173



>ref|XP_010491550.1| PREDICTED: NAC domain-containing protein 89-like [Camelina sativa]
 ref|XP_010491551.1| PREDICTED: NAC domain-containing protein 89-like [Camelina sativa]
 ref|XP_010491552.1| PREDICTED: NAC domain-containing protein 89-like [Camelina sativa]
Length=398

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRAT+ GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATDCGYWKTTGKERPVLCNSEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKALTQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>gb|EMS46324.1| NAC domain-containing protein 78 [Triticum urartu]
Length=411

 Score =   164 bits (414),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY  G R NRAT  GYWKT+G+DR +  N R VG+ KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRTIELNSRIVGLKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++EDE  +     +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYKMEDETLVSAGFSKDAYVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_010674451.1| PREDICTED: NAC domain-containing protein 78-like [Beta vulgaris 
subsp. vulgaris]
Length=347

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL WYFFCPR +KY +GGR NRATE GYWK+TG DR V YN R VG +KTLVFH G AP
Sbjct  64   RDLNWYFFCPRAKKYPNGGRANRATECGYWKSTGNDRTVTYNSRPVGKIKTLVFHRGKAP  123

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RTDWV+HEYR+ED+        QD YV+CK+++KSG GPKNG  YGA F
Sbjct  124  KGERTDWVMHEYRLEDKVLAERGVPQDCYVICKIYEKSGLGPKNGENYGARF  175



>ref|XP_003568407.1| PREDICTED: NAC domain-containing protein 74-like [Brachypodium 
distachyon]
Length=464

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY  G R NRAT  GYWKT+G+DR +  N RTVG+ KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRTIELNSRTVGLKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EYR+ED+  +     +D YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYRMEDDNLVSAGFSKDEYVLCKIFKKSGLGPRIGEQYGAPF  171



>gb|AHN60146.1| NAC transcription factor 82 [Brassica napus]
Length=432

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 150/277 (54%), Gaps = 47/277 (17%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++R V+ N  +VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERAVLCNGESVGKIKTLVYHVGKSPR  120

Query  185  GKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
            G+RTDWV+HEYR+ED     +   QD+YVLC +FKK GPGP+NGAQYGAPF EEDW D E
Sbjct  121  GERTDWVMHEYRLEDNVLTQKNIPQDTYVLCVLFKKDGPGPRNGAQYGAPFKEEDWSDEE  180

Query  350  ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
            +      + + PS  N S      + E           S A+ P+    P N++C     
Sbjct  181  HRT---GVDV-PSTSNASIFLHGPNAE----------PSLAVAPSL---PPNKDC--FGG  221

Query  530  MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNT-CSRSLANPGPSLA  706
            MI   C S  P                       +  T   D  N      L +P  S +
Sbjct  222  MISESCVSDFPP---------------------ATATTNVTDAANAPMPAPLVDPSSSAS  260

Query  707  VPHSSEVPPDDDDISQFFASFLEDTDLLPI-ENNENV  814
            +  + + P DDDD+      F+++ + LP+ E N NV
Sbjct  261  LAQTLQAPNDDDDLYAMLDLFVDEDEFLPLSEPNTNV  297



>ref|XP_010423010.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
 ref|XP_010423012.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
 ref|XP_010423013.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=422

 Score =   164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRAT+ GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATDCGYWKTTGKERPVLCNSEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKALAQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_007048341.1| NAC domain containing protein 82, putative [Theobroma cacao]
 gb|EOX92498.1| NAC domain containing protein 82, putative [Theobroma cacao]
Length=348

 Score =   161 bits (408),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCP E+K   G + NRAT  G+WKTTG+DR V YN+  VGM+KTLVFH+G AP 
Sbjct  61   DLKWFFFCPIEKKCARGVKFNRATMYGFWKTTGKDRTVTYNDAVVGMIKTLVFHQGKAPC  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E++E      +QD+YVLC VFKK G GP+NGAQYGAPF
Sbjct  121  GDRTDWVMHEYRLEEKELADRGVVQDTYVLCVVFKKDGMGPRNGAQYGAPF  171



>ref|XP_010452909.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
 ref|XP_010452910.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
 ref|XP_010452911.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=399

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRAT+ GYWKTTG++RPV+ N   VG +KTL++H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATDCGYWKTTGKERPVLCNSEVVGKIKTLIYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKALAQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_007010050.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18860.1| NAC domain protein, IPR003441, putative isoform 1 [Theobroma 
cacao]
Length=590

 Score =   166 bits (419),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DRP+ Y ER VGM KTLV+H+G AP
Sbjct  62   RDLEWYFFSALDKKYGNGSRTNRATERGYWKTTGKDRPIRYRERVVGMKKTLVYHKGRAP  121

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       Q ++VLC+VF+KSG GPKNG QYGAPF
Sbjct  122  RGERTNWVMHEYRLIDEELEKSGIQQGAFVLCRVFQKSGSGPKNGEQYGAPF  173



>emb|CDX81124.1| BnaC03g03780D [Brassica napus]
Length=342

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY +G R NRATE GYWKTTG++R V+ ++  VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYATGVRANRATECGYWKTTGKERAVLCSDEVVGKIKTLVYHVGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLAQKNIPQDTYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_011032332.1| PREDICTED: NAC transcription factor 29-like [Populus euphratica]
Length=400

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP E+KY SG RM R+T+ GYWKTTG+DR + Y    VGM+KTLVFH G APK
Sbjct  62   DLKWYFFCPTEKKYASGVRMKRSTDIGYWKTTGKDRSIQYKNEVVGMIKTLVFHTGRAPK  121

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+E     D+   QD YVLC +FKK GPGPKNGAQYG PF
Sbjct  122  GDRTDWVMYEYRLEEIELADKGIAQDGYVLCVIFKK-GPGPKNGAQYGEPF  171



>gb|ADZ55681.1| NAC transcription factor [Setaria italica]
Length=461

 Score =   164 bits (414),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D+EWYFFCPR++KY +G R NR T  G+WK+TG DR +V N R VGM KTLVFHEG AP
Sbjct  60   RDMEWYFFCPRDKKYATGSRANRLTPNGFWKSTGNDRTIVLNTRIVGMKKTLVFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV+HEYR+ED E       +D+YVLCK+FKKSGPGP+ G QYGA F
Sbjct  120  RGDRTDWVMHEYRMEDNELDVGGFSKDAYVLCKIFKKSGPGPRIGEQYGATF  171



>dbj|BAG32519.1| transcription factor [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   163 bits (412),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY  G R NRAT  GYWKT+G+DR +  N R VG+ KTL+FHEG AP
Sbjct  60   KDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRTIELNSRIVGLKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED ETL      +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYKMED-ETLDAAGFSKDAYVLCKIFKKSGLGPRIGEQYGAPF  171



>dbj|BAJ86914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   163 bits (412),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEW+FFCPR++KY  G R NRAT  GYWKT+G+DR +  N R VG+ KTL+FHEG AP
Sbjct  63   KDLEWFFFCPRDKKYPKGSRTNRATPNGYWKTSGKDRTIELNSRIVGLKKTLIFHEGKAP  122

Query  182  KGKRTDWVIHEYRIEDEETL------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED ETL      +D+YVLCK+FKKSG GP+ G QYGAPF
Sbjct  123  KGNRTDWVMYEYKMED-ETLDAAGFSKDAYVLCKIFKKSGLGPRIGEQYGAPF  174



>gb|ABR18034.1| unknown [Picea sitchensis]
Length=660

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P++RKY +G R NR+T+ GYWKTTG+DRPV    +TVGM KTLV+H G AP
Sbjct  60   RDLEWYFFNPKDRKYPNGSRTNRSTKDGYWKTTGKDRPVCSASQTVGMKKTLVYHTGRAP  119

Query  182  KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+E ++       QDSYVLC+VF+KSGPGPKNG QYGAPF
Sbjct  120  RGERTNWVMHEYRLEGKDLKMSNPAQDSYVLCRVFQKSGPGPKNGEQYGAPF  171



>ref|NP_196495.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 ref|NP_001078551.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 ref|NP_001078552.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 ref|NP_001154700.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 emb|CAC05459.1| putative protein [Arabidopsis thaliana]
 gb|AAV84484.1| At5g09330 [Arabidopsis thaliana]
 dbj|BAH19899.1| AT5G09330 [Arabidopsis thaliana]
 gb|AED91375.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 gb|AED91376.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 gb|AED91377.1| NAC domain containing protein 82 [Arabidopsis thaliana]
 gb|AED91378.1| NAC domain containing protein 82 [Arabidopsis thaliana]
Length=489

 Score =   164 bits (415),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 90/111 (81%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY SG R NRATE GYWKTTG++RPV+ N   VG +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYASGVRANRATECGYWKTTGKERPVLCNSEVVGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR++D+        QD+YV+C +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLDDKVLTQMNVPQDTYVVCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_008446811.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis melo]
Length=561

 Score =   165 bits (417),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV ++ RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSALDKKYGNSSRTNRATEKGYWKTTGKDRPVRHSARTVGMKKTLVYHIGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEY++ DEE     T+QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARTNWVMHEYKLTDEEMGKIATVQDAFVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|XP_009150476.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
 emb|CDY43785.1| BnaA06g23210D [Brassica napus]
Length=344

 Score =   160 bits (406),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 92/112 (82%), Gaps = 7/112 (6%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPR +KY +GG+ NR+TE+GYWKTTG+DR V YN+  VG ++TL+FH G  P+
Sbjct  61   DLKWYFFCPRLKKYPNGGKANRSTESGYWKTTGKDRDVTYNDEVVGKIRTLIFHYGKTPR  120

Query  185  GKRTDWVIHEYRIEDEETL------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED  TL      QD+YV+CK+FKK+G GP++G++YGAPF
Sbjct  121  GERTDWVMHEYRLED-RTLEQRNIPQDTYVICKLFKKNGLGPRHGSEYGAPF  171



>ref|XP_011024334.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=556

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+ +N R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGAKTNRATEKGYWKTTGKDRPIHWNSRVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERSNWVMHEYRLADEELDKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_011024333.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=558

 Score =   165 bits (417),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+ +N R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGAKTNRATEKGYWKTTGKDRPIHWNSRVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERSNWVMHEYRLADEELDKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_007201392.1| hypothetical protein PRUPE_ppa007941mg [Prunus persica]
 gb|EMJ02591.1| hypothetical protein PRUPE_ppa007941mg [Prunus persica]
Length=351

 Score =   160 bits (406),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 163/344 (47%), Gaps = 62/344 (18%)
 Frame = +2

Query  5     DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
             DL+ YFFCPRE+KY +G R+ RATE GYWKTTG+DR V+Y+   VG +KTL+FH G AP+
Sbjct  61    DLKRYFFCPREKKYRNGNRIQRATEGGYWKTTGKDRSVLYSGEVVGWIKTLIFHTGRAPR  120

Query  185   GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
             G RT+WV+HEYR+ED+         DSYV+C +F+K G GPK GAQYGAPF EEDW D E
Sbjct  121   GDRTNWVMHEYRLEDQGLADRGVPLDSYVICMIFQKDGLGPKIGAQYGAPFKEEDWTDDE  180

Query  350   ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
                   AIP    ++N S    ++   C+S   +S        P  +    +++C  ++D
Sbjct  181   VEICSEAIP----HENMSEPNLVVPSNCNSSITTSGHT-----PKGIHTSPSESC--ISD  229

Query  530   MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLANPGPSLAV  709
             ++ P C+  Q  +    ++ +LH                                     
Sbjct  230   VLPPSCNVHQLVSSNHVTMEKLHG------------------------------------  253

Query  710   PHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCNQ--GLNVDMMPCMDGNDVYTA  883
                      DDDI      F E +  L  EN++N    N     N    P  + +D+Y  
Sbjct  254   --------SDDDILSMLNCFTEGSTSLMKENDKNEELGNVIPSGNASATPNFNSDDIYEG  305

Query  884   FGGRDNFADLSGGRSYPSGSLVGDHPPNLLFPQDDAPFLELNDL  1015
              G     A +S      S        P  +   D+  FLEL+DL
Sbjct  306   LGDLGKMARVSEDGYNFSNVHNSIFAPAQMQLGDNEQFLELDDL  349



>ref|XP_002315338.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
 gb|EEF01509.2| hypothetical protein POPTR_0010s23650g [Populus trichocarpa]
Length=556

 Score =   164 bits (416),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+ +N R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGAKTNRATEKGYWKTTGKDRPINWNSRVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERSNWVMHEYRLADEELEKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_009418629.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score =   165 bits (418),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCP +RKY +  R NRAT  GYWKTTG+DRPV    R VGM KTLVFH+G AP
Sbjct  75   RDLEWYFFCPVDRKYPNRSRTNRATARGYWKTTGKDRPVHRRGRVVGMKKTLVFHDGRAP  134

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G RT+WV+HEYR+ED+E       QD+YV+C++F+KSG GP+NGAQYGAPF
Sbjct  135  HGARTNWVMHEYRLEDDELTHSGIPQDAYVVCRIFQKSGAGPRNGAQYGAPF  186



>ref|XP_002532627.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29758.1| conserved hypothetical protein [Ricinus communis]
Length=514

 Score =   164 bits (415),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRPV +N R VGM KTLV+H G AP
Sbjct  65   RDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPVRWNSRNVGMKKTLVYHLGRAP  124

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+      +QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  125  RGERTNWVMHEYRLTDEDLEKAGIVQDAFVLCRIFQKSGTGPKNGEQYGAPF  176



>ref|XP_006378789.1| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|ERP56586.1| NAC domain-containing protein 78 [Populus trichocarpa]
Length=554

 Score =   164 bits (416),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+ +N R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGAKTNRATEKGYWKTTGKDRPINWNSRVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERSNWVMHEYRLADEELEKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_009418630.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score =   165 bits (417),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFCP +RKY +  R NRAT  GYWKTTG+DRPV    R VGM KTLVFH+G AP
Sbjct  75   RDLEWYFFCPVDRKYPNRSRTNRATARGYWKTTGKDRPVHRRGRVVGMKKTLVFHDGRAP  134

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G RT+WV+HEYR+ED+E       QD+YV+C++F+KSG GP+NGAQYGAPF
Sbjct  135  HGARTNWVMHEYRLEDDELTHSGIPQDAYVVCRIFQKSGAGPRNGAQYGAPF  186



>ref|XP_004502932.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cicer 
arietinum]
 ref|XP_004502933.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Cicer 
arietinum]
Length=334

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFF P  +KY++GGRMNRATE GYWKTTG+DR + +  + VGM++TLVFH G + K
Sbjct  41   DLKWYFFSPTGKKYSTGGRMNRATEIGYWKTTGKDRSIEHKNQVVGMIRTLVFHTGKSHK  100

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R+ED+        Q+SYV+C+VF+K GPGP+NGAQYG PF
Sbjct  101  GDRTDWVMHEFRLEDKYLTDKGIPQNSYVICRVFQKEGPGPRNGAQYGKPF  151



>emb|CDX84485.1| BnaC03g50150D [Brassica napus]
 gb|AIU39723.1| NAC transcription factor 103 [Brassica napus]
Length=346

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 92/112 (82%), Gaps = 7/112 (6%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPR +KY +GG+ NR+TE+GYWKTTG+DR V YN+  VG ++TL+FH G  P+
Sbjct  61   DLKWYFFCPRLKKYPNGGKANRSTESGYWKTTGKDRDVTYNDEVVGKIRTLIFHYGKTPR  120

Query  185  GKRTDWVIHEYRIEDEETL------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED  TL      QD+YV+CK+FKK+G GP++G++YGAPF
Sbjct  121  GERTDWVMHEYRLED-RTLEQRNIPQDTYVICKLFKKNGLGPRHGSEYGAPF  171



>emb|CDY44793.1| BnaC02g00940D [Brassica napus]
Length=350

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY++G R NRAT  GYWKTTG++R V+ N    G +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYSTGVRANRATACGYWKTTGKEREVLCNGEVAGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            GKRTDWV+HEYR+ED+        QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GKRTDWVMHEYRLEDKVLTQKNVPQDTYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_002866590.1| ANAC103 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42849.1| ANAC103 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V YN+   G ++TL++H G  P+
Sbjct  61   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVSYNDEVTGKIRTLIYHYGKIPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWVIHEYR+ED+        QD+YVLC +FKK+G GP++G+QYGAPF
Sbjct  121  GDRTDWVIHEYRLEDKVLAQKNVPQDTYVLCVLFKKNGLGPRHGSQYGAPF  171



>ref|XP_010243195.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFF   ++KY +G R NRAT+ GYWKTTG+DRPV  N RTVGM KTLV+H G AP
Sbjct  61   RDLQWYFFGALDKKYGNGSRTNRATDQGYWKTTGKDRPVRRNNRTVGMKKTLVYHIGRAP  120

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  121  RGERTNWVMHEYRLVDEELERAGVQQDAYVLCRIFQKSGSGPKNGEQYGAPF  172



>ref|XP_010243196.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nelumbo 
nucifera]
Length=556

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFF   ++KY +G R NRAT+ GYWKTTG+DRPV  N RTVGM KTLV+H G AP
Sbjct  61   RDLQWYFFGALDKKYGNGSRTNRATDQGYWKTTGKDRPVRRNNRTVGMKKTLVYHIGRAP  120

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  121  RGERTNWVMHEYRLVDEELERAGVQQDAYVLCRIFQKSGSGPKNGEQYGAPF  172



>ref|XP_004142444.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=524

 Score =   163 bits (413),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV ++ RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSALDKKYGNSSRTNRATEKGYWKTTGKDRPVRHSARTVGMKKTLVYHIGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEY++ DEE      +QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARTNWVMHEYKLTDEEMGKIAIVQDAFVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|XP_010444332.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
 ref|XP_010444333.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=361

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V+YN   VG ++TLV+H G  P+
Sbjct  61   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVLYNNEVVGKIRTLVYHFGKTPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
              RTDWVIHEYR+ED+        QDSYVLC +FKK+G GP++G+QYGAP+
Sbjct  121  SDRTDWVIHEYRLEDQVLAQKNVPQDSYVLCVLFKKNGLGPRHGSQYGAPY  171



>ref|NP_201211.1| NAC domain containing protein 103 [Arabidopsis thaliana]
 dbj|BAB10274.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97835.1| NAC domain containing protein 103 [Arabidopsis thaliana]
Length=356

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY  GG+ NR+TE GYWKTTGRDR V YN+   G ++TL++H G  P+
Sbjct  61   DLKWYFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVSYNDEVTGKIRTLIYHYGKIPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWVIHEYR+ED+        QD+YVLC +FKK+G GP++G+QYGAPF
Sbjct  121  GDRTDWVIHEYRLEDKVLAQKNVPQDTYVLCVLFKKNGLGPRHGSQYGAPF  171



>ref|XP_010940544.1| PREDICTED: uncharacterized protein LOC105059077 [Elaeis guineensis]
Length=688

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 91/112 (81%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   +RKY++  RMNR+T  GYWKTTG+DRPV +N R +G  KTLV+H G AP
Sbjct  77   RDLEWYFFSRVDRKYSNRSRMNRSTAQGYWKTTGKDRPVRHNNRIIGNKKTLVYHAGRAP  136

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D+E      LQD+YV+C++FKK+GPGP+NGAQYGAPF
Sbjct  137  RGERTNWVMHEYRLGDQELAGTGILQDAYVVCRIFKKNGPGPQNGAQYGAPF  188



>emb|CDO99814.1| unnamed protein product [Coffea canephora]
Length=582

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DRPV +  + VGM KTLV+H G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSRTNRATEEGYWKTTGKDRPVRHKSQVVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEYR+ DEE      +QD++VLC+VF+KSG GPKNG QYGAPF
Sbjct  123  KGQRTNWVMHEYRLIDEELEKAGIVQDAFVLCRVFQKSGSGPKNGEQYGAPF  174



>ref|XP_004502931.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Cicer 
arietinum]
Length=354

 Score =   160 bits (404),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFF P  +KY++GGRMNRATE GYWKTTG+DR + +  + VGM++TLVFH G + K
Sbjct  61   DLKWYFFSPTGKKYSTGGRMNRATEIGYWKTTGKDRSIEHKNQVVGMIRTLVFHTGKSHK  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HE+R+ED+        Q+SYV+C+VF+K GPGP+NGAQYG PF
Sbjct  121  GDRTDWVMHEFRLEDKYLTDKGIPQNSYVICRVFQKEGPGPRNGAQYGKPF  171



>gb|KDO47588.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=433

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDTFVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_008381837.1| PREDICTED: NAC domain-containing protein 67-like [Malus domestica]
 ref|XP_008381838.1| PREDICTED: NAC domain-containing protein 67-like [Malus domestica]
Length=388

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP ERKY +G R  R TE GYWK TG DR V+YN    G +KTL+FH G APK
Sbjct  63   DLKWYFFCPTERKYPTGARAKRTTERGYWKATGNDRSVLYNGEVAGKIKTLIFHTGRAPK  122

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+E ++       Q+SYVLC +F+K GPGPKNGAQYGAP 
Sbjct  123  GERTDWVMHEYRLESKDLANRGVPQESYVLCTIFQKEGPGPKNGAQYGAPL  173



>gb|KGN52230.1| hypothetical protein Csa_5G622470 [Cucumis sativus]
Length=562

 Score =   163 bits (413),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV ++ RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSALDKKYGNSSRTNRATEKGYWKTTGKDRPVRHSARTVGMKKTLVYHIGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEY++ DEE      +QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARTNWVMHEYKLTDEEMGKIAIVQDAFVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|XP_004970791.1| PREDICTED: NAC domain-containing protein 68-like isoform X1 [Setaria 
italica]
 ref|XP_004970792.1| PREDICTED: NAC domain-containing protein 68-like isoform X2 [Setaria 
italica]
 ref|XP_004970793.1| PREDICTED: NAC domain-containing protein 68-like isoform X3 [Setaria 
italica]
 ref|XP_004970794.1| PREDICTED: NAC domain-containing protein 68-like isoform X4 [Setaria 
italica]
 ref|XP_004970795.1| PREDICTED: NAC domain-containing protein 68-like isoform X5 [Setaria 
italica]
 ref|XP_004970796.1| PREDICTED: NAC domain-containing protein 68-like isoform X6 [Setaria 
italica]
Length=461

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D+EWYFFCPR++KY +G R NR T  G+WK+TG DR +V N R VGM KTLVFHEG AP
Sbjct  60   RDMEWYFFCPRDKKYATGSRANRLTPNGFWKSTGNDRTIVLNTRIVGMKKTLVFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RTDWV++EYR+ED E       +D+YVLCK+FKKSGPGP+ G QYGA F
Sbjct  120  RGDRTDWVMYEYRMEDNELDVGGFSKDAYVLCKIFKKSGPGPRIGEQYGATF  171



>ref|XP_009383926.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  R NRAT  GYWKTTG+DRPV    R VGM KTLVFH G AP
Sbjct  75   RDLEWYFFSPLDRKYSNRSRTNRATAEGYWKTTGKDRPVRRGPRIVGMKKTLVFHAGRAP  134

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEYR+EDEE       QD+YV+C++F+K+G GP+NGAQYGAPF
Sbjct  135  RGTRTNWVMHEYRLEDEELTQAGISQDAYVVCRIFQKNGAGPQNGAQYGAPF  186



>ref|XP_010267268.1| PREDICTED: NAC domain-containing protein 78-like [Nelumbo nucifera]
Length=589

 Score =   163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFF   ++KY +G R NRAT+ GYWKTTG+DRPV +N +TVGM KTLVFH G  P
Sbjct  73   RDLQWYFFGALDKKYGNGSRTNRATDQGYWKTTGKDRPVRHNNKTVGMKKTLVFHIGRPP  132

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R +WV+HEYR+ DEE      LQD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  133  RGERANWVMHEYRLVDEELELAGVLQDAYVLCRIFQKSGSGPKNGEQYGAPF  184



>ref|XP_010547665.1| PREDICTED: uncharacterized protein LOC104819339 [Tarenaya hassleriana]
Length=413

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPR +KY SG R NR T  GYWK TG+DR V+ N   VG++KTLV+H G +P+
Sbjct  61   DLKWYFFCPRGKKYASGVRKNRTTGFGYWKITGKDRAVLCNNEIVGIIKTLVYHCGKSPR  120

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+E       QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKELAQMDVAQDAYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_008348770.1| PREDICTED: NAC domain-containing protein 78-like [Malus domestica]
Length=349

 Score =   159 bits (401),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP ERKY +G R  R TE GYWK TG DR V+YN    G +KTL+FH G APK
Sbjct  63   DLKWYFFCPTERKYPTGARAKRTTERGYWKATGNDRSVLYNGEVAGKIKTLIFHTGRAPK  122

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+E ++       Q+SYVLC +F+K GPGPKNGAQYGAP 
Sbjct  123  GERTDWVMHEYRLESKDLANRGVPQESYVLCTIFQKEGPGPKNGAQYGAPL  173



>ref|XP_009383919.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=672

 Score =   163 bits (413),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  R NRAT  GYWKTTG+DRPV    R VGM KTLVFH G AP
Sbjct  75   RDLEWYFFSPLDRKYSNRSRTNRATAEGYWKTTGKDRPVRRGPRIVGMKKTLVFHAGRAP  134

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEYR+EDEE       QD+YV+C++F+K+G GP+NGAQYGAPF
Sbjct  135  RGTRTNWVMHEYRLEDEELTQAGISQDAYVVCRIFQKNGAGPQNGAQYGAPF  186



>ref|XP_011031619.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Populus 
euphratica]
Length=502

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRPV  N + VGM KTLV+H+G AP
Sbjct  10   RDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPVRQNSQVVGMKKTLVYHQGRAP  69

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  70   RGQRSNWVMHEYRLVDEELEKAGITQDAFVLCRIFQKSGTGPKNGEQYGAPF  121



>gb|AGC97442.1| NAC protein 12 [Gossypium hirsutum]
Length=348

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYF+CP E+KY  G R+NRAT  GYWK TG+DRPV YN+  VGM+KTLVFH+G AP+
Sbjct  61   DLKWYFYCPIEKKYARGDRVNRATIFGYWKATGKDRPVKYNDEVVGMIKTLVFHKGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E     D   +QD Y+L  VFKK G GP+NG+QYGAPF
Sbjct  121  GDRTDWVMHEYRLEEKILADRGPVQDMYMLYVVFKKDGLGPRNGSQYGAPF  171



>gb|KHG06113.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=348

 Score =   158 bits (400),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYF+CP E+KY  G R+NRAT  GYWK TG+DRPV YN+  VGM+KTLVFH+G AP+
Sbjct  61   DLKWYFYCPIEKKYARGDRVNRATIFGYWKATGKDRPVKYNDEVVGMIKTLVFHKGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E     D   +QD Y+L  VFKK G GP+NG+QYGAPF
Sbjct  121  GDRTDWVMHEYRLEEKILADRGPVQDMYMLYVVFKKDGLGPRNGSQYGAPF  171



>ref|XP_009420175.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420176.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420177.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420178.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420179.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420180.1| PREDICTED: NAC domain-containing protein 74-like [Musa acuminata 
subsp. malaccensis]
Length=379

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFFCPR++KY +G R NRAT  GYWK TGRDR V++N +TVGM KTLVF+EG   
Sbjct  60   KDLEWYFFCPRDKKYPNGSRTNRATGIGYWKATGRDRYVIHNSQTVGMKKTLVFYEGKPS  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KGKRTDWV++EYR+ + + +     Q++YVLCK+F+KSGPGPK G +Y APF
Sbjct  120  KGKRTDWVMYEYRLLNRQLVEAGFSQEAYVLCKIFQKSGPGPKIGERYCAPF  171



>gb|AGC27316.1| NAC domain protein 13 [Gossypium hirsutum]
Length=591

 Score =   162 bits (410),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR + + ER VGM KTLV+H+G AP
Sbjct  62   RDLEWYFFSALDKKYGNGSRTNRATERGYWKTTGKDRAIRFRERVVGMKKTLVYHKGRAP  121

Query  182  KGKRTDWVIHEYRIEDEETL------QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D ETL      QD++VLC+VF+KSG GPKNG QYGAPF
Sbjct  122  RGERTNWVMHEYRLTD-ETLEKGGIQQDAFVLCRVFQKSGSGPKNGEQYGAPF  173



>gb|KDO47585.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=548

 Score =   162 bits (409),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDTFVLCRIFQKSGSGPKNGEQYGAPF  175



>gb|KDO47584.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=549

 Score =   162 bits (409),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDTFVLCRIFQKSGSGPKNGEQYGAPF  175



>gb|KDO47586.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=528

 Score =   162 bits (409),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDTFVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_007144249.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
 gb|ESW16243.1| hypothetical protein PHAVU_007G140500g [Phaseolus vulgaris]
Length=588

 Score =   162 bits (410),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFF   +RKY +G R NRATE GYWKTTG+DRPV + +R VGM KTLV+H G AP
Sbjct  58   KDLEWYFFSVLDRKYGNGSRTNRATEKGYWKTTGKDRPVAHGDRIVGMKKTLVYHIGRAP  117

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEY++ DEE     T+ D YV+C++F+KSG GPKNGA+YGAP 
Sbjct  118  HGRRTNWVMHEYKMLDEELTRAGTVLDVYVVCRIFEKSGSGPKNGAKYGAPL  169



>ref|XP_006436536.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485307.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Citrus 
sinensis]
 gb|ESR49776.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=549

 Score =   162 bits (409),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDAFVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_006436535.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
 ref|XP_006485308.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Citrus 
sinensis]
 gb|ESR49775.1| hypothetical protein CICLE_v10031147mg [Citrus clementina]
Length=548

 Score =   162 bits (409),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDAFVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_006654429.1| PREDICTED: NAC domain-containing protein 43-like isoform X2 [Oryza 
brachyantha]
Length=420

 Score =   160 bits (404),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEW+FFCPR++KY +G R NR+T  GYWKT+G+DR +  N R VG  KTL+FHEG AP
Sbjct  60   RDLEWFFFCPRDKKYANGSRTNRSTPNGYWKTSGKDRTIELNSRMVGSKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED++ +     +D YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGSRTDWVMYEYKMEDDKLVSAGFSKDDYVLCKIFKKSGLGPRIGEQYGAPF  171



>gb|AHA84185.1| NAC domain-containing protein 78 [Phaseolus vulgaris]
Length=572

 Score =   162 bits (409),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFF   +RKY +G R NRATE GYWKTTG+DRPV + +R VGM KTLV+H G AP
Sbjct  59   KDLEWYFFSVLDRKYGNGSRTNRATEKGYWKTTGKDRPVAHGDRIVGMKKTLVYHIGRAP  118

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEY++ DEE     T+ D YV+C++F+KSG GPKNGA+YGAP 
Sbjct  119  HGRRTNWVMHEYKMLDEELTRAGTVLDVYVVCRIFEKSGSGPKNGAKYGAPL  170



>ref|XP_006585360.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Glycine 
max]
Length=316

 Score =   157 bits (397),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            +LEWYFFCP E+KY SG +M RATE GYWK TG+DR V +N RTVGM+KTL+FH G +P+
Sbjct  58   ELEWYFFCPLEKKYGSGSKMKRATEIGYWKATGKDRVVQHNNRTVGMIKTLIFHTGKSPR  117

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HE+R+ED++       QDSYV+CKVF+K G GP  G  Y  PF
Sbjct  118  GERTDWVMHEHRLEDKDLADKGIAQDSYVVCKVFQKEGLGPGKGTHYARPF  168



>ref|XP_004173168.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus]
Length=566

 Score =   162 bits (409),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 89/116 (77%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV ++ RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSALDKKYGNSSRTNRATEKGYWKTTGKDRPVRHSARTVGMKKTLVYHIGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE---------TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G RT+WV+HEY++ DEE          +QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGARTNWVMHEYKLTDEEMDEEMGKIGIVQDAFVLCRIFQKSGTGPKNGEQYGAPF  178



>ref|XP_006849894.1| hypothetical protein AMTR_s00022p00094930 [Amborella trichopoda]
 gb|ERN11475.1| hypothetical protein AMTR_s00022p00094930 [Amborella trichopoda]
Length=613

 Score =   162 bits (410),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF P++RKY  G R+NRAT+ GYWK TG+DR +  N  TVG+ KTL++H G AP
Sbjct  60   RDREWYFFSPKDRKYPKGVRINRATQAGYWKATGKDRCICSNSHTVGIKKTLIYHMGRAP  119

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RTDWV+HEYR+ED+E       QDSY LCKV++KSGPGPKNG QYGAPF
Sbjct  120  RGERTDWVMHEYRLEDDELKKDNIAQDSYALCKVYRKSGPGPKNGEQYGAPF  171



>ref|XP_006382846.1| hypothetical protein POPTR_0005s06040g [Populus trichocarpa]
 gb|ERP60643.1| hypothetical protein POPTR_0005s06040g [Populus trichocarpa]
Length=402

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP E+KY SG RM R+T+ GYWK+TG+DR + Y    VGM+KTLVFH G APK
Sbjct  62   DLKWYFFCPTEKKYASGVRMKRSTDIGYWKSTGKDRSIQYKNEVVGMIKTLVFHTGRAPK  121

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+E     D+   QD YVLC +FKK GPGP NGAQYG PF
Sbjct  122  GDRTDWVMYEYRLEEIELADKGIAQDGYVLCVIFKK-GPGPNNGAQYGEPF  171



>ref|XP_003531450.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Glycine 
max]
 gb|KHN29242.1| NAC domain-containing protein 78 [Glycine soja]
Length=323

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            +LEWYFFCP E+KY SG +M RATE GYWK TG+DR V +N RTVGM+KTL+FH G +P+
Sbjct  58   ELEWYFFCPLEKKYGSGSKMKRATEIGYWKATGKDRVVQHNNRTVGMIKTLIFHTGKSPR  117

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HE+R+ED++       QDSYV+CKVF+K G GP  G  Y  PF
Sbjct  118  GERTDWVMHEHRLEDKDLADKGIAQDSYVVCKVFQKEGLGPGKGTHYARPF  168



>ref|XP_010261099.1| PREDICTED: NAC domain-containing protein 89-like [Nelumbo nucifera]
Length=567

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FF PR+R+Y +GGR+NRAT  GYWK TG+DR + YN RTVG+ KTLVF++G AP 
Sbjct  72   DRQWFFFSPRDRRYPNGGRLNRATRHGYWKVTGKDRNISYNSRTVGVKKTLVFYKGRAPS  131

Query  185  GKRTDWVIHEYRIEDEE----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY I++EE      QD Y L KVFKKSGPGPKNG QYGAPF
Sbjct  132  GERTDWVMHEYSIDEEELKRCAAQDCYALYKVFKKSGPGPKNGEQYGAPF  181



>ref|XP_006654428.1| PREDICTED: NAC domain-containing protein 43-like isoform X1 [Oryza 
brachyantha]
Length=453

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEW+FFCPR++KY +G R NR+T  GYWKT+G+DR +  N R VG  KTL+FHEG AP
Sbjct  60   RDLEWFFFCPRDKKYANGSRTNRSTPNGYWKTSGKDRTIELNSRMVGSKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED++ +     +D YVLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGSRTDWVMYEYKMEDDKLVSAGFSKDDYVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_011031618.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Populus 
euphratica]
Length=556

 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRPV  N + VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPVRQNSQVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGQRSNWVMHEYRLVDEELEKAGITQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_011076897.1| PREDICTED: NAC domain-containing protein 78-like [Sesamum indicum]
Length=563

 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V +  + VGM KTLV+H G AP
Sbjct  71   RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVYHKAQIVGMKKTLVYHSGRAP  130

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEYR+ D E      +QD++VLC+VF+KSG GPKNG QYGAPF
Sbjct  131  KGQRTNWVMHEYRLADLELEKAGIVQDAFVLCRVFQKSGSGPKNGEQYGAPF  182



>ref|XP_003556302.1| PREDICTED: NAC domain-containing protein 78-like [Glycine max]
Length=604

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFF   +RKY +G R NRAT+ GYWKTTG+DRPV + +RTVGM KTLV+H G AP
Sbjct  58   KDLEWYFFSALDRKYGNGSRTNRATDRGYWKTTGKDRPVTHGDRTVGMKKTLVYHSGRAP  117

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G+RT+WV+HEY++ DEE     T+ D +V+C++F+KSG GPKNGA+YGAP 
Sbjct  118  HGRRTNWVMHEYKMLDEELARAGTVPDVFVVCRIFEKSGSGPKNGAKYGAPL  169



>emb|CDY58437.1| BnaC03g71220D [Brassica napus]
Length=556

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KYN+G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD+YVLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRTGAPQDAYVLCRIFQKSGTGPKNGEQYGAPY  174



>gb|AHJ79209.1| NAC domain protein NAC68 [Gossypium hirsutum]
Length=347

 Score =   157 bits (396),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYF+CP E+KY  G R+NRAT  GYWK TG+DRPV YN   VGM+KTLVFH+G AP+
Sbjct  61   DLKWYFYCPIEKKYARGDRVNRATIFGYWKATGKDRPVKYNGEVVGMIKTLVFHKGKAPR  120

Query  185  GKRTDWVIHEYRIE-----DEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E     D   +QD Y+L  VFKK G GP+NG+QYGAPF
Sbjct  121  GDRTDWVMHEYRLEEKILADRGPVQDMYMLYVVFKKDGLGPRNGSQYGAPF  171



>emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera]
Length=573

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRAT+ GYWKTTG+DR V +  RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSRTNRATDRGYWKTTGKDREVRHRARTVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLMDEELKKTGVAQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78 [Vitis vinifera]
 emb|CBI31389.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   160 bits (406),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRAT+ GYWKTTG+DR V +  RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSRTNRATDRGYWKTTGKDREVRHRARTVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLMDEELKKTGVAQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_010032131.1| PREDICTED: NAC domain-containing protein 78 [Eucalyptus grandis]
 gb|KCW51525.1| hypothetical protein EUGRSUZ_J01038 [Eucalyptus grandis]
Length=538

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR + +  RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSKTNRATENGYWKTTGKDRAIYHYSRTVGMKKTLVYHNGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGQRTNWVMHEYRLTDEELEKAGIPQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_009339471.1| PREDICTED: NAC domain-containing protein 7-like [Pyrus x bretschneideri]
Length=396

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP ERKY +G R  R TE GYWK TG DR V+YN    G +KTLVFH G APK
Sbjct  63   DLKWYFFCPTERKYPTGVRTKRTTECGYWKATGIDRSVLYNGEVAGKIKTLVFHTGRAPK  122

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+E ++       Q+SYVLC +F+K GPGP+NGAQYGAP 
Sbjct  123  GDRTDWVMHEYRLESKDLANQGVPQESYVLCTIFQKEGPGPRNGAQYGAPL  173



>gb|KCW54236.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
Length=481

 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>ref|XP_007201045.1| hypothetical protein PRUPE_ppa006028mg [Prunus persica]
 gb|EMJ02244.1| hypothetical protein PRUPE_ppa006028mg [Prunus persica]
Length=432

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY SG R+ RATE GYWKTTG+DR V+Y+   VG +KTL+FH G AP 
Sbjct  61   DLKWYFFCPREKKYRSGNRIQRATEGGYWKTTGKDRSVLYSGEIVGWIKTLIFHTGRAPS  120

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RT+WV+HEYR+ED+         DSYVLC +F+K G GP+ GAQYGAPF
Sbjct  121  GDRTNWVMHEYRLEDQGLADRGVPLDSYVLCMIFQKEGLGPRIGAQYGAPF  171



>ref|XP_010027672.1| PREDICTED: NAC domain-containing protein 19-like isoform X5 [Eucalyptus 
grandis]
 gb|KCW54235.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
Length=477

 Score =   159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>ref|XP_002311983.2| NAC domain-containing protein 78 [Populus trichocarpa]
 gb|EEE89350.2| NAC domain-containing protein 78 [Populus trichocarpa]
Length=568

 Score =   160 bits (404),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+  N + VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPIRQNSQVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGQRSNWVMHEYRLVDEELEKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_010090439.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB39454.1| NAC domain-containing protein 78 [Morus notabilis]
Length=612

 Score =   160 bits (405),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRAT  GYWKTTG+DRP+  + RTVGM KTLV+H G AP
Sbjct  63   RDLEWYFFSALDKKYGNSSRTNRATVEGYWKTTGKDRPIRQSSRTVGMKKTLVYHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  KGARTNWVMHEYRLADEELEKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|XP_006379522.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
 gb|ERP57319.1| hypothetical protein POPTR_0008s03170g [Populus trichocarpa]
Length=581

 Score =   160 bits (404),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DRP+  N + VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGSKTNRATEKGYWKTTGKDRPIRQNSQVVGMKKTLVYHQGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGQRSNWVMHEYRLVDEELEKAGIAQDAFVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_008237527.1| PREDICTED: NAC domain-containing protein 78-like [Prunus mume]
Length=432

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY SG R+ RATE GYWKTTG+DR V+Y+   VG +KTL+FH G AP 
Sbjct  61   DLKWYFFCPREKKYRSGNRVQRATEGGYWKTTGKDRSVLYSGAIVGWIKTLIFHTGRAPS  120

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RT+WV+HEYR+ED+         DSYVLC +F+K G GP+ GAQYGAPF
Sbjct  121  GDRTNWVMHEYRLEDQGLADRGVPLDSYVLCMIFQKEGLGPRIGAQYGAPF  171



>gb|KCW54237.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
 gb|KCW54238.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
 gb|KCW54239.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
Length=480

 Score =   159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>ref|XP_009125756.1| PREDICTED: NAC domain-containing protein 89-like [Brassica rapa]
Length=399

 Score =   157 bits (397),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+W+FFCPRE+KY++G R NRAT  G+WKTTG++R V+ N    G +KTLV+H G +P+
Sbjct  61   DLKWHFFCPREKKYSTGVRANRATACGFWKTTGKERDVLCNGEVAGKIKTLVYHFGKSPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED+        QD+YVLC +FKK GPGP+NGAQYGAPF
Sbjct  121  GERTDWVMHEYRLEDKVLTQKNVPQDTYVLCVLFKKDGPGPRNGAQYGAPF  171



>ref|XP_010027671.1| PREDICTED: NAC domain-containing protein 19-like isoform X4 [Eucalyptus 
grandis]
Length=494

 Score =   159 bits (401),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>gb|AGV29475.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=340

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 4/109 (4%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL WYFFCP  +KY S GR NRATE GYWK+TG DR V Y +R VG +KTLVFH G  PK
Sbjct  65   DLNWYFFCPC-KKYGSSGRSNRATEIGYWKSTGNDRDVDYKDRVVGKIKTLVFHLGKPPK  123

Query  185  GKRTDWVIHEYRIEDEE---TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+R DWV+HE+R++D E     QD+YV+CK+FKKSG GPKNG QYGAPF
Sbjct  124  GERKDWVMHEFRLDDPELTGVAQDAYVICKIFKKSGLGPKNGEQYGAPF  172



>ref|XP_006394207.1| hypothetical protein EUTSA_v10004501mg [Eutrema salsugineum]
 gb|ESQ31493.1| hypothetical protein EUTSA_v10004501mg [Eutrema salsugineum]
Length=350

 Score =   155 bits (393),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE+KY    +  R+TE+GYWKTTG+DR V YN   VG ++TL+FH G  P+
Sbjct  61   DLKWYFFCPREKKYPKSAKAKRSTESGYWKTTGKDRDVSYNNEVVGKIRTLIFHYGKTPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV+HEYR+ED+        QD+YVLC +FKK+G GP++G+QYGAPF
Sbjct  121  GDRTDWVMHEYRLEDKVLAQKNVPQDTYVLCVLFKKNGLGPRHGSQYGAPF  171



>ref|XP_008369167.1| PREDICTED: NAC domain-containing protein 68-like [Malus domestica]
Length=396

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 114/310 (37%), Positives = 147/310 (47%), Gaps = 67/310 (22%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCP ERKY +G R  R TE GYWK TG DR V+YN    G +KTLVFH G APK
Sbjct  63   DLKWYFFCPTERKYPTGARTKRTTECGYWKATGNDRSVLYNGEVAGKIKTLVFHTGRAPK  122

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPFneedwedce  349
              RTDWV+HEYR+E ++       Q+SYVLC +F+K GPGP+NGAQYGAP  EEDW D E
Sbjct  123  RDRTDWVMHEYRLESKDLANRGVPQESYVLCTIFQKEGPGPRNGAQYGAPLMEEDWSDDE  182

Query  350  ncdIPFAIPMHPSNQNCSSVTGMIDPECssrqpssepgssAIPPAKLPDPINQNCTYVAD  529
                          +NCS                      A+P A +P P   N    +D
Sbjct  183  A-------------ENCSE---------------------AVPHANMPVP---NLVLPSD  205

Query  530  MIDPGCSSRQPSNEPGPSLSRLHADEVRPNNQNCSVFTGTIDPGNTCSRSLANPGPSLAV  709
                             + S    D +R    + S  +  +      S+ +++   ++  
Sbjct  206  Y------------NSSITTSTYTHDGIRIGPSSESCISDVVPLSCNVSQLVSSNHATVEE  253

Query  710  PHSSEVPPDDDDISQFFASFLEDTDLLPIENNENVNCCNQ--GLNVDMMPCMDGNDVYTA  883
            PH+SE     DDI    A F E++  L  EN +N    N     N    P +  ND+Y  
Sbjct  254  PHTSE-----DDILSMLACFSEESPSLFEENEKNKEVGNAIPVGNASATPHLVINDMY--  306

Query  884  FGGRDNFADL  913
                DN  DL
Sbjct  307  ----DNLGDL  312



>gb|EMT06613.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=406

 Score =   157 bits (396),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFC R RKY+ G R NR+TE GYWK TG+DR VVY  RTVGM +TLVFH G APK
Sbjct  61   DLQWYFFCTRGRKYSVGHRANRSTEGGYWKATGKDRQVVYENRTVGMKRTLVFHSGKAPK  120

Query  185  GKRTDWVIHEYR-----IEDEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR     I D     D  VLCKV KKSGPGPK G QYGAPF
Sbjct  121  GTRTDWVMYEYRLVQGEIPDAGVRLDDSVLCKVHKKSGPGPKIGEQYGAPF  171



>ref|XP_010543581.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=567

 Score =   159 bits (402),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR +    R VGM KTLV+H G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSKTNRATEKGYWKTTGKDREIRNGSRIVGMKKTLVYHRGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLIDEELGKTGVAQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>emb|CDY11289.1| BnaA03g01250D [Brassica napus]
Length=566

 Score =   159 bits (401),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KYN+G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRTGAPQDAFVLCRIFQKSGTGPKNGEQYGAPY  174



>ref|XP_009130822.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Brassica 
rapa]
Length=566

 Score =   159 bits (401),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KYN+G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRTGAPQDAFVLCRIFQKSGTGPKNGEQYGAPY  174



>ref|XP_009130821.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Brassica 
rapa]
Length=567

 Score =   159 bits (401),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KYN+G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRTGAPQDAFVLCRIFQKSGTGPKNGEQYGAPY  174



>gb|EEC79258.1| hypothetical protein OsI_20033 [Oryza sativa Indica Group]
Length=388

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEW+FFCPR++KY +G R NR+T  GYWKT+G+DR +  N R VG  KTL+FHEG AP
Sbjct  60   RDLEWFFFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRTIELNSRIVGSKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED + +     +D +VLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYKMEDNQLVSAGFSKDDFVLCKIFKKSGLGPRIGEQYGAPF  171



>gb|EMS50266.1| NAC domain-containing protein 78 [Triticum urartu]
Length=392

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFC R RKY+ G R NR+TE GYWK TG+DR VVY  RTVGM +TLVFH G APK
Sbjct  61   DLQWYFFCTRGRKYSVGHRANRSTEGGYWKATGKDRQVVYENRTVGMKRTLVFHSGKAPK  120

Query  185  GKRTDWVIHEYR-----IEDEETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR     I D     D  VLCKV KKSGPGPK G QYGAPF
Sbjct  121  GTRTDWVMYEYRLVQGEIPDAGVRLDDSVLCKVHKKSGPGPKIGEQYGAPF  171



>ref|XP_009386218.1| PREDICTED: NAC domain-containing protein 78-like [Musa acuminata 
subsp. malaccensis]
Length=631

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   +RKY++  R NRAT  G+WK TG+DRPV +  R VGM KTLVFH G AP
Sbjct  64   RDLEWYFFSALDRKYSNRSRTNRATGHGFWKMTGKDRPVRHRARVVGMKKTLVFHAGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G RT+WV+HEYR+EDEE      LQD+YV+C++F+KSG GP+NGAQYGA F
Sbjct  124  HGSRTNWVMHEYRLEDEELAHSGVLQDAYVVCRIFQKSGSGPQNGAQYGALF  175



>ref|XP_011044815.1| PREDICTED: NAC domain-containing protein 69 isoform X2 [Populus 
euphratica]
Length=482

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +WYFF PR+RKY +G R NRAT  GYWK TG+DR VV N R VG+ KTLVF+ G AP 
Sbjct  71   DRQWYFFSPRDRKYPNGARSNRATRQGYWKATGKDRIVVCNSRNVGVKKTLVFYRGRAPS  130

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY +++EE      +QD Y L KVFKKSGPGPKNG QYGAPF
Sbjct  131  GQRTDWVMHEYTLDEEELNRCPNVQDYYALYKVFKKSGPGPKNGEQYGAPF  181



>ref|XP_008232319.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Prunus 
mume]
Length=590

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV++N R VGM KTLVFH G APK
Sbjct  61   DLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVLHNSRNVGMKKTLVFHSGRAPK  120

Query  185  GKRTDWVIHEYRIEDEE------TLQDSYVLCKVFKKSGPGPKNGAQYGAP  319
            G RT+WV+HEYR+ +EE        +D YVLC++F+KSG GPKNG QYGAP
Sbjct  121  GARTNWVMHEYRLSNEELEKSGIQQKDPYVLCRIFQKSGTGPKNGEQYGAP  171



>ref|XP_010027667.1| PREDICTED: uncharacterized protein LOC104418129 isoform X1 [Eucalyptus 
grandis]
Length=681

 Score =   159 bits (401),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>ref|XP_008232318.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Prunus 
mume]
Length=591

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV++N R VGM KTLVFH G APK
Sbjct  61   DLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVLHNSRNVGMKKTLVFHSGRAPK  120

Query  185  GKRTDWVIHEYRIEDEE------TLQDSYVLCKVFKKSGPGPKNGAQYGAP  319
            G RT+WV+HEYR+ +EE        +D YVLC++F+KSG GPKNG QYGAP
Sbjct  121  GARTNWVMHEYRLSNEELEKSGIQQKDPYVLCRIFQKSGTGPKNGEQYGAP  171



>ref|XP_006398899.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
 gb|ESQ40352.1| hypothetical protein EUTSA_v10013110mg [Eutrema salsugineum]
Length=572

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGVRVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLSDEELKKAGVSQDAFVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|NP_001055600.1| Os05g0426200 [Oryza sativa Japonica Group]
 gb|AAV25009.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF17514.1| Os05g0426200 [Oryza sativa Japonica Group]
 dbj|BAG32518.1| transcription factor [Oryza sativa Japonica Group]
 gb|ACJ54902.1| NAM-like protein [Oryza sativa Japonica Group]
 dbj|BAG94183.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63787.1| hypothetical protein OsJ_18610 [Oryza sativa Japonica Group]
Length=449

 Score =   156 bits (395),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEW+FFCPR++KY +G R NR+T  GYWKT+G+DR +  N R VG  KTL+FHEG AP
Sbjct  60   RDLEWFFFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRTIELNSRIVGSKKTLIFHEGKAP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RTDWV++EY++ED + +     +D +VLCK+FKKSG GP+ G QYGAPF
Sbjct  120  KGNRTDWVMYEYKMEDNQLVSAGFSKDDFVLCKIFKKSGLGPRIGEQYGAPF  171



>ref|XP_006345843.1| PREDICTED: NAC domain-containing protein 78-like [Solanum tuberosum]
Length=544

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   +RK+ +G + NRATE GYWKTTG+DR V +  + VGM KTLVFH G AP
Sbjct  64   RDLEWYFFSVLDRKHGNGAKTNRATERGYWKTTGKDRAVHHKSKVVGMKKTLVFHSGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEY++ DEE      +QD+ VLC+VF+KSG GPKNG +YGAPF
Sbjct  124  KGQRTNWVMHEYKLIDEELEKAGVVQDALVLCRVFQKSGAGPKNGEKYGAPF  175



>ref|XP_010027670.1| PREDICTED: uncharacterized protein LOC104418129 isoform X3 [Eucalyptus 
grandis]
 gb|KCW54234.1| hypothetical protein EUGRSUZ_I00213 [Eucalyptus grandis]
Length=628

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>gb|KFK38438.1| hypothetical protein AALP_AA3G113300 [Arabis alpina]
Length=558

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 8/115 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR + Y  R VGM KTLV+H+G AP
Sbjct  61   RDLEWYFFSMLDKKYRNGLKTNRATENGYWKTTGKDREIRYGSRVVGMKKTLVYHKGRAP  120

Query  182  KGKRTDWVIHEYRIEDEET--------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+  E+T         QDSYVLC++F+KSG GPKNG  YGAPF
Sbjct  121  RGERTNWVMHEYRLVSEDTDKEKKTGVQQDSYVLCRIFQKSGTGPKNGENYGAPF  175



>gb|KDO47587.1| hypothetical protein CISIN_1g007598mg [Citrus sinensis]
Length=536

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 86/110 (78%), Gaps = 5/110 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   ++KY +G R NRATE GYWKTTG+DRPV +N RTVGM KTLV+H G AP
Sbjct  64   RDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVHHNTRTVGMKKTLVYHMGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGA  316
             G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGA
Sbjct  124  HGERTNWVMHEYRLTDDDLEKAGVAQDTFVLCRIFQKSGSGPKNGEQYGA  173



>ref|XP_010027668.1| PREDICTED: uncharacterized protein LOC104418129 isoform X2 [Eucalyptus 
grandis]
Length=634

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 8/112 (7%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DL+WYFFCPRERKY +G R NR+T+ G+WKTTG DRPV+YN +TVG +++L+FH     
Sbjct  59   RDLKWYFFCPRERKYATGARTNRSTDYGFWKTTGNDRPVIYNGKTVGKIRSLIFHR---T  115

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            K +RTDWV+HEYR+EDE+       QD+YVLC++++K G GP+NGAQYGAPF
Sbjct  116  KTERTDWVMHEYRLEDEDLKTKGVAQDTYVLCEIYEKDGRGPRNGAQYGAPF  167



>ref|XP_009410688.1| PREDICTED: NAC domain-containing protein 67-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFFC R++KY++G R NRAT+ GYWK TG+D+ V++N  TVGM +TLVFHEG  P
Sbjct  60   RDLEWYFFCHRDKKYSNGSRSNRATDGGYWKATGKDKSVIHNSCTVGMRRTLVFHEGKPP  119

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RT+WV++EYR++  E +     QD+Y+LCKVF+KSG GP+ G QYGAPF
Sbjct  120  KGTRTNWVMYEYRLQSRELVDAGFAQDAYLLCKVFQKSGLGPRIGEQYGAPF  171



>ref|XP_010486664.1| PREDICTED: NAC domain-containing protein 78 [Camelina sativa]
Length=555

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR +    + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTGKDREIRNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE        QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDEELDKINVHQQDAYVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_011044813.1| PREDICTED: NAC domain-containing protein 69 isoform X1 [Populus 
euphratica]
Length=586

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +WYFF PR+RKY +G R NRAT  GYWK TG+DR VV N R VG+ KTLVF+ G AP 
Sbjct  71   DRQWYFFSPRDRKYPNGARSNRATRQGYWKATGKDRIVVCNSRNVGVKKTLVFYRGRAPS  130

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY +++EE      +QD Y L KVFKKSGPGPKNG QYGAPF
Sbjct  131  GQRTDWVMHEYTLDEEELNRCPNVQDYYALYKVFKKSGPGPKNGEQYGAPF  181



>ref|XP_007218872.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
 gb|EMJ20071.1| hypothetical protein PRUPE_ppa003239mg [Prunus persica]
Length=590

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 85/111 (77%), Gaps = 6/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV++N R VGM KTLVFH G APK
Sbjct  61   DLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVLHNSRNVGMKKTLVFHSGRAPK  120

Query  185  GKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAP  319
            G RT+WV+HEYR+ +EE        +D YVLC++F+KSG GPKNG QYGAP
Sbjct  121  GARTNWVMHEYRLSNEELEKSGIPQKDPYVLCRIFQKSGTGPKNGEQYGAP  171



>gb|EYU39671.1| hypothetical protein MIMGU_mgv1a003896mg [Erythranthe guttata]
Length=557

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V +  + VGM KTLV+H G AP
Sbjct  70   RDLEWYFFSVLDKKYGNGSRTNRATEKGYWKTTGKDRAVYHRTQVVGMKKTLVYHSGRAP  129

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG R++WV+HEYR+ D E      +QD++VLC+VF+KSG GPKNG QYGAPF
Sbjct  130  KGLRSNWVMHEYRLIDMELEKAGIVQDAFVLCRVFQKSGSGPKNGEQYGAPF  181



>ref|XP_004290500.1| PREDICTED: NAC domain-containing protein 78-like [Fragaria vesca 
subsp. vesca]
Length=396

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            DL+WYFFCPRE KY +G R+NRAT  G+WK +G+DR V YN + VG +KTLVFH G  P+
Sbjct  61   DLKWYFFCPREMKYATGARVNRATGAGFWKMSGKDRSVNYNGQVVGWIKTLVFHIGRPPR  120

Query  185  GKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEYR+ED++       Q+SYVLC +F+K G GPK  AQYGAPF
Sbjct  121  GERTDWVLHEYRLEDKDLADMGMPQESYVLCVIFQKEGAGPKLSAQYGAPF  171



>gb|AFU61114.1| NAC domain class transcription factor [Capsicum annuum]
Length=409

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY +G R+NRAT  GYWK TG+DRPV +  +T+GM KTLVFH G AP
Sbjct  85   RDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVRHKSQTIGMKKTLVFHSGRAP  144

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             GKRT+WV+HEYR+ DEE      +QD++VLC++F+KSG GP NG +Y APF
Sbjct  145  DGKRTNWVMHEYRLADEELDRAGVVQDAFVLCRIFQKSGLGPPNGDRY-APF  195



>ref|XP_004307017.1| PREDICTED: NAC domain-containing protein 78-like [Fragaria vesca 
subsp. vesca]
Length=559

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +D EWYFF   +RKY +  R NRATE GYWKTTG+DRPV ++ R VGM KTLVFH G AP
Sbjct  63   RDTEWYFFSLLDRKYGNSSRTNRATEKGYWKTTGKDRPVCHSSRAVGMKKTLVFHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE------TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG RT+WV+HEYR++++E        +D+YVLC++F+KSG GPKNG QYGAP 
Sbjct  123  KGARTNWVMHEYRLDNQELEKAGIVEKDAYVLCRIFQKSGTGPKNGEQYGAPL  175



>ref|XP_002882677.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58936.1| ANAC053 [Arabidopsis lyrata subsp. lyrata]
Length=560

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR ++   + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDEDLDKTGVHQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_006297351.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
 gb|EOA30249.1| hypothetical protein CARUB_v10013370mg [Capsella rubella]
Length=558

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   + KY +G + NRATE GYWKTTG+DR +    + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSTLDSKYGNGSKTNRATEMGYWKTTGKDREIRNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDEELEKTGVHQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_010423583.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Camelina 
sativa]
Length=562

 Score =   157 bits (397),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_004239710.1| PREDICTED: NAC domain-containing protein 78-like [Solanum lycopersicum]
Length=544

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   +RK+ +G + NRATE GYWKTTG+DR V +  + VGM KTLVFH G AP
Sbjct  64   RDLEWYFFSVLDRKHGNGAKTNRATERGYWKTTGKDRAVHHKSKVVGMKKTLVFHSGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEY++ DEE      +QD+ VLC+VF+KSG GPKNG +YGAPF
Sbjct  124  KGERTNWVMHEYKLIDEELQKAGIVQDALVLCRVFQKSGAGPKNGEKYGAPF  175



>ref|XP_010490950.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Camelina 
sativa]
 ref|XP_010490951.1| PREDICTED: NAC domain-containing protein 78-like isoform X4 [Camelina 
sativa]
Length=562

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKRAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_010552948.1| PREDICTED: NAC domain-containing protein 78-like [Tarenaya hassleriana]
Length=568

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSVLDKKYGNGSKTNRATEKGYWKTTGKDREIRNGPRVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D+E       QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDDELGKAGVAQDAYVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_009619467.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=404

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY +G R+NRAT  GYWK TG+DRPV +  +T+GM KTLVFH G AP
Sbjct  86   RDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVRHKSQTIGMKKTLVFHSGRAP  145

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             GKRT+WV+HEYR+ DEE      +QD++VLC++F+KSG GP NG +Y APF
Sbjct  146  DGKRTNWVMHEYRLTDEELERAGVVQDAFVLCRIFQKSGLGPPNGDRY-APF  196



>ref|XP_010452337.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=562

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_010243336.1| PREDICTED: NAC domain-containing protein 74-like [Nelumbo nucifera]
 ref|XP_010243338.1| PREDICTED: NAC domain-containing protein 74-like [Nelumbo nucifera]
Length=568

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FF PR+R+Y +GGR+NRAT  GYWK TG+DR +  N RTVG+ KTLVF++G AP 
Sbjct  72   DRQWFFFSPRDRRYPNGGRLNRATRLGYWKATGKDRNITCNSRTVGVKKTLVFYKGRAPS  131

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY +++EE      +QD Y L KV+KKSGPGPKNG QYGAPF
Sbjct  132  GERTDWVMHEYTMDEEELKRCSVVQDCYALYKVYKKSGPGPKNGEQYGAPF  182



>ref|XP_009599412.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis]
Length=541

 Score =   157 bits (396),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNE-RTVGMVKTLVFHEGHA  178
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V  N+ + VGM KTLVFH G A
Sbjct  64   RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVHRNKSQVVGMKKTLVFHSGRA  123

Query  179  PKGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            PKG+RT+WV+HEYR+ DEE       QD++V+C+VF+KSG GPKNG QYGAPF
Sbjct  124  PKGQRTNWVMHEYRLIDEELDRAGIPQDAFVVCRVFQKSGAGPKNGEQYGAPF  176



>ref|XP_009418258.1| PREDICTED: uncharacterized protein LOC103998499 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   157 bits (398),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY++  R NRAT  GYWKTTG+DRPV    R VGM KTLV+H G AP
Sbjct  79   RDLEWYFFSPLDRKYSNRSRTNRATPQGYWKTTGKDRPVCRGPRVVGMKKTLVYHAGRAP  138

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G RT+WV+HEYR++DEE       Q+++V+C++F+KSG GP+NGAQYGAPF
Sbjct  139  HGTRTNWVMHEYRLKDEELTQAGISQNAFVVCRIFQKSGAGPQNGAQYGAPF  190



>ref|XP_009780872.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris]
Length=405

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY +G R+NRAT  GYWK TG+DRPV +  +T+GM KTLVFH G AP
Sbjct  86   RDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVRHKSQTIGMKKTLVFHSGRAP  145

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             GKRT+WV+HEYR+ DEE      +QD++VLC++F+KSG GP NG +Y APF
Sbjct  146  DGKRTNWVMHEYRLTDEELERAGVVQDAFVLCRIFQKSGLGPPNGDRY-APF  196



>ref|XP_002871092.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47351.1| hypothetical protein ARALYDRAFT_908325 [Arabidopsis lyrata subsp. 
lyrata]
Length=568

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q++YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPF  174



>ref|XP_011101544.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Sesamum 
indicum]
Length=542

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V +  + VGM KTLV+H G AP
Sbjct  73   RDLEWYFFSALDKKYGNGARTNRATEKGYWKTTGKDRAVYHKTQIVGMKKTLVYHSGRAP  132

Query  182  KGKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEYR+ D         QD++VLC+VF+KSG G KNG QYGAPF
Sbjct  133  KGQRTNWVMHEYRLADLGLEASGIAQDAFVLCRVFQKSGSGSKNGEQYGAPF  184



>emb|CDY44853.1| BnaC09g50530D [Brassica napus]
Length=560

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE       QD++VLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRAGAPQDAFVLCRIFQKSGTGPKNGEQYGAPY  174



>ref|XP_011101543.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Sesamum 
indicum]
Length=547

 Score =   156 bits (395),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V +  + VGM KTLV+H G AP
Sbjct  78   RDLEWYFFSALDKKYGNGARTNRATEKGYWKTTGKDRAVYHKTQIVGMKKTLVYHSGRAP  137

Query  182  KGKRTDWVIHEYRIED-----EETLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEYR+ D         QD++VLC+VF+KSG G KNG QYGAPF
Sbjct  138  KGQRTNWVMHEYRLADLGLEASGIAQDAFVLCRVFQKSGSGSKNGEQYGAPF  189



>ref|XP_009771992.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Nicotiana 
sylvestris]
Length=507

 Score =   155 bits (393),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNE-RTVGMVKTLVFHEGHA  178
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V  N+ + VGM KTLV+H G A
Sbjct  30   RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVHRNKSQVVGMKKTLVYHSGRA  89

Query  179  PKGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            PKG+RT+WV+HEYR+ DEE       QD++V+C+VF+KSG GPKNG QYGAPF
Sbjct  90   PKGQRTNWVMHEYRLIDEELDRAGIPQDAFVVCRVFQKSGAGPKNGEQYGAPF  142



>ref|XP_010464726.1| PREDICTED: NAC domain-containing protein 78-like [Camelina sativa]
Length=556

 Score =   156 bits (394),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 87/113 (77%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR +    + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYGNGSKTNRATEMGYWKTTGKDREIRNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ DEE        QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERSNWVMHEYRLVDEELEKTNVHQQDAYVLCRIFQKSGSGPKNGEQYGAPF  175



>ref|XP_004173925.1| PREDICTED: NAC domain-containing protein 78-like, partial [Cucumis 
sativus]
Length=224

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FFCPR+RKY +G + NRAT  GYWK TG+DR V  N R VG+ KTL+F+ G APK
Sbjct  17   DRQWFFFCPRDRKYPNGAKSNRATSQGYWKVTGKDRTVKCNSRNVGVKKTLIFYRGRAPK  76

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY + +EE      +Q  Y + KVFKKSGPGPKNG QYGAPF
Sbjct  77   GERTDWVMHEYTMNEEELTRCTNVQSYYAVYKVFKKSGPGPKNGEQYGAPF  127



>gb|AAG51388.1|AC011560_20 unknown protein; 75639-73470 [Arabidopsis thaliana]
 gb|AAF76351.1| NAC, putative [Arabidopsis thaliana]
Length=558

 Score =   155 bits (393),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR ++   + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_002306731.1| no apical meristem family protein [Populus trichocarpa]
 gb|EEE93727.1| no apical meristem family protein [Populus trichocarpa]
Length=570

 Score =   156 bits (394),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FF PR+RKY +G R NRAT  GYWK TG+DR VV N R VG+ KTLVF+ G AP 
Sbjct  71   DRQWFFFSPRDRKYPNGARSNRATRQGYWKATGKDRIVVCNSRNVGVKKTLVFYRGRAPS  130

Query  185  GKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY +++EE      +QD Y L KVFKKSGPGPKNG QYGAPF
Sbjct  131  GQRTDWVMHEYTLDEEELNRCPNVQDYYALYKVFKKSGPGPKNGEQYGAPF  181



>ref|NP_566376.1| NAC domain containing protein 53 [Arabidopsis thaliana]
 gb|AAK93680.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85076.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74917.1| NAC domain containing protein 53 [Arabidopsis thaliana]
Length=549

 Score =   155 bits (393),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR ++   + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>ref|XP_003581627.1| PREDICTED: NAC domain-containing protein 102-like [Brachypodium 
distachyon]
Length=390

 Score =   153 bits (386),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D EWYFFC R+RKY+SG R NR+TE GYWK TG+DR V++  +TVGM +TLVFH G  P+
Sbjct  60   DREWYFFCMRDRKYSSGSRTNRSTEAGYWKATGKDRAVIHKNQTVGMKRTLVFHSGKPPQ  119

Query  185  GKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G RTDWV++EYR+ D++        D+ VLCK+FKKSG GPK G QYGAPF
Sbjct  120  GTRTDWVMYEYRLVDKDISSSDVKLDNCVLCKIFKKSGAGPKIGEQYGAPF  170



>gb|KHN00770.1| NAC domain-containing protein 78 [Glycine soja]
Length=487

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FFC R+RKY +GGR NRAT  GYWK TG+DR V+ N R+VG+ KTLVF+ G AP 
Sbjct  11   DRQWFFFCHRDRKYPNGGRSNRATRRGYWKATGKDRNVICNSRSVGVKKTLVFYAGRAPS  70

Query  185  GKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY +++EE      ++D Y L KV+KKSGPGPKNG QYGAPF
Sbjct  71   GERTDWVMHEYTLDEEELKRCQGVKDYYALYKVYKKSGPGPKNGEQYGAPF  121



>gb|EYU32441.1| hypothetical protein MIMGU_mgv1a002437mg [Erythranthe guttata]
Length=675

 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V +  +  GM KTLV+H G AP
Sbjct  222  RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVYHRTKVSGMKKTLVYHSGRAP  281

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEYR+ D +       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  282  KGQRTNWVMHEYRLTDVDFNTAGITQDAFVLCRIFQKSGSGPKNGEQYGAPF  333



>ref|XP_004496134.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Cicer 
arietinum]
Length=577

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            KDLEWYFF   ++KY  G R NRAT+ GYWKTTG+DR V   E TVGM KTLV+H G AP
Sbjct  60   KDLEWYFFTVLDKKYGHGIRTNRATDRGYWKTTGKDRIVKNGEDTVGMKKTLVYHSGRAP  119

Query  182  KGKRTDWVIHEYRIEDEET----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             G RT+WV+HEYR+ DEE     LQD+YV C++F+KSG GPKNG +YGAPF
Sbjct  120  HGDRTNWVMHEYRMIDEELAKAGLQDTYVACRIFEKSGSGPKNGEKYGAPF  170



>gb|KEH43609.1| NAC transcription factor-like protein [Medicago truncatula]
Length=571

 Score =   155 bits (392),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    DLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAPK  184
            D +W+FFC R+RKY +GGR +RAT  GYWK TG+DR V+YN R+VG+ KTLVF+ G AP 
Sbjct  74   DRQWFFFCHRDRKYPNGGRSSRATRHGYWKATGKDRNVIYNSRSVGVKKTLVFYLGRAPS  133

Query  185  GKRTDWVIHEYRIEDEET-----LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            G+RTDWV+HEY ++++E      ++D Y L KVFKKSGPGPKNG QYGAPF
Sbjct  134  GERTDWVMHEYTMDEDELRTCRDVKDYYALYKVFKKSGPGPKNGEQYGAPF  184



>gb|AAM34772.1|AF509872_1 nam-like protein 9 [Petunia x hybrida]
Length=462

 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR + +  + V M KTLV+H G AP
Sbjct  64   RDLEWYFFSMLDKKYGNGSRTNRATEQGYWKTTGKDRAIHHKSQVVAMKKTLVYHSGRAP  123

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            KG+RT+WV+HEY++ DEE       QD++VLC+VF+KSG GPKNG +YGAPF
Sbjct  124  KGQRTNWVMHEYKLVDEELHKAGISQDAFVLCRVFQKSGAGPKNGEKYGAPF  175



>ref|XP_009771991.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNE-RTVGMVKTLVFHEGHA  178
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V  N+ + VGM KTLV+H G A
Sbjct  64   RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVHRNKSQVVGMKKTLVYHSGRA  123

Query  179  PKGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            PKG+RT+WV+HEYR+ DEE       QD++V+C+VF+KSG GPKNG QYGAPF
Sbjct  124  PKGQRTNWVMHEYRLIDEELDRAGIPQDAFVVCRVFQKSGAGPKNGEQYGAPF  176



>emb|CDY41354.1| BnaA01g31650D [Brassica napus]
Length=537

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   + KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  67   RDLEWYFFSVLDNKYSNGSKTNRATEMGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  126

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ D++ +     +D+YVLCK+F+KSG GPKNG QYGAPF
Sbjct  127  RGERSNWVMHEYRLVDDDIVKAGVQKDAYVLCKIFQKSGSGPKNGEQYGAPF  178



>ref|XP_009346652.1| PREDICTED: NAC domain-containing protein 78-like isoform X3 [Pyrus 
x bretschneideri]
Length=607

 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +  R NRATE GYWKTTG+DRPV +N R VGM KTLVFH G AP
Sbjct  63   RDLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKDRPVKHNSRDVGMKKTLVFHSGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAP  319
             G RT+WV+HEYR+ +EE       QD YVLC++F+KSG GPKNG +YGAP
Sbjct  123  TGARTNWVMHEYRLSNEELEKAGIQQDPYVLCRIFQKSGTGPKNGEKYGAP  173



>ref|XP_010490948.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
 ref|XP_010490949.1| PREDICTED: NAC domain-containing protein 78-like isoform X2 [Camelina 
sativa]
Length=563

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+        +++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKRAGVPQKEAYVLCRIFQKSGTGPKNGEQYGAPF  176



>ref|XP_010423582.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Camelina 
sativa]
Length=563

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+        +++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKKAGVPQKEAYVLCRIFQKSGTGPKNGEQYGAPF  176



>ref|XP_009122853.1| PREDICTED: NAC domain-containing protein 78 [Brassica rapa]
Length=537

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   + KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  67   RDLEWYFFSVLDNKYSNGSKTNRATEMGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  126

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+R++WV+HEYR+ D++ +     +D+YVLCK+F+KSG GPKNG QYGAPF
Sbjct  127  RGERSNWVMHEYRLVDDDIVKAGVQKDAYVLCKIFQKSGSGPKNGEQYGAPF  178



>emb|CDO99813.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF P +RKY +G R+NRAT  GYWK TG+DRPV +  +T+GM KTLVFH G AP
Sbjct  91   RDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPVRHKSQTIGMKKTLVFHSGRAP  150

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
             GKRT+WV+HEYR+ DEE       QD++VLC++F+KSG GP NG +Y APF
Sbjct  151  DGKRTNWVMHEYRLVDEELEKAGVAQDAFVLCRIFQKSGLGPPNGDRY-APF  201



>ref|XP_010452336.1| PREDICTED: NAC domain-containing protein 78-like isoform X1 [Camelina 
sativa]
Length=563

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  64   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  123

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+        +++YVLC++F+KSG GPKNG QYGAPF
Sbjct  124  RGERTNWVMHEYRLSDEDLKKAGVPQKEAYVLCRIFQKSGTGPKNGEQYGAPF  176



>ref|NP_196061.1| NAC family transcriptional activator [Arabidopsis thaliana]
 sp|Q84K00.2|NAC78_ARATH RecName: Full=NAC domain-containing protein 78; Short=ANAC078 
[Arabidopsis thaliana]
 emb|CAB85547.1| putative protein [Arabidopsis thaliana]
 gb|AAM20460.1| putative protein [Arabidopsis thaliana]
 gb|AAM91259.1| putative protein [Arabidopsis thaliana]
 gb|AED90739.1| NAC family transcriptional activator [Arabidopsis thaliana]
Length=567

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q++YVLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPY  174



>ref|XP_004250028.1| PREDICTED: NAC domain-containing protein 78 [Solanum lycopersicum]
Length=528

 Score =   154 bits (390),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNE-RTVGMVKTLVFHEGHA  178
            +DLEWYFF   ++KY +G R NRATE GYWKTTG+DR V  N+ + VGM KTLV+H G A
Sbjct  64   RDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKDRAVHRNKSQVVGMKKTLVYHSGRA  123

Query  179  PKGKRTDWVIHEYRIEDEETL-----QDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            PKG+RT+WV+HEYR+ DE        QD++VLC+VF+KSG GPKNG QYGAPF
Sbjct  124  PKGQRTNWVMHEYRLIDEALDKAGIPQDAFVLCRVFQKSGAGPKNGEQYGAPF  176



>gb|AAM65338.1| NAC, putative [Arabidopsis thaliana]
Length=549

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF    +KY +G + NRATE GYWKTTG+DR ++   + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLNKKYRNGSKTNRATEMGYWKTTGKDREILNGSKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ D++       QD++VLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQKSGSGPKNGEQYGAPF  174



>gb|KFK24891.1| hypothetical protein AALP_AA8G038000 [Arabis alpina]
Length=580

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 86/113 (76%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY +G + NRATE GYWKTTG+DR +    + VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYANGSKTNRATEKGYWKTTGKDREIFNGLKVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEET------LQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE         QD+YVLC++F+KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLSDEVLKKAEVPQQDAYVLCRIFQKSGTGPKNGEQYGAPF  175



>ref|XP_006407560.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
 gb|ESQ49013.1| hypothetical protein EUTSA_v10020438mg [Eutrema salsugineum]
Length=553

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSVLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEE-----TLQDSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DE+       Q +YVLC++F KSG GPKNG QYGAPF
Sbjct  123  RGERTNWVMHEYRLVDEDLEKAGVQQGAYVLCRIFHKSGTGPKNGEQYGAPF  174



>ref|XP_009122601.1| PREDICTED: NAC domain-containing protein 78-like [Brassica rapa]
Length=554

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 88/112 (79%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    KDLEWYFFCPRERKYNSGGRMNRATETGYWKTTGRDRPVVYNERTVGMVKTLVFHEGHAP  181
            +DLEWYFF   ++KY++G + NRATE GYWKTTG+DR +    R VGM KTLV+H+G AP
Sbjct  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRAVGMKKTLVYHKGRAP  122

Query  182  KGKRTDWVIHEYRIEDEETLQ-----DSYVLCKVFKKSGPGPKNGAQYGAPF  322
            +G+RT+WV+HEYR+ DEE  +     D++VLC++F+KSG GPKNG QYGAP+
Sbjct  123  RGERTNWVMHEYRLTDEELKRAGAPLDAFVLCRIFQKSGTGPKNGEQYGAPY  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4365618994296