BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20695_g1_i1 len=2401 path=[2629:0-848 3477:849-1502 4130:1503-2400]

Length=2401
                                                                      Score     E

ref|XP_009759851.1|  PREDICTED: probable inactive leucine-rich re...    667   0.0      
ref|XP_009627313.1|  PREDICTED: probable inactive leucine-rich re...    667   0.0      
dbj|BAO02531.1|  predicted receptor-like protein kinase ortholog        662   0.0      
ref|XP_009801638.1|  PREDICTED: probable inactive leucine-rich re...    655   0.0      
ref|XP_009598283.1|  PREDICTED: probable inactive leucine-rich re...    653   0.0      
ref|XP_004251695.1|  PREDICTED: probable inactive leucine-rich re...    649   0.0      
ref|XP_006345259.1|  PREDICTED: probable inactive leucine-rich re...    645   0.0      
ref|XP_011078123.1|  PREDICTED: probable inactive leucine-rich re...    629   0.0      
gb|EYU28315.1|  hypothetical protein MIMGU_mgv1a025411mg                627   0.0      
ref|XP_006355772.1|  PREDICTED: probable inactive leucine-rich re...    608   0.0      
ref|NP_001234483.1|  receptor-like protein kinase 3 precursor           607   0.0      
gb|EPS68284.1|  receptor-like protein kinase 3                          597   0.0      
ref|XP_004508012.1|  PREDICTED: probable inactive leucine-rich re...    595   0.0      
gb|KDP33937.1|  hypothetical protein JCGZ_07508                         590   0.0      
ref|XP_010656101.1|  PREDICTED: probable inactive leucine-rich re...    588   0.0      
ref|XP_008460083.1|  PREDICTED: probable inactive leucine-rich re...    587   0.0      
ref|XP_004157971.1|  PREDICTED: probable inactive leucine-rich re...    586   0.0      
gb|KGN60492.1|  hypothetical protein Csa_2G000010                       583   0.0      
ref|XP_004141181.1|  PREDICTED: probable inactive leucine-rich re...    583   0.0      
ref|XP_010047460.1|  PREDICTED: probable inactive leucine-rich re...    581   0.0      
ref|XP_002516246.1|  Serine/threonine-protein kinase PBS1, putative     576   0.0      Ricinus communis
ref|XP_004488098.1|  PREDICTED: probable inactive leucine-rich re...    575   0.0      
ref|XP_003595340.1|  Leucine-rich repeat receptor-like protein ki...    572   0.0      
ref|XP_003609981.1|  Leucine-rich repeat receptor-like protein ki...    571   0.0      
ref|XP_003541314.1|  PREDICTED: probable inactive leucine-rich re...    569   0.0      
ref|XP_007154564.1|  hypothetical protein PHAVU_003G129400g             568   0.0      
ref|XP_003551100.1|  PREDICTED: probable inactive leucine-rich re...    567   0.0      
gb|KHN07887.1|  Putative inactive leucine-rich repeat receptor-li...    565   0.0      
ref|XP_010111986.1|  putative inactive leucine-rich repeat recept...    566   0.0      
ref|XP_010273984.1|  PREDICTED: probable inactive leucine-rich re...    565   0.0      
ref|XP_003632778.2|  PREDICTED: probable inactive leucine-rich re...    563   0.0      
emb|CAN83804.1|  hypothetical protein VITISV_015737                     561   0.0      Vitis vinifera
ref|XP_003547509.1|  PREDICTED: probable inactive leucine-rich re...    559   0.0      
ref|XP_010049389.1|  PREDICTED: probable inactive leucine-rich re...    559   0.0      
ref|XP_004236378.2|  PREDICTED: probable inactive leucine-rich re...    551   0.0      
ref|XP_011079548.1|  PREDICTED: probable inactive leucine-rich re...    550   0.0      
ref|XP_003548370.1|  PREDICTED: probable inactive leucine-rich re...    549   0.0      
ref|XP_007135416.1|  hypothetical protein PHAVU_010G127500g             551   0.0      
ref|XP_007024676.1|  Leucine-rich repeat protein kinase family pr...    548   0.0      
ref|XP_010687545.1|  PREDICTED: probable inactive leucine-rich re...    545   0.0      
ref|XP_003529841.1|  PREDICTED: probable inactive leucine-rich re...    546   1e-180   
ref|XP_011039958.1|  PREDICTED: probable inactive leucine-rich re...    544   2e-180   
ref|XP_006343125.1|  PREDICTED: probable inactive leucine-rich re...    542   4e-179   
ref|XP_009622140.1|  PREDICTED: probable inactive leucine-rich re...    539   3e-178   
ref|XP_006381598.1|  leucine-rich repeat transmembrane protein ki...    534   1e-176   
gb|KDP40674.1|  hypothetical protein JCGZ_24673                         536   3e-176   
ref|XP_007138639.1|  hypothetical protein PHAVU_009G225700g             531   8e-176   
ref|XP_009116398.1|  PREDICTED: probable inactive leucine-rich re...    531   2e-175   
ref|XP_010098007.1|  putative inactive leucine-rich repeat recept...    529   2e-175   
ref|XP_010454375.1|  PREDICTED: probable inactive leucine-rich re...    532   3e-175   
ref|XP_006474705.1|  PREDICTED: probable inactive leucine-rich re...    531   3e-175   
ref|XP_006369120.1|  hypothetical protein POPTR_0001s16650g             532   7e-175   
gb|EYU21298.1|  hypothetical protein MIMGU_mgv1a002404mg                531   9e-175   
emb|CDY28610.1|  BnaA06g19280D                                          529   1e-174   
ref|XP_002871954.1|  hypothetical protein ARALYDRAFT_488975             528   6e-174   
ref|XP_010262229.1|  PREDICTED: probable inactive leucine-rich re...    525   6e-173   
ref|XP_002532730.1|  Serine/threonine-protein kinase PBS1, putative     526   2e-172   Ricinus communis
ref|XP_010420914.1|  PREDICTED: probable inactive leucine-rich re...    525   2e-172   
ref|XP_010493179.1|  PREDICTED: probable inactive leucine-rich re...    524   3e-172   
ref|XP_002303233.1|  hypothetical protein POPTR_0003s06660g             519   4e-170   Populus trichocarpa [western balsam poplar]
ref|XP_009120782.1|  PREDICTED: probable inactive leucine-rich re...    518   5e-170   
emb|CDY20366.1|  BnaC02g24500D                                          516   2e-169   
emb|CDY16555.1|  BnaC09g37180D                                          514   1e-168   
ref|XP_008786941.1|  PREDICTED: probable inactive leucine-rich re...    515   2e-168   
gb|EYU45896.1|  hypothetical protein MIMGU_mgv1a025291mg                513   2e-168   
ref|XP_010535804.1|  PREDICTED: probable inactive leucine-rich re...    513   4e-168   
ref|XP_011036550.1|  PREDICTED: probable inactive leucine-rich re...    513   8e-168   
ref|XP_009126469.1|  PREDICTED: probable inactive leucine-rich re...    501   2e-163   
emb|CDY45073.1|  BnaA02g05030D                                          498   1e-162   
ref|XP_010520528.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    493   2e-160   
gb|KHN39608.1|  Putative inactive leucine-rich repeat receptor-li...    492   2e-160   
emb|CDP03056.1|  unnamed protein product                                452   1e-146   
ref|XP_010537633.1|  PREDICTED: probable inactive leucine-rich re...    456   5e-146   
gb|EPS65307.1|  hypothetical protein M569_09473                         443   1e-142   
ref|XP_006301629.1|  hypothetical protein CARUB_v10022071mg             446   2e-142   
ref|XP_006850972.1|  hypothetical protein AMTR_s00025p00206890          442   8e-141   
gb|KFK41666.1|  hypothetical protein AALP_AA2G157000                    429   1e-135   
ref|NP_177390.1|  putative leucine-rich repeat transmembrane prot...    423   1e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887434.1|  hypothetical protein ARALYDRAFT_316211             422   3e-133   
gb|KHN17736.1|  Putative inactive leucine-rich repeat receptor-li...    412   2e-132   
ref|XP_009393951.1|  PREDICTED: probable LRR receptor-like serine...    417   7e-131   
emb|CDO97828.1|  unnamed protein product                                412   1e-130   
ref|XP_007011459.1|  Leucine-rich repeat protein kinase family pr...    409   3e-128   
ref|XP_009379907.1|  PREDICTED: probably inactive leucine-rich re...    403   5e-126   
ref|XP_003588623.1|  Receptor-like protein kinase                       404   8e-126   
gb|AES58874.2|  LRR receptor-like kinase                                404   8e-126   
gb|KFK30772.1|  hypothetical protein AALP_AA6G024300                    403   1e-125   
gb|KDP25034.1|  hypothetical protein JCGZ_22569                         402   3e-125   
ref|XP_010048526.1|  PREDICTED: probable LRR receptor-like serine...    401   8e-125   
ref|NP_001057063.1|  Os06g0198900                                       402   1e-124   Oryza sativa Japonica Group [Japonica rice]
emb|CBI27779.3|  unnamed protein product                                397   1e-124   
gb|EAZ00041.1|  hypothetical protein OsI_22042                          401   2e-124   Oryza sativa Indica Group [Indian rice]
gb|EAZ36151.1|  hypothetical protein OsJ_20461                          401   3e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008228018.1|  PREDICTED: probably inactive leucine-rich re...    399   5e-124   
ref|XP_007217637.1|  hypothetical protein PRUPE_ppa002419mg             397   3e-123   
gb|AET04312.2|  LRR receptor-like kinase                                396   4e-123   
gb|KHN42785.1|  Putative inactive leucine-rich repeat receptor-li...    385   5e-123   
gb|KCW80801.1|  hypothetical protein EUGRSUZ_C02173                     396   5e-123   
ref|XP_009127936.1|  PREDICTED: probably inactive leucine-rich re...    394   2e-122   
ref|XP_002531377.1|  leucine-rich repeat transmembrane protein ki...    394   5e-122   Ricinus communis
emb|CDY53303.1|  BnaC02g46420D                                          392   9e-122   
emb|CDY03637.1|  BnaA02g16000D                                          392   1e-121   
ref|XP_010454374.1|  PREDICTED: probable inactive leucine-rich re...    380   3e-120   
ref|XP_003629836.1|  Receptor-like protein kinase                       395   3e-120   
ref|XP_010696133.1|  PREDICTED: probably inactive leucine-rich re...    387   8e-120   
ref|XP_011011658.1|  PREDICTED: probably inactive leucine-rich re...    387   1e-119   
ref|XP_008242264.1|  PREDICTED: probable inactive leucine-rich re...    386   2e-119   
ref|XP_002310352.2|  hypothetical protein POPTR_0007s15220g             384   2e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009359759.1|  PREDICTED: probable inactive leucine-rich re...    384   3e-118   
ref|XP_007204840.1|  hypothetical protein PRUPE_ppa026803mg             383   8e-118   
ref|XP_008337835.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    382   1e-117   
ref|XP_008389019.1|  PREDICTED: probable inactive leucine-rich re...    381   3e-117   
ref|XP_009337188.1|  PREDICTED: probable inactive leucine-rich re...    381   4e-117   
ref|XP_007012600.1|  Leucine-rich repeat protein kinase family pr...    374   7e-117   
ref|NP_197569.2|  probable inactive leucine-rich repeat receptor-...    380   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545559.1|  PREDICTED: probably inactive leucine-rich re...    379   2e-116   
ref|XP_002868416.1|  hypothetical protein ARALYDRAFT_330185             377   1e-115   
ref|XP_006400637.1|  hypothetical protein EUTSA_v10015893mg             375   1e-115   
ref|XP_004498698.1|  PREDICTED: probably inactive leucine-rich re...    376   4e-115   
ref|XP_006374738.1|  leucine-rich repeat transmembrane protein ki...    375   5e-115   
ref|XP_007012599.1|  Leucine-rich repeat protein kinase family pr...    374   9e-115   
ref|XP_002877261.1|  hypothetical protein ARALYDRAFT_347421             374   1e-114   
gb|KHN30797.1|  Putative LRR receptor-like serine/threonine-prote...    374   1e-114   
ref|XP_010425800.1|  PREDICTED: probable inactive leucine-rich re...    373   2e-114   
ref|XP_006601075.1|  PREDICTED: probably inactive leucine-rich re...    373   3e-114   
ref|XP_006290165.1|  hypothetical protein CARUB_v10003833mg             374   3e-114   
ref|XP_010514707.1|  PREDICTED: probable inactive leucine-rich re...    372   3e-114   
ref|NP_189874.1|  leucine-rich repeat protein kinase-like protein       371   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228165.1|  PREDICTED: probable inactive leucine-rich re...    373   1e-113   
ref|XP_007217312.1|  hypothetical protein PRUPE_ppa016164mg             373   1e-113   
gb|ABA18095.1|  lrr transmembrane protein kinase                        370   1e-113   Olimarabidopsis pumila
gb|KFK33835.1|  hypothetical protein AALP_AA5G066100                    370   2e-113   
ref|XP_004288996.1|  PREDICTED: probable inactive leucine-rich re...    372   3e-113   
ref|XP_010503020.1|  PREDICTED: probable inactive leucine-rich re...    369   4e-113   
ref|XP_006292595.1|  hypothetical protein CARUB_v10018834mg             369   6e-113   
ref|XP_010450371.1|  PREDICTED: probable LRR receptor-like serine...    368   2e-112   
emb|CDY12339.1|  BnaA06g20050D                                          367   5e-112   
ref|XP_006419171.1|  hypothetical protein EUTSA_v10002439mg             367   6e-112   
ref|XP_009123261.1|  PREDICTED: probable inactive leucine-rich re...    366   9e-112   
ref|XP_010435432.1|  PREDICTED: probable LRR receptor-like serine...    366   1e-111   
gb|KEH18496.1|  receptor-like kinase, putative                          364   5e-110   
emb|CDY36051.1|  BnaC03g41470D                                          362   6e-110   
ref|XP_006452838.1|  hypothetical protein CICLE_v10007699mg             362   6e-110   
gb|KDO73854.1|  hypothetical protein CISIN_1g006306mg                   361   8e-110   
ref|XP_010034802.1|  PREDICTED: probable inactive leucine-rich re...    362   8e-110   
ref|XP_007140993.1|  hypothetical protein PHAVU_008G158100g             358   8e-109   
ref|XP_009111239.1|  PREDICTED: probably inactive leucine-rich re...    358   1e-108   
ref|XP_009788384.1|  PREDICTED: probable inactive leucine-rich re...    357   3e-108   
ref|XP_009135668.1|  PREDICTED: probably inactive leucine-rich re...    358   4e-108   
emb|CDX82258.1|  BnaA03g35630D                                          357   8e-108   
ref|XP_010488804.1|  PREDICTED: probable LRR receptor-like serine...    355   1e-107   
ref|XP_008453523.1|  PREDICTED: probable LRR receptor-like serine...    355   2e-107   
gb|KDO64959.1|  hypothetical protein CISIN_1g0456521mg                  352   2e-107   
gb|KFK26292.1|  hypothetical protein AALP_AA8G229000                    355   3e-107   
ref|XP_004305762.1|  PREDICTED: probable inactive leucine-rich re...    357   3e-107   
ref|XP_010467136.1|  PREDICTED: probable LRR receptor-like serine...    352   2e-106   
ref|XP_009135669.1|  PREDICTED: probably inactive leucine-rich re...    353   2e-106   
ref|XP_006426704.1|  hypothetical protein CICLE_v10027353mg             352   2e-106   
ref|XP_008802490.1|  PREDICTED: probable inactive leucine-rich re...    353   3e-106   
ref|XP_010424673.1|  PREDICTED: probable LRR receptor-like serine...    351   2e-105   
ref|XP_006466144.1|  PREDICTED: probable inactive leucine-rich re...    350   2e-105   
ref|XP_010685280.1|  PREDICTED: probable inactive leucine-rich re...    348   1e-104   
ref|XP_010937370.1|  PREDICTED: probable inactive leucine-rich re...    352   2e-103   
ref|XP_004510527.1|  PREDICTED: probable inactive leucine-rich re...    344   2e-102   
ref|XP_009398949.1|  PREDICTED: probable inactive leucine-rich re...    340   8e-102   
ref|XP_008659160.1|  PREDICTED: probable inactive leucine-rich re...    335   3e-99    
emb|CDY33451.1|  BnaC01g32740D                                          335   8e-99    
ref|XP_011012022.1|  PREDICTED: probable inactive leucine-rich re...    333   3e-98    
ref|XP_004964582.1|  PREDICTED: probable inactive leucine-rich re...    330   1e-97    
ref|XP_009400107.1|  PREDICTED: probable inactive leucine-rich re...    328   2e-97    
ref|XP_010917473.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    328   6e-97    
ref|XP_006656738.1|  PREDICTED: probable inactive leucine-rich re...    325   3e-96    
ref|XP_008792889.1|  PREDICTED: probable inactive leucine-rich re...    326   7e-96    
gb|KHN16700.1|  Putative LRR receptor-like serine/threonine-prote...    320   1e-95    
ref|XP_009417809.1|  PREDICTED: probable inactive leucine-rich re...    323   1e-94    
ref|XP_002882256.1|  hypothetical protein ARALYDRAFT_896266             317   3e-93    
ref|XP_002436644.1|  hypothetical protein SORBIDRAFT_10g006480          315   1e-91    Sorghum bicolor [broomcorn]
ref|NP_186938.1|  leucine-rich repeat protein kinase family protein     307   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004292489.1|  PREDICTED: probable inactive receptor kinase...    305   5e-89    
ref|XP_006297231.1|  hypothetical protein CARUB_v10013240mg             305   8e-89    
emb|CDY49655.1|  BnaC09g41330D                                          304   1e-88    
ref|XP_006408370.1|  hypothetical protein EUTSA_v10020304mg             302   9e-88    
gb|KFK37686.1|  hypothetical protein AALP_AA3G015500                    300   3e-87    
ref|XP_006400197.1|  hypothetical protein EUTSA_v10012966mg             301   3e-87    
ref|XP_010525076.1|  PREDICTED: probable inactive receptor kinase...    298   3e-86    
ref|XP_006351525.1|  PREDICTED: probable leucine-rich repeat rece...    297   4e-86    
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             296   4e-86    
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    297   6e-86    Populus trichocarpa [western balsam poplar]
gb|EPS62777.1|  hypothetical protein M569_12011                         295   4e-85    
gb|AAA33715.1|  receptor kinase                                         296   7e-85    Petunia integrifolia [violet-flowered petunia]
ref|XP_010032718.1|  PREDICTED: probable inactive receptor kinase...    294   2e-84    
ref|XP_010502431.1|  PREDICTED: probable inactive receptor kinase...    292   4e-84    
gb|KFK25876.1|  hypothetical protein AALP_AA8G173700                    291   6e-84    
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    293   6e-84    
ref|XP_006287270.1|  hypothetical protein CARUB_v10000461mg             291   1e-83    
ref|XP_006849766.1|  hypothetical protein AMTR_s00024p00252010          291   1e-83    
ref|XP_009126125.1|  PREDICTED: probable inactive receptor kinase...    287   2e-82    
gb|KHG20593.1|  putative inactive receptor kinase -like protein         286   3e-82    
ref|XP_010317542.1|  PREDICTED: probable leucine-rich repeat rece...    285   8e-82    
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    285   3e-81    
ref|NP_197162.1|  leucine-rich repeat protein 1                         283   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105639.1|  putative inactive receptor kinase                  280   2e-79    
ref|XP_001774015.1|  predicted protein                                  278   2e-79    
ref|XP_010420358.1|  PREDICTED: probable inactive receptor kinase...    280   2e-79    
dbj|BAK05854.1|  predicted protein                                      281   2e-79    
ref|NP_001170153.1|  uncharacterized protein LOC100384085               269   4e-79    Zea mays [maize]
ref|XP_007141918.1|  hypothetical protein PHAVU_008G236900g             278   9e-79    
ref|XP_002868800.1|  hypothetical protein ARALYDRAFT_356181             276   2e-78    
ref|XP_009396580.1|  PREDICTED: probable LRR receptor-like serine...    276   4e-78    
ref|XP_008457025.1|  PREDICTED: probable inactive receptor kinase...    276   4e-78    
ref|XP_002449883.1|  hypothetical protein SORBIDRAFT_05g024870          277   4e-78    Sorghum bicolor [broomcorn]
gb|KGN53699.1|  hypothetical protein Csa_4G107410                       274   2e-77    
gb|KDP33412.1|  hypothetical protein JCGZ_06983                         273   5e-77    
ref|XP_004979747.1|  PREDICTED: probable inactive leucine-rich re...    274   6e-77    
gb|AFW60340.1|  putative leucine-rich repeat protein kinase famil...    272   2e-76    
gb|KHN41064.1|  Putative inactive receptor kinase                       268   5e-76    
ref|XP_010048494.1|  PREDICTED: probable LRR receptor-like serine...    270   7e-76    
gb|AAN40020.1|  putative receptor kinase                                270   9e-76    Zea mays [maize]
ref|XP_002310125.2|  leucine-rich repeat transmembrane protein ki...    269   1e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008781714.1|  PREDICTED: probable LRR receptor-like serine...    268   3e-75    
ref|XP_011001561.1|  PREDICTED: probable inactive receptor kinase...    266   9e-75    
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    267   1e-74    
ref|XP_003577341.1|  PREDICTED: probable inactive leucine-rich re...    267   2e-74    
ref|XP_010548524.1|  PREDICTED: probable LRR receptor-like serine...    266   2e-74    
ref|XP_009418877.1|  PREDICTED: probable LRR receptor-like serine...    265   4e-74    
gb|EMT28754.1|  Putative inactive receptor kinase                       264   5e-74    
ref|XP_010913795.1|  PREDICTED: probable LRR receptor-like serine...    265   6e-74    
ref|XP_004169814.1|  PREDICTED: probable inactive receptor kinase...    268   6e-74    
gb|KDO67159.1|  hypothetical protein CISIN_1g008431mg                   263   6e-74    
ref|XP_004503557.1|  PREDICTED: probable LRR receptor-like serine...    264   9e-74    
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    264   9e-74    
ref|XP_007014565.1|  Leucine-rich repeat protein kinase family pr...    264   9e-74    
ref|XP_008783081.1|  PREDICTED: probable LRR receptor-like serine...    265   1e-73    
gb|KHM99860.1|  Putative LRR receptor-like serine/threonine-prote...    261   1e-73    
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    264   2e-73    
ref|XP_006483642.1|  PREDICTED: probable LRR receptor-like serine...    263   2e-73    
ref|XP_004512689.1|  PREDICTED: probable leucine-rich repeat rece...    262   3e-73    
ref|XP_003524427.1|  PREDICTED: probable LRR receptor-like serine...    262   6e-73    
ref|XP_010929417.1|  PREDICTED: probable LRR receptor-like serine...    263   6e-73    
gb|KDO62032.1|  hypothetical protein CISIN_1g044996mg                   263   7e-73    
ref|XP_010928783.1|  PREDICTED: probably inactive leucine-rich re...    262   8e-73    
ref|XP_003560964.1|  PREDICTED: probable inactive leucine-rich re...    263   8e-73    
ref|XP_006450084.1|  hypothetical protein CICLE_v10010710mg             262   9e-73    
ref|XP_006371830.1|  leucine-rich repeat transmembrane protein ki...    261   1e-72    
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    263   1e-72    
ref|XP_006453183.1|  hypothetical protein CICLE_v10010420mg             263   1e-72    
ref|XP_006474649.1|  PREDICTED: probable LRR receptor-like serine...    262   2e-72    
gb|KCW52164.1|  hypothetical protein EUGRSUZ_J01604                     259   3e-72    
ref|XP_010669504.1|  PREDICTED: probable LRR receptor-like serine...    260   5e-72    
ref|XP_006360647.1|  PREDICTED: receptor-like protein kinase            260   5e-72    
gb|KHN40609.1|  Putative inactive receptor kinase                       258   7e-72    
ref|XP_007023629.1|  Leucine-rich repeat protein kinase family pr...    259   1e-71    
ref|XP_011002964.1|  PREDICTED: probable LRR receptor-like serine...    258   1e-71    
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    257   1e-71    
ref|XP_006372561.1|  hypothetical protein POPTR_0017s02820g             256   2e-71    
gb|EYU22081.1|  hypothetical protein MIMGU_mgv1a025506mg                258   2e-71    
ref|NP_001068295.1|  Os11g0620500                                       258   4e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002438799.1|  hypothetical protein SORBIDRAFT_10g026460          257   4e-71    Sorghum bicolor [broomcorn]
gb|EAZ37914.1|  hypothetical protein OsJ_22264                          254   5e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007227448.1|  hypothetical protein PRUPE_ppa002739mg             256   5e-71    
dbj|BAD43961.1|  receptor kinase - like protein                         255   7e-71    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001169728.1|  uncharacterized LOC100383609 precursor             256   8e-71    Zea mays [maize]
gb|EAZ01976.1|  hypothetical protein OsI_24010                          254   8e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_008223942.1|  PREDICTED: probable LRR receptor-like serine...    257   8e-71    
ref|XP_009618438.1|  PREDICTED: probable LRR receptor-like serine...    257   9e-71    
ref|XP_003532451.1|  PREDICTED: probable LRR receptor-like serine...    255   1e-70    
ref|XP_011076339.1|  PREDICTED: probable LRR receptor-like serine...    255   1e-70    
ref|XP_008348703.1|  PREDICTED: probably inactive leucine-rich re...    256   2e-70    
ref|XP_002267926.1|  PREDICTED: probable LRR receptor-like serine...    255   2e-70    Vitis vinifera
ref|XP_009759671.1|  PREDICTED: probable LRR receptor-like serine...    256   2e-70    
ref|XP_010252428.1|  PREDICTED: probably inactive leucine-rich re...    255   2e-70    
ref|XP_006412614.1|  hypothetical protein EUTSA_v10024605mg             256   2e-70    
ref|XP_009406388.1|  PREDICTED: probable LRR receptor-like serine...    254   2e-70    
emb|CDY61284.1|  BnaA01g36890D                                          254   3e-70    
ref|XP_004954693.1|  PREDICTED: probably inactive leucine-rich re...    255   3e-70    
ref|XP_008680891.1|  PREDICTED: probably inactive leucine-rich re...    255   3e-70    
ref|XP_011006663.1|  PREDICTED: probable LRR receptor-like serine...    254   3e-70    
ref|XP_004137558.1|  PREDICTED: probable LRR receptor-like serine...    254   3e-70    
gb|AAK49114.1|AF252414_1  receptor-like protein kinase                  243   3e-70    Nicotiana tabacum [American tobacco]
ref|NP_567870.1|  putative LRR receptor-like serine/threonine-pro...    255   4e-70    
ref|XP_009420000.1|  PREDICTED: probably inactive leucine-rich re...    254   4e-70    
ref|NP_001233883.1|  receptor-like protein kinase precursor             255   4e-70    
ref|XP_007160216.1|  hypothetical protein PHAVU_002G302600g             253   5e-70    
ref|XP_004166390.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    254   5e-70    
ref|XP_009362063.1|  PREDICTED: probable LRR receptor-like serine...    254   5e-70    
ref|XP_008455650.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    254   6e-70    
dbj|BAD45864.1|  putative receptor-like protein kinase PRK1             254   6e-70    
emb|CAN83670.1|  hypothetical protein VITISV_017867                     253   7e-70    
ref|XP_008380416.1|  PREDICTED: probably inactive leucine-rich re...    254   7e-70    
ref|XP_004245435.1|  PREDICTED: probably inactive leucine-rich re...    253   8e-70    
ref|XP_003630602.1|  Receptor-like protein kinase                       253   8e-70    
ref|XP_002266187.2|  PREDICTED: probable LRR receptor-like serine...    253   8e-70    
ref|XP_004967115.1|  PREDICTED: probably inactive leucine-rich re...    253   9e-70    
ref|XP_006382206.1|  hypothetical protein POPTR_0006s29360g             253   9e-70    
ref|XP_007137141.1|  hypothetical protein PHAVU_009G103100g             253   1e-69    
ref|XP_009379253.1|  PREDICTED: probably inactive leucine-rich re...    254   1e-69    
ref|XP_009763657.1|  PREDICTED: probable LRR receptor-like serine...    253   1e-69    
ref|XP_004301394.1|  PREDICTED: probable LRR receptor-like serine...    254   1e-69    
ref|XP_008391423.1|  PREDICTED: probable LRR receptor-like serine...    253   1e-69    
ref|XP_009610719.1|  PREDICTED: probable LRR receptor-like serine...    253   1e-69    
ref|XP_009334978.1|  PREDICTED: probably inactive leucine-rich re...    253   2e-69    
ref|XP_006285357.1|  hypothetical protein CARUB_v10006748mg             253   2e-69    
ref|XP_010557641.1|  PREDICTED: probable LRR receptor-like serine...    253   2e-69    
ref|XP_010669608.1|  PREDICTED: probable LRR receptor-like serine...    253   2e-69    
ref|XP_009130148.1|  PREDICTED: probable LRR receptor-like serine...    252   4e-69    
dbj|BAO02524.1|  predicted receptor-like protein kinase ortholog        251   5e-69    
ref|XP_010432887.1|  PREDICTED: probable LRR receptor-like serine...    251   7e-69    
ref|XP_006355245.1|  PREDICTED: probably inactive leucine-rich re...    251   7e-69    
ref|XP_008645295.1|  PREDICTED: probably inactive leucine-rich re...    251   7e-69    
ref|XP_009762626.1|  PREDICTED: probable LRR receptor-like serine...    251   8e-69    
dbj|BAJ94990.1|  predicted protein                                      244   9e-69    
ref|XP_010438061.1|  PREDICTED: probable LRR receptor-like serine...    251   9e-69    
gb|EYU29168.1|  hypothetical protein MIMGU_mgv1a021385mg                249   9e-69    
ref|XP_010648453.1|  PREDICTED: probable LRR receptor-like serine...    250   9e-69    
gb|KGN54624.1|  hypothetical protein Csa_4G385800                       244   1e-68    
ref|XP_010447595.1|  PREDICTED: probable LRR receptor-like serine...    251   2e-68    
ref|XP_009370043.1|  PREDICTED: probable LRR receptor-like serine...    250   2e-68    
ref|XP_004151687.1|  PREDICTED: probably inactive leucine-rich re...    243   2e-68    
ref|XP_004164104.1|  PREDICTED: probable LRR receptor-like serine...    243   2e-68    
gb|KFK41665.1|  hypothetical protein AALP_AA2G157000                    250   2e-68    
emb|CBI20805.3|  unnamed protein product                                250   2e-68    
gb|KFK29710.1|  hypothetical protein AALP_AA7G168800                    250   3e-68    
ref|XP_004488972.1|  PREDICTED: probably inactive leucine-rich re...    249   3e-68    
ref|XP_009113711.1|  PREDICTED: probable inactive receptor kinase...    249   3e-68    
ref|XP_007150847.1|  hypothetical protein PHAVU_005G185800g             249   5e-68    
gb|AFX60111.1|  phytophthora resistance protein RpsWD15-1               245   6e-68    
ref|XP_010263379.1|  PREDICTED: probable LRR receptor-like serine...    248   6e-68    
gb|KHN32925.1|  Putative LRR receptor-like serine/threonine-prote...    247   7e-68    
ref|XP_003517616.2|  PREDICTED: probable LRR receptor-like serine...    247   7e-68    
ref|XP_004513119.1|  PREDICTED: probable LRR receptor-like serine...    248   9e-68    
gb|EMT31804.1|  Putative LRR receptor-like serine/threonine-prote...    241   1e-67    
ref|XP_010420196.1|  PREDICTED: probably inactive leucine-rich re...    243   1e-67    
ref|XP_008341159.1|  PREDICTED: probable LRR receptor-like serine...    247   1e-67    
emb|CDY59781.1|  BnaCnng35570D                                          248   2e-67    
ref|XP_010112460.1|  Probably inactive leucine-rich repeat recept...    247   2e-67    
ref|XP_008801439.1|  PREDICTED: probable LRR receptor-like serine...    248   2e-67    
ref|XP_002867307.1|  hypothetical protein ARALYDRAFT_328596             251   3e-67    
ref|XP_010440709.1|  PREDICTED: probable LRR receptor-like serine...    247   3e-67    
ref|XP_010106937.1|  putative LRR receptor-like serine/threonine-...    244   3e-67    
ref|XP_002451635.1|  hypothetical protein SORBIDRAFT_04g004970          246   3e-67    
gb|KGN62853.1|  hypothetical protein Csa_2G377890                       241   3e-67    
ref|XP_004169373.1|  PREDICTED: probable LRR receptor-like serine...    246   4e-67    
ref|XP_009590269.1|  PREDICTED: probably inactive leucine-rich re...    246   4e-67    
ref|XP_008798178.1|  PREDICTED: probable LRR receptor-like serine...    246   4e-67    
dbj|BAO02528.1|  predicted receptor-like protein kinase ortholog        235   7e-67    
gb|KEH27280.1|  LRR receptor-like kinase                                245   7e-67    
ref|XP_009334877.1|  PREDICTED: probable leucine-rich repeat rece...    246   7e-67    
ref|XP_011082267.1|  PREDICTED: probable LRR receptor-like serine...    244   8e-67    
gb|EYU40778.1|  hypothetical protein MIMGU_mgv1a019401mg                245   8e-67    
ref|XP_006344573.1|  PREDICTED: receptor-like protein kinase            244   1e-66    
emb|CAA16528.1|  receptor kinase-like protein                           249   1e-66    
ref|XP_004136442.1|  PREDICTED: probable LRR receptor-like serine...    244   1e-66    
emb|CDY60523.1|  BnaAnng16900D                                          246   1e-66    
gb|KEH39699.1|  LRR receptor-like kinase                                244   2e-66    
ref|XP_009108026.1|  PREDICTED: probable LRR receptor-like serine...    245   2e-66    
ref|XP_008350328.1|  PREDICTED: probable leucine-rich repeat rece...    245   2e-66    
emb|CDP12489.1|  unnamed protein product                                244   2e-66    
emb|CDY28252.1|  BnaA01g05970D                                          251   2e-66    
ref|XP_008444094.1|  PREDICTED: probably inactive leucine-rich re...    244   2e-66    
emb|CDX68730.1|  BnaC01g07230D                                          252   2e-66    
ref|XP_008466279.1|  PREDICTED: probable LRR receptor-like serine...    243   3e-66    
ref|XP_006372223.1|  leucine-rich repeat transmembrane protein ki...    243   6e-66    
ref|NP_001233877.1|  receptor-like protein kinase precursor             243   6e-66    
ref|XP_009400106.1|  PREDICTED: U-box domain-containing protein 5...    250   7e-66    
ref|XP_010112127.1|  putative LRR receptor-like serine/threonine-...    242   9e-66    
ref|XP_004138883.1|  PREDICTED: probable LRR receptor-like serine...    241   9e-66    
ref|XP_004305795.1|  PREDICTED: probable LRR receptor-like serine...    242   1e-65    
ref|XP_002527999.1|  leucine-rich repeat transmembrane protein ki...    241   1e-65    
ref|XP_010487987.1|  PREDICTED: probably inactive leucine-rich re...    242   2e-65    
ref|XP_006374812.1|  leucine-rich repeat transmembrane protein ki...    232   2e-65    
ref|XP_003523723.2|  PREDICTED: probably inactive leucine-rich re...    241   2e-65    
ref|XP_011017610.1|  PREDICTED: probable LRR receptor-like serine...    242   2e-65    
ref|XP_002309026.2|  leucine-rich repeat transmembrane protein ki...    241   2e-65    
ref|XP_004236369.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    242   3e-65    
gb|AAK49112.1|AF252412_1  receptor-like protein kinase                  229   3e-65    
ref|XP_006848637.1|  hypothetical protein AMTR_s00171p00046350          231   3e-65    
emb|CDY67567.1|  BnaCnng55470D                                          239   4e-65    
ref|XP_004160860.1|  PREDICTED: probable LRR receptor-like serine...    240   6e-65    
ref|NP_198389.2|  probable LRR receptor-like serine/threonine-pro...    240   7e-65    
ref|XP_008378232.1|  PREDICTED: probable LRR receptor-like serine...    239   7e-65    
ref|XP_010415996.1|  PREDICTED: probable inactive leucine-rich re...    239   8e-65    
gb|AAC13607.1|  similar to eukaryotic protein kinase domains (Pfa...    240   9e-65    
ref|XP_008663839.1|  PREDICTED: probable LRR receptor-like serine...    241   1e-64    
ref|XP_011031245.1|  PREDICTED: probably inactive leucine-rich re...    239   2e-64    
ref|XP_010474298.1|  PREDICTED: probable inactive leucine-rich re...    241   2e-64    
ref|XP_010431495.1|  PREDICTED: probable inactive leucine-rich re...    238   2e-64    
ref|XP_011094043.1|  PREDICTED: probable LRR receptor-like serine...    238   2e-64    
ref|XP_008361047.1|  PREDICTED: probable LRR receptor-like serine...    237   3e-64    
gb|EMT05722.1|  Putative LRR receptor-like serine/threonine-prote...    233   3e-64    
ref|XP_008393925.1|  PREDICTED: probable LRR receptor-like serine...    237   4e-64    
ref|XP_008445066.1|  PREDICTED: probable LRR receptor-like serine...    238   5e-64    
ref|XP_011101568.1|  PREDICTED: probable LRR receptor-like serine...    238   5e-64    
emb|CDX68266.1|  BnaA07g23060D                                          238   5e-64    
gb|EAY84680.1|  hypothetical protein OsI_06052                          238   6e-64    
dbj|BAD26195.1|  putative receptor-like protein kinase PRK1             238   6e-64    
ref|XP_010236288.1|  PREDICTED: probably inactive leucine-rich re...    237   6e-64    
gb|EAZ21924.1|  hypothetical protein OsJ_05577                          238   6e-64    
ref|XP_009353377.1|  PREDICTED: probable LRR receptor-like serine...    239   7e-64    
ref|XP_004974851.1|  PREDICTED: probably inactive leucine-rich re...    238   7e-64    
ref|XP_006286117.1|  hypothetical protein CARUB_v10007666mg             237   7e-64    
ref|XP_003560406.2|  PREDICTED: probably inactive leucine-rich re...    237   7e-64    
ref|XP_002513300.1|  receptor protein kinase, putative                  236   9e-64    
gb|AAK49113.1|AF252413_1  receptor-like protein kinase                  225   1e-63    
ref|XP_011019962.1|  PREDICTED: probable LRR receptor-like serine...    236   2e-63    
gb|AAO22728.1|  putative leucine-rich repeat transmembrane protei...    231   2e-63    
emb|CDX92443.1|  BnaA10g14820D                                          233   3e-63    
gb|KDP27751.1|  hypothetical protein JCGZ_19780                         234   3e-63    
ref|XP_009104857.1|  PREDICTED: probable inactive leucine-rich re...    235   3e-63    
ref|XP_006393130.1|  hypothetical protein EUTSA_v10012173mg             236   3e-63    
ref|XP_010534738.1|  PREDICTED: probably inactive leucine-rich re...    235   4e-63    
ref|XP_011073036.1|  PREDICTED: probable LRR receptor-like serine...    234   4e-63    
ref|XP_007224182.1|  hypothetical protein PRUPE_ppa016973mg             234   4e-63    
gb|KFK39344.1|  hypothetical protein AALP_AA3G232000                    235   5e-63    
ref|XP_008220008.1|  PREDICTED: probable LRR receptor-like serine...    234   5e-63    
ref|XP_007152998.1|  hypothetical protein PHAVU_004G177900g             234   6e-63    
emb|CDY42231.1|  BnaA01g25640D                                          236   6e-63    
ref|XP_004292872.1|  PREDICTED: probable LRR receptor-like serine...    233   1e-62    
ref|XP_006450023.1|  hypothetical protein CICLE_v10013947mg             233   1e-62    
ref|XP_009368028.1|  PREDICTED: probable LRR receptor-like serine...    234   2e-62    
gb|KFK35922.1|  hypothetical protein AALP_AA4G053700                    234   2e-62    
gb|EYU45943.1|  hypothetical protein MIMGU_mgv1a003846mg                231   2e-62    
ref|XP_006390654.1|  hypothetical protein EUTSA_v10019489mg             232   4e-62    
gb|EYU26559.1|  hypothetical protein MIMGU_mgv1a002630mg                231   5e-62    
ref|XP_002445874.1|  hypothetical protein SORBIDRAFT_07g027220          233   6e-62    
ref|XP_011078194.1|  PREDICTED: probable LRR receptor-like serine...    232   6e-62    
ref|XP_006660296.1|  PREDICTED: probably inactive leucine-rich re...    232   7e-62    
ref|XP_006396093.1|  hypothetical protein EUTSA_v10002436mg             231   8e-62    
gb|KDO48983.1|  hypothetical protein CISIN_1g038422mg                   231   8e-62    
ref|XP_006468243.1|  PREDICTED: probably inactive leucine-rich re...    231   8e-62    
ref|NP_188654.2|  leucine-rich repeat protein kinase-like protein       231   2e-61    
ref|NP_175476.2|  probably inactive leucine-rich repeat receptor-...    230   2e-61    
gb|EYU21189.1|  hypothetical protein MIMGU_mgv1a002862mg                229   2e-61    
ref|XP_003546901.2|  PREDICTED: probably inactive leucine-rich re...    230   3e-61    
gb|KFK39918.1|  hypothetical protein AALP_AA3G306100                    229   3e-61    
ref|XP_009144949.1|  PREDICTED: probably inactive leucine-rich re...    229   5e-61    
emb|CDO97732.1|  unnamed protein product                                229   7e-61    
ref|XP_002883234.1|  hypothetical protein ARALYDRAFT_479539             229   7e-61    
ref|XP_008240433.1|  PREDICTED: probable leucine-rich repeat rece...    227   7e-61    
gb|EAZ07670.1|  hypothetical protein OsI_29926                          229   7e-61    
ref|XP_006298973.1|  hypothetical protein CARUB_v10015098mg             229   8e-61    
emb|CBI27592.3|  unnamed protein product                                228   1e-60    
ref|XP_006374751.1|  hypothetical protein POPTR_0014s00480g             223   1e-60    
ref|XP_006304574.1|  hypothetical protein CARUB_v10011600mg             227   3e-60    
ref|XP_003574774.1|  PREDICTED: probable LRR receptor-like serine...    228   3e-60    
ref|XP_002883746.1|  hypothetical protein ARALYDRAFT_480229             226   3e-60    
ref|NP_001182863.1|  uncharacterized LOC100501125 precursor             228   4e-60    
ref|XP_007208860.1|  hypothetical protein PRUPE_ppa025841mg             225   4e-60    
ref|NP_001062273.1|  Os08g0521200                                       227   5e-60    
gb|EPS63649.1|  receptor-like protein kinase                            225   5e-60    
emb|CDY07311.1|  BnaC05g26730D                                          226   5e-60    
ref|XP_008393531.1|  PREDICTED: probable leucine-rich repeat rece...    225   6e-60    
ref|XP_006648359.1|  PREDICTED: probable LRR receptor-like serine...    219   7e-60    
ref|XP_006406412.1|  hypothetical protein EUTSA_v10020208mg             226   7e-60    
ref|XP_002267180.2|  PREDICTED: probable leucine-rich repeat rece...    224   1e-59    
ref|XP_002265151.2|  PREDICTED: probable inactive leucine-rich re...    226   1e-59    
ref|XP_009123668.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    224   1e-59    
emb|CBI26398.3|  unnamed protein product                                224   2e-59    
emb|CDY03611.1|  BnaC03g68700D                                          224   2e-59    
gb|EYU25757.1|  hypothetical protein MIMGU_mgv1a002807mg                224   2e-59    
gb|EPS66154.1|  receptor-like protein kinase                            223   3e-59    
ref|XP_009107215.1|  PREDICTED: probably inactive leucine-rich re...    221   2e-58    
ref|XP_010500635.1|  PREDICTED: probably inactive leucine-rich re...    222   2e-58    
ref|XP_009597544.1|  PREDICTED: probable leucine-rich repeat rece...    221   2e-58    
ref|NP_178721.3|  pollen receptor kinase 2A                             221   3e-58    
ref|XP_009767151.1|  PREDICTED: probable inactive receptor kinase...    220   4e-58    
ref|XP_010461912.1|  PREDICTED: probably inactive leucine-rich re...    221   4e-58    
ref|XP_011035436.1|  PREDICTED: probable inactive receptor kinase...    219   5e-58    
ref|XP_011035435.1|  PREDICTED: probable inactive receptor kinase...    219   5e-58    
ref|XP_002305040.2|  hypothetical protein POPTR_0004s06500g             219   8e-58    
ref|XP_010479523.1|  PREDICTED: probably inactive leucine-rich re...    220   9e-58    
ref|XP_011035434.1|  PREDICTED: probable inactive receptor kinase...    219   9e-58    
ref|XP_007010899.1|  Leucine-rich repeat transmembrane protein ki...    220   1e-57    
ref|XP_006478234.1|  PREDICTED: probable leucine-rich repeat rece...    218   1e-57    
ref|XP_002525662.1|  serine-threonine protein kinase, plant-type,...    218   2e-57    
gb|KDO55999.1|  hypothetical protein CISIN_1g007427mg                   217   3e-57    
ref|XP_010435421.1|  PREDICTED: probable LRR receptor-like serine...    207   3e-57    
ref|XP_007214953.1|  hypothetical protein PRUPE_ppa003172mg             217   3e-57    
emb|CDY50640.1|  BnaC06g24330D                                          217   4e-57    
ref|XP_006441498.1|  hypothetical protein CICLE_v10023378mg             217   4e-57    
ref|XP_006582776.1|  PREDICTED: probable inactive leucine-rich re...    206   7e-57    
ref|XP_010933300.1|  PREDICTED: probable leucine-rich repeat rece...    216   7e-57    
gb|EMS64084.1|  putative LRR receptor-like serine/threonine-prote...    214   1e-56    
ref|XP_008797241.1|  PREDICTED: probable leucine-rich repeat rece...    215   2e-56    
ref|XP_010025989.1|  PREDICTED: probable leucine-rich repeat rece...    215   2e-56    
emb|CDP17377.1|  unnamed protein product                                214   3e-56    
gb|AAC67207.1|  putative receptor-like protein kinase                   214   4e-56    
gb|KHN24474.1|  Putative leucine-rich repeat receptor-like protei...    213   6e-56    
ref|XP_004301209.1|  PREDICTED: probable leucine-rich repeat rece...    213   6e-56    
ref|XP_009401805.1|  PREDICTED: probable leucine-rich repeat rece...    213   9e-56    
emb|CDX84553.1|  BnaA03g16770D                                          213   1e-55    
ref|XP_006372646.1|  hypothetical protein POPTR_0017s03530g             213   1e-55    
ref|XP_006599672.1|  PREDICTED: probable leucine-rich repeat rece...    212   2e-55    
dbj|BAK08317.1|  predicted protein                                      214   2e-55    
ref|XP_006410829.1|  hypothetical protein EUTSA_v10016353mg             213   2e-55    
ref|XP_011046105.1|  PREDICTED: probable inactive receptor kinase...    211   2e-55    
gb|ABR17070.1|  unknown                                                 204   3e-55    
ref|XP_010516881.1|  PREDICTED: probable leucine-rich repeat rece...    212   4e-55    
ref|XP_007152507.1|  hypothetical protein PHAVU_004G136100g             211   4e-55    
emb|CDP01639.1|  unnamed protein product                                211   6e-55    
emb|CDP15342.1|  unnamed protein product                                211   8e-55    



>ref|XP_009759851.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana sylvestris]
Length=634

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/630 (57%), Positives = 449/630 (71%), Gaps = 26/630 (4%)
 Frame = +3

Query  204   PTFPLIFF---SFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR  374
             P   L+F+    F + L   P S S+ +D  LI+FKESL+NT  LD TW KG +PCDK +
Sbjct  15    PKKHLLFYISIFFLIFLSNTPFSFSISEDEALIKFKESLKNTTALDSTWHKGSNPCDKNK  74

Query  375   RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHL  554
             +W  V C   TV GL L   GL+G+IDVD L  L GLR++ LANNSFSG IP+F  L  L
Sbjct  75    KWTRVQCEGNTVEGLLLGEAGLSGEIDVDPLIALPGLRVLELANNSFSGTIPEFFFLGAL  134

Query  555   KSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFS  734
             KS++I GN+FSGEI  D+F+KM  L+K+W S N FSG IP SL  L  L+ELHLE N FS
Sbjct  135   KSIYIDGNQFSGEIPKDFFSKMGSLKKIWFSRNKFSGPIPESLANLKYLMELHLESNEFS  194

Query  735   SAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDG  914
               +P  +Q SLT +DLS NKLQGEIP  M++FG+  F+GN ELCG+ +G+ C ++     
Sbjct  195   GPIPSFSQASLTSIDLSNNKLQGEIPQSMSKFGSDPFKGNNELCGKQLGKDCNKE-----  249

Query  915   GGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVV  1094
                 E  T + A    S M+W++L +V  LLL+ ILF   + E++     K+NLDE L V
Sbjct  250   ---KENNTFQRAPM--SKMKWIILGLVVSLLLITILFKAKRKEDHFDKLGKENLDEGLHV  304

Query  1095  QIASMARSESIN-------HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEV  1253
               +S  +S SI+       H S R  +        GD VLVNEE+G FGL +LM A+AEV
Sbjct  305   S-SSNRKSTSIHSKGGDSVHESLRRGAGSQRGKATGDLVLVNEEKGTFGLPDLMKAAAEV  363

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LGNG LGSAYKA + V GL+VVVKRL+E NKMN+D FD E+RK+  LRH NIL LLAYHY
Sbjct  364   LGNGVLGSAYKAKM-VNGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHRNILQLLAYHY  422

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
             RK+EKL+VSE+ PKGSLLYLLHGDRG +H +L   TR++II GVASGM +LH+EFA+Y +
Sbjct  423   RKEEKLLVSEYVPKGSLLYLLHGDRGISHAELNWPTRLRIIHGVASGMNFLHSEFASYVV  482

Query  1614  PHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYC  1784
             PHGNLKSSNILLT  YEPLL+DYAF+PL++ T T+QC+FA K+PE     QIS KSDVYC
Sbjct  483   PHGNLKSSNILLTEKYEPLLSDYAFYPLINNTQTVQCLFAYKSPEAIQNQQISPKSDVYC  542

Query  1785  LGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV  1964
             LGI+ILE++TGKFPSQYL+NQKGGTDVVQWV+ A+AD +ESE+ID EIA A  DS  +MV
Sbjct  543   LGIIILEILTGKFPSQYLNNQKGGTDVVQWVQSAIADNRESELIDQEIANA-TDSIEQMV  601

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             KLL +GAACT SD EKR+ MKEA +RI EI
Sbjct  602   KLLHVGAACTVSDPEKRIDMKEASRRIEEI  631



>ref|XP_009627313.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana tomentosiformis]
Length=634

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/618 (58%), Positives = 445/618 (72%), Gaps = 23/618 (4%)
 Frame = +3

Query  231   FCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTV  410
             F + L   P S S+ +D  LI+FKESL+NT  LD TW KG +PCDK ++W  V C    V
Sbjct  27    FLIFLSNTPFSFSISEDEALIKFKESLKNTTALDSTWHKGSNPCDKNKKWTRVQCEGNAV  86

Query  411   TGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSG  590
              GL L  +GL+G+IDVD L  L GLR++ LANNSFSG IP+F  L  LKSL+I GN+FSG
Sbjct  87    EGLLLGEVGLSGEIDVDPLIALPGLRVLELANNSFSGTIPEFFLLGALKSLYIDGNQFSG  146

Query  591   EISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             +I  D+F+KM  L+K+W S N FSG IP SL  L  L+ELHLE N FS  +P  +Q SLT
Sbjct  147   DIPKDFFSKMGSLKKIWFSRNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLT  206

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
              +DLS NKLQGEIP  M+RFGA  F+GN ELCG+ +G++C +        G E  T + A
Sbjct  207   SIDLSNNKLQGEIPQSMSRFGADPFKGNNELCGKRLGKECNK--------GKENNTFQRA  258

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
                 S ++W++L +V  LLL+ ILF   + E++     K+NLDE L V  +S  ++ SI+
Sbjct  259   PM--SKLKWIILGLVVSLLLITILFKAKRKEDHFDKLGKENLDEGLHVS-SSNRKNTSIH  315

Query  1131  -------HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKA  1289
                    H S R  +        GD VLVNEE+G FGL +LM A+AEVLGNG LGSAYKA
Sbjct  316   SKGGDSVHGSSRRGAGSQRGKAMGDLVLVNEEKGTFGLPDLMKAAAEVLGNGVLGSAYKA  375

Query  1290  ALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFG  1469
              + V GL+VVVKRL+E NKMN+D FD E+RK+  LRH NIL LLAYHYRK+EKL+VSE+ 
Sbjct  376   KM-VYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHYRKEEKLLVSEYV  434

Query  1470  PKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILL  1649
             PKGSLLYLLHGDRG +H +L   TR+KII GVASGM +LH+EFA+Y +PHGNLKSSNILL
Sbjct  435   PKGSLLYLLHGDRGISHAELNWPTRLKIIHGVASGMSFLHSEFASYVVPHGNLKSSNILL  494

Query  1650  TPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGK  1820
             T  YEPLL+DYAF+PL++ T T+QC+FA K+PE     QIS KSD+YCLGI+ILE++TGK
Sbjct  495   TEKYEPLLSDYAFYPLINNTQTVQCLFAYKSPEAIQNQQISPKSDIYCLGIIILEILTGK  554

Query  1821  FPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTES  2000
             FPSQYL+NQKGGTDVVQWV+ A+AD +ESE+ID EIA A  DS  +MVKLL +GAACT +
Sbjct  555   FPSQYLNNQKGGTDVVQWVQSAIADNRESELIDQEIANA-TDSIEQMVKLLHVGAACTVN  613

Query  2001  DVEKRLSMKEAIKRIREI  2054
             D EKR+ MKEA +RI EI
Sbjct  614   DPEKRIDMKEASRRIEEI  631



>dbj|BAO02531.1| predicted receptor-like protein kinase ortholog [Nicotiana alata]
Length=632

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/628 (57%), Positives = 446/628 (71%), Gaps = 31/628 (5%)
 Frame = +3

Query  216   LIFFS----FCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWF  383
             L+FF     F + L   P S S+ +D  LI+FKESL+NT  LD TW KG +PC+K ++W 
Sbjct  18    LLFFYISIFFLIFLSNTPFSFSISEDEALIKFKESLKNTTALDSTWHKGSNPCEKNKKWT  77

Query  384   GVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSL  563
              V C   TV GL L   GL+G+IDVD L  L GLR++ LANNSFSG IP+F  L  LKS+
Sbjct  78    RVQCEGNTVEGLLLGEAGLSGEIDVDPLIALPGLRVLELANNSFSGTIPEFFLLGALKSI  137

Query  564   FIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAV  743
             +I GN+FSGEI  D+F+KM  L+K+W S N FSG IP SL  L  L+ELHLE N FS  +
Sbjct  138   YIDGNQFSGEIPKDFFSKMGSLKKIWFSRNKFSGPIPESLANLKYLMELHLESNEFSGPI  197

Query  744   PPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGG  923
             P  +Q SL  +DLS NKLQGEIP  M++FG+  F+GN ELCG+ +G++C  +        
Sbjct  198   PSFSQASLISIDLSNNKLQGEIPQSMSKFGSDPFKGNNELCGKQLGKECNNE--------  249

Query  924   AEAQTPENAQRHS-SGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI  1100
                    + QR   S ++W++L +V  LLL+ ILF   + E++     K+NLDE L V  
Sbjct  250   -----KNSFQRAPMSKLKWIILGLVVCLLLITILFKAKRKEDHFDKLGKENLDEGLHVS-  303

Query  1101  ASMARSESIN-------HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG  1259
             +S  +S SI        H S R  +        GD VLVNEE+G FGL +LM A+AEVLG
Sbjct  304   SSNRKSTSIRSKGGDSVHGSSRRGAGSQRGKATGDLVLVNEEKGTFGLPDLMKAAAEVLG  363

Query  1260  NGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRK  1439
             NG LGSAYKA + V GL+VVVKRL+E NKMN+D FD E+RK+  LRH NIL LLAYHYRK
Sbjct  364   NGVLGSAYKAKM-VNGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHRNILQLLAYHYRK  422

Query  1440  QEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPH  1619
             +EKL+VSE+ PKGSLLYLLHGDRG +H +L   TR+KII+GVASGM +LH+EFA+Y +PH
Sbjct  423   EEKLLVSEYVPKGSLLYLLHGDRGISHAELNWPTRLKIIQGVASGMSFLHSEFASYVVPH  482

Query  1620  GNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLG  1790
             GNLKSSNILLT  YEPLL+DYAF+PL++ T T+QC+FA K+PE     QIS KSDVYCLG
Sbjct  483   GNLKSSNILLTEKYEPLLSDYAFYPLINYTQTVQCLFAYKSPEAIQNQQISPKSDVYCLG  542

Query  1791  IVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKL  1970
             I+ILE++TGKFPSQYL+NQKGGTDVVQWV+ A+AD +ESE+ID EIA A  DS  +MVKL
Sbjct  543   IIILEIITGKFPSQYLNNQKGGTDVVQWVQSAIADNRESELIDQEIANA-TDSSEQMVKL  601

Query  1971  LQIGAACTESDVEKRLSMKEAIKRIREI  2054
             L +GAACT SD +KR+ MKEA +RI EI
Sbjct  602   LHVGAACTVSDPDKRIDMKEASRRIEEI  629



>ref|XP_009801638.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana sylvestris]
Length=614

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/606 (58%), Positives = 437/606 (72%), Gaps = 20/606 (3%)
 Frame = +3

Query  255   PLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNM  434
             P   S+GDD  L+EFKE L NT  LD +W KG +PCD  ++W GV C +  V GL L   
Sbjct  23    PPCFSIGDDEALVEFKELLTNTSALDSSWKKGTNPCDNNKKWVGVQCEKNVVQGLILGGF  82

Query  435   GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
             GL+GDIDVD L  LQGLR++ LANNSFSG IP+F  L  LKSLFI GN+F+GEI  ++F+
Sbjct  83    GLSGDIDVDPLVRLQGLRVLNLANNSFSGFIPEFFMLGALKSLFIDGNQFTGEIPGNFFS  142

Query  615   KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNK  794
             KM+ LRK+WLS N FSG IP SL  L  L+EL L+ N  S  +P L+Q +L  ++LS NK
Sbjct  143   KMSSLRKVWLSRNKFSGKIPDSLASLKYLLELRLDNNELSGTIPSLSQGTLISINLSINK  202

Query  795   LQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMR  974
             LQGEIP G++RFG+  F+GNPELCG+ +GR+C+          A  +  E      S ++
Sbjct  203   LQGEIPQGLSRFGSDPFQGNPELCGQQLGRECK--------AAASGEKSE-----GSSIK  249

Query  975   WlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIA-SMARSESI-NHssrrs  1148
             W+++ +V  LLLVAI F   + E++ +   K+NLDE + V I  S  RS S+ N      
Sbjct  250   WIIIGLVVVLLLVAIFFKTKRKEDHFEKLEKENLDESVSVNIPISNKRSMSLRNSMRSSR  309

Query  1149  tstegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKR  1328
                  S S  GD V+VNEERG+FGL +LM ASAEVLGNGGLGSAYKA L   GL++VVKR
Sbjct  310   RGRSRSGSDMGDLVVVNEERGIFGLPDLMKASAEVLGNGGLGSAYKAVLGN-GLSLVVKR  368

Query  1329  LKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDR  1508
             L+E NK+NK+ FD E+RK+ MLRH N+L  LAYHYRK+EKLVVSE+ PKGSLLYLLHGDR
Sbjct  369   LREINKLNKETFDTEIRKLAMLRHRNLLQPLAYHYRKEEKLVVSEYIPKGSLLYLLHGDR  428

Query  1509  GTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAF  1688
             G AH  L   TR+KII GVA+GM++LH+EFA+Y +PHGNLKSSNILLT   EPLLTDYAF
Sbjct  429   GIAHAQLNWPTRLKIIHGVANGMKFLHSEFASYDVPHGNLKSSNILLTANNEPLLTDYAF  488

Query  1689  HPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT  1859
             +PL++ +  +Q +FA K+PE     QIS KSDVYCLGI+ILE++TGKFPSQYLSNQK GT
Sbjct  489   YPLINNSQAVQSLFAYKSPEAILNQQISPKSDVYCLGIIILEILTGKFPSQYLSNQKCGT  548

Query  1860  DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIK  2039
             DVVQWV+ AV + + SE+IDP+IA A +DS  KM  LL IGA CT+SD +KR+ MKEAI+
Sbjct  549   DVVQWVQSAVEEKRVSELIDPQIATA-KDSLEKMETLLYIGAVCTDSDHDKRIDMKEAIR  607

Query  2040  RIREIQ  2057
             RI EI+
Sbjct  608   RIEEIE  613



>ref|XP_009598283.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana tomentosiformis]
Length=614

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/606 (58%), Positives = 438/606 (72%), Gaps = 20/606 (3%)
 Frame = +3

Query  255   PLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNM  434
             P   S+G D  L+EFKE L NT  LD +W KG +PCD  ++W GV C +  V GL L   
Sbjct  23    PPCFSIGGDEALVEFKELLTNTSALDSSWKKGTNPCDNNKKWVGVQCDKNVVQGLILGGF  82

Query  435   GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
             GL+GDIDVD+L +LQGLR++ LANNSFSG IP+F  L  LKSLFI GN+F+GEI  D+F+
Sbjct  83    GLSGDIDVDSLVSLQGLRVLNLANNSFSGFIPEFFILGALKSLFIDGNQFTGEIPGDFFS  142

Query  615   KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNK  794
             KM+ LRK+WLS N F G IP SL  L  L+ELHLE N FS  +P L+Q +L  ++LS NK
Sbjct  143   KMSSLRKVWLSRNKFLGKIPDSLASLKYLLELHLENNEFSGTIPSLSQGTLISINLSNNK  202

Query  795   LQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMR  974
             LQGEIP  ++RFG+  F+GNPELCG+ +GR+C+          A  +  E      S ++
Sbjct  203   LQGEIPQVLSRFGSDPFQGNPELCGQQLGRECK--------AAASGEKSE-----GSSIK  249

Query  975   WlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI-ASMARSESI-NHssrrs  1148
             W+++ +V  LLLVAI F   + E++ +   K+NLDE + + I +S  RS S+ N      
Sbjct  250   WIIIGLVVVLLLVAIFFKTKRKEDHFEKLEKENLDESVKLNIPSSNKRSMSLRNSMRSSR  309

Query  1149  tstegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKR  1328
                  S S  GD V+VNEERG+FGL +LM ASAEVLGNGGLGSAYKA L   GL++VVKR
Sbjct  310   RGRSRSGSDMGDLVVVNEERGIFGLPDLMKASAEVLGNGGLGSAYKAVLGN-GLSLVVKR  368

Query  1329  LKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDR  1508
             L+E NK+NK++FD E+RK+  LRH N+L  LAYHYRK+EKLVVSE+ PKGSLLYLLHGDR
Sbjct  369   LREINKLNKESFDTEIRKLAKLRHRNLLQPLAYHYRKEEKLVVSEYIPKGSLLYLLHGDR  428

Query  1509  GTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAF  1688
             G AH  L   TR+KII GVA+GM++LH+EFA+Y +PHGNLKSSNILLT   EPLLTDYAF
Sbjct  429   GIAHAQLNWPTRLKIIHGVANGMKFLHSEFASYDVPHGNLKSSNILLTANNEPLLTDYAF  488

Query  1689  HPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT  1859
             +PL++ +  +Q +FA K+PE     QIS KSDVYCLGI+ILE++TGKFPSQYLSNQK GT
Sbjct  489   YPLINNSQAVQSLFAYKSPEAIINQQISPKSDVYCLGIIILEILTGKFPSQYLSNQKCGT  548

Query  1860  DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIK  2039
             DVVQW + AV + + SE+IDP+IA A +DS  KM  LL IGA CTESD +KR+ MKEAIK
Sbjct  549   DVVQWAQSAVEEKRVSEMIDPQIATA-KDSLEKMETLLYIGAVCTESDHDKRIDMKEAIK  607

Query  2040  RIREIQ  2057
             RI EI+
Sbjct  608   RIEEIE  613



>ref|XP_004251695.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Solanum lycopersicum]
Length=636

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/621 (57%), Positives = 438/621 (71%), Gaps = 30/621 (5%)
 Frame = +3

Query  231   FCLILQCLP-LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKT  407
             F LI  C P  S S+ +D  LI+FK+SL+NT  LD +WVKG SPC+K +RW  V C R  
Sbjct  30    FFLISLCNPQFSFSISEDDALIKFKKSLKNTTSLDSSWVKGTSPCEKNKRWARVQCERNV  89

Query  408   VTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFS  587
             V GL L   GL+G++D+D L  L GLR++ +ANNSFSG IP+F  L  LKS++I GN+FS
Sbjct  90    VEGLLLGEAGLSGELDIDPLIALPGLRVLDIANNSFSGLIPEFFLLGALKSIYIDGNQFS  149

Query  588   GEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSL  767
             GEI  D+FAKM  L+K+WL+ N FSG IP SL  L  L+EL LE N F+  VP L+Q SL
Sbjct  150   GEIPKDFFAKMGSLKKIWLARNKFSGAIPESLASLKYLMELRLESNAFTGRVPSLSQGSL  209

Query  768   TILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPEN  947
             T +D + NKLQGEIP  M++FGA  F+GN ELCG+ +G++C+E               + 
Sbjct  210   TSIDFTNNKLQGEIPQEMSKFGADPFKGNEELCGKQLGKECKE-------------MNKT  256

Query  948   AQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS---  1118
                  S +RW+LL IV  +LLV ILF   + E++     K+NLDE L   IAS  R    
Sbjct  257   QSAPMSKLRWILLGIVVCILLVTILFRVKRKEDHFDKLGKENLDEGL--HIASSIRKSMS  314

Query  1119  ------ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSA  1280
                   +SI   S R      S    GD VLVN E G FGL +LM A+AEVLGNG LGSA
Sbjct  315   IHSKGGDSIRGGSTRRGGGSQSGKAMGDLVLVNNENGTFGLPDLMKAAAEVLGNGVLGSA  374

Query  1281  YKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVS  1460
             YKA +   G++VVVKRL+E NKMN+D FDAEMRK+G LRH N+L LLAYHYRK+EKL+VS
Sbjct  375   YKAKMGN-GMSVVVKRLREMNKMNRDVFDAEMRKLGKLRHKNLLQLLAYHYRKEEKLMVS  433

Query  1461  EFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSN  1640
             E+ P+GSLLYLLHGDRG +H +L   TR++II+GVASGM YLH EFA+Y +PHGNLKSSN
Sbjct  434   EYVPRGSLLYLLHGDRGVSHGELNWPTRLRIIQGVASGMSYLHLEFASYAVPHGNLKSSN  493

Query  1641  ILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVYCLGIVILEVV  1811
             ILL   YEPLL+DYAF+PL++ T  +Q +FA KAPE  Q  H   K D+YCLGI+ILE++
Sbjct  494   ILLNGKYEPLLSDYAFYPLINNTQIVQSLFAYKAPEATQHQHLTPKCDIYCLGIIILEIL  553

Query  1812  TGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAAC  1991
             TGKFPSQYL+NQKGGTDVVQWV+ A+AD +ESE+IDPEIA A  DS  +MVKLL +GAAC
Sbjct  554   TGKFPSQYLNNQKGGTDVVQWVQSAIADQRESELIDPEIASA-TDSVEQMVKLLHVGAAC  612

Query  1992  TESDVEKRLSMKEAIKRIREI  2054
             T SD +KR+ MKEA++RI EI
Sbjct  613   TISDPDKRIDMKEALRRIEEI  633



>ref|XP_006345259.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Solanum tuberosum]
Length=635

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/617 (56%), Positives = 438/617 (71%), Gaps = 24/617 (4%)
 Frame = +3

Query  231   FCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTV  410
             F + L     S S+ +D  LI+FKESL+NT  LD +W+KG SPCDK ++W  + C    V
Sbjct  31    FLISLSNPQFSFSISEDDALIKFKESLKNTTSLDSSWLKGTSPCDKNKKWDRIQCEGNVV  90

Query  411   TGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSG  590
              GL L   GL+G++D+D L  L GLR++ +ANNSFSG IP+F  L  LKS++I GN+FSG
Sbjct  91    EGLLLGEAGLSGELDIDPLIALPGLRVLEIANNSFSGTIPEFFLLGALKSIYIDGNQFSG  150

Query  591   EISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             EI  D+FAKM  L+K+W + N FSG+IP SL  L  L+EL LE N FS  VP  +Q SLT
Sbjct  151   EIPKDFFAKMGSLKKIWFARNKFSGSIPESLTNLKYLMELRLESNAFSGRVPSFSQVSLT  210

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
              +DLS NKLQGEIP GM++FGA  F+GN +LCG+ +G++C + + K  G           
Sbjct  211   SIDLSNNKLQGEIPQGMSKFGADPFKGNADLCGQQLGKECNKGINKTQGAPM--------  262

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
                 S ++W++L IV  LLLV ILF   + E++     K+NLDE L V  +S+ +S SI+
Sbjct  263   ----SKLKWIILGIVVSLLLVTILFRVKRKEDHFDKLGKENLDEGLHVG-SSIRKSMSIH  317

Query  1131  Hssrrststegss------srggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAA  1292
                  S                GD VLVN E G FGL +LM A+AEVLGNG LGSAYKA 
Sbjct  318   SKGGDSGRGSTRRGGSQGGKAMGDLVLVNNENGTFGLPDLMKAAAEVLGNGVLGSAYKAK  377

Query  1293  LPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGP  1472
             +   G++VVVKRL+E NKMN+D FDAEMRK+G LRH N+L LLAYHYRK+EKL+VSE+ P
Sbjct  378   MGN-GMSVVVKRLREMNKMNRDVFDAEMRKLGKLRHKNLLQLLAYHYRKEEKLMVSEYVP  436

Query  1473  KGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLT  1652
             KGSLLYLLHGDRG +H +L   TR++II+GVASGM YLH+EFA+Y +PHGNLKSSNILL 
Sbjct  437   KGSLLYLLHGDRGISHGELNWPTRLRIIQGVASGMCYLHSEFASYAVPHGNLKSSNILLN  496

Query  1653  PTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVYCLGIVILEVVTGKF  1823
               YEPLL+DYAF+PL++ T  +Q +FA KAPE  Q  H   K D+YCLGI+ILE++TGKF
Sbjct  497   EKYEPLLSDYAFYPLINNTQIVQSLFAYKAPEAIQHQHLTPKCDIYCLGIIILEILTGKF  556

Query  1824  PSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESD  2003
             PSQYL+NQKGGTDVVQWV+ A+AD +ESE+IDPEIA A  DS  +MVKLL +GAACT SD
Sbjct  557   PSQYLNNQKGGTDVVQWVQSAIADQRESELIDPEIASA-TDSVEQMVKLLHVGAACTISD  615

Query  2004  VEKRLSMKEAIKRIREI  2054
              +KR+ MKEA++RI EI
Sbjct  616   PDKRIDMKEALRRIEEI  632



>ref|XP_011078123.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Sesamum indicum]
Length=636

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/648 (53%), Positives = 463/648 (71%), Gaps = 36/648 (6%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             MAAVR    F L  F FCL  +  P S ++G+DV LI+FKESL+++  LD +W+KG +PC
Sbjct  1     MAAVR---LFLLSLFVFCL--RTNP-SHAIGEDVHLIDFKESLKDSSPLDSSWIKGSNPC  54

Query  363   DKTRRWFGVLCH---RKTVTGLRLYNMGLAG---DIDVDALSNLQGLRMIALANNSFSGP  524
             D  + W G+ C     + V+ + L N GL+G   ++D+DALS L  LR ++L NNSFSGP
Sbjct  55    DAKKPWQGIDCSDTGSQAVSAILLMNRGLSGAGPELDIDALSKLGSLRFLSLENNSFSGP  114

Query  525   IPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLV  704
             +P+F++L  L+SLF+ GN+FSGEI   YF KM  L+KL L+ N F+G IP SL KL  L+
Sbjct  115   LPEFNQLSSLRSLFLSGNQFSGEIPQGYFDKMGSLKKLHLARNKFTGPIPGSLTKLSNLM  174

Query  705   ELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGR  884
             E+ L+ N FS  VP   Q+SL  +DLS NKLQGEIP  M+RF A  F+GN ++CG  + +
Sbjct  175   EMWLQENEFSGPVPSFEQKSLQSIDLSNNKLQGEIPQSMSRFPASVFQGNADVCGAVISK  234

Query  885   QCREDLGKDGGGGAEAQTPENAQR--HSSG--MRWlllsivaglllvailFNKNQNEENV  1052
             QC+       G      TP++  +  H SG   +W++L++V  +LLV ILF   + EEN 
Sbjct  235   QCQAAEAPASG------TPDDKSKESHKSGALTKWVILAVVVTVLLVTILFKAKKKEENF  288

Query  1053  KTRRKDNLDEVLVVQIASM--------ARSESINHssrrststegss--srggDFVLVNE  1202
             +   K+NLD+V+ V++AS+         R+ S N +  +S+   G++      D V++NE
Sbjct  289   RVLGKENLDDVVQVRVASINRRTGSSIRRTGSYNETGSQSSRRGGAAGGKSPNDLVVINE  348

Query  1203  ERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRK  1382
             E+G+FGL +LM A+AEVLG+GGLGS+YKA +   G+TVVVKR+++ NK+N+DAF+ E+RK
Sbjct  349   EKGVFGLPDLMKAAAEVLGSGGLGSSYKAIM-ANGMTVVVKRMRDMNKLNRDAFETEIRK  407

Query  1383  MGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKG  1562
             +G +RH N+LP LAYHYRK+EKL+V+EF PKGSLL+LLHGDRG AH++L   TR+KIIKG
Sbjct  408   LGRIRHRNVLPPLAYHYRKEEKLLVTEFVPKGSLLFLLHGDRGVAHSELNWPTRLKIIKG  467

Query  1563  VASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKA  1742
             +A GM +LHTEFA+Y LPHGNLKSSNILL+P YEPLLTDYA + L+S T ++Q +FA K+
Sbjct  468   MARGMGFLHTEFASYDLPHGNLKSSNILLSPGYEPLLTDYALYSLISNTQSVQVLFAYKS  527

Query  1743  PEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEV  1913
             PE     Q+S KSDVYCLGIVILE++TGKFPSQYL+NQKGGTDVVQW RQ++++G+ +E+
Sbjct  528   PEAVLYQQLSPKSDVYCLGIVILEIMTGKFPSQYLNNQKGGTDVVQWARQSISEGRVAEL  587

Query  1914  IDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             IDPEIA     S  +M  +LQIGA CTESD E R+ M+EAI+ I EIQ
Sbjct  588   IDPEIANGSSSSLDQMENMLQIGAMCTESDHESRIEMREAIRSIEEIQ  635



>gb|EYU28315.1| hypothetical protein MIMGU_mgv1a025411mg [Erythranthe guttata]
Length=637

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/631 (54%), Positives = 445/631 (71%), Gaps = 47/631 (7%)
 Frame = +3

Query  261   SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR---KTVTGLRLYN  431
             S+S+G+D+ L+EFKESL++   LD TW+K  +PCD  + W GV C     K+V+ L L N
Sbjct  21    SLSIGEDIHLLEFKESLKDPISLDSTWIKDTNPCDPKKPWEGVDCSDTAFKSVSALLLMN  80

Query  432   MGLAGD---IDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISA  602
             +GL+GD   +D+DAL NL+ LR+I+L NN+FSG +P+F++L  LKSLF+ GN+FSGEI  
Sbjct  81    LGLSGDGGDLDMDALGNLESLRIISLENNTFSGVLPEFNRLGSLKSLFLSGNQFSGEIPQ  140

Query  603   DYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDL  782
             D+F KM  L+KL LS N FSG IP SL +L  L+EL L+ N FS  VP   Q+SL  +DL
Sbjct  141   DFFDKMGSLKKLHLSRNKFSGTIPGSLTRLDNLMELFLQQNEFSGPVPVFGQKSLQTIDL  200

Query  783   SGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC---REDLGKDGGGGAEAQTPENAQ  953
             SGNKLQGEIP GM+RF AKAF+GNP+LCG  V + C    ++ G+  G G          
Sbjct  201   SGNKLQGEIPEGMSRFPAKAFDGNPDLCGTVVSKDCVAPEKNAGQPDGSG----------  250

Query  954   RHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINH  1133
                S  +W++L++V G+LLV ILF   + +EN +   K+NLDEV+ V + + + S   + 
Sbjct  251   ---SVTKWVILAVVVGVLLVTILFKAKKEDENFRVLGKENLDEVVQVHMPTSSSSNKRSG  307

Query  1134  ssrrststegss--------------------srggDFVLVNEERGMFGLSELMMASAEV  1253
             SS R     G                          D V++NEE+G+FGL +LM A+AEV
Sbjct  308   SSTRRGGGGGGGGGGYNEPGSQSSSRRGSGGGKSNNDLVVINEEKGVFGLPDLMKAAAEV  367

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LG+GG+GSAYKA +   G++VVVKR+++ NK+NKDAF+AE+R++G +RH NILP LAYHY
Sbjct  368   LGSGGMGSAYKAIM-ANGVSVVVKRMRDMNKLNKDAFEAEIRRLGRIRHRNILPPLAYHY  426

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
             RK+EKL+++EF PKGSLL+LLHGDRG  H +L   TR+KIIKGVA GM +LHTEFA Y+L
Sbjct  427   RKEEKLLITEFIPKGSLLFLLHGDRGIGHAELNWPTRLKIIKGVARGMGFLHTEFANYEL  486

Query  1614  PHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYC  1784
             PHGNLKSSNILL+  YEPLLTDYA + L+S T ++Q +FA K+PE     Q+S KSDVYC
Sbjct  487   PHGNLKSSNILLSQNYEPLLTDYALYSLISNTQSIQALFAYKSPEAVLFQQLSPKSDVYC  546

Query  1785  LGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV  1964
             LGIV+LE++TGKFPSQYL+NQKGGTDVVQW  QA+++G+ SE+IDPEI   G DS  +M 
Sbjct  547   LGIVVLEIMTGKFPSQYLNNQKGGTDVVQWAGQAISEGRVSELIDPEIVN-GSDSLEQME  605

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             K+L IG  CTESD EKR+ M+EAI+ I E+ 
Sbjct  606   KMLYIGTECTESDHEKRIEMREAIRHIEEVH  636



>ref|XP_006355772.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Solanum tuberosum]
Length=615

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/619 (53%), Positives = 429/619 (69%), Gaps = 19/619 (3%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             + F F   L      +S+GDD VL+EFKE L NT  LD +W KG +PCD   +WFGV C 
Sbjct  11    LIFLFVFFLSHPTPCVSIGDDQVLLEFKELLLNTSLLDSSWKKGTNPCDNNNKWFGVQCD  70

Query  399   RKTVT-GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
              K V   L L  +GL+G++DVD L +LQGLR++ LANNSFSG IPDF +L  LKSLFI G
Sbjct  71    NKNVIQALLLGGVGLSGNLDVDVLISLQGLRVVNLANNSFSGTIPDFFRLGALKSLFING  130

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N+FSG+I  D+F+KM  LRK+W S N FSG IP SL  L  L+ELHLE N F+  +P L+
Sbjct  131   NQFSGDIPGDFFSKMGSLRKIWFSRNKFSGKIPDSLAGLKYLLELHLENNEFTGPIPILS  190

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQ  935
             Q +L  ++ S NKLQG IP  +++FG+  F+GNP+LCG  +GR+C+     +   G    
Sbjct  191   QANLATINFSNNKLQGLIPQSLSKFGSNPFQGNPDLCGNQIGRECKAVASGEKSEG----  246

Query  936   TPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMAR  1115
                     S   +W+++ +V  LLLVAILF   + ++  +   K++LDE + V +   + 
Sbjct  247   --------SGSTKWIIIGLVVVLLLVAILFKSKRKDDQFEKLEKESLDEAVKVHLNKRSM  298

Query  1116  SESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAAL  1295
             S +             S S  GD V+VN+E+G+FG+ +LM A+AEVLGNGGLGSAYKA L
Sbjct  299   S-TRTSMRSSRKGRSRSGSDMGDLVVVNDEKGIFGMPDLMKAAAEVLGNGGLGSAYKAVL  357

Query  1296  PVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPK  1475
                G++VVVKRL+ETNK NK++FDAE+R++  +RH NIL  LAYHYRK+EKLVVSE+ PK
Sbjct  358   GN-GVSVVVKRLRETNKFNKESFDAEIRRLARIRHRNILQPLAYHYRKEEKLVVSEYIPK  416

Query  1476  GSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTP  1655
             GSLLYLLHGDRG AH  L    R+KII GVASGM++LH+EFA+Y +PHGNLKSSNILL+ 
Sbjct  417   GSLLYLLHGDRGIAHAQLNWTIRVKIILGVASGMKFLHSEFASYDVPHGNLKSSNILLSA  476

Query  1656  TYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFP  1826
               EPLLTDYAF+PL++ +  +Q +FA K+PE     Q++ KSDVYCLGI+ILE++TGKFP
Sbjct  477   NNEPLLTDYAFYPLLNDSQAVQSLFAYKSPEAILNQQVTPKSDVYCLGIIILEILTGKFP  536

Query  1827  SQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDV  2006
             SQYLSNQK GTDV QW   A+ + + SE+I PEI    +DS   M K L IGAACTESD 
Sbjct  537   SQYLSNQKCGTDVAQWAWSAIEENRVSELIAPEIE-TEKDSLEMMEKFLHIGAACTESDH  595

Query  2007  EKRLSMKEAIKRIREIQDV  2063
             + R+ MKEAI+RI EI ++
Sbjct  596   DNRIDMKEAIRRIEEITNL  614



>ref|NP_001234483.1| receptor-like protein kinase 3 precursor [Solanum lycopersicum]
 gb|AAK28345.1|AF243040_1 receptor-like protein kinase 3 [Solanum lycopersicum]
Length=612

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/623 (53%), Positives = 434/623 (70%), Gaps = 25/623 (4%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             ++ F F  I  C    +S+GDD VL+EFKE L NT  LD +W KG +PCD   +WFGV C
Sbjct  7     IVLFVFFSITSC----VSIGDDQVLVEFKELLLNTSLLDSSWKKGTNPCDNNNKWFGVQC  62

Query  396   ---HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
                +   +  L L  +GL+G++DVD L +LQGLR++ L+NNSFSG IP+F +L  LKSLF
Sbjct  63    DNNNNNVIQALLLGGIGLSGNLDVDVLISLQGLRVVNLSNNSFSGSIPEFFRLGALKSLF  122

Query  567   IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
             I GN+FSG+I  D+F+KM  L K+W S N FSG IP SL  L  L+ELHLE N F+  +P
Sbjct  123   IDGNQFSGDIPPDFFSKMASLWKIWFSRNKFSGKIPESLASLKYLLELHLENNEFTGTIP  182

Query  747   PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
              L+Q +L  ++LS NKLQG IP  +++FG+  F+GNP+LCG  +GR+C+  +      G 
Sbjct  183   SLSQPNLATINLSNNKLQGLIPQSLSKFGSNPFQGNPDLCGNQIGRECKAVIY-----GE  237

Query  927   EAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIAS  1106
             ++++       S   +W+++ +V  LLLVAILF   + ++  +   K+NLDE + V +  
Sbjct  238   KSES-------SGSTKWIIVGLVVVLLLVAILFKSKRKDDQFEKLEKENLDEAVKVHLNK  290

Query  1107  MARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
              + S +             S S  GD V+VN+E+G+FG+ +LM A+AEVLGNGGLGSAYK
Sbjct  291   RSMS-TRTSMRSSRKGRSRSGSDMGDLVVVNDEKGIFGMPDLMKAAAEVLGNGGLGSAYK  349

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A L    L+VVVKRL+ETNK NK+ FDAE+R++  +RH NIL  LAYHY K+EKLVVSE+
Sbjct  350   ALLGNGVLSVVVKRLRETNKFNKECFDAEIRRLARIRHKNILQPLAYHYGKEEKLVVSEY  409

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              PKGSLLYL HGDRGTAH  L    R+KII GVA+GM++LH+EF +Y +PHGNLKSSNIL
Sbjct  410   IPKGSLLYLFHGDRGTAHAQLNWCIRVKIILGVANGMKFLHSEFGSYDVPHGNLKSSNIL  469

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTG  1817
             L+   EPLLTDYAF+PLV+ +  +Q +FA K+PE     Q++ KSDVYCLGI+ILE++TG
Sbjct  470   LSANNEPLLTDYAFYPLVNNSQAVQSLFAYKSPEAILNQQVTPKSDVYCLGIIILEILTG  529

Query  1818  KFPSQYLSNQK-GGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACT  1994
             KFPSQYLSNQK  GTDV QWV+ A+ + + SE+IDPEI    +DS   M K L IGAACT
Sbjct  530   KFPSQYLSNQKFTGTDVAQWVQSAIEENRVSELIDPEIE-TEKDSLEMMEKFLYIGAACT  588

Query  1995  ESDVEKRLSMKEAIKRIREIQDV  2063
             ESD + R+ MKEAI+RI EI D+
Sbjct  589   ESDHDHRIDMKEAIRRIEEITDL  611



>gb|EPS68284.1| receptor-like protein kinase 3 [Genlisea aurea]
Length=630

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/621 (51%), Positives = 436/621 (70%), Gaps = 29/621 (5%)
 Frame = +3

Query  255   PLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH---RKTVTGLRL  425
             PLS S G+D+ L+EFK +L+N+  LD TWV G  PCD+ + W GV C     + V+ + L
Sbjct  18    PLSASPGEDLHLLEFKRTLRNSAALDATWVGGGDPCDRKKAWRGVDCSDSGYRNVSAVLL  77

Query  426   YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
              N+GL+GD+DV AL  LQ LR++ L NNSF+G +P+ ++L +LKSLF+ GN+FSGEI  D
Sbjct  78    MNLGLSGDVDVTALGKLQSLRILGLENNSFTGTMPEVNRLSYLKSLFLSGNQFSGEIPPD  137

Query  606   YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
             YF KM  L+KL L+ NGFSG+IP SL +L  L+EL L+ N F+  +P L Q +L  +++S
Sbjct  138   YFGKMGSLKKLHLARNGFSGSIPPSLAQLHNLMELFLQNNEFTGPIPDLEQATLHYVNVS  197

Query  786   GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSS  965
              N L GEIP+ +ARFGA AF+GNP+LCG  VG+ C+          A A  P ++    S
Sbjct  198   FNNLHGEIPANLARFGASAFQGNPDLCGTVVGKPCQTAAAA-----AAAAAPGSS---GS  249

Query  966   GMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESI------  1127
               +W++L +V G+LLV ILF   + +++    RK+NLDEV+ V + S  R  +       
Sbjct  250   MTKWVILGVVVGILLVTILFKAKKKDDDFTMLRKENLDEVIQVNVPSTVRRSASSRRGSF  309

Query  1128  -------NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
                    +  S  S  +        D V++NE++G FGL +LM A+AEVLGNGGLGS+YK
Sbjct  310   SGSRRGNDGGSTSSKRSSQHGRSSNDLVVINEDKGFFGLQDLMKAAAEVLGNGGLGSSYK  369

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   G+ VVVKR+++ NK+NK+AF+ E+RK+G ++H NILP LA+H+RK+EKL+V+E+
Sbjct  370   AVM-ANGVAVVVKRMRDMNKLNKEAFETEIRKLGKIKHRNILPPLAFHFRKEEKLLVTEY  428

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              P+GSLL+LLHGDRG  H +L   TR+KIIKG+  GM +LHTEFA Y+LPHGNLKSSN+L
Sbjct  429   IPRGSLLFLLHGDRGIGHAELNWGTRLKIIKGIGRGMAFLHTEFANYELPHGNLKSSNVL  488

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTG  1817
             L+  Y+PLLTDYA   L+S T ++Q +FA K+PE     Q+S KSDVYCLGIVILE++TG
Sbjct  489   LSHNYDPLLTDYALFALISNTQSVQALFAYKSPEAILYQQLSPKSDVYCLGIVILEIMTG  548

Query  1818  KFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIA-GAGEDSDGKMVKLLQIGAACT  1994
             KFPSQYLSNQKGGTD+VQ  + A+ +G+ +E+IDPE++ GA  ++  +M ++L+IGA+CT
Sbjct  549   KFPSQYLSNQKGGTDIVQGTKTAIGEGRAAELIDPELSGGATAEAVEQMERMLRIGASCT  608

Query  1995  ESDVEKRLSMKEAIKRIREIQ  2057
             ES+  KR+ MKE I+ I EI+
Sbjct  609   ESEPAKRMEMKEVIRNIEEIK  629



>ref|XP_004508012.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Cicer arietinum]
Length=612

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/603 (51%), Positives = 424/603 (70%), Gaps = 18/603 (3%)
 Frame = +3

Query  267   SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAG  446
             S+ +   L++ K+S  N++ L  +W+  ++PC  + RW GV+C    ++ L L ++GL+G
Sbjct  21    SIPESEALLKLKQSFTNSQSLS-SWLPNQNPC--SSRWVGVICFNNIISSLHLGDLGLSG  77

Query  447   DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
              ID+D+L  +  LR I+  NNSFSGPIP F+KL  LK+L++  N+FSG I  ++F+ +  
Sbjct  78    QIDIDSLLQIPTLRTISFVNNSFSGPIPQFNKLGALKALYLSENQFSGPIPPEFFSHLAS  137

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
             L+K WL++N FSGNIP SL  L  L ELHLE N FS  +P L Q  +   D+S NKLQG 
Sbjct  138   LKKAWLNNNKFSGNIPDSLTNLRFLSELHLENNEFSGPIPELKQ-DIKSFDVSNNKLQGA  196

Query  807   IPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlll  986
             IP  M+RF AK+F GN ELCG+P+ ++C   L           TP+N Q  S   + + +
Sbjct  197   IPGSMSRFEAKSFAGNEELCGKPLDKECDPSL-------VSLPTPDNGQSSSWVSKVISI  249

Query  987   sivaglllvailFNKNQ---NEENVKTRRKDNLDEVLVVQIASMARSESINHssrrstst  1157
              IVA ++ +   F K++   ++++     ++N D+V+ V + S    ++   S + S   
Sbjct  250   LIVATIVGLIFTFLKSKRRNDDDDFSVMSRENNDDVVQVHVPSSNHRQASEGSKKESKRG  309

Query  1158  egsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKE  1337
                S   GD ++VN+E+G+FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVVKR++E
Sbjct  310   SSRSGGMGDLIMVNDEKGVFGLPDLMKAAAEVLGNGGLGSAYKAAM-TNGLSVVVKRMRE  368

Query  1338  TNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTA  1517
              NK+++D FDAEMR+ G LR+ NIL  LAYHYR++EKL V+E+ PKGSLLY+LHGDRGT+
Sbjct  369   MNKVSRDIFDAEMRRFGRLRNRNILTPLAYHYRREEKLFVTEYMPKGSLLYVLHGDRGTS  428

Query  1518  HNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPL  1697
             H +L   TR+KI+KG+A G+ +L+TEFA+  LPHGNLKSSNILL  TYEPLL+D+AFHPL
Sbjct  429   HAELNWPTRLKIVKGIARGLSFLYTEFASEDLPHGNLKSSNILLADTYEPLLSDFAFHPL  488

Query  1698  VSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVV  1868
             ++ +   Q MFA K P+     QIS K+DVYCLGI+ILE++TGKFPSQY SN KGGTDVV
Sbjct  489   INPSYAAQTMFAYKTPDYVIYQQISQKTDVYCLGIIILEIITGKFPSQYHSNGKGGTDVV  548

Query  1869  QWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIR  2048
             QWV  A+++ +E+E+IDPE+ G   DS  +M++LLQIGAACTES+ E+RL+MKEAI+RI 
Sbjct  549   QWVFTAISERREAELIDPELTGNNADSINQMLQLLQIGAACTESNPEQRLNMKEAIRRIE  608

Query  2049  EIQ  2057
             E+Q
Sbjct  609   ELQ  611



>gb|KDP33937.1| hypothetical protein JCGZ_07508 [Jatropha curcas]
Length=628

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/617 (52%), Positives = 422/617 (68%), Gaps = 26/617 (4%)
 Frame = +3

Query  258   LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMG  437
             LS S+ ++  L++FKESL N + LDD WV G SPC++  +W GV+C   T+TGL L N+G
Sbjct  20    LSSSLSENEALVKFKESLTNAEALDD-WVSGPSPCEE--KWVGVVCFDGTITGLHLSNLG  76

Query  438   LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
             L+G IDV+AL  L GLR  +  NNSF+GPIP F+K+  LKSL +  N FSGEI+ D+FA 
Sbjct  77    LSGTIDVEALQELPGLRTTSFINNSFTGPIPAFNKIGALKSLLLSHNGFSGEIANDFFAP  136

Query  618   MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL--AQRSLTILDLSGN  791
             M  L+K+WLS N F+G IP S+ +L  L ELHLEGN FS  +PPL  A++ +T LDLS N
Sbjct  137   MLSLKKVWLSDNKFTGKIPESVMQLKNLKELHLEGNQFSGPIPPLNQAKQVITSLDLSNN  196

Query  792   KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGM  971
             KL+GEIPS  + F A +F  N +LCG+P+   C                P ++   SS  
Sbjct  197   KLEGEIPSSFSTFSADSFANNDKLCGQPLHVAC-----SSSTPSLAVSLPNSSSSSSSAA  251

Query  972   RWlllsivaglllvailF------NKNQNEENVKTRRKDNLDEVLVVQIASMA--RSESI  1127
                + S        + +       N    +++     K+NLDEV++   AS +  R  S 
Sbjct  252   ATSVASSSNPSDSASEVMYTLCSPNGRHKDDDFSMLEKENLDEVVLSVRASGSNKRQPSD  311

Query  1128  NHssrrstste---gsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALP  1298
             N     S++        +  GD +++N+ERG FGL +LM A+AEVLG+GGLGSAYKA L 
Sbjct  312   NSRRSTSSTRRGPHQGRNGMGDLIMINDERGTFGLQDLMKAAAEVLGSGGLGSAYKAML-  370

Query  1299  VIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKG  1478
               G++VVVKR++E N +++D FDAEMRK G +RH NIL  LAYH+RK+EKL+V+E+ PKG
Sbjct  371   TSGVSVVVKRIREMNMLSRDGFDAEMRKFGRIRHKNILTPLAYHFRKEEKLMVTEYMPKG  430

Query  1479  SLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPT  1658
             SLLY++HGDRG  H++L    R+KIIKG+A+G+ +LHTE++TY LPHGNLKSSN++L   
Sbjct  431   SLLYVIHGDRGICHSELNWENRLKIIKGIANGLSFLHTEYSTYNLPHGNLKSSNVVLDDD  490

Query  1659  YEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPS  1829
             YEPLLTDYA  PL +   + Q MFA K+PE    HQ+S KSDV+CLGI+ILEVVTGKFPS
Sbjct  491   YEPLLTDYALDPLTNPNHSAQTMFAYKSPEYLLNHQVSAKSDVFCLGIIILEVVTGKFPS  550

Query  1830  QYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIA-GAGEDSDGKMVKLLQIGAACTESDV  2006
             QYL+N KGGTDVV+WV++A A+GKE EVIDPEIA G+  +S  +MVKLL+IGAAC ES+ 
Sbjct  551   QYLANGKGGTDVVKWVQRAKAEGKEQEVIDPEIANGSSAESIQEMVKLLRIGAACAESNT  610

Query  2007  EKRLSMKEAIKRIREIQ  2057
               RL MKEAI+RI E++
Sbjct  611   ALRLDMKEAIRRIGEVK  627



>ref|XP_010656101.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Vitis vinifera]
Length=626

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/602 (52%), Positives = 426/602 (71%), Gaps = 15/602 (2%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             ++  L++ K+SL +T  LD +WV   +PC     W G++C    VTGLRL +M L+G+ID
Sbjct  31    ENEALLKLKKSLVHTGALD-SWVPSSNPCQGP--WDGLICLNGIVTGLRLGSMDLSGNID  87

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             VDAL +++GLR I+L NNSFSGP+P F++L  LK L++  N+FSGEI +DYF+ +T L+K
Sbjct  88    VDALIDIRGLRTISLTNNSFSGPLPAFNRLGSLKGLYLTRNQFSGEIPSDYFSTLTSLKK  147

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             LWLS N F+G IP S+ +L  L+ELHL+ N FS  +P     SL  L LS NKL+GEIP 
Sbjct  148   LWLSKNKFTGQIPKSVMQLTHLMELHLDDNQFSGPIPSTLPLSLKSLGLSNNKLEGEIPE  207

Query  816   GMARFGAKAFEGNPELCGEPVGRQCRED---LGKDGGGGAEAQTPENAQRHSSGMRWll-  983
              +A+F AKAFEGN  LCG+ +G+QC +    L         +   E ++ + S +  +  
Sbjct  208   TLAKFDAKAFEGNEGLCGKQLGKQCEQANKALSPSPPPPPPSPEIEKSKINISKVMTMAG  267

Query  984   -lsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMAR--SESINHssrrsts  1154
                ++  LL+   L + ++ +E      K+NLDEV+ +Q++   R  ++S+  ++  S  
Sbjct  268   IAFLMIALLVFTSLVSSSRRKEEFNILGKENLDEVVEIQVSGSTRKGADSLKKANGSSRR  327

Query  1155  tegs-ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRL  1331
                   +   D V++N+E+G FGL +LM A+AEVLGNGGLGSAYKA +   GL VVVKR+
Sbjct  328   GSQHGRASVSDLVMINDEKGSFGLPDLMKAAAEVLGNGGLGSAYKAVM-ANGLAVVVKRM  386

Query  1332  KETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRG  1511
             +E N++ +D+FDA++RK+G LRH NIL  LAYHYRK+EKL++SE+ PKGSLLY++HGDRG
Sbjct  387   REINRLGRDSFDAQIRKIGRLRHENILTPLAYHYRKEEKLLISEYVPKGSLLYVMHGDRG  446

Query  1512  TAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFH  1691
              +H++L   TR+KII+G+ASGM +LH+EFA+  LPHGNLKSSNILL   Y PLLTDYAF+
Sbjct  447   ISHSELNWPTRLKIIQGIASGMNFLHSEFASLDLPHGNLKSSNILLDEHYVPLLTDYAFY  506

Query  1692  PLVSGTPTLQCMFALKAPEGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQ  1871
             PLV+ T   Q MFA +A + H +S K DVYCLGIVILE++TGKFPSQYLSN KGGTDVVQ
Sbjct  507   PLVNATQASQAMFAYRAQDQH-VSPKCDVYCLGIVILEIITGKFPSQYLSNGKGGTDVVQ  565

Query  1872  WVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIRE  2051
             WV+ A+ + +E+E+IDPEI  A E S+ +M +LLQI A CTES+ E RL MKEAI+RI+E
Sbjct  566   WVKSAIEENRETELIDPEI--ASEASEREMQRLLQIAAECTESNPENRLDMKEAIRRIQE  623

Query  2052  IQ  2057
             I+
Sbjct  624   IK  625



>ref|XP_008460083.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Cucumis melo]
Length=670

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/645 (49%), Positives = 436/645 (68%), Gaps = 21/645 (3%)
 Frame = +3

Query  144   LFREAF*RFP-AT*MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNT  320
             L+ E F  FP  + M AVR      ++F    +    LPL   + ++  L++ KES  ++
Sbjct  39    LYPEVFSIFPFGSAMGAVR------IVFLIILVGGGGLPLCCPLSENEALLKLKESFTHS  92

Query  321   KGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIAL  500
             + L+ +W     PC  + +W G++C+R  +TGL L ++ L+G IDV+AL  L+GLR I+ 
Sbjct  93    ESLN-SWNPDSVPC--SAQWTGIICNRGVITGLHLSDLQLSGKIDVEALLQLRGLRTISF  149

Query  501   ANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPAS  680
              NN FSGPIP+F+K+  LKSL + GN FSG I +D+F+ +T L+K+WLS N FSGNIP S
Sbjct  150   VNNKFSGPIPEFNKIGVLKSLLLTGNHFSGAIPSDFFSSLTSLKKVWLSSNNFSGNIPHS  209

Query  681   LGKLPRLVELHLEGNGFSSAVPPLAQRSL-TILDLSGNKLQGEIPSGMARFGAKAFEGNP  857
             L +L  L+ELHLE N FS  +P L   S+ T LDLS NKL+G+IP  +++F AKAF GN 
Sbjct  210   LAQLSHLIELHLESNQFSGPIPHLKHASIITSLDLSNNKLEGQIPDILSKFDAKAFAGNE  269

Query  858   ELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQ  1037
              LCG P+ + C   + +D      +  P  +Q + S +    L  V   L+V I  + ++
Sbjct  270   GLCGNPLPKSCGARIPEDQK--PSSSPPGESQGNVSKLVVASLIAVTVFLMVFIFLSASK  327

Query  1038  N-EENVKTRRKDNLDEVLVVQIASMA--RSESINHssrrststegsssrggDFVLVNEER  1208
               E+      ++ ++EV+ V + S    +  S          ++   +   D V+VNE++
Sbjct  328   RREDEFSVLGRERMEEVVEVHVPSSGHDKQSSRKGGGDSKRGSQQGKAGMSDLVVVNEDK  387

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
             G+FGL++LM A+AEVLGNGGLGSAYKA +   GL+VVVKR++E NK+ KD FDAEMR++G
Sbjct  388   GIFGLADLMKAAAEVLGNGGLGSAYKAVMSN-GLSVVVKRMREMNKLGKDGFDAEMRRLG  446

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              LRHHNIL  LAYHYR++EKL+VSE+ PKGSLLY+LHGDRG  H DL  ATR++I++G+A
Sbjct  447   RLRHHNILTPLAYHYRREEKLLVSEYIPKGSLLYVLHGDRGACHADLNWATRLRIVQGIA  506

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ +LH+EFATY LPHGNLKSSN+LL   YEPLL+DYAFHPL++     Q MFA ++PE
Sbjct  507   RGLGFLHSEFATYDLPHGNLKSSNVLLCDNYEPLLSDYAFHPLINPNNATQAMFAYRSPE  566

Query  1749  GHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
               Q   +S KSDVYCLGI+ILE++T KFPSQYL+N KGGTDVVQWV  AV++ +E+E+ID
Sbjct  567   YAQYQEVSPKSDVYCLGIIILEIMTSKFPSQYLTNGKGGTDVVQWVSSAVSEKREAELID  626

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             PEIA   +  D +MV LL IGA CT ++ ++R  M+EAI+RI EI
Sbjct  627   PEIANDTDALD-RMVNLLTIGADCTHNNPQQRPEMREAIRRIEEI  670



>ref|XP_004157971.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Cucumis sativus]
Length=645

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/645 (49%), Positives = 436/645 (68%), Gaps = 21/645 (3%)
 Frame = +3

Query  144   LFREAF*RFP-AT*MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNT  320
             L+ E F  FP  + M AVR +  F +I      +  C PLS    ++  L++ KES  ++
Sbjct  14    LYPEVFSIFPFGSAMGAVRIV--FLIILVGGGGLPSCCPLS----ENEALLKLKESFTHS  67

Query  321   KGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIAL  500
             + L+ +W     PC  + RW G++C+R  +TGL L  + L+G IDV+AL  L+GLR I+ 
Sbjct  68    ESLN-SWNPDSVPC--SARWIGIICNRGVITGLHLSGLQLSGKIDVEALLQLRGLRTISF  124

Query  501   ANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPAS  680
              +N FSGPIP+F+K+  LKSL + GN FSG I +D+F+ +T L+K+WLS N FSGNIP S
Sbjct  125   VDNQFSGPIPEFNKIGVLKSLLLTGNHFSGAIPSDFFSSLTSLKKVWLSSNNFSGNIPHS  184

Query  681   LGKLPRLVELHLEGNGFSSAVPPLAQRSL-TILDLSGNKLQGEIPSGMARFGAKAFEGNP  857
             L +L  L+ELHLE N FS  +P L   S+ T L++S NKL+G+IP  +++F AKAF GN 
Sbjct  185   LAQLSHLIELHLESNQFSGPIPHLKHASIITSLNVSNNKLEGQIPDILSKFDAKAFAGNE  244

Query  858   ELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQ  1037
              LCG P+ + C   + +D      +  P  +Q + S +    L  V   L+V I  + ++
Sbjct  245   GLCGNPLPKSCGAQISEDQK--PPSSPPGESQGNISKLVVASLIAVTVFLMVFIFLSASK  302

Query  1038  NEEN-VKTRRKDNLDEVLVVQIASMA--RSESINHssrrststegsssrggDFVLVNEER  1208
               E+      ++ ++EV+ V + S    +  S          ++   +   D V+VNE++
Sbjct  303   RREDEFSVLGREQMEEVVEVHVPSSGHDKQSSRRGGGDSKRGSQQGKAGMSDLVVVNEDK  362

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
             G+FGL++LM A+AEVLGNGGLGSAYKA +   GL+VVVKR++E NK+ KD FDAEMR++G
Sbjct  363   GIFGLADLMKAAAEVLGNGGLGSAYKAVMSN-GLSVVVKRMREMNKLGKDGFDAEMRRLG  421

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              LRHHNIL  LAYHYR++EKL+VSE+ PKGSLLY+LHGDRG  H DL  ATR++I++G+A
Sbjct  422   RLRHHNILTPLAYHYRREEKLLVSEYIPKGSLLYVLHGDRGACHADLNWATRLRIVQGIA  481

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ +LH+EFATY LPHGNLKSSN+LL   YEPLL+DYAFHPL++     Q MFA ++PE
Sbjct  482   RGLGFLHSEFATYDLPHGNLKSSNVLLCDNYEPLLSDYAFHPLINPNNATQAMFAYRSPE  541

Query  1749  GHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
               Q   +S KSDVYCLGI+ILE++T KFPSQYL+N KGGTDVVQWV  AV++ +E+E+ID
Sbjct  542   YAQYQEVSPKSDVYCLGIIILEIMTSKFPSQYLTNGKGGTDVVQWVSSAVSEKREAELID  601

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             PEIA    D+  +MV LL IGA CT ++ ++R  M+EAI+RI EI
Sbjct  602   PEIAN-DTDALDRMVHLLTIGADCTHNNPQQRPEMREAIRRIEEI  645



>gb|KGN60492.1| hypothetical protein Csa_2G000010 [Cucumis sativus]
Length=618

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/631 (49%), Positives = 429/631 (68%), Gaps = 20/631 (3%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             M AVR +  F +I      +  C PLS    ++  L++ KES  +++ L+ +W     PC
Sbjct  1     MGAVRIV--FLIILVGGGGLPSCCPLS----ENEALLKLKESFTHSESLN-SWNPDSVPC  53

Query  363   DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
               + RW G++C+R  +TGL L  + L+G IDV+AL  L+GLR I+  +N FSGPIP+F+K
Sbjct  54    --SARWIGIICNRGVITGLHLSGLQLSGKIDVEALLQLRGLRTISFVDNQFSGPIPEFNK  111

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             +  LKSL + GN FSG I +D+F+ +T L+K+WLS N FSGNIP SL +L  L+ELHLE 
Sbjct  112   IGVLKSLLLTGNHFSGAIPSDFFSSLTSLKKVWLSSNNFSGNIPHSLAQLSHLIELHLES  171

Query  723   NGFSSAVPPLAQRSL-TILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
             N FS  +P L   S+ T L++S NKL+G+IP  +++F AKAF GN  LCG P+ + C   
Sbjct  172   NQFSGPIPHLKHASIITSLNVSNNKLEGQIPDILSKFDAKAFAGNEGLCGNPLPKSCGAQ  231

Query  900   LGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEEN-VKTRRKDNL  1076
             + +D      +  P  +Q + S +    L  V   L+V I  + ++  E+      ++ +
Sbjct  232   ISEDQK--PPSSPPGESQGNISKLVVASLIAVTVFLMVFIFLSASKRREDEFSVLGREQM  289

Query  1077  DEVLVVQIASMA--RSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAE  1250
             +EV+ V + S    +  S          ++   +   D V+VNE++G+FGL++LM A+AE
Sbjct  290   EEVVEVHVPSSGHDKQSSRRGGGDSKRGSQQGKAGMSDLVVVNEDKGIFGLADLMKAAAE  349

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             VLGNGGLGSAYKA +   GL+VVVKR++E NK+ KD FDAEMR++G LRHHNIL  LAYH
Sbjct  350   VLGNGGLGSAYKAVMSN-GLSVVVKRMREMNKLGKDGFDAEMRRLGRLRHHNILTPLAYH  408

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             YR++EKL+VSE+ PKGSLLY+LHGDRG  H DL  ATR++I++G+A G+ +LH+EFATY 
Sbjct  409   YRREEKLLVSEYIPKGSLLYVLHGDRGACHADLNWATRLRIVQGIARGLGFLHSEFATYD  468

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVY  1781
             LPHGNLKSSN+LL   YEPLL+DYAFHPL++     Q MFA ++PE  Q   +S KSDVY
Sbjct  469   LPHGNLKSSNVLLCDNYEPLLSDYAFHPLINPNNATQAMFAYRSPEYAQYQEVSPKSDVY  528

Query  1782  CLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKM  1961
             CLGI+ILE++T KFPSQYL+N KGGTDVVQWV  AV++ +E+E+IDPEIA   +  D +M
Sbjct  529   CLGIIILEIMTSKFPSQYLTNGKGGTDVVQWVSSAVSEKREAELIDPEIANDTDALD-RM  587

Query  1962  VKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V LL IGA CT ++ ++R  M+EAI+RI EI
Sbjct  588   VHLLTIGADCTHNNPQQRPEMREAIRRIEEI  618



>ref|XP_004141181.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Cucumis sativus]
Length=645

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/645 (49%), Positives = 435/645 (67%), Gaps = 21/645 (3%)
 Frame = +3

Query  144   LFREAF*RFP-AT*MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNT  320
             L+ E F  FP  + M AVR +  F +I      +  C PLS    ++  L++ KES  ++
Sbjct  14    LYPEVFSIFPFGSAMGAVRIV--FLIILVGGGGLPSCCPLS----ENEALLKLKESFTHS  67

Query  321   KGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIAL  500
             + L+ +W     PC  + RW G++C+R  +TGL L  + L+G IDV+AL  L+GLR I+ 
Sbjct  68    ESLN-SWNPDSVPC--SARWIGIICNRGVITGLHLSGLQLSGKIDVEALLQLRGLRTISF  124

Query  501   ANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPAS  680
              +N FSGPIP+F+K+  LKSL + GN FSG I +D+F+ +T L+K+WLS N FSGNIP S
Sbjct  125   VDNQFSGPIPEFNKIGVLKSLLLTGNHFSGAIPSDFFSSLTSLKKVWLSSNNFSGNIPHS  184

Query  681   LGKLPRLVELHLEGNGFSSAVPPLAQRSL-TILDLSGNKLQGEIPSGMARFGAKAFEGNP  857
             L +L  L+ELHLE N FS  +P L   S+ T L++S NKL+G+IP  +++F AKAF GN 
Sbjct  185   LAQLSHLIELHLESNQFSGPIPHLKHASIITSLNVSNNKLEGQIPDILSKFDAKAFAGNE  244

Query  858   ELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQ  1037
              LCG P+ + C   + +D      +  P  +Q + S +    L  V   L+V I  + ++
Sbjct  245   GLCGNPLPKSCGAQISEDQK--PPSSPPGESQGNISKLVVASLIAVTVFLMVFIFLSASK  302

Query  1038  NEEN-VKTRRKDNLDEVLVVQIASMA--RSESINHssrrststegsssrggDFVLVNEER  1208
               E+      ++ ++EV+ V + S    +  S          ++   +   D V+VNE++
Sbjct  303   RREDEFSVLGREQMEEVVEVHVPSSGHDKQSSRRGGGDSKRGSQQGKAGMSDLVVVNEDK  362

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
             G+FGL++LM A+AEVLGNGGLGSAYKA +   GL+VVVKR++E NK+ KD FDAEMR++G
Sbjct  363   GIFGLADLMKAAAEVLGNGGLGSAYKAVMSN-GLSVVVKRMREMNKLGKDGFDAEMRRLG  421

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              LRHHNIL  LAYHYR++EKL+VSE+ PKGSLL +LHGDRG  H DL  ATR++I++G+A
Sbjct  422   RLRHHNILTPLAYHYRREEKLLVSEYIPKGSLLCVLHGDRGACHADLNWATRLRIVQGIA  481

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ +LH+EFATY LPHGNLKSSN+LL   YEPLL+DYAFHPL++     Q MFA ++PE
Sbjct  482   RGLGFLHSEFATYDLPHGNLKSSNVLLCDNYEPLLSDYAFHPLINPNNATQAMFAYRSPE  541

Query  1749  GHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
               Q   +S KSDVYCLGI+ILE++T KFPSQYL+N KGGTDVVQWV  AV++ +E+E+ID
Sbjct  542   YAQYQEVSPKSDVYCLGIIILEIMTSKFPSQYLTNGKGGTDVVQWVSSAVSEKREAELID  601

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             PEIA    D+  +MV LL IGA CT ++ ++R  M+EAI+RI EI
Sbjct  602   PEIAN-DTDALDRMVHLLTIGADCTHNNPQQRPEMREAIRRIEEI  645



>ref|XP_010047460.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Eucalyptus grandis]
 gb|KCW79372.1| hypothetical protein EUGRSUZ_C00787 [Eucalyptus grandis]
Length=628

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/630 (50%), Positives = 417/630 (66%), Gaps = 28/630 (4%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             I  S  L+L     S  + +D  L+E K S+ +   LD +WV    PC   + W GV+C 
Sbjct  9     ILLSSLLVLAMAYPSDCITEDEALLELKRSITDNGALD-SWVPSTPPC---KGWIGVVCF  64

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
                +TGL L + GL G ++V++L  ++GLR I+L NNSFSGPIP+F +L  LKSL + GN
Sbjct  65    NGIITGLHLSDRGLTGKVNVESLETIRGLRTISLVNNSFSGPIPEFSRLGALKSLLLVGN  124

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
              FSGEIS D+F++M  L+K+WLS N FSG IPASL +LP L+ELHLEGN FS  +P    
Sbjct  125   EFSGEISRDFFSRMLSLKKVWLSDNNFSGLIPASLAELPNLMELHLEGNQFSGYIPDFRN  184

Query  759   RSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED---LGKDGGGGAE  929
               LT LDLS NKL+G IP+ + +FG  +F GN  LCG+P+ R C +      K   GG  
Sbjct  185   EKLTSLDLSHNKLEGPIPASLLKFGVSSFRGNEGLCGKPLDRVCTDPAKPTAKPVPGGES  244

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASM  1109
              +   N +  +S   W++   V  LL+V +LF+   +     TRR+DN   VL  ++   
Sbjct  245   LEASPNTEPKNSVDSWVIFGTVGALLVVGMLFSYVYS-----TRRRDNDFSVLGKEVVHD  299

Query  1110  A-----------RSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVL  1256
             A              + +  S  S           D VL+NE++G FGLS+LM A+AEVL
Sbjct  300   AVEVHVSSSKHSSRTASSKKSSVSKRGSHKGKDMADLVLLNEDKGPFGLSDLMKAAAEVL  359

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             GNGGLGSAYKA +   GL+VVVKR++E N++ K+ FDAEMR+ G LRH NIL  LAYHYR
Sbjct  360   GNGGLGSAYKAVMSN-GLSVVVKRMREMNRLGKEGFDAEMRRFGSLRHENILTPLAYHYR  418

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             K+EKL+VSE+ PKGSLLY+LHGDRG  H +L   TR+KII+G+  G+ +L +EFA+Y LP
Sbjct  419   KEEKLLVSEYVPKGSLLYILHGDRGICHAELNWPTRLKIIRGIGRGLGFLQSEFASYDLP  478

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCL  1787
             HGNLKSSN+LL   YEPLL+DYAFHPL++    +Q MFA KAPE     Q+S K DVYCL
Sbjct  479   HGNLKSSNVLLGEDYEPLLSDYAFHPLINPPQAVQAMFAYKAPESLQNQQVSPKCDVYCL  538

Query  1788  GIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             GIVILE+VTGKFPSQYLSN +GGTDVV+WV  A++  +E EVIDPEI  +  ++  +M++
Sbjct  539   GIVILEIVTGKFPSQYLSNGRGGTDVVKWVHSAISHKREEEVIDPEILSSA-NAMPQMLQ  597

Query  1968  LLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             LL IGA+CTES+ E R+ ++EAI+ I E++
Sbjct  598   LLHIGASCTESNPEHRIDLREAIRNIEEVK  627



>ref|XP_002516246.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF46248.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=624

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/609 (51%), Positives = 415/609 (68%), Gaps = 15/609 (2%)
 Frame = +3

Query  258   LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMG  437
             LS S+ ++  L++ K+SL +   LDD WV G +PC   RRW GV+C    +TGL L ++G
Sbjct  21    LSFSLSENESLLKLKKSLNHAGVLDD-WVSGSNPC--VRRWVGVICFGGIITGLHLSDLG  77

Query  438   LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
             L+G ID++AL  L GLR I+  NNSFSGPIP+F+KL  LKSL +  N FSGEI+ D+F  
Sbjct  78    LSGTIDIEALQQLPGLRTISFVNNSFSGPIPEFNKLGALKSLLLTHNEFSGEIANDFFTP  137

Query  618   MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
             M+ L+K+WLS N F+G IP SL +L  L ELHLEGN FS  +PPL Q  L  LDLS N L
Sbjct  138   MSSLKKVWLSENKFTGKIPDSLMQLSLLKELHLEGNQFSGKIPPLKQSKLNSLDLSQNLL  197

Query  798   QGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRW  977
             +GEIP  ++ F A +F GN  LCG+P+  +C   L     G  E+  P     ++     
Sbjct  198   EGEIPQSLSAFSASSFAGNTGLCGKPLATECSSSL-PSLPGQPESHPPAGDNTNTMVGVV  256

Query  978   lllsivaglllvailFNKNQNEENVKTRRKDNLDE-VLVVQIASMARSESINHss----r  1142
             +LL I   +       NK+  +E      K+NLDE VL V+    ++   + +S      
Sbjct  257   VLLLITLLISCTLCSSNKSDKDE-FSFSEKENLDELVLSVRGNGSSKKPPLENSRKGPGS  315

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
             R  S   + +   D ++VN+E+G FGL +LM A+AEVLG+GGLGSAYKA +   GL+VVV
Sbjct  316   RRASQHNNGNGMTDLIMVNDEKGSFGLPDLMKAAAEVLGSGGLGSAYKAMM-TSGLSVVV  374

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR++E N + +D+FDAEMR+ G +RH NIL  LAYH+RK+EKL+VSE+ PKGSLLY+LHG
Sbjct  375   KRMREMNVLGRDSFDAEMRRFGRIRHKNILTPLAYHFRKEEKLLVSEYIPKGSLLYVLHG  434

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
             DRG  H +L    R+KIIKG+A+G+ +LH++++TY LPHGNLKSSN+LL   YEPLL DY
Sbjct  435   DRGMCHAELNWPIRLKIIKGIANGLGFLHSDYSTYNLPHGNLKSSNVLLDENYEPLLGDY  494

Query  1683  AFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
             A  PL +   + Q MFA K+PE    HQ+S KSDVYC GI+ILE++TGKFPSQYLSN KG
Sbjct  495   ALDPLTNSNHSAQAMFAYKSPEYITTHQVSPKSDVYCFGIIILEIITGKFPSQYLSNGKG  554

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAG-AGEDSDGKMVKLLQIGAACTESDVEKRLSMKE  2030
             GTDVVQWV QA ++G+E E+IDPEIA  +  +S  +MV++L+IGAAC E+D  +RL M E
Sbjct  555   GTDVVQWVLQASSEGREQELIDPEIANTSNTNSIHQMVQMLRIGAACAETDATQRLDMSE  614

Query  2031  AIKRIREIQ  2057
             AI+RI EI+
Sbjct  615   AIRRIEEIK  623



>ref|XP_004488098.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Cicer arietinum]
Length=628

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/608 (50%), Positives = 422/608 (69%), Gaps = 29/608 (5%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
             L++ K+S +N+  +  +W+   SPC  T  W GV+C    +TGL L ++ L+G IDVDA+
Sbjct  31    LLKLKQSFKNSDKILSSWIPNVSPCSGT--WIGVVCFNNIITGLHLSDLSLSGTIDVDAI  88

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
             S ++GLR ++  NNSF+GPIP F+KL  +KSL +  N+FSG I  D+F+ +  L+K+W S
Sbjct  89    SEIRGLRTLSFVNNSFTGPIPQFNKLGTIKSLLLTQNQFSGPIPQDFFSHLNSLKKIWFS  148

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N FSG+IP SL +L  L ELHLE N FS  +P L Q  +   D+S NKL+G IP G+++
Sbjct  149   GNKFSGDIPVSLTELDLLKELHLESNEFSGQLPNLKQ-DIKSFDVSNNKLEGPIPEGLSK  207

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA--EAQTPENAQRHSSGMRWlllsivag  1001
             FGA +F GN  LCG+P+ + C      DG   +     +PE   R+ SG    ++ I+  
Sbjct  208   FGAVSFAGNANLCGKPLEKPC------DGSFSSYYSLPSPETENRYGSGWAVKVIVILFL  261

Query  1002  lllvailF-------NKNQNEENVKTRRKDNLDEVLVVQIA-SMARSE-----SINHssr  1142
              ++ AI+F        + ++++     R  N+DEV+ V +  + A SE     ++  SS+
Sbjct  262   AVIAAIIFLLVKSKQRRREDDDFSVVSRDSNVDEVMQVHVPITRASSERVGRRNVGESSK  321

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
             R +   G+ +  GD V+VN+E+G FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVV
Sbjct  322   RGSGMGGARTGIGDIVMVNDEKGSFGLQDLMKAAAEVLGNGGLGSAYKAAM-ANGLSVVV  380

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR++E NK+ KD FDAEMR+ G +RH NIL  LAYHYR++EKL V+E+ PKGSLLY+LHG
Sbjct  381   KRMREMNKIGKDVFDAEMRQFGRIRHTNILTPLAYHYRREEKLFVTEYKPKGSLLYVLHG  440

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
             DRGT+H++L    R+KI KG+A G+ +L+TEF+TY LPHGNLKS N+LL   YEPLL+DY
Sbjct  441   DRGTSHSELTWPIRLKIAKGIARGLSFLYTEFSTYDLPHGNLKSCNVLLNDDYEPLLSDY  500

Query  1683  AFHPLVSGTPTLQCMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
             AF PL++ +  +Q MFA K P   +  ++S K+DVYCLGI+ILE++TGKFPSQY SN KG
Sbjct  501   AFQPLINPSVAVQSMFAYKTPDYIQNQKLSQKADVYCLGIIILEIITGKFPSQYHSNGKG  560

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEA  2033
             GTDVVQWV  A+++ +E+E+IDPE+     +S  +M++LLQIGAACTES+ ++R+ MKEA
Sbjct  561   GTDVVQWVLTAISERREAELIDPELQNNA-NSMNQMLQLLQIGAACTESNPDQRVHMKEA  619

Query  2034  IKRIREIQ  2057
             I+RI E+Q
Sbjct  620   IRRIEEVQ  627



>ref|XP_003595340.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES65591.1| LRR receptor-like kinase [Medicago truncatula]
Length=630

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/609 (50%), Positives = 413/609 (68%), Gaps = 31/609 (5%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
             L++ K+SL N+  +  TW+   SPC  T  W GV+C    +TGL L ++ L+G IDVDA+
Sbjct  33    LLKLKQSLINSDKILSTWIPNVSPCSGT--WIGVICFDNVITGLHLSDLQLSGTIDVDAI  90

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
               ++GLR ++  NNSF+GPIP F KL  +KSL +Q N+FSG I  D+F+++T L+K+WLS
Sbjct  91    VEIRGLRTLSFVNNSFTGPIPQFHKLGAIKSLLLQQNQFSGPIPGDFFSQLTSLKKVWLS  150

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N FSGNIP SL +L  L ELHLEGN FS  +P L Q  +   D+S NKL+G IP  + R
Sbjct  151   GNKFSGNIPPSLTELDLLKELHLEGNEFSGQLPSLKQ-DMKSFDVSNNKLEGPIPESLVR  209

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSS--------GMRWll  983
             FG  +F GN  LCG+P+ +QC           +E   P++    SS        G+  + 
Sbjct  210   FGPVSFAGNEGLCGKPLEKQC-------DSPSSEYTLPDSKTESSSSSWVPQVIGLVIMA  262

Query  984   lsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIA-SMARSES-------INHss  1139
             + +    L V     K +++ +V   R  ++DEV+ V++  S A S S       +  SS
Sbjct  263   VIMAVIFLFVKSRQRKREDDFSV-VSRDSSVDEVMQVRVPISRASSASERVGRRNVGESS  321

Query  1140  rrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVV  1319
             ++     GS +  GD V+VN+E+G FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VV
Sbjct  322   KKGGMGGGSRNGIGDIVMVNDEKGSFGLQDLMKAAAEVLGNGGLGSAYKAAM-ATGLSVV  380

Query  1320  VKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLH  1499
             VKR++E NK+ KD FDAEMR+ G +RH NIL  LAYHYR++EKL V+E+ PKGSLLY+LH
Sbjct  381   VKRMREMNKIGKDVFDAEMRQFGRIRHANILTPLAYHYRREEKLFVTEYKPKGSLLYVLH  440

Query  1500  GDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTD  1679
             GDRG +H +L    R+KI KG+A G+ +L+TEF+TY LPHGNLKSSN+LLT  YEPLL+D
Sbjct  441   GDRGMSHAELTWPNRLKIAKGIARGLSFLYTEFSTYDLPHGNLKSSNVLLTDDYEPLLSD  500

Query  1680  YAFHPLVSGTPTLQCMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQK  1850
             YAF PL++ +  +Q MFA K P   +  ++S K+DVYCLGI+ILE++TGKFPSQY SN K
Sbjct  501   YAFQPLINPSIAVQSMFAYKTPDYVQNQKLSQKADVYCLGIIILELITGKFPSQYHSNGK  560

Query  1851  GGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKE  2030
             GGTDVVQWV  A+++ +E+E+IDPE+     +    M++LL IGAACTES+ E+RL MKE
Sbjct  561   GGTDVVQWVLTAISERREAELIDPELKNNASNKTSNMLQLLLIGAACTESNPEQRLHMKE  620

Query  2031  AIKRIREIQ  2057
             AI+RI E Q
Sbjct  621   AIRRIEEAQ  629



>ref|XP_003609981.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES92178.1| LRR receptor-like kinase [Medicago truncatula]
Length=627

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/639 (48%), Positives = 435/639 (68%), Gaps = 27/639 (4%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPL-SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
             MAAVR    F LIFF    +L  LP  S S+ +   L++ K+S  NT+ L  +W+  ++P
Sbjct  1     MAAVR----FILIFF----LLISLPFHSSSISEAEALLKLKQSFTNTQSLA-SWLPNQNP  51

Query  360   CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
             C  + RW GV+C    ++ L L ++GL+G ID+D+L  +  LR I+  NNSFSG IP+F+
Sbjct  52    C--SSRWVGVICFDNVISSLHLTDLGLSGKIDIDSLLQIPTLRTISFVNNSFSGAIPEFN  109

Query  540   KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             KL  LK+L++  N+FSG I  D+F+ +  L+K+WL++N FSGNIP SL  L  L ELHL+
Sbjct  110   KLGALKALYLSLNQFSGPIPPDFFSHLGSLKKVWLNNNKFSGNIPDSLTNLRFLGELHLD  169

Query  720   GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC--R  893
              N FS  +P   Q  +  LD+S NKLQG IP  ++++ AK+F GN ELCG+P+ + C   
Sbjct  170   NNEFSGPIPEFKQ-DIKSLDMSNNKLQGAIPGPLSKYEAKSFAGNEELCGKPLDKACDPS  228

Query  894   EDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailF--NKNQNEENVKTRRK  1067
              DL      G+   +          ++++ + +VA L +V + F  +K + +++     +
Sbjct  229   SDLTSPPSDGSGQDSGGGGGGTGWALKFIGILLVAALFVVFVTFIKSKRRKDDDFSVMSR  288

Query  1068  DNLDEVLVVQI------ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSE  1229
             +N ++++ V +      +S     S +   + S      S   GD V+VN+E+G+FGL +
Sbjct  289   ENNEDIIPVHVPISKHSSSKHSRASESSGKKDSRRGSSKSGGMGDLVMVNDEKGVFGLPD  348

Query  1230  LMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNI  1409
             LM A+AEVLGNGGLGSAYKAA+   GL+VVVKR++E NK+++D FDAEMR+ G LR+ NI
Sbjct  349   LMKAAAEVLGNGGLGSAYKAAM-TNGLSVVVKRMREMNKVSRDIFDAEMRRFGRLRNRNI  407

Query  1410  LPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLH  1589
             L  LAYHYR++EKL V+E+ PKGSLLY+LHGDRGT+H +L   TR+KI+KG+A G+ +L+
Sbjct  408   LAPLAYHYRREEKLFVTEYMPKGSLLYVLHGDRGTSHAELNWPTRLKIVKGIARGLTFLY  467

Query  1590  TEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQI  1760
             TEF +  LPHGNLKSSNILL   YEPLL+D+AFHPL++ +   Q MFA K P+      +
Sbjct  468   TEFESEDLPHGNLKSSNILLADNYEPLLSDFAFHPLINSSHATQTMFAYKTPDYVLYQHV  527

Query  1761  SHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAG  1940
             S K+DVYCLGI+ILE++TGKFPSQY SN KGGTDVVQWV  A+++ +E+E+IDPE+    
Sbjct  528   SQKTDVYCLGIIILEIITGKFPSQYHSNGKGGTDVVQWVFTAISERREAELIDPELTANN  587

Query  1941  EDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +DS   M++LLQIGAACTES+ E+RL+MKEAI+RI E+Q
Sbjct  588   QDSINHMLQLLQIGAACTESNPEQRLNMKEAIRRIEELQ  626



>ref|XP_003541314.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=606

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/607 (48%), Positives = 417/607 (69%), Gaps = 35/607 (6%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             ++  L+  K+S  N   L  +WV  ++PC  + RW GV+C    +  L L ++ L+G ID
Sbjct  21    ENEALLNLKKSFSNPVALS-SWVPNQNPC--SSRWLGVICFNNIINSLHLVDLSLSGAID  77

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             V+AL+ +  LR I+  NNSFSGPIP F++L  LKSL++  N+FSG+I +D+F+++  L+K
Sbjct  78    VNALTQIPTLRSISFVNNSFSGPIPPFNQLGALKSLYLAHNQFSGQIPSDFFSQLASLKK  137

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             +W+S+N FSG IP+SL  L  L ELHLE N FS  VP L Q  +  LD+S NKLQGEIP+
Sbjct  138   IWISNNKFSGPIPSSLTNLRFLTELHLENNEFSGPVPELKQ-DIKSLDMSNNKLQGEIPA  196

Query  816   GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiv  995
              M+RF AK+F  N  LCG+P+  +C      + GG +E            G  W +  ++
Sbjct  197   AMSRFEAKSFANNEGLCGKPLNNEC------EAGGSSEV-----------GSGWGMKVVI  239

Query  996   aglllvailF------NKNQNEENVKTRRKDNLDEVLVVQIASMARSE----SINHssrr  1145
               ++ VA+ F      +K +++++     +D++DEV+ V + S   S       +     
Sbjct  240   VLIVAVALAFIFALTRSKRRHDDDFSVMSRDHVDEVVQVHVPSSNHSRGASEGGSKKESS  299

Query  1146  ststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVK  1325
             S+    S    GD V+VN+E+G+FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVVK
Sbjct  300   SSKKGSSRGGMGDLVMVNDEKGVFGLPDLMKAAAEVLGNGGLGSAYKAAMNN-GLSVVVK  358

Query  1326  RLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGD  1505
             R++E NK+++D FDAEMR+ G LR+ NI+  LAYHYRK+EKL V+E+ PKGSLLY+LHGD
Sbjct  359   RMREMNKVSRDIFDAEMRRFGRLRNLNIITPLAYHYRKEEKLFVTEYMPKGSLLYVLHGD  418

Query  1506  RGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYA  1685
             RG++H DL    R+ I+KG+A G++++++EF+   LPHGNLKSSN+LLT  YEPLL+D+A
Sbjct  419   RGSSHADLNWPIRLNIVKGIARGLDFIYSEFSNEDLPHGNLKSSNVLLTENYEPLLSDFA  478

Query  1686  FHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG  1856
             FHPL++    +Q MFA K P+      +S K+DVYCLGI++LE++TGKFPSQY SN KGG
Sbjct  479   FHPLINPNYAIQTMFAYKTPDYVSYQHVSQKTDVYCLGIIVLEIITGKFPSQYHSNGKGG  538

Query  1857  TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAI  2036
             TDVV WV  A+++ +E+E+IDPE+     +S  +M++LLQ+GAACTES+ ++RL+MKEAI
Sbjct  539   TDVVHWVFTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLNMKEAI  598

Query  2037  KRIREIQ  2057
             +RI E+Q
Sbjct  599   RRIEEVQ  605



>ref|XP_007154564.1| hypothetical protein PHAVU_003G129400g [Phaseolus vulgaris]
 gb|ESW26558.1| hypothetical protein PHAVU_003G129400g [Phaseolus vulgaris]
Length=608

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/602 (49%), Positives = 417/602 (69%), Gaps = 26/602 (4%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             D+  L+  K+S  N + L  +W+  ++PC  + RW GV+C    ++ + L ++ L+G ID
Sbjct  24    DNQALLALKKSFSNPQTLP-SWIPDQNPC--SARWVGVICLNNGISSIHLTDLSLSGSID  80

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             ++ALS +  LR I+  NNSFSGPIP F+KL  LK+L++  N+FSG I +D+F+++  L+K
Sbjct  81    IEALSQIPSLRSISFVNNSFSGPIPPFNKLGVLKALYLTNNQFSGPIPSDFFSQLASLKK  140

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             +WLS+N F+G IP S+  L  L ELHLE N FS  VP L Q  +  LD+S N LQG+IPS
Sbjct  141   IWLSYNKFTGPIPESITNLRFLSELHLENNQFSGRVPELKQ-DIKSLDMSHNNLQGQIPS  199

Query  816   GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiv  995
              M+RF  K+F  N ELCG+P+  +C  +             P+ ++    G++ ++L  +
Sbjct  200   SMSRFDPKSFSENKELCGKPLAIECESE-------------PKASESTGWGLKVVILIFI  246

Query  996   aglllvailF--NKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegs-  1166
             A +L  A +   +K Q +++     +DN +EV+ V + S   S   +  S++ +ST    
Sbjct  247   AAVLAGAFVIMRSKRQRDDDFSVMSRDNAEEVVQVHVPSTNHSRGTSEGSKKESSTTSKK  306

Query  1167  --ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKET  1340
               S   GD V+VN+ERG FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVVKR++E 
Sbjct  307   GGSRSIGDLVMVNDERGTFGLPDLMKAAAEVLGNGGLGSAYKAAM-ASGLSVVVKRMREM  365

Query  1341  NKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAH  1520
             NK+++D FDAEMR+ G LR+ NIL  LAYHYRK+EKL V+E+ PKGSLLY+LHGDRG+ H
Sbjct  366   NKVSRDIFDAEMRRFGRLRNPNILTPLAYHYRKEEKLFVTEYMPKGSLLYVLHGDRGSNH  425

Query  1521  NDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLV  1700
             +DL    R+KI+KG+A G+ +L+ EF    LPHGNLKSSN+LL   YEPLL D+AFHPL+
Sbjct  426   SDLNWPIRLKIVKGIARGLGFLYKEFPNEDLPHGNLKSSNVLLAENYEPLLGDFAFHPLI  485

Query  1701  SGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQ  1871
             +    +Q MFA K P+     +++ K+DVYCLGI++LE++TGKFPSQY SN KGGTDVVQ
Sbjct  486   NHNYAVQTMFAYKTPDYVSYQRVTQKTDVYCLGIIVLEIITGKFPSQYHSNGKGGTDVVQ  545

Query  1872  WVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIRE  2051
             WV  A++D +E+E+IDPE+  +  +S  +M++LLQIGAACTES+ ++RL+MKEAI+RI E
Sbjct  546   WVFTAISDRREAELIDPELKSSHSNSLNQMLQLLQIGAACTESNPDQRLNMKEAIRRIEE  605

Query  2052  IQ  2057
             +Q
Sbjct  606   VQ  607



>ref|XP_003551100.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=609

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/600 (49%), Positives = 413/600 (69%), Gaps = 24/600 (4%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             ++  L+  K+S  N   L  +WV  +SPC  + RW GV+C    V+ L L ++ L+G ID
Sbjct  27    ENEALLNLKKSFSNPVALS-SWVPNQSPC--SSRWLGVICFNNIVSSLHLADLSLSGTID  83

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             VDAL+ +  LR I+  NNSFSGPIP F+KL  LK+L++  N FSG+I +D+F+++  L+K
Sbjct  84    VDALTQIPTLRSISFINNSFSGPIPPFNKLGALKALYLARNHFSGQIPSDFFSQLASLKK  143

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             +W+S N FSG IP+SL  L  L ELHLE N FS  VP L Q  +  LD+S NKLQGEIP+
Sbjct  144   IWISDNNFSGPIPSSLTNLRFLTELHLENNQFSGPVPELKQ-GIKSLDMSNNKLQGEIPA  202

Query  816   GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiv  995
              M+RF A +F  N  LCG+P+ ++C     +  G G +             M  +L++ V
Sbjct  203   AMSRFDANSFSNNEGLCGKPLIKECEAGSSEGSGWGMK-------------MVIILIAAV  249

Query  996   aglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS---ESINHssrrststegs  1166
             A  ++  ++ +K + +++     +D++DEV+ V + S   S   E  +     S+    S
Sbjct  250   ALAMIFVLMRSKRRRDDDFSVMSRDHVDEVVQVHVPSSNHSRASERGSKKEFTSSKKGSS  309

Query  1167  ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNK  1346
                 GD V+VN+E+G+FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVVKR++E NK
Sbjct  310   RGGMGDLVMVNDEKGVFGLPDLMKAAAEVLGNGGLGSAYKAAMNN-GLSVVVKRMREMNK  368

Query  1347  MNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHND  1526
             +++D FDAEMR+ G LR+ NI+  LAYHYRK+EKL V+E+ PKGSLLY+LHGDRG++H D
Sbjct  369   VSRDIFDAEMRRFGRLRNPNIITPLAYHYRKEEKLFVTEYMPKGSLLYVLHGDRGSSHAD  428

Query  1527  LKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
             L    R+ I+KG+A G+ ++++EF    LPHGNLKSSN+LLT  YEPLL+D+AFHPL++ 
Sbjct  429   LNWPMRLNIVKGIARGLGFIYSEFPNEVLPHGNLKSSNVLLTENYEPLLSDFAFHPLINP  488

Query  1707  TPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWV  1877
                +Q MFA K P+      +S K+DVYCLGI++LE++TGKFPSQY SN KGGTDVV WV
Sbjct  489   NYAIQTMFAYKTPDYVSYQHVSQKTDVYCLGIIVLEIITGKFPSQYHSNGKGGTDVVHWV  548

Query  1878  RQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
               A+++ +E+E+IDPE+     +S  +M++LLQ+GAACTES+ ++RL+MKEAI+RI E+Q
Sbjct  549   FTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLNMKEAIRRIEEVQ  608



>gb|KHN07887.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=606

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/607 (48%), Positives = 414/607 (68%), Gaps = 35/607 (6%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             ++  L+  K+S  N   L  +WV  ++PC  + RW GV+C    +  L L ++ L+G ID
Sbjct  21    ENEALLNLKKSFSNPVALS-SWVPNQNPC--SSRWLGVICFNNIINSLHLVDLSLSGAID  77

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             V+AL+ +  LR I+  NNSFSGPIP F++L  LKSL++  N+FSG+I +D+F+++  L+K
Sbjct  78    VNALTQIPTLRSISFVNNSFSGPIPPFNQLGALKSLYLAHNQFSGQIPSDFFSQLASLKK  137

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             +W+S+N FSG IP+SL  L  L ELHLE N FS  VP L Q  +  LD+S NKLQGEIP+
Sbjct  138   IWISNNKFSGPIPSSLTNLGFLTELHLENNEFSGPVPELKQ-DIKSLDMSNNKLQGEIPA  196

Query  816   GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiv  995
              M+RF AK+F  N  LCG+P+  +C      + GG +E            G  W +  ++
Sbjct  197   AMSRFEAKSFANNEGLCGKPLNNEC------EAGGSSEV-----------GSGWGMKVVI  239

Query  996   aglllvailF------NKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrstst  1157
               ++ VA+ F      +K +++++     +D++DEV+   + S   S   +    +  S+
Sbjct  240   VLIVAVALAFIFALTRSKRRHDDDFSVMSRDHVDEVVQGHVPSSNHSRGASEGGSKKESS  299

Query  1158  egsssrgg----DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVK  1325
                         D V+VN+E+G+FGL +LM A+AEVLGNGGLGSAYKAA+   GL+VVVK
Sbjct  300   SSKKGSSRGGMGDLVMVNDEKGVFGLPDLMKAAAEVLGNGGLGSAYKAAMNN-GLSVVVK  358

Query  1326  RLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGD  1505
             R++E NK+++D FDAEMR+ G LR+ NI+  LAYHYRK+EKL V+E+ PKGSLLY+LHGD
Sbjct  359   RMREMNKVSRDIFDAEMRRFGRLRNLNIITPLAYHYRKEEKLFVTEYMPKGSLLYVLHGD  418

Query  1506  RGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYA  1685
             RG++H DL    R+ I+KG+A G+ ++++EF+   LPHGNLKSSN+LLT  YEPLL+D+A
Sbjct  419   RGSSHADLNWPIRLNIVKGIARGLNFIYSEFSNEDLPHGNLKSSNVLLTENYEPLLSDFA  478

Query  1686  FHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG  1856
             FHPL++    +Q MFA K P+      +S K+DVYCLGI++LE++TGKFPSQY SN KGG
Sbjct  479   FHPLINPNYAIQTMFAYKTPDYVSYQHVSQKTDVYCLGIIVLEIITGKFPSQYHSNGKGG  538

Query  1857  TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAI  2036
             TDVV WV  A+++ +E+E+IDPE+     +S  +M++LLQ+GAACTES+ ++RL+MKEAI
Sbjct  539   TDVVHWVFTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLNMKEAI  598

Query  2037  KRIREIQ  2057
             +RI E+Q
Sbjct  599   RRIEEVQ  605



>ref|XP_010111986.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC32297.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=675

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/639 (48%), Positives = 417/639 (65%), Gaps = 43/639 (7%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWV--KGKS  356
             MA + R+   P I  S  LIL+   L+ S+ +   L++ K+S      LD +WV     S
Sbjct  1     MAVLDRLLLRPYIIISL-LILRFSYLTHSITESEALLKLKDSFAKNDALD-SWVPSASSS  58

Query  357   PCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDF  536
             PC ++ +W G++C+   VTG+ L  +GL+G IDV AL  ++GLR+I+ ANNSFSG IPD 
Sbjct  59    PCIRSAQWRGIVCYNGIVTGISLQGLGLSGKIDVAALRGIRGLRIISFANNSFSGSIPDL  118

Query  537   DKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHL  716
               L  L+++++  N F+G+I +DYFAKM  L+KLWLS+N F GNIP SL +L RLVELHL
Sbjct  119   SSLGALRAIYLSDNEFTGDIPSDYFAKMAFLKKLWLSNNKFVGNIPFSLAQLSRLVELHL  178

Query  717   EGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR-  893
             E N F  ++P L   +L  L+LS NKL+GEIP+ + +F   +F GN   CGE VGR C+ 
Sbjct  179   ENNRFRGSIPSLYMPNLASLNLSNNKLEGEIPAELLKFDETSFAGNEGFCGEKVGRTCQI  238

Query  894   --EDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRK  1067
                D  K    G  +     +      +R                 +K + EE   T  K
Sbjct  239   SSVDFKKIVAAGITSSVVIISVVVLLILR-----------------SKRKGEE---TFEK  278

Query  1068  DNLDEVLVVQI----ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELM  1235
             +   EV V  +      + R++S+N     S  +        D V+VN+E+G+FG+ +LM
Sbjct  279   EAPVEVHVSSLNKKEMDLVRNDSVN-----SLVSNKGGGNAVDIVMVNDEKGVFGMPDLM  333

Query  1236  MASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
              ASAEVLGNGG+GS+YKA +   G+ VVVKR+K+ +   KD FDAE+R++G LRH N+L 
Sbjct  334   KASAEVLGNGGMGSSYKAVM-ANGIAVVVKRIKDMSVKGKDEFDAEIRRLGKLRHWNVLS  392

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
              LAYHYRK+EKLVV E+ P GSLLYLLHG+RG++H +L  + R+KI++G+A G+EYLH+E
Sbjct  393   PLAYHYRKEEKLVVYEYVPNGSLLYLLHGERGSSHVELNWSARLKIVQGIAKGLEYLHSE  452

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QISH  1766
              A++ LPHGNLKSSN+LL P YEPL++D+ F PL++     Q MFA KAPE     Q+S 
Sbjct  453   LASFDLPHGNLKSSNVLLGPEYEPLISDFGFSPLINPASVSQAMFAYKAPEFTQHGQVSP  512

Query  1767  KSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKE-SEVIDPEIAG--A  1937
             KSDVYCLGIVILE++TGKFPSQYL   KGGTDV QWV  A+++G++ +E++DPEIA   +
Sbjct  513   KSDVYCLGIVILEILTGKFPSQYLYTGKGGTDVAQWVTSAISEGRDLAELLDPEIANVTS  572

Query  1938  GEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               DS G+M +LL IGAACTESD E+RLS  EAI+RI EI
Sbjct  573   SRDSLGEMKRLLHIGAACTESDPERRLSTMEAIRRIEEI  611



>ref|XP_010273984.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nelumbo nucifera]
Length=692

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/640 (50%), Positives = 424/640 (66%), Gaps = 24/640 (4%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDV-VLIEFKESLQNTKGLDDTWVKGKSP  359
             MAAVR +     +FFS         L++    DV  L++ K+S  NTK LD +W     P
Sbjct  1     MAAVRFLCQSLFLFFSLSR------LALGSSSDVEALLKLKKSFVNTKALD-SWTTDSFP  53

Query  360   CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
             C     W GV+C    VTGLRL +MGL+G+ID +AL+ + GLR +   NN+F+GPIP F+
Sbjct  54    CTGNTPWAGVVCFNGFVTGLRLASMGLSGNIDTEALNEIPGLRTLNFKNNAFTGPIPAFN  113

Query  540   KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             +L  LK +++ GNRFSG I ++YF  M  L+K+WLS N F+G IP SL KL  L+ELHLE
Sbjct  114   RLIALKVIYLSGNRFSGGIPSNYFLNMDSLKKVWLSGNEFTGKIPESLAKLSHLIELHLE  173

Query  720   GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
              N FS  +P + Q SL  L++S NKL+GEIP+ +++FG+  F GN  LCG  VG++C  D
Sbjct  174   DNHFSGHIPDIGQPSLVSLNMSNNKLEGEIPASLSKFGSSCFAGNGGLCGSQVGKKCGVD  233

Query  900   -LGKDGGGGAEAQT-PENAQRHSS-GMRWlllsivaglllvailFNKNQNEENVKTRRKD  1070
              + +D  G    ++ P NA  H++     L L +V  LL V  +F   + E+      ++
Sbjct  234   AMAEDSIGAISNRSNPNNAPEHNNVAAAALTLVMVVLLLGVGAIFILRKREDKFNVLGRE  293

Query  1071  NLDEVLVVQIASMARSES-------INHssrrststegsssrggDFVLVNEERGMFGLSE  1229
             NLD  + V + S   S+         + SS+R +    S++  G+ V+VN+E+G+FGL +
Sbjct  294   NLDHAVEVHVPSSVHSKKGDSVRRGADSSSKRGSQNGKSAASMGELVIVNDEKGVFGLPD  353

Query  1230  LMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNI  1409
             LM A+AEVLG GGLGSAYKA +   G+TVVVKR+K+ N++ KD FD EMR++G LRH N+
Sbjct  354   LMKAAAEVLGTGGLGSAYKAVMSN-GVTVVVKRMKDMNRVGKDGFDMEMRRIGGLRHPNV  412

Query  1410  LPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLH  1589
             L  LAY+YRK+EKL+V E+  KGSLLYLLHGDRG +H +     R+KI++G+A GM YLH
Sbjct  413   LTPLAYYYRKEEKLLVYEYINKGSLLYLLHGDRGPSHAEFNWPARLKIVQGIARGMGYLH  472

Query  1590  TEFATYKLPHGNLKSSNILLTPTY-EPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH  1766
             TE A+  LPHGNLKSSNILL P   EPLL+DY F  +VS T   Q MFA KAPE  Q  H
Sbjct  473   TELASLDLPHGNLKSSNILLNPNDGEPLLSDYGFCAVVSPTQGAQAMFAYKAPESLQYRH  532

Query  1767  ---KSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGA  1937
                K DVYCLGIVILE++TGKFP QYL+N KGGTDVV+WV  A+++ +E E+ DPEIA A
Sbjct  533   VSPKCDVYCLGIVILEILTGKFPCQYLNNGKGGTDVVEWVLSAMSEKRERELFDPEIASA  592

Query  1938  GEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
               +S G+M +LL IGAACTES  E+R  MKEAI+RI E+Q
Sbjct  593   -TNSLGEMERLLHIGAACTESVPEQRPDMKEAIRRIEEVQ  631



>ref|XP_003632778.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Vitis vinifera]
 emb|CBI35843.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/628 (48%), Positives = 416/628 (66%), Gaps = 34/628 (5%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             + FF+  L+    P S S+ D   L++ K+S  NT  LD +W  G  PC   + W G++C
Sbjct  8     VFFFTVVLLF---PFSFSMSDSEALLKLKQSFTNTNALD-SWEPGSGPCSGDKEWGGLVC  63

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
                 VTGL L  MGL+G IDV+AL  + GLR I++ NNSFSG IP+F++L  LK++FI G
Sbjct  64    FNGIVTGLHLVGMGLSGKIDVEALIAITGLRTISIVNNSFSGSIPEFNRLGALKAIFISG  123

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N+FSGEI  DYF +M  L+KLWLS N F+G IP S+  L  L+ELHLE N F+  +P   
Sbjct  124   NQFSGEIPPDYFVRMASLKKLWLSDNKFTGAIPLSIQLLSHLIELHLENNQFTGTIPDFN  183

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE---DLGKDGGGGA  926
               +L  L+LS NKL+G IP  +++FG  AF GN  LCGE +G  C +   DLG D     
Sbjct  184   LPTLKSLNLSNNKLKGAIPDSLSKFGGSAFAGNAGLCGEELGNGCNDHGIDLGTD-----  238

Query  927   EAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIAS  1106
                      R +  +   +  ++  LL++ +   + + EE       +N+DE + V+I+ 
Sbjct  239   -------RSRKAIAVIISVAVVIISLLIIVVFLMRRRKEEEFDVL--ENVDESVEVRISG  289

Query  1107  MARSESINHssrr--------ststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN  1262
              +R E  + S R         + S++  SS   D V+VNEE+G+FG+S+LM A+AEVLG 
Sbjct  290   SSRKEGSSTSRRAIGSSRRGSNRSSQVKSSMKEDMVVVNEEKGIFGMSDLMKAAAEVLGT  349

Query  1263  GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
             G LGSAYKA +   G+ VVVKR+KE N+++K+ FD E+R++G L+H N+L  L YH+RK+
Sbjct  350   GSLGSAYKAVM-ATGIAVVVKRMKEMNRVSKEGFDLELRRLGSLQHPNVLNPLGYHFRKE  408

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL++ E+ PKGSLL++LHGDRG +H +L    R+KI++G+A G+ YLHTE A+  LPHG
Sbjct  409   EKLIIYEYIPKGSLLFVLHGDRGPSHAELNWPARLKIVQGIARGLGYLHTELASLDLPHG  468

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGI  1793
             NLKSSNILLT  ++PLL+DY + PL+S +   Q +FA +APE    +QIS K DVYCLGI
Sbjct  469   NLKSSNILLTFDHDPLLSDYGYSPLISVSFVSQALFAYRAPEAVRDNQISPKCDVYCLGI  528

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             VILE++ GKFP+QYL+N KGGTDVV+W   A+ADG+E+EV DPEIA +  +S  +MVKLL
Sbjct  529   VILEILIGKFPTQYLNNSKGGTDVVEWAVSAIADGREAEVFDPEIA-SSINSMEEMVKLL  587

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              IG AC ES+ E+R  +KEAI+RI EI 
Sbjct  588   HIGVACAESNPEQRPDIKEAIRRIEEIH  615



>emb|CAN83804.1| hypothetical protein VITISV_015737 [Vitis vinifera]
Length=686

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/628 (48%), Positives = 416/628 (66%), Gaps = 34/628 (5%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             + FF+  L+    P S S+ D   L++ K+S  NT  LD +W  G  PC   + W G++C
Sbjct  8     VFFFTVVLLF---PFSFSMSDSEALLKLKQSFTNTNALD-SWEPGSGPCTGDKEWGGLVC  63

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
                 VTGL L  MGL+G IDV+AL  + GLR I++ NNSFSG IP+F++   LK++FI G
Sbjct  64    FNGIVTGLHLVGMGLSGKIDVEALIAITGLRTISIVNNSFSGSIPEFNRSGALKAIFISG  123

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N+FSGEI  DYF +M  L+KLWLS N F+G IP S+  L  L+ELHLE N F+  +P   
Sbjct  124   NQFSGEIPPDYFVRMASLKKLWLSDNKFTGAIPLSIQLLSHLIELHLENNQFTGTIPDFN  183

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE---DLGKDGGGGA  926
               +L  L+LS NKL+G IP  +++FG  AF GN  LCGE +G  C +   DLG D     
Sbjct  184   LPTLKSLNLSNNKLKGAIPDSLSKFGGSAFAGNAGLCGEELGNGCNDHGIDLGTD-----  238

Query  927   EAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIAS  1106
                      R +  +   +  ++  LL++ +   + + EE       +N+DE + V+I+ 
Sbjct  239   -------RSRKAIAVIISVAVVIISLLIIVVFLMRRRKEEEFDVL--ENVDESVEVRISG  289

Query  1107  MARSESINHssrr--------ststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN  1262
              +R E  + S R         + S++  SS   D V+VNEE+G+FG+S+LM A+AEVLG 
Sbjct  290   SSRKEGSSTSRRAIGSSQRGSNRSSQVKSSMKEDMVVVNEEKGIFGMSDLMKAAAEVLGT  349

Query  1263  GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
             G LGSAYKA +   G+ VVVKR+KE N+++K+ FD E+R++G L+H N+L  L YH+RK+
Sbjct  350   GSLGSAYKAVMAT-GIAVVVKRMKEMNRVSKEGFDLELRRLGSLQHPNVLNPLGYHFRKE  408

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL++ E+ PKGSLL++LHGDRG +H +L    R+KI++G+A G+ YLHTE A+  LPHG
Sbjct  409   EKLIIYEYIPKGSLLFVLHGDRGPSHAELNWPARLKIVQGIARGLGYLHTELASLDLPHG  468

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGI  1793
             NLKSSNILLT  ++PLL+DY + PL+S +   Q +FA +APE    +QIS K DVYCLGI
Sbjct  469   NLKSSNILLTFDHDPLLSDYGYSPLISVSFVSQALFAYRAPEAVRDNQISPKCDVYCLGI  528

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             VILE++ GKFP+QYL+N KGGTDVV+W   A+ADG+E+EV DPEIA +  +S  +MVKLL
Sbjct  529   VILEILIGKFPTQYLNNSKGGTDVVEWAVSAIADGREAEVFDPEIA-SSINSMEEMVKLL  587

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              IG AC ES++E+R  +KEAI+RI EI 
Sbjct  588   HIGVACAESNLEQRPDIKEAIRRIEEIH  615



>ref|XP_003547509.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=615

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/600 (50%), Positives = 409/600 (68%), Gaps = 27/600 (5%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
             L+  K+SL N+     +W+   SPC  T  W GV+C   T+TGL L ++GL+G IDVDAL
Sbjct  32    LLHLKKSLTNSDRSLSSWIPNISPCSGT--WLGVVCFDNTITGLHLSDLGLSGSIDVDAL  89

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
               ++ LR ++  NNSFSGPIP+F+KL  +KSL +  NRFSG I  D+F+ +  L+KLWLS
Sbjct  90    VEIRSLRTLSFINNSFSGPIPNFNKLGSIKSLLLTQNRFSGTIPTDFFSTLNSLKKLWLS  149

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N FSG IP SL +L  L ELHLE N FS  +P   Q  L  LDLS NKLQG IP  +AR
Sbjct  150   GNNFSGEIPQSLTQLKLLKELHLEYNSFSGQIPNFNQ-DLKSLDLSNNKLQGAIPVSLAR  208

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivagll  1007
             FG  +F GN  LCG+P+ + C +D   DG       +  N +++ +     ++ I+   +
Sbjct  209   FGPNSFAGNEGLCGKPLEKTCGDD---DGSSLFSLLSNVNEEKYDTSWATKVIVILVIAV  265

Query  1008  lvailF------NKNQNEENVKTR-RKDNLDEVLVVQIASMARSESINHssrrststegs  1166
             + A++F       +   E  V +R R ++ +EVL+VQ+ SM                +  
Sbjct  266   VAAMIFLFVKRSRRGDGELRVVSRSRSNSTEEVLMVQVPSM---------RGGVGDKKKE  316

Query  1167  ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNK  1346
              ++ GD V+VNEERG+FGL +LM ASAEVLGNGGLGS YKA +   GL VVVKR++E NK
Sbjct  317   GNKRGDIVMVNEERGVFGLQDLMKASAEVLGNGGLGSMYKAMMGT-GLCVVVKRMREMNK  375

Query  1347  MNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHND  1526
             + KD FDAEMR+ G +RH NI+  LAYHYR++EKL ++E+ PKGSLLY+LHGDRGT+H++
Sbjct  376   IGKDVFDAEMRQFGRIRHRNIITPLAYHYRREEKLFITEYMPKGSLLYVLHGDRGTSHSE  435

Query  1527  LKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
             L   TR+ I+KG+A G+++L++EF+TY LPHGNLKSSN+LLT  YEPLL+DYAF PL++ 
Sbjct  436   LTWPTRLNIVKGIARGLKFLYSEFSTYDLPHGNLKSSNVLLTDDYEPLLSDYAFQPLINP  495

Query  1707  TPTLQCMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWV  1877
               ++Q +FA K+P   +  ++S K+DVYCLG++ILE++TGKFPSQY SN KGGTDVVQW 
Sbjct  496   KVSVQALFAFKSPDFVQNQKVSQKTDVYCLGVIILEIITGKFPSQYHSNGKGGTDVVQWA  555

Query  1878  RQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
               A+++G E+E+ID E+     +S   M+ LL IGA C ES+ E+RL+MKEA++RI E+Q
Sbjct  556   FTAISEGTEAELIDSELPNDA-NSRKNMLHLLHIGACCAESNPEQRLNMKEAVRRIEEVQ  614



>ref|XP_010049389.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Eucalyptus grandis]
Length=626

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/620 (48%), Positives = 420/620 (68%), Gaps = 21/620 (3%)
 Frame = +3

Query  237   LILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTG  416
             LI+    LS+S  +D  L++FK SL N   LD +W  G  PC+    W G++C    +TG
Sbjct  14    LIISFTKLSLSAPEDA-LLQFKRSLGNADALD-SWAPGSHPCNG---WIGIICFDGIITG  68

Query  417   LRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEI  596
             L L +MGL+G ID+DAL +L+GLR ++  NN F+GP+P+F++L  +KSL +  N+FSGEI
Sbjct  69    LHLSDMGLSGKIDIDALQSLRGLRTLSFVNNVFAGPMPEFNRLGAIKSLLLSRNKFSGEI  128

Query  597   SADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTIL  776
             S+++F  M  L+K+WL+ N FSGNIP SL +L  L+ELHLEGN FS  +P +    LT L
Sbjct  129   SSNFFQHMASLKKIWLADNNFSGNIPESLMQLANLMELHLEGNEFSGRIPVIKHEKLTSL  188

Query  777   DLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC--REDLGKDGGGGAEAQTPENA  950
             DLS NKL+GEIP  +++F +K+FEGNP LCG+P+ + C  +E    D       Q P   
Sbjct  189   DLSDNKLEGEIPESLSKFNSKSFEGNPGLCGKPLDKVCPGKETPSTDTTTVKPPQPPPPV  248

Query  951   QRHSSGMR-----WlllsivaglllvailF-NKNQNEENVKTRRKDNLDEVLVVQIASM-  1109
                 S  R     W +  +VA  +L+  +  ++ + +++     +DN+ E + V I+ + 
Sbjct  249   NEQKSSERLSIILWTVAGLVAAGVLLTAIVSSRRRRDDDFSILGRDNVREAVQVPISGVK  308

Query  1110  -ARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
               R+ S +         + S    G+ +++++E+G FGL++LM ASAEVLGNGGLG AYK
Sbjct  309   PVRTGS-SRKGSSKRKAQSSKHGLGNLMMLSDEKGEFGLADLMRASAEVLGNGGLGCAYK  367

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   G +VVVKR++E N ++KD FDAE+R+   LRH NIL  LAYHYR+ EKL+VSE+
Sbjct  368   AVMSN-GQSVVVKRMREMNALDKDEFDAEIRRFAGLRHPNILTPLAYHYRRDEKLLVSEY  426

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              P GSLLY+LHGDRG +H +L   TR+KI+KGVASG+ +LH+E A+Y LPHGNLKSSNIL
Sbjct  427   IPMGSLLYILHGDRGISHRELNWPTRLKIVKGVASGLAFLHSELASYDLPHGNLKSSNIL  486

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTG  1817
             L+  YEPLL DY FH L++ +   Q +FA KAPE  Q   IS K DVYCLG++ILEV+ G
Sbjct  487   LSSDYEPLLNDYGFHHLINPSQAAQTLFAYKAPEISQQGSISPKCDVYCLGLIILEVLMG  546

Query  1818  KFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTE  1997
             K PSQY+S+ K GTDVV  V  A+++ +E+EVIDPE+AG+ E S  +M++LL IGAACTE
Sbjct  547   KLPSQYISSGKSGTDVVMLVHSAISEEREAEVIDPEMAGSTE-SKSEMLQLLHIGAACTE  605

Query  1998  SDVEKRLSMKEAIKRIREIQ  2057
              + + RL ++EAI+++ E+Q
Sbjct  606   KNPDHRLDLREAIRKLEELQ  625



>ref|XP_004236378.2| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Solanum lycopersicum]
Length=662

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/616 (47%), Positives = 413/616 (67%), Gaps = 10/616 (2%)
 Frame = +3

Query  234   CLILQCL-PLSI-SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKT  407
             C++L  + P+ I SV D   L++ K+S  N   L+ +W  G  PCDK  RW GV C +K 
Sbjct  5     CIVLLMIYPVKIISVSDTDALLKLKQSFTNAASLE-SWKPGTDPCDKNIRWLGVFCQKKI  63

Query  408   VTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFS  587
             VTGL L    L+G IDV+ALS + GLR ++  +N FSGP+P+F+++  LK L++  N+FS
Sbjct  64    VTGLLLAETNLSGIIDVEALSQMPGLRTLSFQSNLFSGPMPEFNRMGALKGLYLSENQFS  123

Query  588   GEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-QRS  764
             GEI ++YFAKM  L+KLWLS N FSG IPASL +L  L+ELHLE N F+  +PP++ Q +
Sbjct  124   GEIPSNYFAKMLSLKKLWLSDNKFSGEIPASLMELQYLIELHLENNQFTGPIPPMSKQST  183

Query  765   LTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPE  944
             L  +D S N L+GEIP  ++RF   +F+GN ELCGE +G+ C +    D       Q   
Sbjct  184   LESIDFSNNNLKGEIPVSLSRFNESSFKGNSELCGEKLGKPCDQATNSDNTNNNGTQQSP  243

Query  945   NAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE-VLVVQIASMAR-S  1118
             ++  + S   W+++S+V  LL+V I+       +  +    ++ DE  L  +I+S ++ S
Sbjct  244   DSNSNKSISMWIVISLVVLLLIVIIVIYLICRYQQSRRASIESFDEPSLGRRISSDSKKS  303

Query  1119  ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALP  1298
               ++              R GD  +VN+++G FGL++LM A+AEVLGNG LGS+YKA + 
Sbjct  304   FELSRRGSSIRKGSIMGKRVGDLTMVNDDKGEFGLADLMKAAAEVLGNGPLGSSYKAMMS  363

Query  1299  VIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKG  1478
               GLTVVVKR+KE NK+ K+ FDAE++++G LRH NIL LLAYH+RK+EKL V E+ PKG
Sbjct  364   N-GLTVVVKRIKEMNKIGKEGFDAEVKRLGSLRHKNILTLLAYHHRKEEKLFVYEYIPKG  422

Query  1479  SLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPT  1658
             SLLY+LHG+RG  H +L    R+KII+GVA G+ YLHTE A+  LPHG+LKSSNIL+   
Sbjct  423   SLLYVLHGERGLPHAELTWPVRLKIIQGVAQGLNYLHTELASSDLPHGDLKSSNILINTN  482

Query  1659  YEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPS  1829
             +EP+LT Y F  L++    +Q + A K+PE    +Q++ K DVYCLGIVILE++TGK+PS
Sbjct  483   HEPILTGYGFCTLMNNAHAVQALIAFKSPEAVQNNQVTPKCDVYCLGIVILEIITGKYPS  542

Query  1830  QYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVE  2009
              YL+  KGG D+ QW + A+A+G+E+E+ DP+I  + +DS   + +L+ I AAC ES+ +
Sbjct  543   IYLNAGKGGIDIAQWAKSAIAEGREAELCDPDITASAKDSMSSIKELIHISAACVESNPQ  602

Query  2010  KRLSMKEAIKRIREIQ  2057
             +R+S++E I+RI EIQ
Sbjct  603   QRISIREVIRRIEEIQ  618



>ref|XP_011079548.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Sesamum indicum]
Length=674

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/638 (47%), Positives = 409/638 (64%), Gaps = 37/638 (6%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             IFF +  +L    ++ SV +   L++ K S  N   LD +W  G  PC K + W GV+C 
Sbjct  11    IFF-YVFLLNFPIITSSVSESEALLKLKGSFTNATALD-SWRPGTEPCAKVKPWVGVICD  68

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
                V+ LRL N+GL+G ID++AL++L GLR I   +N+FSGPIP+F ++  LK+LF+  N
Sbjct  69    NTVVSALRLGNLGLSGTIDIEALASLSGLRSIGFMSNAFSGPIPEFHRMGALKALFLSKN  128

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             +FSGEI  DYF K+ GL+K+WLS N FSG IP+SLG+L  L+ELHLE N FS  +P L Q
Sbjct  129   QFSGEIPTDYFTKLLGLKKVWLSGNRFSGPIPSSLGQLSHLMELHLEDNQFSGPIPSLVQ  188

Query  759   RSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQT  938
             +SL  LDLS N L+G+IPS MA+F A AF+GNP LCG  +G+ C   +       +    
Sbjct  189   QSLISLDLSNNDLEGQIPSSMAKFPANAFKGNPGLCGGSLGKPCNTSVQS-----SNIIA  243

Query  939   PENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS  1118
               N  R +  +  L+ S V  LL+ A +F        V  +R+D  D  LV++ +    +
Sbjct  244   ENNGPRRTIFIWVLVASAVLFLLMAAGIF--------VLKQRQDRFD--LVIEDSPSISA  293

Query  1119  ESI---------------NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEV  1253
              SI               +        +   +   GD V++N E+G FGL+++M A+AEV
Sbjct  294   SSIRKKDFDTGRDGLGSGHRIGSSQKGSSRFARGVGDIVMLNYEKGEFGLADMMRAAAEV  353

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LGNG LGS+YKA +   GLTVVVKR+KE  KM +D FDAEMRK+  L H N+LP LAYHY
Sbjct  354   LGNGSLGSSYKATM-ASGLTVVVKRVKEIPKMGRDHFDAEMRKLASLNHENVLPPLAYHY  412

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
             RK EKL V E+ PKGSLL+LLHGDRG AH  L    R+KII+G+A G+ YLH+E +   L
Sbjct  413   RKDEKLFVYEYQPKGSLLFLLHGDRGVAHAQLTWPVRLKIIQGIARGLGYLHSELSLLDL  472

Query  1614  PHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYC  1784
             PHG+LKSSN+LLTP +EPLLTDY F  LVS +   Q + A K+PE    H IS K DV+C
Sbjct  473   PHGDLKSSNVLLTPGFEPLLTDYGFCALVSSSHAAQALAAYKSPEAALDHSISPKCDVFC  532

Query  1785  LGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV  1964
             LG++ILE++TGKFPS  LSN +GGTD+VQWVR A ++G+E+++ DP+I    +    +M 
Sbjct  533   LGVIILEILTGKFPSHNLSNGEGGTDLVQWVRLAASEGREADLFDPDIMST-KAIIHQME  591

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
             +LL IG ACT+S+ + RL + EAI RI  ++ V+  ++
Sbjct  592   QLLHIGVACTQSNPDHRLDLAEAISRIEGLKPVDTSYQ  629



>ref|XP_003548370.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=672

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/630 (46%), Positives = 408/630 (65%), Gaps = 19/630 (3%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             +I     +I+  LP   S+ +   L+  K S  N + L DTWV G +PC +  +W GV C
Sbjct  7     IILQPTLIIIVTLPAIYSMTEAEALVSLKSSFSNPE-LLDTWVPGSAPCSEEDQWEGVAC  65

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
             +   VTGLRL  +GLAG+I VD L  L+GLR I+L NN+FSG +P+F ++  LK+L++QG
Sbjct  66    NNGVVTGLRLGGIGLAGEIHVDPLLELKGLRTISLNNNAFSGSMPEFHRIGFLKALYLQG  125

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N+FSG+I  DYF +M  L+KLWL+ N F+G IP+SL ++P+L+ELHLE N F   +P L+
Sbjct  126   NKFSGDIPMDYFQRMRSLKKLWLADNQFTGKIPSSLVEIPQLMELHLENNQFVGNIPDLS  185

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQ  935
               SL   ++S NKL+G IP+G+ RF   +F GN  LC E +G+ C + +           
Sbjct  186   NPSLVKFNVSNNKLEGGIPAGLLRFNVSSFSGNSGLCDEKLGKSCEKTMEPPSPSPIVGD  245

Query  936   TPENAQRHSSGMRWlllsivaglllvailF----NKNQNEENVKTRRKDNLDEVLVVQIA  1103
                +    SS      + + +  L+  ++F    ++ + EEN  T  ++  +  + VQ+ 
Sbjct  246   DVPSVPHRSSSFEVAGIILASVFLVSLVVFLIVRSRRKKEENFGTVGQEANEGSVEVQVT  305

Query  1104  SMAR---------SESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVL  1256
             +  +         S  +  SS R       S   G+ V+VN E+G+FG+ +LM A+AEVL
Sbjct  306   APVKRDLDTASTSSTPVKKSSSRRGCISSQSKNAGELVMVNNEKGVFGMPDLMRAAAEVL  365

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             GNG  GS+YKA L   G+ VVVKR +E N + KD FDAEMRK+ ML+H NIL  LAYH+R
Sbjct  366   GNGSFGSSYKAVL-ANGVAVVVKRTREMNVLEKDDFDAEMRKLTMLKHWNILTPLAYHFR  424

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             K EKLV+SE+ P+GSLL+ LHGDRG +H +L    R+KI++G+A GM YL+T   +  LP
Sbjct  425   KDEKLVISEYVPRGSLLFSLHGDRGASHVELDWPARLKIVRGIAQGMHYLYTVLGSSDLP  484

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QISHKSDVYCL  1787
             HGNLKSSN+LL P  EP+L DY F  +V+ +   Q +FA KAPE     Q+S   DVYCL
Sbjct  485   HGNLKSSNVLLGPDNEPMLVDYGFSHMVNPSTIAQTLFAYKAPEAAQQGQVSRSCDVYCL  544

Query  1788  GIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             G+VI+E++TG+FPSQYLSN KGG DVVQWV  A+++G+ESEV+DPEIAG+  +  G+M +
Sbjct  545   GVVIIEILTGRFPSQYLSNGKGGADVVQWVETAISEGRESEVLDPEIAGS-RNWLGEMEQ  603

Query  1968  LLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             LL IGAACTES+ + RL M EA++RI EI+
Sbjct  604   LLHIGAACTESNPQWRLDMAEAVRRIMEIK  633



>ref|XP_007135416.1| hypothetical protein PHAVU_010G127500g [Phaseolus vulgaris]
 gb|ESW07410.1| hypothetical protein PHAVU_010G127500g [Phaseolus vulgaris]
Length=741

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/648 (47%), Positives = 411/648 (63%), Gaps = 44/648 (7%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             +I     +I+  LP+  S+ +   L+  K +  N + LD  WV   +PC    +W G+LC
Sbjct  47    IILHPTLIIIVTLPVIYSMTEAEALVSLKRTFSNAELLDG-WVADSAPCSVEDQWEGILC  105

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
             +   VTGLRL  +GL G+I VD L  L+GLR I+L NNSFSG +P+F+++  LK+L++QG
Sbjct  106   NNGLVTGLRLGGIGLIGEITVDPLLELKGLRTISLNNNSFSGSMPEFNRIGFLKALYLQG  165

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N+FSG+I  +YF +M  L+K+WLS N F+G+IP SL ++P LVELHLE N FS  +P   
Sbjct  166   NKFSGDIPPEYFQRMKSLKKVWLSDNQFTGSIPNSLTEVPSLVELHLENNQFSGTIPDFN  225

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR--------------  893
               SL  LD+S NKL+GEIP+ + RF   +F GN  LCGE VG+ C               
Sbjct  226   NPSLEKLDVSNNKLKGEIPASLLRFSENSFSGNSGLCGERVGKPCEKPMETPSPAPMVAS  285

Query  894   --EDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailF--------NKNQNE  1043
               ED  +D GGG +A  P     H S   W +  I+ G +++  +          K + E
Sbjct  286   DAEDNAQDNGGG-DAHVP-----HKS-TSWEVTGIIIGSVVLVSIIVFCIVRTRRKKEEE  338

Query  1044  ENVKTRRKDNLDEVLVVQIASMAR-------SESINHssrrststegsssrggDFVLVNE  1202
             EN            + VQ+ +  +       S  +  SS R  ST   S   G+ V+VN+
Sbjct  339   ENFDIFGNYTNGGSVEVQVTAPVKRDMEASTSAPVKKSSSRRGSTSSQSKSVGELVMVND  398

Query  1203  ERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRK  1382
             E+G+FGL +LM A+AEVLGNG  GS+YKA +   G+ VVVKR +E N + KD FDAEMRK
Sbjct  399   EKGVFGLPDLMRAAAEVLGNGSFGSSYKAVM-ANGVAVVVKRTREINALEKDGFDAEMRK  457

Query  1383  MGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKG  1562
             +  L+H NIL  LAYH+RK+EKLV+SE+ P+GSLL+ LHGDRGT+H DL    RIKI+ G
Sbjct  458   LTALKHWNILTPLAYHFRKEEKLVISEYVPRGSLLFSLHGDRGTSHADLDWPARIKIVHG  517

Query  1563  VASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKA  1742
             +A GM YLH E  +  LPHGNLKSSN+LL P  E LL DY F  +V+ +   Q +FA +A
Sbjct  518   IAEGMSYLHRELGSSDLPHGNLKSSNVLLGPNNEALLVDYGFSNMVNPSNAAQTLFAFRA  577

Query  1743  PEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEV  1913
             PE    +QISH  DVYCLG+VILE++TGKFPSQYL   KGGTDVVQWV  A+++G+ESEV
Sbjct  578   PEAVQHNQISHSCDVYCLGVVILEILTGKFPSQYLITGKGGTDVVQWVETAISEGRESEV  637

Query  1914  IDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +DPEIA +     G+M KLL +G+ACTES+  +RL ++EA +RI EI+
Sbjct  638   VDPEIA-SSRKWVGEMKKLLHVGSACTESNPVQRLGLEEAFRRIEEIR  684



>ref|XP_007024676.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY27298.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=684

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/616 (49%), Positives = 409/616 (66%), Gaps = 32/616 (5%)
 Frame = +3

Query  261   SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGL  440
             + SV D   L+  K+S  N   LD +WV G +PC++   W G+LCH   VTGLRL  MGL
Sbjct  23    TFSVSDSEALLMLKKSFTNASALD-SWVPGSAPCNEEGTWNGLLCHNGIVTGLRLEGMGL  81

Query  441   AGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKM  620
             +G+IDVDAL  ++GLR  ++ NNSF+G IP+ ++L  LK+LF+  N FSGEI  +YFAKM
Sbjct  82    SGNIDVDALVWIKGLRSFSVINNSFTGTIPEINRLGALKALFLSRNLFSGEIPTEYFAKM  141

Query  621   TGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQ  800
               L+K+WLSHN F+GNIP SLG+LP L+++HLE N FS  +P     SL  ++LS NKL 
Sbjct  142   ESLKKVWLSHNKFTGNIPYSLGQLPHLIDVHLENNQFSGHIPAFNPPSLKSVNLSNNKLV  201

Query  801   GEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA--------QR  956
             GEIPS +++F A +F GNP LCGE VG  C + + +  G      +PEN         ++
Sbjct  202   GEIPSSLSKFNANSFAGNPGLCGEQVGVDCSKAIDRSPG---PMSSPENTAPVVQDHGRK  258

Query  957   HSSGMRWlllsivaglllvailF------NKNQNEENVKTRRKDNLDEVLVVQIASMARS  1118
             + S      +  +  +LL  ILF       K + + +V  R     D  + VQ++  AR 
Sbjct  259   NDSKKIIAAIITLGVMLLSVILFFAIRWRKKKKGDSDVLGRGSP--DGAVSVQVSVPARR  316

Query  1119  E------SINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSA  1280
             E      + + S R S   +GS+    + V+VN+E+G+FGL +LM A+AEVLG GGLGS+
Sbjct  317   EMEESRKNASSSRRGSNHAKGSAGVVAELVMVNDEKGVFGLPDLMKAAAEVLGVGGLGSS  376

Query  1281  YKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVS  1460
             YKA +   G+ VV KR++E N + KDAFD ++RK+G LRH NIL  LAYHYRK EKL V 
Sbjct  377   YKAVM-ANGVAVVAKRMREMNALGKDAFDTDVRKLGKLRHPNILTPLAYHYRKDEKLFVY  435

Query  1461  EFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSN  1640
             E+ PKGSLLYLLHGD GT+  +L    R+KI++G+A G++YLHTE A+  +PHGNLKSSN
Sbjct  436   EYLPKGSLLYLLHGDHGTSCLELDWPARLKIVQGIAQGLDYLHTELASLDVPHGNLKSSN  495

Query  1641  ILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVV  1811
             +LL P   P L+DY F PLV+ T   Q +FA K PE  Q   +S KSDVYCLGI+ILE++
Sbjct  496   VLLGPDNHPFLSDYGFWPLVN-TNGAQALFAYKTPEALQHGMVSPKSDVYCLGIIILEIL  554

Query  1812  TGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAAC  1991
             TGKFPSQYLS+ KGGTDVVQWV  A ++G+++E++DPEIA   ++S   M KLL IG  C
Sbjct  555   TGKFPSQYLSDGKGGTDVVQWVTSAFSEGRQAELLDPEIA-CCQNSLASMEKLLHIGLLC  613

Query  1992  TESDVEKRLSMKEAIK  2039
             T++  ++RL MKEAI+
Sbjct  614   TQNSPDQRLDMKEAIR  629



>ref|XP_010687545.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Beta vulgaris subsp. vulgaris]
Length=643

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/642 (47%), Positives = 420/642 (65%), Gaps = 57/642 (9%)
 Frame = +3

Query  249   CLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK---TVTGL  419
             CL   +S+ +   L+ FK+S+ N + LD +W     PC    +W GV C  +    V  L
Sbjct  19    CL---LSMSEAEALLAFKKSMSNAESLD-SWKPNSDPCKD--KWEGVFCDEEGKGVVIRL  72

Query  420   RLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEIS  599
              L  M L+G IDV+ ++ ++ L+ ++L+NN+F G +P F+ L+ L++L++  N+FSGEI 
Sbjct  73    HLTKMSLSGTIDVNTITQIKNLKTLSLSNNTFEGALPPFNMLKGLRALYVSSNKFSGEIP  132

Query  600   ADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILD  779
              DYFA    LR++WLS N FSG IP SLGK+  L+ LHLE N F  A+P ++Q SLT LD
Sbjct  133   GDYFADSI-LRRIWLSDNEFSGKIPYSLGKVHGLMALHLERNKFIGAIPEISQESLTELD  191

Query  780   LSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRH  959
             +SGN+L+G+IP+ M RFGA AF+ N  LCG+PV ++C    GK  GG  +          
Sbjct  192   MSGNQLEGQIPASMERFGADAFKDNSGLCGKPVSKECVN--GKKTGGNVKVTI-------  242

Query  960   SSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS-----ES  1124
             +  +  +++  +  LL   I    NQ+EE      K++ ++V+ V++   A++      S
Sbjct  243   AIMIGIVVIMALLLLLSALIKSKNNQHEEEFDVLNKESAEDVVEVRVHGNAKTGGGSTRS  302

Query  1125  IN----------------------------HssrrststegsssrggDFVLVNEERGMFG  1220
              N                            H S+++ S +G ++  GD +++N+E+G FG
Sbjct  303   QNGGGGGGSVGGGSSRKSSTNDSSSHKKGEHGSKKAGSQQGKNAGMGDLIVINDEKGSFG  362

Query  1221  LSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRH  1400
             L++LM ASAEVLGNG LGSAYKA +   G++VVVKR+++ N++ KD FDAE+R++G  RH
Sbjct  363   LADLMKASAEVLGNGALGSAYKAVMSN-GVSVVVKRIRDMNQLGKDEFDAEIRRIGKFRH  421

Query  1401  HNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGME  1580
              NIL  LAYHYRK+EKLVVSE+ PKGSLLY+LHGDRG +H +L   TR+KIIKG+ASG++
Sbjct  422   KNILTPLAYHYRKEEKLVVSEYVPKGSLLYVLHGDRGISHAELNWPTRLKIIKGIASGLQ  481

Query  1581  YLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---EG  1751
             YL+ E + Y+LPHGNLKSSNI L   YEP+L+DY F  +V+ T   Q MFA K+P   E 
Sbjct  482   YLYAELSDYELPHGNLKSSNIFLGSNYEPILSDYGFFRMVTTTQAAQGMFAYKSPESVES  541

Query  1752  HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIA  1931
              Q+S K DVYCLGIVILEV+TGKFPSQYL+  KGGT+VVQWVR A+ + KE+E +DPEIA
Sbjct  542   QQVSSKGDVYCLGIVILEVLTGKFPSQYLNTGKGGTNVVQWVRSAIEEKKEAEFLDPEIA  601

Query  1932  GAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
                 D+   M +LL++GA+CTE++  KR SM++AIKRI EIQ
Sbjct  602   ST-TDALEAMTRLLRLGASCTETETNKRPSMEDAIKRIEEIQ  642



>ref|XP_003529841.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Glycine max]
Length=681

 Score =   546 bits (1407),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 293/628 (47%), Positives = 408/628 (65%), Gaps = 29/628 (5%)
 Frame = +3

Query  249   CLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLY  428
              LP+  S+ +   L+ FK S  N + LD +WV G +PC +  +W GV C+   VTGLRL 
Sbjct  18    TLPVIYSMTEAEALVSFKSSFSNAELLD-SWVPGSAPCSEEDQWEGVTCNNGVVTGLRLG  76

Query  429   NMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADY  608
              MGL G+I VD L  L+GLR I+L +NSFSGP+P+F+++  LK+L++QGN+FSG+I  +Y
Sbjct  77    GMGLVGEIHVDPLLELKGLRQISLNDNSFSGPMPEFNRIGFLKALYLQGNKFSGDIPTEY  136

Query  609   FAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSG  788
             F KM  L+K+WLS N F+G IP+SL  +P+L+ELHLE N FS  +P L+  SL I D+S 
Sbjct  137   FQKMRSLKKVWLSDNLFTGKIPSSLADIPQLMELHLENNQFSGNIPDLSNPSLAIFDVSN  196

Query  789   NKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE-AQTPENAQRHSS  965
             NKL+G IP+G+ RF   +F GN  LC E + + C + +     G  + AQ         S
Sbjct  197   NKLEGGIPAGLLRFNDSSFSGNSGLCDEKLRKSCEKTMETPSPGPIDDAQDKVVGDHVPS  256

Query  966   GMRWlllsivaglllvailFNKNQNEENVKTRRK---DNLDEVLVVQI------------  1100
                      VAG+++ ++          V++RRK   +N D ++  Q+            
Sbjct  257   VPHSSSSFEVAGIIVASVFLVSLVVLLIVRSRRKKEEENFDHIVGQQVNEGGAVEVQVTA  316

Query  1101  -------ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG  1259
                    A+   S  +  +S R  S    S   G+ V VN+E+G+FG+S+LM A+AEVLG
Sbjct  317   PVKRVLDAASTSSTPMKKTSSRRGSISSQSKNVGELVTVNDEKGVFGMSDLMRAAAEVLG  376

Query  1260  NGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRK  1439
             NG  GS+YKA +   G+ VVVKR +E N + KD FDAEMRK+  L+H NIL  LAYH+RK
Sbjct  377   NGSFGSSYKAVM-ANGVAVVVKRTREMNVLEKDDFDAEMRKLTKLKHWNILTPLAYHFRK  435

Query  1440  QEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPH  1619
              EKLV+SE+ P+GSLL+ LHGDR  +H +L    R+KI++G+A GM YL+TE ++  LPH
Sbjct  436   DEKLVISEYVPRGSLLFSLHGDRRPSHAELDWPARMKIVRGIAEGMHYLYTELSSLDLPH  495

Query  1620  GNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QISHKSDVYCLG  1790
             GNLKSSN+LL P  EP+L DY F  +V+ +     +FA KAPE     Q+S   DVYCLG
Sbjct  496   GNLKSSNVLLGPDNEPMLVDYGFSHMVNPSSAANTLFAYKAPEAAQHGQVSRSCDVYCLG  555

Query  1791  IVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKL  1970
             +VI+E++TGK+PSQYLSN KGG DVVQWV  A+++G+E+EV+DPEIA +  +  G+M +L
Sbjct  556   VVIIEILTGKYPSQYLSNGKGGADVVQWVETAISEGRETEVLDPEIA-SSRNWLGEMEQL  614

Query  1971  LQIGAACTESDVEKRLSMKEAIKRIREI  2054
             L IGAACT+S+ ++RL M EA++RI+EI
Sbjct  615   LHIGAACTQSNPQRRLDMGEAVRRIKEI  642



>ref|XP_011039958.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Populus euphratica]
Length=630

 Score =   544 bits (1402),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 312/635 (49%), Positives = 428/635 (67%), Gaps = 18/635 (3%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             MAAVR    F L   +F   L     S++  ++  L++ K S  N++ LDD W    SPC
Sbjct  1     MAAVRIRTVFVLSLLTFSFSLSKFAFSLT--ENEALLKVKSSFTNSEALDD-WDSRSSPC  57

Query  363   DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
                +RW G++C    +TGL L + GL+G ID++AL  L+ LR ++L NNSFSG IP+F+K
Sbjct  58    --VKRWAGIICFGGLITGLHLSDFGLSGTIDIEALQQLRALRTLSLKNNSFSGQIPEFNK  115

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             L  LK L +  N+FSG+I  D+F+ M  L+K+WLS+N F+GNIP SL  LP L+ELHLEG
Sbjct  116   LGALKLLLLSHNKFSGQIPNDFFSSMASLKKVWLSNNDFTGNIPVSLMSLPHLLELHLEG  175

Query  723   NGFSSAVPPLAQ-RSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
             N FS  +PPL +  ++T LDLS NKL+GEIP   ++F  ++F GN  LCG+ + R C   
Sbjct  176   NQFSGHIPPLKKPTTVTSLDLSHNKLEGEIPDSFSKFSNESFLGNDRLCGKQLDRDCSSV  235

Query  900   LGKDGGGGA--EAQTPENAQRHSS-GMRWlllsivaglllvailFNKNQNEENVKTRRKD  1070
             + +        E +   N+  H+   +   +L ++  L++ A    K   +++     K+
Sbjct  236   VAESLPQPVIEEKKESANSDGHTKLAIGIGILVVMGILIIAAFTGRKKDKDDDFSILEKE  295

Query  1071  NLDEVLVVQIASMAR----SESINHssrrststegsssrggDFVLVNEERGMFGLSELMM  1238
               +E++ V++ S+ +    S      S R  S+ GS +  GD +++N+E+G FGL +LM 
Sbjct  296   TPNEMIPVRVRSIKKPAEGSTRRGLDSSRKGSSHGSKNGMGDLIMINDEKGAFGLPDLMK  355

Query  1239  ASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPL  1418
             A+AEVLGNGGLGSAYKA +   GL+VVVKR++E NK+ +D FDAEMR+ G ++H NIL  
Sbjct  356   AAAEVLGNGGLGSAYKAVM-TNGLSVVVKRMREMNKLGRDGFDAEMRRFGRIKHKNILAP  414

Query  1419  LAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEF  1598
             LAYHYRK+EKL+VSE+ PKGSLLY+LHGDRGT H DL  ATR+KIIKG++S + +LH+E+
Sbjct  415   LAYHYRKEEKLLVSEYVPKGSLLYVLHGDRGTCHADLNWATRLKIIKGISSALGFLHSEY  474

Query  1599  ATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHK  1769
             ATY LPHGNLKSSN+LL+  YEPL+ DYA  PL +     Q MFA K+PE     QIS K
Sbjct  475   ATYDLPHGNLKSSNVLLSENYEPLIIDYALDPLTNPNHAAQAMFAYKSPEYIQHQQISPK  534

Query  1770  SDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDS  1949
             SDVYCLGI+ILE++TGKFPSQYL+N KGGTDVVQWV QA ++ +E ++IDPEIA +    
Sbjct  535   SDVYCLGIIILEIITGKFPSQYLANGKGGTDVVQWVLQASSEQREQDLIDPEIANSTSSI  594

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             D +MV+LL+IGA C ES   +RL  +EAI+RI +I
Sbjct  595   D-QMVQLLRIGATCIESSPVQRLDTREAIRRIEQI  628



>ref|XP_006343125.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Solanum tuberosum]
Length=675

 Score =   542 bits (1397),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 280/610 (46%), Positives = 406/610 (67%), Gaps = 14/610 (2%)
 Frame = +3

Query  264   ISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLA  443
             ISV D   L++ K+S  N   L+ +W  G  PCDK  RW GV C +K VTGL L    L+
Sbjct  26    ISVSDTDALLKLKQSFTNAASLE-SWKPGTDPCDKNIRWLGVFCQKKMVTGLLLAETNLS  84

Query  444   GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
             G IDV+ALS +  LR ++  +N FSGPIP+F+++  LK L++  N+FSGEI ++YF KM 
Sbjct  85    GIIDVEALSQMPALRTLSFQSNLFSGPIPEFNRMGALKGLYLSENQFSGEIPSNYFEKML  144

Query  624   GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-QRSLTILDLSGNKLQ  800
              L+KLWLS N FSG IP+SL +L  L+ELHLE N F+  +PP++ Q +L  +DLS N L+
Sbjct  145   SLKKLWLSDNKFSGEIPSSLMELQYLIELHLENNQFTGPIPPISKQSTLESIDLSNNNLK  204

Query  801   GEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEA-------QTPENAQRH  959
             GEIP  ++RF   +F+GN ELCGE +G+ C   +                 Q+P++    
Sbjct  205   GEIPVSLSRFNESSFKGNSELCGEKLGKACNPTINSSNDNNTNNNANNGTQQSPDSNSNK  264

Query  960   SSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMAR-SESINHs  1136
             S  M  ++ S+V  L+++ +++   + ++N +   +   +  L  +I+S ++ S  ++  
Sbjct  265   SISMWIMISSVVLLLIMIIVIYLICRYQQNRRASIESFDEPSLGRRISSDSKKSFELSRR  324

Query  1137  srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTV  1316
                         R GD  +VN+++G FGL++LM A+AEVLGNG LGS+YKA +   GLTV
Sbjct  325   GSSIRKGSIMGKRVGDLTMVNDDKGEFGLADLMKAAAEVLGNGPLGSSYKAMMSN-GLTV  383

Query  1317  VVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLL  1496
             VVKR+KE NK+ KD FDAE++++G LRH NIL LLAYH+RK+EKL V E+ PKGSLLY+L
Sbjct  384   VVKRIKEMNKIGKDGFDAEVKRLGRLRHKNILTLLAYHHRKEEKLFVYEYIPKGSLLYIL  443

Query  1497  HGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLT  1676
             HG+RG  H +L    R+ II+GVA G+ YLHTE A+  LPHG+LKSSNIL++  +EP+LT
Sbjct  444   HGERGLPHAELTWPVRLNIIQGVAEGLNYLHTELASSDLPHGDLKSSNILISTNHEPILT  503

Query  1677  DYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQ  1847
              Y F  L++    +Q + A K+PE    +Q++ K DVYCLGIVILE++TGK+PS YL+  
Sbjct  504   GYGFCTLMNNAHAVQALIAFKSPEAVQNNQVTPKCDVYCLGIVILEIITGKYPSIYLNTG  563

Query  1848  KGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMK  2027
             KGG D+ QW + A+A+G+E+E+ DP+I  + +DS   + +L+ I AAC ES+ ++R++++
Sbjct  564   KGGIDIAQWAKSAIAEGRETELCDPDIIASAKDSMSSIKELIHISAACVESNPQQRINIR  623

Query  2028  EAIKRIREIQ  2057
             E I+RI EIQ
Sbjct  624   EVIRRIEEIQ  633



>ref|XP_009622140.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana tomentosiformis]
Length=655

 Score =   539 bits (1389),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 291/622 (47%), Positives = 400/622 (64%), Gaps = 30/622 (5%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             MA + R      +     LI   +P SISV     L++ K+S  N + LD +W  G  PC
Sbjct  1     MANIFRFMIKTCLICIVSLINYPVP-SISVTHTEALLKLKQSFTNAESLD-SWKIGSDPC  58

Query  363   DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
             DK  RW GV+C  + V  + L  M L+G+IDVD+LS L GLR ++  +NSFSGPIP+F++
Sbjct  59    DKNNRWVGVICQNQIVRSVLLGRMNLSGNIDVDSLSQLPGLRTLSFRSNSFSGPIPEFNR  118

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             +  LK L++  N+FSGEI ++YF KM  L+KLWLS N F+G IP+S+ +L  L+ELHLE 
Sbjct  119   MGALKGLYLSANQFSGEIPSNYFDKMQSLKKLWLSGNKFTGEIPSSILELYHLIELHLEN  178

Query  723   NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
             N FS  +P L Q +L  LDLS N  +GEIP  ++RF A +F+GN ELCGE +G+ C +  
Sbjct  179   NQFSGPIPTLNQSTLLSLDLSNNNFKGEIPESLSRFNASSFKGNAELCGEKLGKACDQAA  238

Query  903   GKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailF--NKNQN--------EENV  1052
                       ++  N+ +  S    +   ++  +++V I F   + QN        EE  
Sbjct  239   NNSNNNSTNNKSHGNSNKSISIWVMIASIVLLLIMIVGIYFMCRRQQNRRAAIESFEEPS  298

Query  1053  KTRR--KDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLS  1226
               RR   D+     + +  S  R  SIN              R GD  +VN+++G FGL+
Sbjct  299   LGRRISSDSKKSFELSRRGSSIRKGSIN------------GKRVGDLTMVNDDKGEFGLA  346

Query  1227  ELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHN  1406
             +LM A+AEVLGNG LGS+YKA +   GLTVVVKR+KE NK+ KD FDAE+R++G LRH N
Sbjct  347   DLMKAAAEVLGNGPLGSSYKAMM-ANGLTVVVKRIKEMNKIGKDGFDAEVRRLGRLRHEN  405

Query  1407  ILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYL  1586
             IL LLAYHYRK+EKL V E+ PKGSLL+LLHGDRG  H +L    R+KI++G+A G+ YL
Sbjct  406   ILTLLAYHYRKEEKLFVYEYIPKGSLLFLLHGDRGIPHAELTWPVRLKIVQGIAQGLSYL  465

Query  1587  HTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQ  1757
             HTE ++  LPHG+LKSSNIL+   +EP+LT Y F+ L++     Q + A K+ E    HQ
Sbjct  466   HTELSSSDLPHGDLKSSNILINTDHEPILTGYGFYTLINNAHAAQALIAFKSSEAVQNHQ  525

Query  1758  ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGA  1937
             ++ KSDVYCLGIVILE++TGKFPSQYL+  KGG D+VQWV+ A+ +G+E+E+ DP+I  +
Sbjct  526   VTPKSDVYCLGIVILEILTGKFPSQYLNTGKGGIDIVQWVKSAIGEGREAELYDPDIMAS  585

Query  1938  GEDSDGKMVKLLQIGAACTESD  2003
              ++S  +M +LL IGAAC ES+
Sbjct  586   AKNSTSQMKELLHIGAACVESN  607



>ref|XP_006381598.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP59395.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=630

 Score =   534 bits (1376),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 303/609 (50%), Positives = 413/609 (68%), Gaps = 16/609 (3%)
 Frame = +3

Query  261   SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGL  440
             + S+ ++  L++ K S  N + LDD W    SPC   +RW G++C    +TGL L + GL
Sbjct  25    AFSLTENEALLKVKSSFTNAEALDD-WDSRSSPC--VKRWAGIICFGGLITGLHLSDFGL  81

Query  441   AGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKM  620
             +G ID++AL  L+ LR ++L NNSFSG IP F+KL  LK L +  N+FSG+I  D+F+ M
Sbjct  82    SGTIDIEALQQLRALRTLSLKNNSFSGQIPAFNKLGALKLLLLSHNKFSGQIPNDFFSSM  141

Query  621   TGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ-RSLTILDLSGNKL  797
               L+K+WLS+N F+GNIP SL  LP L+ELHLEGN FS  +PPL +  S+T LDLS NKL
Sbjct  142   ASLKKVWLSNNDFTGNIPVSLMSLPHLLELHLEGNQFSGHIPPLKKPTSVTSLDLSHNKL  201

Query  798   QGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHS-SGMR  974
             +GEIP   ++F  ++F GN  LCG+ + R C   + +     A  +  E+A   S + + 
Sbjct  202   EGEIPDSFSKFSNESFLGNDRLCGKQLDRDCSSMVAESLPQPAVEEKKESANSDSHTKLA  261

Query  975   WlllsivaglllvailFN--KNQNEENVKTRRKDNLDEVLVVQIASMAR----SESINHs  1136
               +  +V   +L+   F   K   +++     K+  +E++ V++ S+ +    S      
Sbjct  262   IGIGVLVVMGILIIAAFTGRKKDTDDDFSILEKETPNEMIPVRVRSIKKPAEGSTRRGLD  321

Query  1137  srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTV  1316
             S R  S+ GS +  GD +++N+E+G FGL +LM A+AEVLGNGGLGSAYKA +   GL+V
Sbjct  322   SSRKGSSHGSKNGMGDLIMINDEKGAFGLPDLMKAAAEVLGNGGLGSAYKAVM-TNGLSV  380

Query  1317  VVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLL  1496
             VVKR++E NK+ +D FD EMR+ G ++H NIL  LAYHYRK+EKL+VSE+ PKGSLLY+L
Sbjct  381   VVKRMREMNKLGRDGFDVEMRRFGRIKHKNILAPLAYHYRKEEKLLVSEYVPKGSLLYVL  440

Query  1497  HGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLT  1676
             HGDRGT H DL   TR+KIIKG++S + +LH+E+ATY LPHGNLKSSN+LL+  YEPL+ 
Sbjct  441   HGDRGTCHADLNWPTRLKIIKGISSALGFLHSEYATYDLPHGNLKSSNVLLSENYEPLII  500

Query  1677  DYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQ  1847
             DYA  PL +     Q MFA K+PE     QIS KSDVYCLGI+ILE++TGKFPSQYL+N 
Sbjct  501   DYALDPLTNPNHAAQAMFAYKSPEYIQHQQISPKSDVYCLGIIILEIITGKFPSQYLTNG  560

Query  1848  KGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMK  2027
             KGGTDVVQWV QA ++ +E ++IDPEIA      D +MV+LL+IGA C ES   +RL  +
Sbjct  561   KGGTDVVQWVLQASSEQREQDLIDPEIANNTSSID-QMVQLLRIGATCIESSPVQRLDTR  619

Query  2028  EAIKRIREI  2054
             EAI+RI +I
Sbjct  620   EAIRRIEQI  628



>gb|KDP40674.1| hypothetical protein JCGZ_24673 [Jatropha curcas]
Length=702

 Score =   536 bits (1381),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 291/645 (45%), Positives = 417/645 (65%), Gaps = 30/645 (5%)
 Frame = +3

Query  189   AVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDK  368
             A+ R+     + F    ILQ    + S+     LI+FK+SL N   L  +W  G  PC  
Sbjct  2     ALNRLLRPIFLLFIVVFILQ-FDFTSSITQSEALIQFKDSLTNKTALS-SWTPGSFPC--  57

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             T +W G+LC    VTG+RL  MGL+G+ID++ALSN+  +R I+ A+NSFSGPIP+  +L 
Sbjct  58    THQWEGILCSNGIVTGIRLEKMGLSGNIDIEALSNMTKIRSISFAHNSFSGPIPELYRLD  117

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
             +LK++++ GN FSGEI +D+F KM  L+K+WLS N F+G IP+SL  L  L+ELHLE N 
Sbjct  118   YLKNIYLMGNEFSGEIPSDFFLKMHSLKKIWLSDNKFTGEIPSSLIYLTNLMELHLENNQ  177

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE----  896
             F+  +P +    L   ++S NKL+G+IP+G+ +F A +F+GN E CGE +G++C      
Sbjct  178   FTGTIPFVKHSRLQSFNVSNNKLRGQIPAGLLKFSASSFDGN-EFCGEKIGKECNRTADA  236

Query  897   --------DLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENV  1052
                              +      N ++  +G+  L   +++  ++V +   +++ E+++
Sbjct  237   LASATLPASFATTMSASSANNNVANFKKTGAGIITLGAMLLSVAIVVLLKMRRSK-EDDM  295

Query  1053  KTRRKDNLD--EVLVVQIASMARSESINHssrrststegsssrgg------DFVLVNEER  1208
             +   KDN D  E   VQ++   R + ++ + +   + +GS+S         + V+VN  +
Sbjct  296   EIHGKDNEDTIETADVQVSMPIRQKEMDFNRKSGAARKGSTSAPAKPNGLGELVVVNPVK  355

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
             G+FGL +LM ASAEVLGNG LGS+YKA +   G TVVVKRL+E N +  D FDAE+RK+ 
Sbjct  356   GVFGLIDLMKASAEVLGNGALGSSYKAVM-ANGATVVVKRLREMNALGNDKFDAEIRKLA  414

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              L+H NIL  LA+HYRK EKL++  F PKGSLLYLLHGDRG +H  L  A R+KI+KG+A
Sbjct  415   TLKHANILTPLAFHYRKDEKLLIYTFIPKGSLLYLLHGDRGPSHASLNWAARLKIVKGIA  474

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ Y+HTE  +  LPHGNLKSSN+L+ P  EPLL+++ F PL+S T   Q +FA KAPE
Sbjct  475   KGLGYIHTELTSCDLPHGNLKSSNVLIGPDNEPLLSEFGFSPLISPTVKEQALFAYKAPE  534

Query  1749  GHQ--ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDP  1922
               Q  +S + DVYCLG++ILE++TGK PSQ L+N K G D+VQWV  A+++G E+E++DP
Sbjct  535   VAQDGLSPQCDVYCLGVIILEIMTGKCPSQCLNNDKEGIDLVQWVETAISEGNETELLDP  594

Query  1923  EIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             EIAG+  +S  +M KLL IGA C E +  KRL ++EAIKRI EI+
Sbjct  595   EIAGS-TNSVEEMRKLLVIGALCAERNPTKRLDLREAIKRIEEIK  638



>ref|XP_007138639.1| hypothetical protein PHAVU_009G225700g [Phaseolus vulgaris]
 gb|ESW10633.1| hypothetical protein PHAVU_009G225700g [Phaseolus vulgaris]
Length=605

 Score =   531 bits (1368),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 287/598 (48%), Positives = 389/598 (65%), Gaps = 31/598 (5%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
             L+  K+SL N+     +W+   SPC  T  W GV+C    +TGL L ++GL+G IDV+AL
Sbjct  30    LLRLKQSLVNSDRSLSSWIPNVSPCSGT--WLGVVCFNGVITGLHLSDLGLSGPIDVNAL  87

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
             + ++GLR ++  NNSFSGP+P+F+KL  +KSL +  NRF G I  D+F+ +  L+KLWLS
Sbjct  88    AEIRGLRTLSFINNSFSGPMPEFNKLGSIKSLLLTQNRFYGPIPNDFFSPLKSLKKLWLS  147

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N FSG+IP SL +L  L ELHLE N FS  +P   Q  L  LDLS NKL+G IP  +A 
Sbjct  148   GNRFSGSIPQSLTRLELLKELHLEYNSFSGLIPDFGQ-GLKSLDLSFNKLEGPIPQNLAT  206

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivagll  1007
             F   +F GN  LCG+P+ + C                P N      G  W    IV  +L
Sbjct  207   FTVDSFVGNDALCGKPLVKACE-------ASTTSYSMPSNVGEEEYGSNWAKKVIVVLML  259

Query  1008  lvailF-----NKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsss  1172
              V          K +  +     R ++ DEV  VQ++S+  S             E   +
Sbjct  260   AVGAALMFLFLTKKRRGQFTAVSRSNSADEVREVQVSSVRGS-----------VGERREN  308

Query  1173  rggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMN  1352
             + GD V+VNE RG+FGL ++M A AEVLGNG LGSAYKA +   GL VVVKR++E NKM 
Sbjct  309   KRGDIVMVNEMRGVFGLQDMMKAEAEVLGNGALGSAYKAGM-ANGLCVVVKRMREMNKMG  367

Query  1353  KDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLK  1532
             K+ FDAEMR+ G +RH N++  LAYHYR++EKL+++E+ PKGSL Y+LHGDRG +H+ L 
Sbjct  368   KEVFDAEMRQFGRIRHRNVITPLAYHYRREEKLLITEYMPKGSLFYVLHGDRGLSHSKLT  427

Query  1533  AATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTP  1712
               TR+ I+KG+A G+ +L+TEF+TY LPHGNLKS N+LL+  YEPLL+DYAF PL++ + 
Sbjct  428   WPTRLNIVKGIARGLGFLYTEFSTYDLPHGNLKSCNVLLSDDYEPLLSDYAFQPLINPSV  487

Query  1713  TLQCMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQ  1883
              +Q +FA K P   +  +IS K+DVYCLGI+ILEV+TGKFP+QY SN KGGTDVVQW   
Sbjct  488   AMQALFAFKTPDYVQNQKISQKTDVYCLGIIILEVITGKFPAQYHSNGKGGTDVVQWAHS  547

Query  1884  AVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +V++  E+E+IDPE++    +S  +M++LL IG ACTE D +KR  MKEAI++I E++
Sbjct  548   SVSERIEAELIDPELSN-DTNSRNQMLQLLHIGVACTEIDPDKRPKMKEAIRKIEEVK  604



>ref|XP_009116398.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690, partial [Brassica rapa]
Length=628

 Score =   531 bits (1368),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 297/634 (47%), Positives = 408/634 (64%), Gaps = 38/634 (6%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             L+FFSF   LQ       V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C
Sbjct  10    LLFFSFTPSLQ------HVSESEPLMRFKTSVNITKGDLNSWRTGTDPCNG--KWFGIYC  61

Query  396   HR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
              R +TV+G+ +  +GL+G I V+ L +L  LR I L NN  SGP+P F KL  L+SL + 
Sbjct  62    QRGQTVSGIHITKLGLSGIIHVEDLKDLPNLRTIRLDNNLLSGPLPPFFKLHGLRSLLLS  121

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
              N FSGEI+AD+F  M  L++++L HN F+GNIP SL +L  L ELHL+ N FS  +P L
Sbjct  122   NNSFSGEIAADFFKDMLQLKRVFLDHNDFTGNIPTSLMQLTGLEELHLQANQFSGEIPLL  181

Query  753   A--QRSLTILDLSGNKLQGEIPSGMAR--FGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
                 ++L +LDLS N L+GEIP  +A        F+GN +LCG+P+   C      D   
Sbjct  182   TDGNKNLKLLDLSNNNLEGEIPKSIAERNIVKMNFQGNQKLCGQPLNIIC------DDKP  235

Query  921   GAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI  1100
              A  + P      +  M  L L I   L+ +   + K +  E  +   KD+L +   V++
Sbjct  236   PALGKNPNEVTGKAVFMVILFLLIFLILVAIITRWKKKRQPE-FRMLSKDHLSDTESVEV  294

Query  1101  -----------ASMARSES--INHssrrststegsssrggDFVLVNEERGMFGLSELMMA  1241
                        AS  RS +   +          G     GD ++VN E+G FGL +LM A
Sbjct  295   RMPDSVKKPVEASKKRSNADGSSKKGSTHHGKSGGGGGMGDIIMVNSEKGSFGLPDLMKA  354

Query  1242  SAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLL  1421
             +AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+++DAFD E+++ G LRH N+L  L
Sbjct  355   AAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLSRDAFDVELQRFGKLRHPNVLTPL  413

Query  1422  AYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFA  1601
             AYHYR++EKLVVSE+ PK SLLY+LHGDRGT H++L  +TR+KII+GVA GM++LH EFA
Sbjct  414   AYHYRREEKLVVSEYMPKSSLLYVLHGDRGTFHSELTWSTRLKIIQGVALGMQFLHEEFA  473

Query  1602  TYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKS  1772
             +Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q +FA K+PE     Q+S KS
Sbjct  474   SYELPHGNLKSSNVLLSETYEPLVSDYAFLPLLQPDNASQALFAFKSPEFAQNQQVSPKS  533

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             DVYCLG+++LE++TGKFPSQYL+N KGGTD+++WV+ +VA  KE E+IDPEI+ +  DS 
Sbjct  534   DVYCLGVILLEIMTGKFPSQYLNNGKGGTDIIEWVQSSVAQHKEEELIDPEIS-SNTDSL  592

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +MV+LL+IGA C  S+ + R +MKE + RI  I
Sbjct  593   QQMVELLRIGAVCIASNPDDRENMKEIVTRIERI  626



>ref|XP_010098007.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB74365.1| putative inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=571

 Score =   529 bits (1362),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 286/575 (50%), Positives = 397/575 (69%), Gaps = 24/575 (4%)
 Frame = +3

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
             +C    +TGL L NMGL G ID+DAL+ ++GLR I+L NN+FSGP+P F+KL  LK+L +
Sbjct  1     MCFDGIITGLHLTNMGLVGAIDIDALAQIRGLRTISLMNNNFSGPMPQFNKLGVLKALLL  60

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
              GN FSGEI AD+F+ +  L+K+WL+ N F+GNIP SLG+L  L+ELHLE N F+  +P 
Sbjct  61    TGNSFSGEIPADFFSHLNSLKKVWLNENKFTGNIPKSLGQLTHLIELHLENNQFNGPIPN  120

Query  750   LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE  929
               Q  ++ LD S NKL+GEIP  +A++ A AF GN  LCG P+ + C    G        
Sbjct  121   FTQ-PISSLDFSNNKLEGEIPGILAKYNATAFSGNDGLCGPPLEKAC-SGRGAQMALSGN  178

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIAS-  1106
             +   ENA  ++  +   +++ +  +LL A+L +KN  E+      K+++ EV+ V + S 
Sbjct  179   SLNDENAN-NTKLIVGGVIATMIVVLLYALLSSKNGREDEFSQLGKEHVGEVVEVDVRSS  237

Query  1107  ------MARSESINH--------ssrrststegsssrggDFVLVNEERGMFGLSELMMAS  1244
                    + SE  N         S+  S+S  G S    D V+VNEE+G FG+++LM A+
Sbjct  238   HKRAGNYSNSEHSNRRSGGAASASASSSSSHHGKSGSMTDLVMVNEEKGSFGMADLMKAA  297

Query  1245  AEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLA  1424
             AEVLGNGGLGSAYKA +   GL+V VKR++E N+M +D FDAEMR+ G LRH NIL  LA
Sbjct  298   AEVLGNGGLGSAYKAVM-TTGLSVAVKRMREMNRMGRDGFDAEMRRFGRLRHKNILTPLA  356

Query  1425  YHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFAT  1604
             YHYR++EKL+VSE+  KGSLLY+LHGDRG++H +L   TR+KII+G+A G+ +L++EF++
Sbjct  357   YHYRREEKLLVSEYISKGSLLYVLHGDRGSSHAELNWPTRLKIIQGIARGLGFLYSEFSS  416

Query  1605  YKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSD  1775
             Y LPHGNLKSSN+LLT  ++P+L+DYAF PL++    +Q MFA K P+  Q   +S+K+D
Sbjct  417   YDLPHGNLKSSNVLLTDDHDPILSDYAFQPLMNPANAVQAMFAFKTPDFLQYQRVSNKTD  476

Query  1776  VYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD-GKESEVIDPEIAGAGEDSD  1952
             VYCLGI+ILE++TGKFPSQYL+N KGG D VQWV  A  D  +E E++DPEIA A   + 
Sbjct  477   VYCLGIIILEILTGKFPSQYLTNGKGGIDAVQWVMSAHGDVDQEMELLDPEIA-ASTVAV  535

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
               M++LL +GAAC ES+ ++R+ M+EAI+RI E+Q
Sbjct  536   NHMLQLLHVGAACVESNPQQRIDMREAIRRIDEVQ  570



>ref|XP_010454375.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=664

 Score =   532 bits (1370),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 311/672 (46%), Positives = 415/672 (62%), Gaps = 58/672 (9%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             MAAV    +F L+   FC     +P    V +   L+ FK S++ TKG  ++W  G  PC
Sbjct  1     MAAVLN-HSFILVLLLFC-CFSIIPSLQHVSESEPLVRFKNSVKITKGDLNSWRAGTDPC  58

Query  363   DKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
               + +WFG+ C +  TV+G+ +  +GL+G I VD L +L  L+ I L NN  SGP+P F 
Sbjct  59    --SGKWFGIYCQKGLTVSGIHVTRLGLSGSITVDDLKDLPNLKTIRLDNNLLSGPLPHFF  116

Query  540   KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             KLR LKSL +  N FSGEI  D+F  MT L++L+L HN F G IP+SL +LP+L ELHL+
Sbjct  117   KLRGLKSLMLSNNSFSGEIPDDFFKDMTKLKRLFLDHNKFEGKIPSSLTQLPQLEELHLQ  176

Query  720   GNGFSSAVPPLAQ--RSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQ  887
              N F+  +P      +SL  LDLS N L+G +P  +   +  A    GN  LCGE V   
Sbjct  177   ENNFTGEIPVEIGNIKSLKTLDLSVNNLEGPVPESITNKKNLAVNVSGNEGLCGELVDLS  236

Query  888   CR-----EDLGKDGGGGAEAQTP---------ENAQRHSSGMRWlllsivaglllvailF  1025
             C      E  G+D GG    QTP          NA  H+  + + LL +   ++ V    
Sbjct  237   CDYIPLDEGQGRDDGG----QTPPTATVSPNSNNATVHAIMVAFTLLLMFVIIVGVIRKR  292

Query  1026  NKNQNEENV---KTRRKDN-LDEVLVVQIASMARSESINHssr-----------------  1142
             NK +N +     K R  DN + EV V +  S     S   S +                 
Sbjct  293   NKKKNPDFRMLDKQRLSDNDIVEVRVPESVSTTAKRSTESSRKRGGNADGSGSSKKGVSQ  352

Query  1143  -----rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
                        G     GD ++VN ++G FGL +LM A+AEVLGNG LGSAYKA +   G
Sbjct  353   VGKGGNGGGGGGLGGGMGDIIMVNSDKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TNG  411

Query  1308  LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLL  1487
             L+VVVKR+++ N++ ++ FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLL
Sbjct  412   LSVVVKRIRDMNQLAREPFDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLL  471

Query  1488  YLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEP  1667
             Y+LHGDRG  H++L   TR+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEP
Sbjct  472   YVLHGDRGIYHSELTWPTRLKIIQGVAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEP  531

Query  1668  LLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYL  1838
             L++DYAF PL+  T   Q +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL
Sbjct  532   LISDYAFLPLLQPTNASQALFAFKTPEFAQTQQVSHKSDVYCLGIIILEILTGKFPSQYL  591

Query  1839  SNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRL  2018
             +N KGGTD+VQWV+ +VA+ KE E+IDPEI     DS  +MV+LL++GAAC  S+ ++RL
Sbjct  592   NNGKGGTDIVQWVQSSVAEQKEEELIDPEIVN-NTDSVRQMVELLRVGAACIASNPDERL  650

Query  2019  SMKEAIKRIREI  2054
              M+EA++RI ++
Sbjct  651   DMREAVRRIEQV  662



>ref|XP_006474705.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Citrus sinensis]
Length=632

 Score =   531 bits (1367),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 293/616 (48%), Positives = 404/616 (66%), Gaps = 22/616 (4%)
 Frame = +3

Query  258   LSISVGDDVVLIEFKESLQNTKGLDDTWVKG--KSPCDKTRRWFGVLCHRKTVTGLRLYN  431
             L+ S+ D+  LI FK+SL +  G+ D+W      +PC  T +W GV+C    V+ L L N
Sbjct  24    LTFSLPDNQALILFKKSLVHN-GVLDSWDPKPISNPC--TDKWQGVMCINGVVSSLFLQN  80

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             M L+G IDV+AL  + GL  IAL NN F+G IP+F+KL  L +L++  N FS EI  D+F
Sbjct  81    MSLSGTIDVEALGQIAGLTSIALQNNFFTGAIPEFNKLGALNALYLSSNNFSEEIPDDFF  140

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP-PLAQRSLTILDLSG  788
             A MT L+KLW  +N F+G IP SL  L  L ELHL GNGFS  +P P+   S+  LD S 
Sbjct  141   APMTPLQKLWFDNNKFTGKIPDSLMNLQNLTELHLHGNGFSGLIPEPIQPTSIVSLDFSN  200

Query  789   NKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSG  968
             N L+GEIP G+++FG K F  N +LCG+P+ +QC +         A            +G
Sbjct  201   NNLEGEIPKGLSKFGPKPFADNDKLCGKPLRKQCSKPTPPPTEPPASEPPATEPPLVIAG  260

Query  969   MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI--------ASMARSES  1124
             +   ++  +   ++VA+ F + +   +     KD+     VV++        +S   +E+
Sbjct  261   V---IIGFLIIFIVVAVFFARRKERAHFSMLEKDHDRNNRVVEVHVPESTSSSSQKYTET  317

Query  1125  INHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVI  1304
              +  S  S  +       GD  ++N+++  FGL++LM A+AEVLGNGGLGS+YKAA+   
Sbjct  318   SSRKSNLSRKSSKRGGGMGDLSMINDDKDPFGLADLMKAAAEVLGNGGLGSSYKAAM-AN  376

Query  1305  GLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSL  1484
             GLTVVVKR++E N++ +D FDAEMR++G ++H NIL  LAYH+R+ EKLVVSE+ PKGSL
Sbjct  377   GLTVVVKRIREMNQLGRDTFDAEMRRLGRIKHPNILAPLAYHFRRDEKLVVSEYMPKGSL  436

Query  1485  LYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYE  1664
             L+LLHG++G +H +L   TR+ IIKGVA+G+ ++H+EFA+Y+LPHGNLKSSN+LL+  Y 
Sbjct  437   LFLLHGEKGISHAELNWPTRLNIIKGVANGLSFIHSEFASYELPHGNLKSSNVLLSQDYV  496

Query  1665  PLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQY  1835
             PLL D+AFHPL +     Q MFA  +PE     Q+S KSDVYCLGI+ILEV+TGKFPSQY
Sbjct  497   PLLGDFAFHPLTNPNHVAQTMFAYISPEYIQHQQLSPKSDVYCLGILILEVITGKFPSQY  556

Query  1836  LSNQKGGTDVVQWVRQAVAD-GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEK  2012
             LSN KGG DVV+ V   + D  + +E+IDPEI+   E+S G MV+LL+IG ACTES+  K
Sbjct  557   LSNAKGGIDVVELVSSLIGDQDRVAELIDPEISANAENSIGMMVQLLKIGLACTESEPAK  616

Query  2013  RLSMKEAIKRIREIQD  2060
             RL ++EA+K I EI D
Sbjct  617   RLDLEEALKMIEEIHD  632



>ref|XP_006369120.1| hypothetical protein POPTR_0001s16650g [Populus trichocarpa]
 gb|ERP65689.1| hypothetical protein POPTR_0001s16650g [Populus trichocarpa]
Length=684

 Score =   532 bits (1370),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 286/628 (46%), Positives = 407/628 (65%), Gaps = 15/628 (2%)
 Frame = +3

Query  210   FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
             F    F F +      L+ SV D   L+  K+S  N   L  +W+ G  PC++   W G+
Sbjct  7     FHPFLFLFIIFTLHFSLTSSVSDSEALLRLKKSFTNAGALS-SWISGSVPCNRQTHWNGL  65

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
             LC    VTGL+L NMGL+G IDVDAL+ +QGLR ++ A NSF+G IP+ ++L +LK++++
Sbjct  66    LCFNGIVTGLQLENMGLSGTIDVDALATIQGLRSLSFARNSFTGAIPELNRLGNLKAIYL  125

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
             +GN+FSGEI +D+F+KM  L+K+WLS N F+G IP SL +LPRL ELHLE N FS  +P 
Sbjct  126   RGNQFSGEIPSDFFSKMKSLKKVWLSDNKFTGGIPPSLAELPRLSELHLENNQFSGTIPS  185

Query  750   LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE  929
             + Q +L   ++S N L+GEIP  +A F   +F+GN  LCG+  GR C   +       + 
Sbjct  186   IDQPTLMSFNVSNNMLEGEIPPNLAIFNYSSFDGNDHLCGDRFGRGCENTM--QTSSESP  243

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASM  1109
               T   A   +  +  +   I+  +      F+  +N  N      +     L VQ++  
Sbjct  244   TGTVAGAVTLAVLLLSITALIIFRMRRRDKDFDVIENSSN-----GNAAAAALEVQVSLS  298

Query  1110  ARSESINHssrrststegsssr---ggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSA  1280
              R + ++ + +  +S +GS++     G+ V+VN E+G+FGL +LM ASAEVLGNGG+GS 
Sbjct  299   NRPKGVDATKKMGSSRKGSNNGRGGVGELVIVNNEKGVFGLPDLMKASAEVLGNGGMGSL  358

Query  1281  YKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVS  1460
             YKA +   G  VVVKR +E N ++KD FDAE+RK+G L H NIL  LA+ YR  EKL+V 
Sbjct  359   YKAQM-ANGAMVVVKRTREMNTLSKDQFDAEIRKLGRLHHTNILTPLAFLYRPDEKLLVY  417

Query  1461  EFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSN  1640
             E+ PKGSLLYLLHGDRGT+H +L    R+KI++G+A G+ YLHT+ A+  LPHGNLKSSN
Sbjct  418   EYMPKGSLLYLLHGDRGTSHAELNWFVRLKIVQGIAKGLGYLHTKLASSPLPHGNLKSSN  477

Query  1641  ILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ--ISHKSDVYCLGIVILEVVT  1814
             + L+   EPLL+++   PL+S     Q +F  KAPE  Q  +S   DVYCLGI++LE++T
Sbjct  478   VFLSNDNEPLLSEFGLSPLISPPMLAQALFGYKAPEAAQYGVSPMCDVYCLGIIVLEILT  537

Query  1815  GKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACT  1994
             GKFPSQYL+  KGGTDVVQWV  AV+DG+E++++DPEIA +  +S G+M +LL IGAAC 
Sbjct  538   GKFPSQYLNKAKGGTDVVQWVESAVSDGRETDLLDPEIA-SSTNSLGQMRQLLGIGAACV  596

Query  1995  ESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
             + + ++RL + +AI+ I+ I+  +  HE
Sbjct  597   KRNPQQRLDITDAIQMIQGIKLEDSNHE  624



>gb|EYU21298.1| hypothetical protein MIMGU_mgv1a002404mg [Erythranthe guttata]
Length=679

 Score =   531 bits (1368),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 296/632 (47%), Positives = 405/632 (64%), Gaps = 39/632 (6%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             MA ++    F ++F  F LI    P + S  D   L++ K S  N      +W  G  PC
Sbjct  1     MAIIQIHGPFIIVFSVFLLIF---PAASSNADADALLQLKSSFINATAPLYSWKPGTEPC  57

Query  363   DKTR-RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
                   W GVLC R ++ GLRL  MGLAG ++VDALS L GLR +AL +N+FSG IPDF+
Sbjct  58    AAGNLTWVGVLCERGSIFGLRLGYMGLAGTVNVDALSKLSGLRTVALTSNAFSGRIPDFN  117

Query  540   KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             ++  LK L+I  N+FSGEI  +YF++M GLRK+WLS+N FSG IP+SL ++ +L+ELHLE
Sbjct  118   RVGSLKGLYISDNKFSGEIPPEYFSRMGGLRKIWLSNNNFSGPIPSSLAQVSQLMELHLE  177

Query  720   GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
              N FS  +P L Q SL   D + N L GEIP+ +++F AKAFEGNP LC           
Sbjct  178   NNRFSGPIPSLGQASLISFDAANNDLSGEIPAALSKFSAKAFEGNPGLC-----------  226

Query  900   LGKDGGGGAEAQTPENAQRHSSGMR---WlllsivaglllvailFNKNQNEENVKTRRKD  1070
                 GG      TP  ++  S+G+R   W L++  A LLL             ++ R + 
Sbjct  227   ----GGNSGNPCTP--SKYVSNGLRIAAWFLVAFAALLLLTVAGIYL------MRRRHEA  274

Query  1071  NLDEVLVVQIASMARSESI----NHssrrststegsssrggDFVLVNEERGMFGLSELMM  1238
             + + + V+ + S      +    N       +     +   D  ++N+E+G FGL +LM 
Sbjct  275   SGENLGVIPLDSKGSKRDLDPSGNGFGSSRRAGSSRRAHNKDLEIINDEKGEFGLGDLMK  334

Query  1239  ASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPL  1418
             A+AEVLGNG LGS+YKA +   GLTVVVKR KE NK+ ++ FD EMR++G L H N+L  
Sbjct  335   AAAEVLGNGALGSSYKATM-ASGLTVVVKRTKEMNKIGREKFDGEMRRLGSLNHRNVLTP  393

Query  1419  LAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEF  1598
             LAYHYRK EKL+VSE+   GSL++LLHG+RG  H  L  A R+KII+G+A G+ Y+HTE 
Sbjct  394   LAYHYRKDEKLLVSEYHHTGSLMFLLHGERGNTHTKLNWAMRLKIIQGIARGLGYIHTEL  453

Query  1599  ATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG--HQ-ISHK  1769
             +++ LPHG+LKSSN++LTP YEPLL+DY    L+S +     + A K+PE   HQ IS K
Sbjct  454   SSFDLPHGDLKSSNVILTPDYEPLLSDYGLCSLMSRSQAALALVAFKSPEAIMHQIISPK  513

Query  1770  SDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDS  1949
              DVYCLGI+ILE++TGKFPSQYL+N +GGTD+VQWVR A+A+G+E+E+IDPEIA    + 
Sbjct  514   CDVYCLGILILEIITGKFPSQYLNNGQGGTDLVQWVRSAIAEGREAELIDPEIANT-SNF  572

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
              G + +LL +GAACTES+ ++R+ + EAI+RI
Sbjct  573   LGGVEELLHVGAACTESNPDQRMDLLEAIQRI  604



>emb|CDY28610.1| BnaA06g19280D [Brassica napus]
Length=627

 Score =   529 bits (1363),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 297/634 (47%), Positives = 408/634 (64%), Gaps = 38/634 (6%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             L+ FSF   LQ       V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C
Sbjct  9     LLCFSFTPSLQ------HVSESEPLMRFKTSVNITKGDLNSWRTGTDPCNG--KWFGIYC  60

Query  396   HR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
              R +TV+G+ +  +GL+G I V+ L +L  LR I L NN  SGP+P F KL  L+SL + 
Sbjct  61    QRGQTVSGIHITKLGLSGIIHVEDLKDLPNLRTIRLDNNLLSGPLPPFFKLHGLRSLLLS  120

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
              N FSGEI+AD+F  M  L++++L HN F+GNIP SL +L  L ELHL+GN FS  +P L
Sbjct  121   NNSFSGEIAADFFKDMLQLKRVFLDHNDFTGNIPTSLMQLTGLEELHLQGNQFSGEIPLL  180

Query  753   A--QRSLTILDLSGNKLQGEIPSGMAR--FGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
                 ++L +LDLS N L+GEIP  +A        F+GN +LCG+P+   C      D   
Sbjct  181   TDGNKNLKLLDLSNNNLEGEIPKSIAERNIVKMNFQGNQKLCGQPLNIIC------DDKP  234

Query  921   GAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI  1100
              A  + P      +  M  L L I   L+ +   + K +  E  +   KD+L +   V++
Sbjct  235   PALGKNPNEVTGKAVFMVILFLLIFLILVAIITRWKKKRQPE-FRMLSKDHLSDTESVEV  293

Query  1101  -----------ASMARSES--INHssrrststegsssrggDFVLVNEERGMFGLSELMMA  1241
                        AS  RS +   +          G     GD ++VN E+G FGL +LM A
Sbjct  294   RMPDSVKKPVEASKKRSNADGSSKKGSTHHGKSGGGGGMGDIIMVNSEKGSFGLPDLMKA  353

Query  1242  SAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLL  1421
             +AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+++DAFD E+++ G LRH N+L  L
Sbjct  354   AAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLSRDAFDVELQRFGKLRHPNVLTPL  412

Query  1422  AYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFA  1601
             AYHYR++EKLVVSE+ PK SLLY+LHGDRGT H++L  +TR+KII+GVA GM++LH EFA
Sbjct  413   AYHYRREEKLVVSEYMPKSSLLYVLHGDRGTFHSELTWSTRLKIIQGVALGMQFLHEEFA  472

Query  1602  TYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKS  1772
             +Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q +FA K+PE     Q+S KS
Sbjct  473   SYELPHGNLKSSNVLLSETYEPLVSDYAFLPLLQPDNASQALFAFKSPEFAQNQQVSPKS  532

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             DVYCLG+++LE++TGKFPSQYL+N KGGTD+++WV+ +VA  KE E+IDPEI+ +  DS 
Sbjct  533   DVYCLGVILLEIMTGKFPSQYLNNGKGGTDIIEWVQSSVAQHKEEELIDPEIS-SNTDSL  591

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +MV+LL+IGA C  S+ + R +MKE + RI  I
Sbjct  592   QQMVELLRIGAVCIASNPDDRENMKEIVTRIERI  625



>ref|XP_002871954.1| hypothetical protein ARALYDRAFT_488975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48213.1| hypothetical protein ARALYDRAFT_488975 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   528 bits (1360),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 288/632 (46%), Positives = 405/632 (64%), Gaps = 41/632 (6%)
 Frame = +3

Query  270   VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAG  446
             V +   L+ FK S+  TKG  ++W  G  PC  + +WFG+ C +  TV+G+ +  +GL+G
Sbjct  25    VSESEPLVRFKSSVNITKGDLNSWRLGTDPC--SGKWFGIYCQKGLTVSGIHVTRLGLSG  82

Query  447   DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
              I VD L +L  L+ I L NN  SGP+P F KLR LKSL +  N FSGEI  D+F  M+ 
Sbjct  83    TITVDDLKDLPNLKTIRLDNNLLSGPLPHFFKLRGLKSLMLSNNSFSGEIRDDFFKDMSK  142

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ--RSLTILDLSGNKLQ  800
             L++L+L HN F GNIP+S+ +LP+L ELHL+ N F+  +PP     ++L +LDLS N+L+
Sbjct  143   LKRLFLDHNKFQGNIPSSITQLPQLEELHLQSNNFTGEIPPEIGNIKNLKVLDLSTNQLE  202

Query  801   GEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGG-------AEAQTPENAQ  953
             G +P  +A  +        N  LCG  +  +C ED+    G G       +  QT   A 
Sbjct  203   GTVPESIADRKNLVANLTENEYLCGAMIDVEC-EDINLTEGEGHNRKAPTSVPQTSNTAT  261

Query  954   RHSSGMRWlllsivaglllvailFNKNQNEE--NVKTRRKDNLDEVLVVQIASMARSES-  1124
              H+  +   LL +   ++ +    NK +N +   +  +R ++  EV + + +S     S 
Sbjct  262   VHAILVSISLLLMFFIIVGIIRKRNKKKNPDFRMLDNQRNNDAVEVRISESSSTTAKRST  321

Query  1125  ------------------INHssrrststegsssrggDFVLVNEERGMFGLSELMMASAE  1250
                               +++  +            GD ++VN E+G FGL +LM A+AE
Sbjct  322   DSSRKRGGHADGGSSKKGLSNIGKGGNGGGALGGGMGDIIMVNTEKGSFGLPDLMKAAAE  381

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             VLGNG LGSAYKA +   GL+VVVKR+++ N++ ++ FD EMR+ G LRH NIL  LAYH
Sbjct  382   VLGNGSLGSAYKAVM-TTGLSVVVKRIRDMNQLAREPFDVEMRRFGKLRHPNILTPLAYH  440

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             YR++EKLVVSE+ PK SLLY+LHGDRG  H++L  ATR+KII+GVA GM++LH EFA+Y 
Sbjct  441   YRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWATRLKIIQGVAHGMKFLHGEFASYD  500

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVY  1781
             LPHGNLKSSN+LL+ TYEPL++DYAF PL+  +   Q +FA K PE     Q+SHKSDVY
Sbjct  501   LPHGNLKSSNVLLSETYEPLISDYAFLPLLQPSNASQALFAFKTPEFAQTQQVSHKSDVY  560

Query  1782  CLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKM  1961
             CLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+ +VA+ KE E+IDPEI    E S  +M
Sbjct  561   CLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQSSVAEQKEEELIDPEIVNNTE-SMRQM  619

Query  1962  VKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             V+LL++GAAC  S+ ++RL M+E ++RI +++
Sbjct  620   VELLRVGAACIASNPDERLDMRETVRRIEQVK  651



>ref|XP_010262229.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nelumbo nucifera]
Length=646

 Score =   525 bits (1353),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 289/608 (48%), Positives = 400/608 (66%), Gaps = 17/608 (3%)
 Frame = +3

Query  258   LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMG  437
             L++++ +   L++ K+S  N   LD +WV G SPC     W G++C    +TGLRL  +G
Sbjct  38    LALAIPESDSLLKLKKSFVNANALD-SWVLGSSPCS----WTGIVCSEGNITGLRLGRLG  92

Query  438   LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
             L+G ID+DAL+ +Q +R I+  NNSFSG IP+F++L  LKS+++ GN+FSGEI +DYF+ 
Sbjct  93    LSGSIDIDALAEIQSIRTISFVNNSFSGSIPEFNRLGALKSMYLSGNQFSGEIPSDYFST  152

Query  618   MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
             M  L+KLWLS N F+G IPASL +LP L+ELHLE N FS A+P      L  LD+S NKL
Sbjct  153   MASLKKLWLSGNAFTGAIPASLAQLPHLIELHLENNQFSGAIPEFVHTPLISLDMSNNKL  212

Query  798   QGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRW  977
             +GEIP+ +++FG  +F  N  LCG  + ++C             A  P++ Q+ S+ M  
Sbjct  213   EGEIPASLSKFGESSFARNEGLCGAQLAKKCAAKATITQVTEPPAGNPDSKQQESNKMTA  272

Query  978   lllsivagll---lvailFNKNQNEE--NVKTRRKDNLDEVLVVQIASMARSESINHssr  1142
               + +V+ ++   +   L  + +++E       +K+NLD   V  + +    + ++ + R
Sbjct  273   AAIVLVSTVVLLGVTVFLVARRKDDELGRFIVLKKENLDLKDVNTLWTGRNRKGVDSNKR  332

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
              S  T+GS +   D +LVNEE+G+F LS+LM A+AEVLG+GGLGSAYK  L   G+ VVV
Sbjct  333   GSRYTKGSGTE--DLILVNEEKGVFRLSDLMQATAEVLGSGGLGSAYKTVLSS-GVVVVV  389

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR+KE  +  +DAFD E+R++  LRH NIL  LAY YRK+EKL+V E+ PKGSL YLLHG
Sbjct  390   KRMKEMKRAGRDAFDVEIRRLANLRHPNILTPLAYRYRKEEKLLVYEYAPKGSLFYLLHG  449

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
             D+G     L   TR+KIIKGVA G+ YLHT+  + ++PHGNLKSSN++L   YEPLL DY
Sbjct  450   DQGPYSAPLDWPTRLKIIKGVAQGLGYLHTKLVSIEIPHGNLKSSNVVLGSAYEPLLIDY  509

Query  1683  AFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
              F  +V   P  + +FA ++PE  Q   +S K DVYCLGI+ILE++TGKFPSQYL +  G
Sbjct  510   GFCSMVLPNPAAKALFAYRSPESLQSRRVSPKCDVYCLGILILEILTGKFPSQYLGDGSG  569

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEA  2033
             GTDVV+  + A+++ KE + +DP I  +   S  +M KLL IGAAC ES  EKR  MKEA
Sbjct  570   GTDVVKLAQSAISNRKEVKSLDPYITDS-RKSLAQMEKLLHIGAACAESLPEKRPDMKEA  628

Query  2034  IKRIREIQ  2057
             IKRI EIQ
Sbjct  629   IKRIEEIQ  636



>ref|XP_002532730.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF29661.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=702

 Score =   526 bits (1355),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 277/615 (45%), Positives = 401/615 (65%), Gaps = 16/615 (3%)
 Frame = +3

Query  252   LPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYN  431
             LP   S  +   LI+ K S  +   L  +WV G +PC    +W G+LC   TV GLRL  
Sbjct  20    LPSISSTSESEALIKLKSSFTDASALS-SWVNGSTPCAGDTQWNGLLCSNGTVVGLRLEK  78

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             MGL+G IDVDAL ++ GLR ++ A NSFSG IP+  +L +LKS+F+ GN+FSGEI +D+F
Sbjct  79    MGLSGKIDVDALIDISGLRTVSFARNSFSGSIPELSRLGYLKSIFLTGNQFSGEIPSDFF  138

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
              KM  L+K+WLS N FSG IP+SL  L  L+EL LE N FS  +P + Q +LT  ++S N
Sbjct  139   LKMVSLKKVWLSDNKFSGEIPSSLIHLSNLLELRLENNEFSGNIPSIEQSTLTTFNVSNN  198

Query  792   KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED-------LGKDGGGGAEAQTPENA  950
             KL+G+IP+G+ +F + +FEGN ELCGE +G++CR         +          +  ++ 
Sbjct  199   KLRGQIPAGLEKFNSTSFEGNSELCGEMIGKECRTVSLAAAALISSVSKNAIYDKDSKSL  258

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
             +  ++G+  L   +++ + +V    ++   +  V  +   + DE + VQ+    RS+ + 
Sbjct  259   KMTNAGIITLAAMLLSVVGVVIFKLSRKDKDFQVGGKDGSDADESVEVQVTMPVRSKEME  318

Query  1131  Hssrrststegsssrg----gDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALP  1298
              + +  ++ +GS+        + V+VN E+G+FGL +LM A+AEVLGNGGLGS+YKA L 
Sbjct  319   ATKKLGSTRKGSNQNKGGGVAELVMVNNEKGVFGLPDLMKAAAEVLGNGGLGSSYKA-LM  377

Query  1299  VIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKG  1478
               G  +VVKRL+E N + +D FDAE+R +G LRH NIL  LA+HYRK EKL++ E+ P G
Sbjct  378   TDGEAMVVKRLREMNALGRDGFDAEVRHLGKLRHPNILGPLAFHYRKDEKLLIYEYMPTG  437

Query  1479  SLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPT  1658
             SLLYLLHGDRG +  +L   TR+K++ G+A G+ YLH E +++ LPHGNLKSSNI L   
Sbjct  438   SLLYLLHGDRGPSRTELNWPTRLKVVVGIARGLGYLHAELSSFDLPHGNLKSSNIFLNYD  497

Query  1659  YEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ--ISHKSDVYCLGIVILEVVTGKFPSQ  1832
              EP+++++ F+ L   +   Q + A KAPE  Q  +S K DVYCLG+VILE++TGK PSQ
Sbjct  498   NEPMISEFGFNQLTKPSVGRQALLAYKAPEAAQFGVSPKCDVYCLGLVILEILTGKVPSQ  557

Query  1833  YLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEK  2012
             YL+   G  D+VQWV+ ++ +G+ESE+ DP+IA +  DS G++  LL IGA C ES+  +
Sbjct  558   YLNYGNGEIDLVQWVQNSITEGRESELFDPDIA-SSTDSVGEIRALLHIGARCAESNPAQ  616

Query  2013  RLSMKEAIKRIREIQ  2057
             RL ++EAI+RI EI+
Sbjct  617   RLDLREAIERIEEIK  631



>ref|XP_010420914.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=663

 Score =   525 bits (1351),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 304/658 (46%), Positives = 408/658 (62%), Gaps = 48/658 (7%)
 Frame = +3

Query  210   FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
             F L+   FC     +P    V +   L+ FK S++ TKG  ++W  G  PC  + +WFG+
Sbjct  9     FILVLLFFC-CFSIIPSLQHVSESEPLVRFKNSVKITKGDLNSWRAGTDPC--SGKWFGI  65

Query  390   LCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
              C +  TV+G+ +  +GL+G I VD L +L  L+ I L NN  SGP+P F KLR LKSL 
Sbjct  66    YCQKGLTVSGIHVTRLGLSGSITVDDLKDLPNLKTIRLDNNLLSGPLPHFFKLRGLKSLM  125

Query  567   IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
             +  N FS EI  D+F  MT L++L+L HN F G IP+SL +LP+L ELHL+ N F+  +P
Sbjct  126   LSNNSFSEEIPDDFFKDMTKLKRLFLDHNKFVGKIPSSLMQLPQLEELHLQENNFTGEIP  185

Query  747   PLAQ--RSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCR-----ED  899
                   +SL  LDLS N L+G +P  +   +  A    GN  LCGE V   C      E 
Sbjct  186   VEIGNIKSLKTLDLSVNNLEGPVPESITNRKNLAVNVSGNEGLCGELVDLSCDYISLDEG  245

Query  900   LGKDGGG-----GAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENV---K  1055
              G+D GG        +    NA  H+  +   LL +   ++ V    NK +N +     K
Sbjct  246   QGRDDGGQTPPTATVSPNSNNATVHAIMVAITLLLMFFIIVGVIRKRNKKKNPDFRMLDK  305

Query  1056  TRRKDN-LDEVLVVQIASMARSESINHssr---------------------rststegss  1169
              R  DN + EV V +  S     S   S +                      +    G S
Sbjct  306   QRLSDNDIVEVRVPESVSTTAKRSTESSRKRGGNADGSGSSKKGVSQVGKGGNGGGGGLS  365

Query  1170  srggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKM  1349
                GD ++VN ++G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++
Sbjct  366   GGMGDIIMVNSDKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TNGLSVVVKRIRDMNQL  424

Query  1350  NKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDL  1529
              ++ FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L
Sbjct  425   AREPFDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSEL  484

Query  1530  KAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGT  1709
                TR+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+  T
Sbjct  485   TWPTRLKIIQGVAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPT  544

Query  1710  PTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVR  1880
                Q +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+
Sbjct  545   NASQALFAFKTPEFAQTQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQ  604

Query  1881  QAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +VA+ KE E+IDPEI     DS  +MV+LL++GAAC  S+ ++RL M+EA++RI ++
Sbjct  605   SSVAEQKEEELIDPEIVN-NTDSVRQMVELLRVGAACIASNPDERLDMREAVRRIEQV  661



>ref|XP_010493179.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=662

 Score =   524 bits (1350),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 305/658 (46%), Positives = 412/658 (63%), Gaps = 49/658 (7%)
 Frame = +3

Query  210   FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
             F L+   FC     +P    V +   L+ FK S++ TKG  ++W  G  PC  + +WFG+
Sbjct  9     FILVLLLFC-CFSIIPSVQHVSESEPLVRFKNSVKITKGDLNSWRAGTDPC--SGKWFGI  65

Query  390   LCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
              C +  TV+G+ +  +GL+G + VD L +L  L+ I L NN  SGP+P F KLR LKSL 
Sbjct  66    YCQKGLTVSGIHVTRLGLSGPVTVDDLKDLPNLKTIRLDNNLLSGPLPHFFKLRGLKSLM  125

Query  567   IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
             +  N FSGEI+ D+F  MT L++L+L HN F GNIP+SL +LP L ELHL+ N F+  +P
Sbjct  126   LSNNSFSGEIADDFFKDMTKLKRLFLDHNKFVGNIPSSLMQLP-LEELHLQENNFTGEIP  184

Query  747   PLAQ--RSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQC--------  890
                   +SL  LDLS N L+G +P  +   +  A    GN  LCG  V   C        
Sbjct  185   EEIGNIKSLKNLDLSVNNLEGPVPESITNKKDLAVNVSGNEGLCGTLVDLACDYVSLDEG  244

Query  891   --REDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENV---K  1055
               R+D GK     A +    NA  H+  + + LL +   ++ V    NK +N +     K
Sbjct  245   QERDDGGKTPPTTAVSPNSNNATVHAIMVAFTLLLMFVIIVGVIRKRNKKKNPDFRMLDK  304

Query  1056  TRRKDN-LDEVLVVQIASMARSESINHssrrststegsssrgg-----------------  1181
              R  DN + EV V +  S     S   S +R  + +GS S                    
Sbjct  305   QRLSDNDIVEVRVPESVSTTAKRSTESSRKRGGNGDGSGSSKKGVSQVGKGGGGGGGGLG  364

Query  1182  ----DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKM  1349
                 D ++VN ++G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++
Sbjct  365   GGMGDIIMVNSDKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TNGLSVVVKRIRDMNQL  423

Query  1350  NKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDL  1529
              ++ FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L
Sbjct  424   AREPFDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIHHSEL  483

Query  1530  KAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGT  1709
                TR+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+  T
Sbjct  484   TWPTRLKIIQGVAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPT  543

Query  1710  PTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVR  1880
                Q +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+
Sbjct  544   NASQALFAFKTPEFAQTQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQ  603

Query  1881  QAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +VA+ KE E+IDPEI     DS  +MV+LL++GAAC  S+ ++RL M+EA++RI ++
Sbjct  604   SSVAEQKEEELIDPEIVN-NTDSVRQMVELLRVGAACIASNPDERLDMREAVRRIEQV  660



>ref|XP_002303233.1| hypothetical protein POPTR_0003s06660g [Populus trichocarpa]
 gb|EEE78212.1| hypothetical protein POPTR_0003s06660g [Populus trichocarpa]
Length=659

 Score =   519 bits (1336),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 276/632 (44%), Positives = 404/632 (64%), Gaps = 22/632 (3%)
 Frame = +3

Query  213   PLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVL  392
             P +F      LQ   L+ SV +   LI  K+S  N  G   +W+ G  PC+K   W GV+
Sbjct  9     PFLFLFIIFTLQ-FSLTSSVSESESLIRLKKSFTNA-GAISSWLPGSVPCNKQTHWRGVV  66

Query  393   CHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
             C    VT L+L NMGL+G IDVDAL+N+QGLR ++ A N F+G IP  ++L +LK+++++
Sbjct  67    CFNGIVTVLQLENMGLSGTIDVDALANMQGLRSLSFAYNYFTGTIPALNRLGYLKAIYLR  126

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
             GN+FSGEI +D+F KM  L+K+W+S N FSG IP+SL +L RL ELHLE N FS  +P +
Sbjct  127   GNQFSGEIPSDFFLKMKSLKKVWISDNNFSGGIPSSLAELSRLSELHLENNQFSGTIPSI  186

Query  753   AQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR--------EDLGK  908
              Q +L   ++S NKL GEIP  +ARF + +F GN  LCG+ +G+ C          D+G 
Sbjct  187   DQPTLMSFNVSNNKLDGEIPPKLARFNSSSFRGNDGLCGQKIGKGCELQGSSEPPTDVGV  246

Query  909   DG----GGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNL  1076
             D       G++ +     +  +  +   +L +    +++  ++ + ++ + +++R   N 
Sbjct  247   DANMMVSEGSDNKRNSVTKTVAGLVTLAVLLVSIIAVVIFRMWRRGKDFDAIESRSSGN-  305

Query  1077  DEVLVVQIASMARS---ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASA  1247
                L VQ++   R    E           +       G+ V+VN E+ +FGL +LM ASA
Sbjct  306   AAALEVQVSLSNRPKEMEVAKKMGSGHKGSNNGRGVVGELVIVNNEKSVFGLPDLMKASA  365

Query  1248  EVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAY  1427
             EVLGNG LGS+YK  +   G+ VVVKR++E N ++K  F+AE+RK+G L H NIL  LA+
Sbjct  366   EVLGNGVLGSSYKTQM-ANGVVVVVKRMREMNTLSKSQFNAEIRKLGRLHHPNILTPLAF  424

Query  1428  HYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATY  1607
             HYR  EKL++ +F PKGSLLYLLHGDRG +H +L  + R+KI++G+A G+ YLHTE A  
Sbjct  425   HYRPDEKLLIYDFVPKGSLLYLLHGDRGPSHAELSWSVRLKIVQGIAKGLGYLHTELAPS  484

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ--ISHKSDVY  1781
              LPHGNLKSSN+ L+   EPLL+++   PL+S     Q +F  +APE  +  +S K DVY
Sbjct  485   NLPHGNLKSSNVFLSNDNEPLLSEFGLSPLISPPMLAQALFGYEAPEAAEFGVSPKCDVY  544

Query  1782  CLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKM  1961
             CLGI+ILE+++GK PSQYL+N +GGTDVV WV  A++DG+E++ +DPEIA + ++S  +M
Sbjct  545   CLGIIILEILSGKIPSQYLNNARGGTDVVHWVESAISDGRETDFLDPEIA-SSKNSLCQM  603

Query  1962  VKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              +L  IGAAC + + E+RL + +AI+ I+EI+
Sbjct  604   KQLQGIGAACVKRNPEQRLDITQAIQLIQEIK  635



>ref|XP_009120782.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Brassica rapa]
Length=648

 Score =   518 bits (1334),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 285/620 (46%), Positives = 401/620 (65%), Gaps = 35/620 (6%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDA  464
             LI FK S++ TKG  ++W  G  PC    +WFG+ C +  TV+G+ +  +GL+G I VD 
Sbjct  33    LIRFKNSVKITKGDLNSWRLGTDPCGG--KWFGIYCQKGLTVSGIHVTRLGLSGTISVDD  90

Query  465   LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
             L  L  L+ + L NN  SGP+P F KLR LKS+ +  N FSGEI  D+F  M+ L++L+L
Sbjct  91    LKALANLKTVRLDNNLLSGPLPHFFKLRGLKSIMLSNNTFSGEIPDDFFKDMSKLKRLFL  150

Query  645   SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ--RSLTILDLSGNKLQGEIPSG  818
              HN F G IP+S+ +LP L ELHL+ N FS  +P L +  ++L  LDLS N+L+GE+P+G
Sbjct  151   DHNQFVGKIPSSIMQLPHLEELHLQDNKFSGEIPLLIETNKNLKSLDLSNNQLEGEVPAG  210

Query  819   MA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQT--PENAQRHSSGMRWlll  986
             ++  +      EGN  LCG+ V   C     K+ G G    T   +N+ R +  +  L++
Sbjct  211   LSDRKNLVMKLEGNEALCGKAVNVGCEAIDPKETGDGLPPPTDGTDNSNRTTINVVLLVI  270

Query  987   sivaglllvailFNKNQNEENVKTRRKD-----NLDEVLVVQIASMARSESINHs-----  1136
             S +    +V     K   ++N   R+ D     ++ EV V +  ++ RS   +       
Sbjct  271   SFLMMCCIVVGFIKKRNKKQNAGFRKLDKERPSDVVEVKVPESTTVKRSTESSKKRGGNS  330

Query  1137  ----------srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
                         +     G     GD ++VN ++G FGL +LM A+AEVLGNG LGSAYK
Sbjct  331   EGGSTKKGSSHGKGGGGRGGGGGMGDIIMVNTDKGSFGLPDLMKAAAEVLGNGSLGSAYK  390

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   GL VVVKR+++ NK+  +AFD EMR++G +RH N+L  LAYHYR++EKLVVSE+
Sbjct  391   AVM-ANGLAVVVKRIRDMNKLASEAFDVEMRRLGTIRHPNVLTPLAYHYRQEEKLVVSEY  449

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              PK SLLY+LHGDRG  H++L  ATR+KII+GVA GM++LH EFA+Y+LPHGNLKSSNIL
Sbjct  450   MPKSSLLYVLHGDRGIQHSELTWATRLKIIQGVAHGMQFLHEEFASYELPHGNLKSSNIL  509

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTG  1817
             L+ TYEPL++DYAF P +  +   Q MFA K PE     Q+SHKSDVYCLGI++LE++TG
Sbjct  510   LSETYEPLISDYAFLPFLQPS-NAQAMFAYKTPEFAQNQQVSHKSDVYCLGIIVLEILTG  568

Query  1818  KFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTE  1997
             KFPSQYL+  KGG D+V+WV+ ++A+ KE E+IDPEI G   DS  +M++LL+ GAAC  
Sbjct  569   KFPSQYLNTGKGGIDIVEWVQSSIAEHKEEELIDPEI-GNNADSVQQMLELLRTGAACIA  627

Query  1998  SDVEKRLSMKEAIKRIREIQ  2057
             S+ ++R  M+E ++RI +++
Sbjct  628   SNPDERPDMRETVRRIEQVK  647



>emb|CDY20366.1| BnaC02g24500D [Brassica napus]
Length=627

 Score =   516 bits (1328),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 291/634 (46%), Positives = 403/634 (64%), Gaps = 38/634 (6%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             L+ FSF   LQ       V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C
Sbjct  9     LLCFSFTPSLQ------HVSESEPLMRFKTSVNITKGDLNSWRTGTDPCNG--KWFGIYC  60

Query  396   HR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
              R +TV+G+ +  +GL+G I V+ L +L  LR I L NN  SGP+P F KL  L+SL + 
Sbjct  61    QRGQTVSGIHVTKLGLSGIIHVEDLKDLPNLRTIRLDNNLLSGPLPPFFKLHGLRSLLLS  120

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
              N FSGEI+ D+F  M  L++++L  N F+G IP SL +L  L ELHL+GN FS  +P L
Sbjct  121   NNSFSGEIADDFFKDMLQLKRIFLDQNDFTGKIPTSLMQLTGLEELHLQGNQFSGEIPLL  180

Query  753   A--QRSLTILDLSGNKLQGEIPSGMAR--FGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
                 ++L ++DLS N L+GEIP  +A        F+GN +LCG+P+   C      D   
Sbjct  181   TDGNKNLKLIDLSNNNLEGEIPKSIAERNIVKMNFQGNQKLCGQPLNIMC------DDKP  234

Query  921   GAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQI  1100
              A  + P      +  M  L L I   L+ +   + K +  E  +   KD+L +   V++
Sbjct  235   PALGKNPNEVTGKAVFMVILFLLIFLILVAIITRWKKKRQPE-FRMLSKDHLSDTESVEV  293

Query  1101  -----------ASMARSES--INHssrrststegsssrggDFVLVNEERGMFGLSELMMA  1241
                        AS  RS +   +          G     GD ++VN E+  FGL +LM A
Sbjct  294   RMPDSVKKPVEASKKRSNADGSSKKGSTHHGKGGGGGGMGDIIMVNSEKCSFGLPDLMKA  353

Query  1242  SAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLL  1421
             +AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+++DAF  E+++ G LRH N+L  L
Sbjct  354   AAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLSRDAFHVELQRFGKLRHPNVLTPL  412

Query  1422  AYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFA  1601
             AYHYR++EKLVVSE+ PK SLLY+LHGDRGT H++L  +TR+KII+GVA GM++LH EFA
Sbjct  413   AYHYRREEKLVVSEYMPKSSLLYVLHGDRGTFHSELTWSTRLKIIQGVALGMQFLHEEFA  472

Query  1602  TYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKS  1772
             +Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q +FA K+PE     Q+S KS
Sbjct  473   SYELPHGNLKSSNVLLSETYEPLVSDYAFLPLLQPDNASQALFAFKSPEFAQNQQVSPKS  532

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             DVYCLG+++LE++TGKFPSQYL+N KGGTD+++WV+ +VA  KE E+IDPEI+ +  DS 
Sbjct  533   DVYCLGVILLEIMTGKFPSQYLNNGKGGTDIIEWVQSSVAQHKEEELIDPEIS-SNTDSL  591

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +MV+LL+IGA C  S+ + R +MKE + RI  I
Sbjct  592   QQMVELLRIGAVCIASNPDDRENMKEIVTRIERI  625



>emb|CDY16555.1| BnaC09g37180D [Brassica napus]
Length=649

 Score =   514 bits (1324),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 282/620 (45%), Positives = 401/620 (65%), Gaps = 35/620 (6%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDA  464
             L+ FK S++ TKG  ++W  G  PC  + +WFG+ C +  TV+G+ +  +GL+G I VD 
Sbjct  34    LVRFKNSVKITKGDLNSWRLGTDPC--SGKWFGIYCQKGLTVSGIHVTRLGLSGTISVDD  91

Query  465   LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
             L  L  L+ + L NN  SGP+P F KLR LKS+ +  N FSGEI  D+F  M  L++L+L
Sbjct  92    LKALANLKTVRLDNNLLSGPLPHFFKLRGLKSIMLSNNTFSGEIPDDFFKDMPKLKRLFL  151

Query  645   SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ--RSLTILDLSGNKLQGEIPSG  818
              HN F G IP+S+ +LP L ELHL+ N FS  +PPL +  ++L  LDLS N+L+GE+ +G
Sbjct  152   DHNQFVGKIPSSIMQLPHLEELHLQDNKFSGEIPPLIETNKNLKSLDLSNNQLEGEVQAG  211

Query  819   MA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGG--AEAQTPENAQRHSSGMRWlll  986
             ++  +      EGN  LCG+ V   C     K+ G G    ++  +N+ R +     L++
Sbjct  212   LSDRKNLVMKLEGNEGLCGKAVNVGCEAIDPKETGDGIPPPSEGTDNSNRTTINAVLLVI  271

Query  987   sivaglllvailFNKNQNEENVKTRRKD-----NLDEVLVVQIASMARSESINHs-----  1136
             S +    +V     K   ++N   R+ D     ++ EV V +  ++ RS   +       
Sbjct  272   SFLMMCCIVVGFIKKRNKKQNAGFRKLDKERPSDVVEVKVPESTTVKRSTESSKKRGGNS  331

Query  1137  ----------srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
                         +     G     GD ++VN ++G FGL +LM A+AEVLGNG LGSAYK
Sbjct  332   EGGSTKKGSSHGKGGGGRGGGGGMGDIIMVNTDKGSFGLPDLMKAAAEVLGNGSLGSAYK  391

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   GL VVVKR+++ NK+  +AFD EMR++G ++H N+L  LAYHYR++EKLVVSE+
Sbjct  392   AVM-ANGLAVVVKRIRDMNKLASEAFDVEMRRLGKIQHPNVLTPLAYHYRQEEKLVVSEY  450

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              PK SLLY+LHGDRG  H++L  ATR+KII+GVA GM++LH EFA+Y+LPHGNLKSSNIL
Sbjct  451   MPKSSLLYVLHGDRGIQHSELTWATRLKIIQGVAHGMQFLHEEFASYELPHGNLKSSNIL  510

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTG  1817
             L+ TYEPL++DYAF P +  +   Q MFA K PE     Q+SHKSDVYCLGI++LE++TG
Sbjct  511   LSETYEPLISDYAFLPFLQPS-NAQAMFAYKTPEFAQNQQVSHKSDVYCLGIIVLEILTG  569

Query  1818  KFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTE  1997
             KFPSQYL+  KGG D+V+WV+ ++A+ KE E+IDPEI G   DS  +M++LL+ GAAC  
Sbjct  570   KFPSQYLNTGKGGIDIVEWVQSSIAEHKEEELIDPEI-GNNADSVQQMLELLRTGAACIA  628

Query  1998  SDVEKRLSMKEAIKRIREIQ  2057
             S+ ++R  M+E ++RI +++
Sbjct  629   SNPDERPDMRETVRRIEQVK  648



>ref|XP_008786941.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Phoenix dactylifera]
Length=683

 Score =   515 bits (1327),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 284/616 (46%), Positives = 381/616 (62%), Gaps = 36/616 (6%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
             D+  L+E K+SL N  GL      G  PC    +W GV C    ++GL L  + L+G ID
Sbjct  26    DESALLELKDSLTNAGGLSSWSANGGPPC----KWTGVFCTNNVISGLNLAGLSLSGKID  81

Query  456   VDALSNLQGLRMIALANNSFSGPIPD-FDKLRHLKSLFIQGNRFSGEISADYFAKMTGLR  632
             +DAL++L+GLR I L NNS SGP P    +L  LKS+++ GN+ SG I +D FA M  L+
Sbjct  82    IDALASLKGLRSINLNNNSLSGPFPTALSRLGALKSIYLSGNKLSGSIPSDVFASMRHLK  141

Query  633   KLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIP  812
             KLWL HN FSG +P+SL  L  L+EL ++ N F  A+P  + ++L   +   NKL G IP
Sbjct  142   KLWLDHNNFSGPVPSSLANLAYLMELRIDDNAFEGAIPDFSSKALKAFNAGNNKLSGPIP  201

Query  813   SGMARFGAKAFEGNPELCGEPVGRQ-CREDLGKDGGGGAEAQTPENAQRHSSGMRWllls  989
               +ARF A AF+GNP LCG P+    C              +TP ++ R S   +  ++ 
Sbjct  202   DSLARFDAAAFQGNPGLCGGPLSTAPCSTT--------PPTETPASSDRESGSGKRAVIL  253

Query  990   ivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIA--------SMARSESINHssrr  1145
             IVA LL  A++     N +    R+ D L  V   +          ++A SES       
Sbjct  254   IVAALLAFALVAAFLINHQRHPDRKFDTLGVVAKAKALEASAAAGPTLAASESSYKQKSV  313

Query  1146  ststegsssrggD----------FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAAL  1295
              +S + S S   D           V++NEE+G+FGLS+LM ASAEVLGNG LGSAYKA +
Sbjct  314   GSSHKRSGSSRSDSADGAGVAGELVMLNEEKGVFGLSDLMKASAEVLGNGSLGSAYKAVM  373

Query  1296  PVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPK  1475
                GL V VKR++E N++ KDAFD +MR++G LRH N+L  LA+HYRK+EKL+VSE+  K
Sbjct  374   -ASGLAVAVKRMREMNRVGKDAFDEQMRRLGRLRHPNVLTPLAFHYRKEEKLIVSEYVQK  432

Query  1476  GSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTP  1655
             GSLLY+LHGDRG  H  L   TR+ II+G+A G+ YLH E A   +PHGNLKS N+LL P
Sbjct  433   GSLLYILHGDRGPDHMALDWPTRLTIIRGIARGIAYLHVELAALDVPHGNLKSGNVLLRP  492

Query  1656  TYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVYCLGIVILEVVTGKFP  1826
              +EP+L DY F  LV+ +   Q MF+ K+PE  Q  H   KSDVYCLG+V+LEV+TGKFP
Sbjct  493   DFEPILVDYGFIGLVNPSQASQVMFSYKSPETLQYRHVSPKSDVYCLGVVMLEVLTGKFP  552

Query  1827  SQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDV  2006
             + YL+N KGGTDVVQW   A+A+ +E+E++DP I    +    KMV+LLQ+GAAC + D 
Sbjct  553   THYLNNTKGGTDVVQWTASAIAENREAELLDPAITAGNKAWKPKMVRLLQLGAACADVDP  612

Query  2007  EKRLSMKEAIKRIREI  2054
             E+R  M+E ++ I EI
Sbjct  613   EQRPDMEEVVRLIEEI  628



>gb|EYU45896.1| hypothetical protein MIMGU_mgv1a025291mg [Erythranthe guttata]
Length=633

 Score =   513 bits (1322),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 289/599 (48%), Positives = 391/599 (65%), Gaps = 30/599 (5%)
 Frame = +3

Query  294   EFKESLQNTKGLDDTWVKGKSPCDKT-RRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDAL  467
             + K+S  N   LD +W     PC K   RW GV+C     V+ LRL N+GL+G IDVDAL
Sbjct  36    KLKQSFTNATSLD-SWNPTTEPCSKNGPRWIGVICDSSGVVSSLRLGNLGLSGKIDVDAL  94

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
               L GLR IA  +N+F+GPIP+F ++ +LK L++  N FSGEI +DYF KM GL+K+WLS
Sbjct  95    VPLSGLRSIAFMSNAFAGPIPEFHRMVNLKGLYLSDNGFSGEIPSDYFTKMMGLKKVWLS  154

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N F+G IP SL +L  L+ELHLE N F   +PPL Q SL  L+LS N L+GEIP  +++
Sbjct  155   GNSFTGPIPYSLSQLFHLMELHLEDNRFFGNIPPLEQTSLVSLNLSNNNLEGEIPMVLSK  214

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivagll  1007
             FG  +F GNP LC   +G  C   +       A ++  EN+  + S + W+L+      L
Sbjct  215   FGPDSFRGNPGLCSAHLGNSCSSSIT------ASSERLENSSYYRSVVNWILVVSGLVFL  268

Query  1008  lvailFNKNQNEENVKTRRKDN-----LDEVLVVQIASMARSESINHssrrs----tste  1160
             L+ I          V  RR+D+     LD+    + AS  R +S +   R      +S  
Sbjct  269   LMVIGIF-------VLKRRQDSSLDFMLDDSYSFRGASSIRRKSKHEPGRDRYGPGSSRR  321

Query  1161  gsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKET  1340
              S   G D V++++E+G FG+S+LM A+AEVLGNG LGS+YKA +   G TVVVKR+KE 
Sbjct  322   ASKKFGDDIVMISDEKGEFGMSDLMRAAAEVLGNGALGSSYKATMGS-GFTVVVKRVKEM  380

Query  1341  NKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAH  1520
              KM K+ FD EMR++G L+H N+L  LAYHYRK+EKL+V E+ PKG+LL+LLHGDRG++H
Sbjct  381   AKMGKEQFDVEMRRLGSLKHENVLAPLAYHYRKEEKLLVYEYQPKGNLLFLLHGDRGSSH  440

Query  1521  NDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLV  1700
              +L    R+KIIKG+A G+ YLH + ++  LPHG+LKSSN++LT  YEPL+ DY F  L+
Sbjct  441   AELTWPVRLKIIKGIARGLGYLHNQLSSLDLPHGDLKSSNVILTDEYEPLIVDYGFCSLI  500

Query  1701  SGTPTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVV  1868
             SG    Q + A K+PE      IS K DVYCLG+VILE++TGKFPS YL+  + GG D+V
Sbjct  501   SGARAAQTLTAFKSPEALVDRYISPKCDVYCLGVVILEIITGKFPSFYLNRGEHGGIDIV  560

Query  1869  QWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
             QWV+ AV++GKE ++ DP+I  + +D  G+M K+L IGAACTES  E RL + EA++RI
Sbjct  561   QWVQSAVSEGKEEDLFDPDIEISDKDWLGEMKKVLHIGAACTESKPELRLDLTEAVRRI  619



>ref|XP_010535804.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Tarenaya hassleriana]
Length=635

 Score =   513 bits (1320),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 285/606 (47%), Positives = 401/606 (66%), Gaps = 25/606 (4%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR-KTVTGLRLYNMGLAGDIDVDA  464
             LI FK ++  TKG  ++W  G  PC+   +WFG+ C   ++VTG+ +  +GL G+I V  
Sbjct  34    LIHFKNTINITKGDLNSWRAGTDPCNG--KWFGIYCQNGESVTGIHVTRLGLTGEISVQD  91

Query  465   LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
             L  L  LR + L NN  SGP+P F  LR LKSL +  N FSGEIS D+F  M  L++L+L
Sbjct  92    LKALTSLRTLRLDNNMLSGPLPPFHMLRGLKSLLLSNNSFSGEISDDFFKDMPQLKRLFL  151

Query  645   SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL--AQRSLTILDLSGNKLQGEIPSG  818
              +N F+G IP SL +L  L E+HL+GN FS  +P L  A + L  +DLS N L+GEIP  
Sbjct  152   DNNHFAGQIPTSLMQLLVLEEIHLQGNQFSGQIPELTDANKILKSIDLSNNDLEGEIPKS  211

Query  819   MA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsi  992
             ++  +     F GN  LCG+P+   C     +      E    E +Q +   +   ++ +
Sbjct  212   ISERKNLEMNFRGNQRLCGQPLNVVCDPSDARKIDPMTEQ---ELSQLNIKSILISIVVL  268

Query  993   vaglllvailFNKNQNEENVKTRRKDNLD-----EVLVVQIASMARSES-----INHssr  1142
             +   ++V I+  + + E + +   K++L      EV V +  S   SES     ++ S++
Sbjct  269   IIFFIIVGIISRRRRREPDFRMLSKEHLSDNEVVEVRVPETTSKKPSESTKKRDLDGSTK  328

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
             + TS  G  S  GD ++VN++RG FGL +LM A+AEVLGNG LGSAYKA +   GL VVV
Sbjct  329   KGTSNHGKGSGMGDIIMVNKDRGSFGLPDLMKAAAEVLGNGSLGSAYKAVMGN-GLAVVV  387

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR+++ NK+ K+AFD EMR++G LRH NIL  LAYHYR++EKL+VSE+ PK SLLY+LHG
Sbjct  388   KRIRDMNKLGKEAFDVEMRRLGQLRHPNILTPLAYHYRREEKLIVSEYMPKSSLLYVLHG  447

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
             DRG  H++L   TR+KII+GV  GM++LH EF +Y+LPHGNLKSSN+LL+  YEPL++DY
Sbjct  448   DRGICHSELTWPTRLKIIQGVVRGMQFLHEEFTSYELPHGNLKSSNVLLSENYEPLISDY  507

Query  1683  AFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
             AF PL+      Q +FA K PE     ++S KSDVYCLGI++LE++TGKFPSQYL+N KG
Sbjct  508   AFLPLLQPENATQSLFAFKTPEFTQNQRVSAKSDVYCLGIIVLEILTGKFPSQYLNNGKG  567

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEA  2033
             GTD+VQWV+ ++++GKE E+IDPEIA   E S  +M++LL+IGA+C  ++ ++RL MKE 
Sbjct  568   GTDIVQWVQTSISEGKEEELIDPEIASNTE-SVAQMIELLRIGASCIATNPDERLDMKET  626

Query  2034  IKRIRE  2051
              +RI++
Sbjct  627   ARRIKQ  632



>ref|XP_011036550.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Populus euphratica]
Length=657

 Score =   513 bits (1320),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 281/629 (45%), Positives = 401/629 (64%), Gaps = 19/629 (3%)
 Frame = +3

Query  210   FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
             F L+F  F L      L+ SV +   LI  K+S  N  G   +W+ G  PC+K   W GV
Sbjct  10    FLLLFIIFTLQFS---LTSSVSESESLIRLKKSFTNA-GAISSWLSGSVPCNKQTHWHGV  65

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
             +C    VTGL+L NMGL+G IDV+AL+N+QGLR ++ A N F+G IP  ++L +LK++++
Sbjct  66    VCFNGIVTGLQLENMGLSGTIDVEALANMQGLRSVSFAYNYFTGKIPALNRLGNLKAIYL  125

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
             +GN+FSGEI +D+F KM  L+K+W+S N FSG IP+SL +L RL ELHLE N FS  +P 
Sbjct  126   RGNQFSGEIPSDFFFKMKSLKKVWISDNNFSGGIPSSLAELSRLGELHLENNRFSGTIPS  185

Query  750   LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR--------EDLG  905
             + Q +L   ++S NKL GEIP  +ARF   +F GN  LCGE +G+ C          D+G
Sbjct  186   IDQPTLMSFNVSNNKLDGEIPPNLARFNFSSFRGNDGLCGEKIGKGCELQGSSEPPTDVG  245

Query  906   KDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEV  1085
              D           +  +  +G   L + +V+ + +V     +   + +    R       
Sbjct  246   VDANMMVSDNKRNSVTKTVAGFVTLAVLLVSIIAVVIFRMRRRDKDFDAIENRSSGDAAA  305

Query  1086  LVVQIASMARS---ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVL  1256
             L VQ++   R    E           +       G+ V+VN E+ +FGL +LM ASAEVL
Sbjct  306   LEVQVSLSNRPKEMEVAKKMGSGRKGSNHGRGVVGELVIVNNEKSVFGLPDLMKASAEVL  365

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             GNG LGS+YK  +   G+ VVVKR++E N ++K  F+AE+RK+G L H NIL  LA+HYR
Sbjct  366   GNGVLGSSYKTQM-ANGVVVVVKRVREMNTLSKSQFNAEIRKLGRLHHPNILTPLAFHYR  424

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
               EKL++ +F PKGSLLYLLHGDRG +H +L  + R+KI++G+A+G+ YLHTE A   LP
Sbjct  425   PDEKLLIYDFVPKGSLLYLLHGDRGPSHAELSWSVRLKIVQGIANGLGYLHTELAPSNLP  484

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ--ISHKSDVYCLG  1790
             HGNLKSSN+ L+   EP+L+++   PL+S     Q +F  +APE  +  +S KSDVYCLG
Sbjct  485   HGNLKSSNVFLSNDNEPILSEFGLSPLISPPTLAQALFGYEAPEAAEFGVSPKSDVYCLG  544

Query  1791  IVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKL  1970
             I+ILE+++GK PSQYL+N +GGTDVVQWV  A++DG+E++ +DPEIA + ++S  +M +L
Sbjct  545   IIILEILSGKIPSQYLNNARGGTDVVQWVESAISDGRETDFLDPEIA-SSKNSLCQMKQL  603

Query  1971  LQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             L IGAAC + + E+RL + +AI+ I+EI+
Sbjct  604   LGIGAACVKRNPEQRLDITQAIQLIQEIK  632



>ref|XP_009126469.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Brassica rapa]
Length=633

 Score =   501 bits (1289),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 286/648 (44%), Positives = 402/648 (62%), Gaps = 39/648 (6%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGK  353
             MAAV  IP+F        ++L C  +S S   + +   L+ FK S++ TKG  ++W  G 
Sbjct  1     MAAVL-IPSF--------ILLMCFWISPSLQHISEAEPLVSFKNSVKITKGDLNSWKIGT  51

Query  354   SPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP  530
              PC    +WFG+ C++  TVTG+ +  +GL G I VD L  L  L+ + L NN  SG +P
Sbjct  52    DPCGG--KWFGIYCNKGLTVTGIHVTQLGLTGTIKVDDLKALPNLKTVRLDNNLLSGHLP  109

Query  531   DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVEL  710
             +F KLR LKSL +  N FSGEI  D+F  +  L++L+L HN F GNIP+S+ +LP L E+
Sbjct  110   NFSKLRGLKSLMLSNNSFSGEIPDDFFKDLPRLKRLFLDHNKFVGNIPSSIMQLPDLEEV  169

Query  711   HLEGNGFSSAVPPLA--QRSLTILDLSGNKLQGEIPSGMA-RFGAKA-FEGNPELCGEPV  878
             HL+GN F+  +PPL+   +++ ILDLS N L GE+P  +  R    A FEGN ++CG+ +
Sbjct  170   HLQGNKFTGKIPPLSDVNKNMKILDLSDNLLGGEVPESIPNRKNLTANFEGNKDVCGKSI  229

Query  879   GRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvai---lFNKNQNEEN  1049
               +C+       G      T      H+S + + ++  +  L    I      + + + N
Sbjct  230   NIECKSVEVTPSGQITLPPTTNPESTHASSIVYAIMLALTFLFTFFIVVGAIKRRKKKIN  289

Query  1050  VKTRR--KDNLD--EVLVVQIASMARSESINHssrrststegsssr-----ggDFVLVNE  1202
              + R   K+ L   E L V++   +++   N     +                D V+VN 
Sbjct  290   AEFRMLDKERLSDLEALQVKVPEPSKNRGGNMDVGSTKKGGVGGGGEVGGGMSDLVMVNN  349

Query  1203  ERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRK  1382
             E+G FGL  LM A+AEVLG+G LGSAY A +   GL+VVVKR+++ NK   +AFD EMR+
Sbjct  350   EKGSFGLPHLMKAAAEVLGSGSLGSAYMAVM-ANGLSVVVKRIRDMNKFAPEAFDVEMRR  408

Query  1383  MGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKG  1562
             +G LRH N+L  LAYHYR++EKLVVSE+ P  SLLY+LHGD G   ++L  ATR+KIIKG
Sbjct  409   LGKLRHPNVLTPLAYHYRREEKLVVSEYMPNSSLLYVLHGDSGEYRSELTWATRLKIIKG  468

Query  1563  VASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKA  1742
             VA GM+YLH EFA+Y LPHGNLKSSN+LL   Y+P+++DYAF P +      Q +FA K 
Sbjct  469   VAQGMQYLHQEFASYDLPHGNLKSSNVLLNENYKPVISDYAFLPFLEPNIASQTLFAYKT  528

Query  1743  PE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEV  1913
             PE     Q+SHKSDVYCLGI+ILE++TGKFPSQY    KGGTD+VQWV+ ++A  K  E+
Sbjct  529   PEFAQNQQVSHKSDVYCLGIIILEILTGKFPSQY---GKGGTDIVQWVQSSMAAQKGEEL  585

Query  1914  IDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             IDPEI  +  DS  +M++LL+IGAAC  S+ ++RL + E ++RI +++
Sbjct  586   IDPEIVKS-TDSMQQMLELLRIGAACIASNPDERLDISEVVRRIEQVK  632



>emb|CDY45073.1| BnaA02g05030D [Brassica napus]
Length=638

 Score =   498 bits (1283),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 281/653 (43%), Positives = 400/653 (61%), Gaps = 44/653 (7%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGK  353
             MAAV  IP+F        ++L C  +S S   + +   L+ FK S++ TKG  ++W  G 
Sbjct  1     MAAVP-IPSF--------ILLMCFWISPSLQHISEAEPLVSFKNSVKITKGDLNSWKIGT  51

Query  354   SPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP  530
              PC    +WFG+ C++  TVTG+ +  +G+ G I VD L  L  L+ + L NN  SG +P
Sbjct  52    DPCGG--KWFGIYCNKGLTVTGIHVTQLGVTGTIKVDDLKALPNLKTVRLDNNLLSGHLP  109

Query  531   DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVEL  710
             +F KLR LKSL +  N FSGEI  D+F  +  L++L+L HN F GNIP+S+ +LP L E+
Sbjct  110   NFSKLRGLKSLMLSNNSFSGEIPDDFFKDLPRLKRLFLDHNKFVGNIPSSIMQLPDLEEV  169

Query  711   HLEGNGFSSAVPPLA--QRSLTILDLSGNKLQGEIPSGMA-RFGAKA-FEGNPELCGEPV  878
             HL+GN F+  +PPL+   +++ ILDLS N L GE+P  +  R    A FEGN ++CG+ +
Sbjct  170   HLQGNKFTGKIPPLSDVNKNMKILDLSDNLLGGEVPESIPNRKNLTANFEGNKDVCGKSI  229

Query  879   GRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiva---glllvailFNKNQNEEN  1049
               +C+       G      T      H+S + + ++  +       +V     + + + N
Sbjct  230   NIECKSVEVTPSGQITLPPTTNPESTHASSIVYAIMLALTFLFTFFIVVGAIKRRKKKIN  289

Query  1050  VKTRR--KDNLDEVLVVQIA------------SMARSESINHssrrststegsssrggDF  1187
              + R   K+ L ++  +Q+              +  ++                    D 
Sbjct  290   AEFRMLDKERLSDLEALQVKVPEPSKNRGGNMDVGSTKKGGVGGGGGGGGGEVGGGMSDL  349

Query  1188  VLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFD  1367
             V+VN E+G FGL  LM A+AEVLG+G LGSAY A +   GL+VVVKR+++ NK   +AFD
Sbjct  350   VMVNNEKGSFGLPHLMKAAAEVLGSGSLGSAYMAVM-ANGLSVVVKRIRDMNKFAPEAFD  408

Query  1368  AEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRI  1547
              EMR++G LRH N+L  LAYHYR++EKLVVSE+ P  SLLY+LHGD G   ++L  ATR+
Sbjct  409   VEMRRLGKLRHPNVLTPLAYHYRREEKLVVSEYMPNSSLLYVLHGDSGEYRSELTWATRL  468

Query  1548  KIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCM  1727
             KIIKGVA GM+YLH EFA+Y LPHGNLKSSN+LL   Y+P+++DYAF P +      Q +
Sbjct  469   KIIKGVAQGMQYLHQEFASYDLPHGNLKSSNVLLNENYKPVISDYAFLPFLEPNIASQTL  528

Query  1728  FALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADG  1898
             FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQY    KGGTD+VQWV+ ++A  
Sbjct  529   FAYKTPEFAQNQQVSHKSDVYCLGIIILEILTGKFPSQY---GKGGTDIVQWVQSSMAAQ  585

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             K  E+IDPEI  +  DS  +M++LL+IGAAC  S+ ++RL + E ++RI +++
Sbjct  586   KGEELIDPEIVKS-TDSMQQMLELLRIGAACIASNPDERLDISEVVRRIEQVK  637



>ref|XP_010520528.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At5g20690 [Tarenaya hassleriana]
Length=629

 Score =   493 bits (1268),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 291/643 (45%), Positives = 413/643 (64%), Gaps = 35/643 (5%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSIS-VGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
             MAA     +  +IFF  CL L  LP S+  + +   LI FK ++  TKG  ++W  G  P
Sbjct  1     MAAFPSPLSIGVIFF--CLSL--LPPSLQHMNEAESLIRFKNTMNITKGDLNSWRTGTDP  56

Query  360   CDKTRRWFGVLCHR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDF  536
             C+   +WFG+ C + + V+G+ +  +GL+G I V  L  L  LR I L NN  SGP+P F
Sbjct  57    CNG--KWFGIYCQKGQWVSGIHVTRLGLSGSISVQDLKALTNLRTIRLDNNLLSGPLPPF  114

Query  537   DKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHL  716
               LR L+SL +  N FSGEIS D+F  M  L++++L +N F G IP SL +L  L ELHL
Sbjct  115   HVLRGLRSLLLSNNSFSGEISDDFFKDMPQLKRVFLDNNEFKGTIPTSLMQLHDLEELHL  174

Query  717   EGNGFSSAVPPL--AQRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGR  884
             +GN FS  +P L  A + L  +DLS N L+GEIP  ++  +     F+GN +LCG+P+  
Sbjct  175   QGNQFSGHIPSLTDANKILKSIDLSNNDLEGEIPKSISERKNLEMHFQGNQKLCGQPLNV  234

Query  885   QCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRR  1064
              C+  + ++     E    E++Q     +   +  ++   ++VA++  + + E + +   
Sbjct  235   VCQPSVTRNLDPKTEQ---EHSQHAIKAILTSIAVLILFFIIVAVISRRRRREPDFRMLG  291

Query  1065  KDNLDEVLVVQI----------ASMARSESINHssrrststegsssrggDFVLVNEERGM  1214
             K++L +  VV++              R    + SS++ +S  G     GD ++VN ++G 
Sbjct  292   KEHLSDNEVVEVRVPESTAKKPTDSGRKRDSDVSSKKGSSHHGKGGGMGDIIMVNTDKGS  351

Query  1215  FGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGML  1394
             FGL +LM A+AEVLGNG LGSAYKA L   GL VVVKR      ++ ++FD EMR++G L
Sbjct  352   FGLPDLMKAAAEVLGNGSLGSAYKA-LMANGLAVVVKR-----XLSTESFDVEMRRLGQL  405

Query  1395  RHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASG  1574
             RH N+L  LAYHYR++EKL+VSE+ PK SLLY+LHGDRG  H++L   TR+KII+GVA G
Sbjct  406   RHPNVLTPLAYHYRREEKLIVSEYMPKSSLLYVLHGDRGIYHSELTWKTRVKIIRGVARG  465

Query  1575  MEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---  1745
             M++LH EF +Y+LPHGNLKSSN+LL+  YEPL++DYAF PL+      Q +FA K P   
Sbjct  466   MQFLHEEFESYELPHGNLKSSNVLLSENYEPLISDYAFLPLLQPENAAQTLFAFKTPEFT  525

Query  1746  EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPE  1925
             E  Q+S KSDVYCLGI++LE++TGKFPSQYL+N KGGTD+VQWV+ ++A+ KE E+IDPE
Sbjct  526   EKQQVSAKSDVYCLGIIVLEILTGKFPSQYLNNGKGGTDIVQWVQSSIAEHKEDELIDPE  585

Query  1926  IAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             IA   E S  +M +LL+IGAAC  S+ ++RL MKEA++RI ++
Sbjct  586   IASDTE-SAAEMAELLRIGAACIASNPDERLGMKEAVRRIEQV  627



>gb|KHN39608.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=621

 Score =   492 bits (1266),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 269/606 (44%), Positives = 375/606 (62%), Gaps = 46/606 (8%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
             L+  K S  N + L DTWV G +PC +  +W GV C+   VTGLRL  +GLAG+I VD L
Sbjct  7     LVSLKSSFSNPE-LLDTWVPGSAPCSEEDQWEGVACNNGVVTGLRLGGIGLAGEIHVDPL  65

Query  468   SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
               L+GLR I+L NN+FSG +P+F ++  LK+L++QGN+FSG+I  DYF +M  L+KLWL+
Sbjct  66    LELKGLRTISLNNNAFSGSMPEFHRIGFLKALYLQGNKFSGDIPMDYFQRMRSLKKLWLA  125

Query  648   HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMAR  827
              N F+G IP+SL ++P+L+ELHLE N F   +P L+  SL   ++S NKL+G IP+G+ R
Sbjct  126   DNQFTGKIPSSLVEIPQLMELHLENNQFVGNIPDLSNPSLVKFNVSNNKLEGGIPAGLLR  185

Query  828   FGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivagll  1007
             F   +F GN  LC E +G+ C + +              +    SS      + + +  L
Sbjct  186   FNVSSFSGNSGLCDEKLGKSCEKTMEPPSPSPIVGDDVPSVPHRSSSFEVAGIILASVFL  245

Query  1008  lvailF----NKNQNEENVKTRRKDNLDEVLVVQIASMAR---------SESINHssrrs  1148
             +  ++F    ++ + EEN  T  ++  +  + VQ+ +  +         S  +  SS R 
Sbjct  246   VSLVVFLIVRSRRKKEENFGTVGQEANEGSVEVQVTAPVKRDLDTASTSSTPVKKSSSRR  305

Query  1149  tstegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKR  1328
                   S   G+ V+VN E+G+FG+ +LM A+AEVLGNG  GS+YKA L   G+ VVVKR
Sbjct  306   GCISSQSKNAGELVMVNNEKGVFGMPDLMRAAAEVLGNGSFGSSYKAVL-ANGVAVVVKR  364

Query  1329  LKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDR  1508
              +E N + KD FDAEMRK+ ML+H NIL  LAYH+RK EKLV+SE+ P+GSLL+ LHGDR
Sbjct  365   TREMNVLEKDDFDAEMRKLTMLKHWNILTPLAYHFRKDEKLVISEYVPRGSLLFSLHGDR  424

Query  1509  GTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAF  1688
             G +H +L    R+KI++G+A GM YL+T   +  LPHGNLKSSN+LL P  EP+L DY F
Sbjct  425   GASHVELDWPARLKIVRGIAQGMHYLYTVLGSSDLPHGNLKSSNVLLGPDNEPMLVDYGF  484

Query  1689  HPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT  1859
               +V+ +   Q +FA KAPE  Q   +S   DVYCLG+VI+E++TG+FPSQYLSN KG  
Sbjct  485   SHMVNPSTIAQTLFAYKAPEAAQQGQVSRSCDVYCLGVVIIEILTGRFPSQYLSNGKGSR  544

Query  1860  DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIK  2039
             +   W+                         G+M +LL IGAACTES+ + RL M EA++
Sbjct  545   N---WL-------------------------GEMEQLLHIGAACTESNPQWRLDMAEAVR  576

Query  2040  RIREIQ  2057
             RI EI+
Sbjct  577   RIMEIK  582



>emb|CDP03056.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   452 bits (1164),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 274/631 (43%), Positives = 364/631 (58%), Gaps = 135/631 (21%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             M AVRR+P+      S  LIL   P+S S+ DD  L  FK+SL+NT  +D +W+KG SPC
Sbjct  1     MTAVRRLPS---QLLSLFLILFLSPVSTSLKDDEALFGFKDSLRNTAAIDSSWIKGTSPC  57

Query  363   DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
                + W GV+CH +TV  +RL                                       
Sbjct  58    AAGKTWKGVVCHEETVQTIRL---------------------------------------  78

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
                      QG   SG+I  +Y +K+  LR L L++                        
Sbjct  79    ---------QGIGLSGDIDVEYLSKLENLRSLTLAY------------------------  105

Query  723   NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
             N FS  +PP             NKL                                   
Sbjct  106   NNFSGPIPPF------------NKL-----------------------------------  118

Query  903   GKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE  1082
                  GG  A   +  Q   SG +W++L +V  LLL+ I F   Q E++     K+N+D+
Sbjct  119   -----GGLRALFIQGNQFSGSGTKWVILGVVVALLLMTIFFKAKQKEDHFDVLAKENIDD  173

Query  1083  VLVVQI---ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEV  1253
             ++ V++      + S    + S  S  +       GD V+VN+ +G FGL +LM A+AEV
Sbjct  174   IVEVRVPSSNRRSTSSRRGNDSFHSRKSSHHGKSVGDLVVVNDAKGTFGLQDLMKAAAEV  233

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LGNGGLGSAYKA +   G++VVVKR++E NK++KDAFD+E+R++G LRH NILP LAYHY
Sbjct  234   LGNGGLGSAYKALMGN-GVSVVVKRMREMNKLSKDAFDSEIRRLGNLRHQNILPPLAYHY  292

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
             RK EKL+VSEF PKGSLLYLLHGDRGT+H +L    R+KII+GVA G+ +LH+EFA+Y+L
Sbjct  293   RKDEKLLVSEFIPKGSLLYLLHGDRGTSHAELNWPIRLKIIQGVAQGLGFLHSEFASYEL  352

Query  1614  PHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEG---HQISHKSDVYC  1784
             PHGNLKSSNILL+ +YEPLLTDYAF PL+S T T Q +FA K+PE     Q++ KSDVYC
Sbjct  353   PHGNLKSSNILLSSSYEPLLTDYAFFPLISNTQTAQSLFAYKSPEAILYQQLTPKSDVYC  412

Query  1785  LGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV  1964
             LGI+ILE++TGKFPSQYL+NQKGGTD+VQWV  A+A+ +E E+IDPEIA A   S  +M 
Sbjct  413   LGIIILEILTGKFPSQYLNNQKGGTDLVQWVNSAIAESREVELIDPEIANA-TGSLAEME  471

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             KLL +GAACTES+ +KR+ ++EA++RI +IQ
Sbjct  472   KLLHLGAACTESEPDKRIDLREALRRIEQIQ  502



>ref|XP_010537633.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Tarenaya hassleriana]
Length=654

 Score =   456 bits (1174),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 262/638 (41%), Positives = 392/638 (61%), Gaps = 38/638 (6%)
 Frame = +3

Query  225   FSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK  404
              +   +   LPLS S+ +   L++FK+SL + K LD +W +   PC K  RWFG+LC++ 
Sbjct  12    LALTALFAFLPLSSSITESESLLKFKQSLPHAKSLD-SWGQNSEPCGKNFRWFGLLCNKN  70

Query  405   TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRF  584
             +V GL+L  MGL+G IDV +L+ L GLR I++ NNSF+G IP+F++L+ LK++++ GNRF
Sbjct  71    SVFGLQLERMGLSGSIDVASLTGLPGLRTISIMNNSFTGAIPEFNRLKSLKTVYLSGNRF  130

Query  585   SGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGK-LPRLVELHLEGNGFSSAVPPLAQR  761
             SG I  DYFA M  L+K+WLS+N FSG IP SL   LP L+E+HLE N F+  +P  AQ+
Sbjct  131   SGTIPPDYFANMASLKKVWLSNNEFSGPIPISLATGLPNLIEVHLENNKFNGPIPDFAQQ  190

Query  762   SLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTP  941
             SL  +D S N+L GEIP G+++F  + F GN  LCG+ +G  C+          +     
Sbjct  191   SLVQVDFSNNQLTGEIPPGLSKFDTRFFAGNVGLCGQKLGTSCQHKTNS-----SSRIVT  245

Query  942   ENAQRHSSGMRWlllsiv----aglllvailFNKNQ---NEENVKTRRKDNLDEVLVVQI  1100
             E + R++S +++++          ++L +I+F K +   +  N ++ + D   +  V   
Sbjct  246   EGSMRNASKIKYVIAFGTLGGLILIVLASIVFRKTKKKISRANPRSDQNDGTRDHHVQVT  305

Query  1101  ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN------  1262
              + +R++S      R   T    + G + V+VN E+G+FGL +LM A+AEVLG       
Sbjct  306   VAGSRNDSDKPRVGRKGGTANKLTAGAELVMVNREKGVFGLPDLMNAAAEVLGGLSTGRT  365

Query  1263  ---------GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
                      G +GS YKA +   G+ VVVKR+   N+M+KD FD E+R++G LRH N+L 
Sbjct  366   SSASRPSSGGNVGSTYKAVMGN-GVAVVVKRVTVMNQMSKDVFDKEIRRLGSLRHKNLLT  424

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
              LAYH+R+ EKL++SEF P  SLL+ LH D G    +L    R KII+G+A G+EYLH E
Sbjct  425   PLAYHFRQDEKLLISEFVPNLSLLHRLHEDHGELGLELDWPARRKIIQGIARGVEYLHRE  484

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISH  1766
                  LPHGNLKSSN+LL+   EPL++ + +H L++    +Q + A ++PE  +   +S 
Sbjct  485   LGFLTLPHGNLKSSNVLLSSDGEPLISGFGYHRLINPEAQIQSLVAYRSPEVDRTGTVSA  544

Query  1767  KSDVYCLGIVILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGE  1943
             KSDV+C+G+VILE++TGKFPSQY    + GGTD+V+WV  A   G   E++ P +A A  
Sbjct  545   KSDVFCVGVVILEILTGKFPSQYAGLGRAGGTDIVEWVGSAAEHGGWMELLHPTVAAAA-  603

Query  1944  DSD---GKMVKLLQIGAACTESDVEKRLSMKEAIKRIR  2048
             DSD    ++ ++L++G  CT  D ++R  M E ++  R
Sbjct  604   DSDQTADEVERILRVGVRCTGEDPDQRPEMIEIVEETR  641



>gb|EPS65307.1| hypothetical protein M569_09473, partial [Genlisea aurea]
Length=536

 Score =   443 bits (1139),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 257/551 (47%), Positives = 359/551 (65%), Gaps = 23/551 (4%)
 Frame = +3

Query  417   LRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEI  596
             LRL NMGL+G+I+VDAL +L GLR ++   N FSGPIP+F+++  LK L+I GNRFSGEI
Sbjct  1     LRLGNMGLSGNINVDALVSLPGLRSVSFMFNGFSGPIPEFNRIGVLKGLYISGNRFSGEI  60

Query  597   SADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTIL  776
              +D+FAKM GL+K+W S N FSG IP+SL  L +L++LHLE N FS ++P L Q SL  L
Sbjct  61    PSDFFAKMVGLKKVWFSGNNFSGPIPSSLVGLSQLIDLHLENNRFSGSIPHLGQISLVSL  120

Query  777   DLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQR  956
             +L+ N+L+GEIP+ ++RF A +F GNP LCG  +G  C            +A T  +A+ 
Sbjct  121   NLTNNRLEGEIPASLSRFDAASFSGNPGLCGTLLGLSCN----------PQASTSSSAKT  170

Query  957   HSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHs  1136
              + G+     S +  L++V I+  + +++E   T           +          I   
Sbjct  171   MALGL-LAAFSGILLLMIVGIVMMRGRHDEASYTDGDPQFSSSGRIDRDVTESGAPIQQR  229

Query  1137  srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTV  1316
             S  S     SSS  G  V++N  R  FG+ +LM A+AEVLGNG +G +YKA +   G  V
Sbjct  230   SGSSKKGSSSSSSSGVLVVMNG-REEFGMKDLMKAAAEVLGNGAVGPSYKATMKGGGSAV  288

Query  1317  VVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLL  1496
             VVKR+KE  +M K+ F+  M ++G L+H N+LPLLAYHYR++EKL++ E  PKGSLL+LL
Sbjct  289   VVKRVKEMVQMEKEEFETSMARLGRLKHTNVLPLLAYHYRREEKLLIYEHRPKGSLLFLL  348

Query  1497  HGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEF-ATYKLPHGNLKSSNILLTPTYEPLL  1673
             HGDRG  H +L    R KII+G A+G+ YLH +  A   LPHG+LKSSN+LL P YEPLL
Sbjct  349   HGDRGIGHGELNWPARKKIIQGTANGLGYLHEQLSAALDLPHGHLKSSNVLLNPDYEPLL  408

Query  1674  TDYAFHPLVSGTP---TLQCMFALKAPEGHQ-ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             +DY F  L+  TP     + + A ++PE    +S K DV+CLGI+ILE++TGKFPS Y++
Sbjct  409   SDYGFCSLI--TPAAAAERVLAAYRSPEASSAVSPKCDVFCLGILILEILTGKFPSLYVA  466

Query  1842  NQKGGTDVVQWVRQAVA--DGKE-SEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEK  2012
               +GG D+V+WVR A A  +G+  +E++DP+IA A   +  +M +LL+I AACTE+D  +
Sbjct  467   GGQGGMDLVRWVRSAAAAEEGRRLAELLDPDIA-ATPSAAAEMEELLRIAAACTEADPNQ  525

Query  2013  RLSMKEAIKRI  2045
             RL +KEA+ RI
Sbjct  526   RLDLKEAVARI  536



>ref|XP_006301629.1| hypothetical protein CARUB_v10022071mg [Capsella rubella]
 gb|EOA34527.1| hypothetical protein CARUB_v10022071mg [Capsella rubella]
Length=644

 Score =   446 bits (1148),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 257/632 (41%), Positives = 379/632 (60%), Gaps = 30/632 (5%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             + + F L L  L  + S+ +   L+ FK+SL NTK LD +W     PC ++ RW G+LC+
Sbjct  6     LIWPFVLSLTALSAN-SITETESLLNFKKSLTNTKSLD-SWTIDSEPCGESNRWVGLLCN  63

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             + +V GL++  MGL+G+IDV  L +L  LR I++ NNSFSG IP+F++L  LKS++I GN
Sbjct  64    KNSVFGLQIEQMGLSGNIDVAPLEDLPSLRTISIMNNSFSGNIPEFNRLTALKSIYISGN  123

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGK-LPRLVELHLEGNGFSSAVPPLA  755
             RFSG I +DYF  M  L+K WLS+N FSG IP SL   LP L+EL LE N F   +P   
Sbjct  124   RFSGNIPSDYFTTMVSLKKAWLSNNEFSGLIPISLATALPNLMELRLENNQFIGTIPNFT  183

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQ  935
             Q +L  +DLS NKL GEIP G+++F AK FEGN  LCG  +   C +          +  
Sbjct  184   QTTLNDVDLSNNKLTGEIPRGLSKFEAKFFEGNSRLCGAKLATACPQPRNATASVTIDG-  242

Query  936   TPENAQRHSSGMRWlllsivaglllvailFNKNQNEEN----VKTRRKDNLDEVLVVQIA  1103
             T ++A +    + +  L ++  ++L+++ F K + +      ++T  +D+ D+  +    
Sbjct  243   TLKDANKSKYFLAFGTLGVLLLVVLISLAFRKKKKKRRRKKALRTSEQDSADDQQIQITV  302

Query  1104  SMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVL---------  1256
               ++S S +    RS      S+   + V+VN+E+G+FGL++LM A+A VL         
Sbjct  303   DESKSSSRHSKGSRSGELTNKSTVAAELVMVNKEKGVFGLTDLMKAAAHVLNNPGGGSSR  362

Query  1257  --GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
                NGG+GSAYKA L   G+TVVVKR+   N+++ D FD E+  +G LRH N+L  LAYH
Sbjct  363   PSSNGGVGSAYKAVLSN-GITVVVKRVTVMNQVSVDVFDKEITNLGTLRHRNVLTPLAYH  421

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             +R+ EKL+V EF P  SLL+ LHGD       L   +R+KII+GVA GM YLH E     
Sbjct  422   FRRDEKLLVFEFVPNLSLLHRLHGDHSEG---LDWPSRLKIIQGVARGMWYLHRELGFLN  478

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVY  1781
             LPHGNLKSSNI L    EPL++++    L++     Q + A K+PE  +   +S KSDV+
Sbjct  479   LPHGNLKSSNIFLAEDGEPLVSEFGLQRLINADALSQSLVAYKSPEAERRGTLSAKSDVF  538

Query  1782  CLGIVILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDS---  1949
               G+V+LE++TGKFPSQY   ++ GGT++V+W+  A+  G   +++ P +  A  D    
Sbjct  539   SFGVVVLEILTGKFPSQYAGLDRAGGTNLVEWIGSAMEQGGWMDLLHPTVVNAAADDKIM  598

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
             + ++  +L+IG  CT  D ++R +M E I  +
Sbjct  599   EEEIENVLRIGVRCTGEDPDQRPNMTEVIDEL  630



>ref|XP_006850972.1| hypothetical protein AMTR_s00025p00206890 [Amborella trichopoda]
 gb|ERN12553.1| hypothetical protein AMTR_s00025p00206890 [Amborella trichopoda]
Length=654

 Score =   442 bits (1138),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 259/603 (43%), Positives = 363/603 (60%), Gaps = 29/603 (5%)
 Frame = +3

Query  285   VLIEFKESLQNTKGLDDTWVKGKSP--CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDV  458
              L++ K SL N   L + W   K+P   + T  W+G+LC   TV G+RL  +GL G+IDV
Sbjct  36    ALLKLKASLGNPSSLAN-WEPAKAPPCTNGTANWYGILCQTDTVDGIRLEGLGLMGNIDV  94

Query  459   DALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
             +AL ++  LR I+  NNSFSG  P+  +L  LK++F+ GN+FSGEI+ + F+ M  L+KL
Sbjct  95    EALLSVPNLRSISFMNNSFSGEFPELGRLGALKAIFLAGNKFSGEIAPNTFSGMGSLKKL  154

Query  639   WLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSG  818
              LS N  SG IP SL  +P+L+EL L GN F+  +P   Q SL   D+S N L G+IP+ 
Sbjct  155   VLSDNELSGQIPKSLTSVPKLLELMLNGNQFTGEIPDFQQTSLEKFDVSNNDLVGQIPAR  214

Query  819   MARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiva  998
             +  FG  +F GN  LCG P+   C               TP ++ R  S  + +++ I  
Sbjct  215   LKSFGPSSFTGNEGLCGLPLKTLCN------------GSTPSSSPRKPSTTKIIVIVIAI  262

Query  999   glllvail---FNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegss  1169
              + L  I    F   +  ++V + R  +     V   A   R+E  +H  + +   E S 
Sbjct  263   IVALAVIAIAFFYLRRRSKSVASHRNPSTAPNKVASFAE-DRAELGSHKKKPARELEQS-  320

Query  1170  srggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKM  1349
                   V V+++   F L +L+ ASAEVLG+G LGS+YKA L   G  +VVKR +E N  
Sbjct  321   ----KLVFVSDDIRTFELQDLLKASAEVLGSGSLGSSYKAVLHG-GPALVVKRFREMNNA  375

Query  1350  NKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDL  1529
              K+ FD  M++MG LRH N+LP+LAY+YRK+EKL+V+E  P GSL YLLHGDR  +   L
Sbjct  376   GKEEFDEHMKRMGTLRHPNLLPVLAYYYRKEEKLLVTELCPNGSLAYLLHGDRSPSRVPL  435

Query  1530  KAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGT  1709
             +  TR+KIIKGVA G+ +L+ E   + LPHG+LKSSN+LL+ + EPLL+DYA  PL++  
Sbjct  436   EWPTRLKIIKGVARGLAFLYQELPDFILPHGHLKSSNVLLSLSNEPLLSDYALGPLINQP  495

Query  1710  PTLQCMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVR  1880
                Q M A K+PE    H+ + KSDV+ LGI+ILE++TGKFP+Q L   KGGTD+  WV 
Sbjct  496   CASQSMVAYKSPEFIQLHRTTKKSDVWTLGILILEILTGKFPAQALRQGKGGTDLPTWVN  555

Query  1881  QAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
               V +    EV D +I G  +  +G+M+KLLQIG  C E +V+KR  M+EA  RI E+++
Sbjct  556   SVVREEWTGEVFDGDIGGY-KSGEGEMLKLLQIGLGCCEIEVDKRWDMREAFMRIEELKE  614

Query  2061  VEV  2069
              E 
Sbjct  615   REA  617



>gb|KFK41666.1| hypothetical protein AALP_AA2G157000 [Arabis alpina]
Length=647

 Score =   429 bits (1103),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 256/634 (40%), Positives = 380/634 (60%), Gaps = 31/634 (5%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             + + F L L  L    S+ +   L+EFK+SL N + LD +W     PC   +RW G+LC+
Sbjct  6     LIWPFVLSLTALSAD-SITEAESLLEFKKSLINAESLD-SWTPDSEPCGDNQRWVGLLCN  63

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +  V GL++  MGL+G+IDV  L +L  LR I++ NNSFSG IP+F++L  LKS+++ GN
Sbjct  64    KNNVFGLQIEQMGLSGNIDVAPLISLPRLRTISIMNNSFSGEIPEFNRLTALKSIYLSGN  123

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLA  755
             RFSG I +DYF  M  L+K WLS+N FSG IP SL   LP L+EL LE N F   +P   
Sbjct  124   RFSGNIPSDYFETMASLKKAWLSNNEFSGLIPVSLATSLPNLMELRLENNQFLGIIPNFT  183

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQ  935
             Q +L  ++LS NKL GEIP G+++F  + FEGN  LCG  +   C +   ++     E  
Sbjct  184   QPTLVDVNLSNNKLTGEIPPGLSKFDVRFFEGNHGLCGTKLATTCTQP--RNSTPKIEID  241

Query  936   -TPENAQRHSSGMRWlllsivaglllvailFNKNQNEENV----KTRRKDNLDEVLVVQI  1100
              T ++A +    + +  L+++  ++L++++F K + +       +    D+ D+  +   
Sbjct  242   GTMKDANKSKYYIAFGTLAVLFIIILISLVFRKKKKKRRRKKKSRASEHDSSDDNQIQVT  301

Query  1101  ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG-------  1259
                +R+    HS   S+S   + S   D V+VN+E+G+FGL +LM A+A VLG       
Sbjct  302   VEGSRTSGSKHSKSSSSSELTNRSITSDLVMVNKEKGVFGLPDLMKAAAHVLGNTGNGTS  361

Query  1260  ----NGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAY  1427
                 NG +GSAYKA +   G+ VVVKR+   N+++ + FD E+R +G LRH NIL  LAY
Sbjct  362   RPSSNGSVGSAYKAVI-ATGVAVVVKRITVMNQVSIEVFDKEIRTLGGLRHRNILTPLAY  420

Query  1428  HYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATY  1607
             H+R+ EKL+V EF P  SLL+ LH D G     L   +R KII+G+A GM YLH E    
Sbjct  421   HFRRDEKLLVFEFVPNLSLLHRLHSDHGEDFQ-LDWPSRFKIIQGIAKGMWYLHKELEFL  479

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ----ISHKSD  1775
              LPHGNLKSSNI +    EPL++++    L++    LQ + A ++PE  +    +S KSD
Sbjct  480   TLPHGNLKSSNIFIGDDGEPLISEFGLQRLINPDARLQSLVAYRSPESDRDHGIVSSKSD  539

Query  1776  VYCLGIVILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPE-IAGAGED-  1946
             V+  G+V+LE++TGKFPSQY   N+ GGTD+V+W+  AV  G   +++ P  ++ AG+D 
Sbjct  540   VFSFGVVVLEILTGKFPSQYAGLNRAGGTDLVEWIGSAVERGGWMDLLHPTVVSAAGDDV  599

Query  1947  -SDGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
              ++ ++  +L+IG  CT  D ++R SM E I  +
Sbjct  600   ATEEEIENVLRIGVRCTGEDPDRRPSMTEVIDEL  633



>ref|NP_177390.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAG52572.1|AC016529_3 putative receptor-like protein kinase; 33719-31696 [Arabidopsis 
thaliana]
 gb|ACN59274.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE35327.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=644

 Score =   423 bits (1088),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 259/627 (41%), Positives = 378/627 (60%), Gaps = 30/627 (5%)
 Frame = +3

Query  237   LILQCLPLSI-SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVT  413
             ++L    LS  S+ +   L++FK+SL NTK LD +W     PC  ++RW G+LC++ +V 
Sbjct  10    IVLSLTALSANSITESESLLKFKKSLNNTKSLD-SWTPESEPCGASQRWIGLLCNKNSVF  68

Query  414   GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGE  593
             GL++  MGL+G +DV  L +L  LR I++ NNSFSG IP+F++L  LKSL+I GNRFSG 
Sbjct  69    GLQIEQMGLSGKVDVAPLKDLPSLRTISIMNNSFSGDIPEFNRLTALKSLYISGNRFSGN  128

Query  594   ISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             I +DYF  M  L+K WLS+N FSG IP SL   LP L+EL LE N F  ++P   Q +L 
Sbjct  129   IPSDYFETMVSLKKAWLSNNHFSGLIPISLATTLPNLIELRLENNQFIGSIPNFTQTTLA  188

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
             I+DLS N+L GEIP G+ +F AK F GN  LCG  +   C +          E  T ++A
Sbjct  189   IVDLSNNQLTGEIPPGLLKFDAKTFAGNSGLCGAKLSTPCPQPKNSTASITIEG-TMKDA  247

Query  951   QRHSSGMRWlllsivaglllvailF----NKNQNEENVKTRRKDNLDEVLVVQIASMARS  1118
              +    + +  L ++  ++LV++ F     K + ++  +T  +DN D+   +Q+     +
Sbjct  248   NKSKYFLAFSTLGVLLIVVLVSLAFRKKKKKRRRKKARRTSEQDNSDDQ-QIQVTVEGSN  306

Query  1119  ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN-----------G  1265
              S    S RS       +   D V+VN+E+G+F LS+LM A+A VLGN           G
Sbjct  307   SSRQSRSSRSGELNKGVAGTSDLVMVNKEKGVFRLSDLMKAAAHVLGNPGGGSNRPRSSG  366

Query  1266  GLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQE  1445
             G+GSAYKA L   G+TVVVKR+   N+++ D FD E+RK+G L+H N+L  LAYH+R+ E
Sbjct  367   GVGSAYKAVLSN-GVTVVVKRVTVMNQVSVDVFDKEIRKLGSLQHKNVLTPLAYHFRQDE  425

Query  1446  KLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGN  1625
             KL+V EF P  +LL+ LHGD       L   +R+KII+G+A GM YLH E     LPHGN
Sbjct  426   KLLVFEFVPNLNLLHRLHGDH--EEFQLDWPSRLKIIQGIARGMWYLHRELGFLNLPHGN  483

Query  1626  LKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIV  1796
             LKSSNI L    EPL++++    L++     Q + A K+PE  +   +S KSDV+  G+V
Sbjct  484   LKSSNIFLAEDGEPLISEFGLQKLINPDAQSQSLVAFKSPEADRDGTVSAKSDVFSFGVV  543

Query  1797  ILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPE-IAGAGEDS--DGKMV  1964
             +LE++TGKFPSQY   N+ GG ++V+W+  A+  G   +++ P  +  A ED   + ++ 
Sbjct  544   VLEILTGKFPSQYAGLNRAGGANLVEWLGSALEQGGWMDLLHPMVVTAAAEDKIMEEEIE  603

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRI  2045
              +L+IG  CT  D ++R +M E +  +
Sbjct  604   NVLRIGVRCTREDPDQRPNMTEVVDEL  630



>ref|XP_002887434.1| hypothetical protein ARALYDRAFT_316211 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63693.1| hypothetical protein ARALYDRAFT_316211 [Arabidopsis lyrata subsp. 
lyrata]
Length=644

 Score =   422 bits (1086),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 264/632 (42%), Positives = 383/632 (61%), Gaps = 30/632 (5%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             + + F L L  L  + S+ +   L++FK+SL NTK LD +W     PC +++RW G++C+
Sbjct  6     LIWPFVLSLTALSAN-SITESESLLKFKKSLTNTKSLD-SWTPDSEPCGESQRWIGLICN  63

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             + +V GL++  MGL+G +DV  L +L  LR I++ NNSFSG IP+F++L  LKSL+I GN
Sbjct  64    KNSVFGLQIEQMGLSGKVDVAPLKDLPSLRTISIMNNSFSGDIPEFNRLTALKSLYISGN  123

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLA  755
             RFSG I +DYF  M  L+K WLS+N FSG IP SL   LP L+EL LE N F  ++P   
Sbjct  124   RFSGNIPSDYFETMVSLKKAWLSNNEFSGLIPISLATTLPNLIELRLENNQFIGSIPNFT  183

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQ  935
             Q +L I+DLS N+L GEIP G+ +F AK+F GN  LCG  +   C +          E  
Sbjct  184   QTTLAIVDLSNNQLTGEIPPGLLKFDAKSFAGNSGLCGAKLSTACPQPKNSTASITIEG-  242

Query  936   TPENAQRHSSGMRWlllsivaglllvailF----NKNQNEENVKTRRKDNLDEVLVVQIA  1103
             T ++A +    + +  L ++  ++LV++ F     K + ++  +T  +DN D+   +Q+ 
Sbjct  243   TMKDANKSKYFLAFGTLGVLLIVVLVSLAFRKKKKKRRRKKARRTSEQDNSDDQ-QIQVT  301

Query  1104  SMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN-------  1262
                 + S    S RS       +   D V+VN+E+G+FGLS+LM A+A VLGN       
Sbjct  302   VEGSNSSRQSKSSRSGELNKGVAGTTDLVMVNKEKGVFGLSDLMKAAAHVLGNPGGGSSR  361

Query  1263  ----GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
                 GG+GSAYKA L   G+TVVVKR+   N+++ D FD E+RK+G LRH NIL  LAYH
Sbjct  362   PSSSGGVGSAYKAVLSN-GVTVVVKRVTVMNQVSVDVFDKEIRKLGSLRHKNILTPLAYH  420

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             +R+ EKL+V EF P  SLL+ LHGD       L   +R+KII+G+A GM YLH E     
Sbjct  421   FRRDEKLLVFEFVPNLSLLHRLHGDH--EEFQLDWPSRLKIIQGIARGMWYLHRELGFLN  478

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVY  1781
             LPHGNLKSSNI L    EPL++++    L++     Q + A K+PE  +   +S KSDV+
Sbjct  479   LPHGNLKSSNIFLAEDGEPLISEFGLQKLINPDAQSQSLVAYKSPEADRDGTVSAKSDVF  538

Query  1782  CLGIVILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPE-IAGAGEDS--  1949
               G+V+LE++TGKFPSQY   N+ GG ++V+W+  AV  G   +++ P  +  A ED   
Sbjct  539   SFGVVVLEILTGKFPSQYAGLNRAGGANLVEWIGSAVEQGGWMDLLHPTVVTAAAEDKIL  598

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
             + ++  +L+IG  CT  D ++R +M E +  +
Sbjct  599   EEEIENVLRIGVKCTGEDPDQRPNMTEVVDEL  630



>gb|KHN17736.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=419

 Score =   412 bits (1060),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/432 (50%), Positives = 304/432 (70%), Gaps = 20/432 (5%)
 Frame = +3

Query  780   LSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRH  959
             +S NKLQGEIP+ M+RF A +F  N  LCG+P+ ++C     +  G G +          
Sbjct  1     MSNNKLQGEIPAAMSRFDANSFSNNEGLCGKPLIKECEAGSSEGSGWGMK----------  50

Query  960   SSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS---ESIN  1130
                M  +L++ VA  ++  ++ +K + +++     +D++DEV+ V + S   S   E  +
Sbjct  51    ---MVIILIAAVALAMIFVLMRSKRRRDDDFSVMSRDHVDEVVQVHVPSSNHSRASERGS  107

Query  1131  HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGL  1310
                  S+    S    GD V+VN+E+G+FGL +LM A+AEVLGNGGLGSAYKAA+   GL
Sbjct  108   KKEFTSSKKGSSRGGMGDLVMVNDEKGVFGLPDLMKAAAEVLGNGGLGSAYKAAMNN-GL  166

Query  1311  TVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLY  1490
             +VVVKR++E NK+++D FDAEMR+ G LR+ NI+  LAYHYRK+EKL V+E+ PKGSLLY
Sbjct  167   SVVVKRMREMNKVSRDIFDAEMRRFGRLRNPNIITPLAYHYRKEEKLFVTEYMPKGSLLY  226

Query  1491  LLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPL  1670
             +LHGDRG++H DL    R+ I+KG+A G+ ++++EF    LPHGNLKSSN+LLT  YEPL
Sbjct  227   VLHGDRGSSHADLNWPMRLNIVKGIARGLGFIYSEFPNEVLPHGNLKSSNVLLTENYEPL  286

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L+D+AFHPL++    +Q MFA K P+      +S K+DVYCLGI++LE++TGKFPSQY S
Sbjct  287   LSDFAFHPLINPNYAIQTMFAYKTPDYVSYQHVSQKTDVYCLGIIVLEIITGKFPSQYHS  346

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
             N KGGTDVV WV  A+++ +E+E+IDPE+     +S  +M++LLQ+GAACTES+ ++RL+
Sbjct  347   NGKGGTDVVHWVFTAISERREAELIDPELMSNHSNSLNQMLQLLQVGAACTESNPDQRLN  406

Query  2022  MKEAIKRIREIQ  2057
             MKEAI+RI E+Q
Sbjct  407   MKEAIRRIEEVQ  418



>ref|XP_009393951.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Musa acuminata subsp. malaccensis]
Length=647

 Score =   417 bits (1071),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 246/618 (40%), Positives = 355/618 (57%), Gaps = 31/618 (5%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDD---TWVKGKSPC--DKTRRWFGVLCHRKTVTGLRLYNMGL  440
             D  +L++FK +L    G D    TWV  + PC       W GV C    V  L+L +M L
Sbjct  31    DGRILLQFKATLSPGVGGDAVLATWVDTRGPCIDQNVSAWAGVYCENGKVATLQLESMSL  90

Query  441   AGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKM  620
              G +D+D L+ L  LR ++ +NNS  G IPDF KL  LKSL++  NRFSGEI    F+ M
Sbjct  91    LGALDLDILTGLPSLRALSFSNNSLEGGIPDFTKLPALKSLYLSWNRFSGEIPDGMFSTM  150

Query  621   TGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQ  800
               L+K+WLSHN FSG IP SL    +L++L L+ N F   +P L Q  L ++++S N L+
Sbjct  151   RALKKVWLSHNNFSGPIPTSLTVPEKLMDLGLDSNSFEGHLPDLWQPELQVVNVSYNNLE  210

Query  801   GEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWl  980
             G IP  ++   A  FEGN  LCG P+   C                PE  +   + +  +
Sbjct  211   GPIPVRLSNMSATLFEGNKNLCGPPLLVSC--------------NLPEKHKLAPALLVAI  256

Query  981   llsivaglllvailF------NKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssr  1142
             +L  VA LL V  L        +N+ EE    R + + +   +  + + A +E +     
Sbjct  257   ILIAVAVLLAVIALIVFLLLRRRNKKEETTVDRPQTSTNSEKIEHLEAAADAE-LGSEKH  315

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
                  +      G    V E R  F + +L+ ASAEVLG+G  GS+YKA L V G  VVV
Sbjct  316   HGGGKKAPKKEQGKLSFVVEWRRKFDMQDLLRASAEVLGSGNFGSSYKATL-VDGPAVVV  374

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR KE   + ++ F   MR++G L H N+LPL+AY+Y+K+EKL+++E+ P GSL ++LHG
Sbjct  375   KRFKEMKGVGREDFQEHMRRLGRLSHPNLLPLVAYYYKKEEKLLITEYIPNGSLAHMLHG  434

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
             +RG+    L   TR+KI+KGVA G+ YL+ E     +PHG+LKSSN+LL+ ++EP+LTDY
Sbjct  435   NRGSKLPPLDWPTRLKIVKGVARGLAYLYDELPMLTVPHGHLKSSNVLLSSSFEPILTDY  494

Query  1683  AFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
             A  P++      Q M A K+PE  Q    S KSDV+  G +ILE++TGKFP+ +L+    
Sbjct  495   ALVPVMKKAAASQVMVAYKSPECAQHGEPSKKSDVWSFGTLILEILTGKFPADHLAEGSA  554

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEA  2033
             G D+  WV     +   S+V D  + G  +DS+G+M+KLL+IG AC E+DV++R  MKEA
Sbjct  555   GADLASWVNTVAGEEGTSKVFDKNMEGT-KDSEGEMLKLLKIGIACCEADVDERWEMKEA  613

Query  2034  IKRIREIQDVEVFHELPF  2087
             +++I E+++ E   E P 
Sbjct  614   LEKIEELKEREGGTERPL  631



>emb|CDO97828.1| unnamed protein product [Coffea canephora]
Length=544

 Score =   412 bits (1059),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 325/486 (67%), Gaps = 20/486 (4%)
 Frame = +3

Query  618   MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
             M  L+K+WLS N F+G IP SL  L  L+ELHLEGN FS  +P L Q +L  L+LS N L
Sbjct  1     MDSLKKVWLSSNKFTGAIPVSLWHLRHLIELHLEGNQFSGTIPALEQPTLMSLNLSNNNL  60

Query  798   QGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPEN---AQRHSSG  968
              GEIP G++RF A +F GNP LCGE +G  C         G     + +N   ++  S G
Sbjct  61    NGEIPQGLSRFNASSFRGNPGLCGEKLGNPC---------GAITVPSSDNNDDSRMISYG  111

Query  969   MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrs  1148
             +      ++  +     +  + Q  E+      ++LD  + V+I+S  + E ++ S + +
Sbjct  112   VLIASGVMLLLMCSGIYVLRRKQETES-DVMADEDLDGSVGVRISSANKKE-LSASQKST  169

Query  1149  tstegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKR  1328
              S+   S+R GD V+VN E G FGL++LM ASAEVLGNG LGS Y A +    L V VKR
Sbjct  170   GSSRRGSNRIGDLVMVNNELGEFGLADLMKASAEVLGNGTLGSTYMAVMSN-DLAVAVKR  228

Query  1329  LKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDR  1508
             +KE NK+ +D FDA++R++G L+H NIL  LAYH+RK EKL+V E+ P GSLLY LH DR
Sbjct  229   IKEMNKIGRDGFDADIRRLGRLKHKNILTPLAYHFRKDEKLLVYEYIPGGSLLYHLHADR  288

Query  1509  GTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAF  1688
             G +H +L   TR+KII+G+A G+ YLHTE +++++PHGNL+S+N+LLT  YEP++ DY +
Sbjct  289   GPSHAELNWPTRLKIIQGIAQGLGYLHTELSSFEVPHGNLRSNNVLLTLEYEPIVADYGY  348

Query  1689  HPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT  1859
               L+SG    + + A K+PE     Q+S K DVYCLG++ILE++TGKFPSQY ++  GGT
Sbjct  349   CSLISGQAR-ESLLAYKSPEVVQYQQVSPKCDVYCLGVLILELITGKFPSQYSNSGTGGT  407

Query  1860  DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIK  2039
             DVVQW + A+A+G+E+E+ DPEIA +  DS  +M +LL +GAACTE++ E+RL ++EAI+
Sbjct  408   DVVQWAKSAIAEGREAELYDPEIA-SSSDSRSEMEELLHVGAACTENNPEQRLDVREAIR  466

Query  2040  RIREIQ  2057
             RI +IQ
Sbjct  467   RIEDIQ  472



>ref|XP_007011459.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY29078.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=631

 Score =   409 bits (1051),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 235/599 (39%), Positives = 345/599 (58%), Gaps = 37/599 (6%)
 Frame = +3

Query  282   VVLIEFKESLQNTKGLDDTWV-KGKSPCD-KTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
              +L+ FK SL N +     W     SPC      W G+ C   T+ GLRL +MGL G ID
Sbjct  30    TILLRFKNSLSNHESALSDWNDSAPSPCTGDNSNWTGLRCSNGTIFGLRLESMGLMGVID  89

Query  456   VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             +D L+ L  LR ++  NNSF G +PD +KL  L++L++  NRFSGEI  + FA M  L+K
Sbjct  90    IDTLTELPLLRTLSFMNNSFDGQLPDVNKLTSLRALYLSYNRFSGEIRENGFAAMNSLQK  149

Query  636   LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
             ++L+ N FSG IP SL  LPRL EL LEGN F   +P   Q+ L +++L+ N+L+G IP 
Sbjct  150   VYLARNNFSGKIPKSLAALPRLSELSLEGNRFEGKIPDFQQKDLIMVNLADNQLEGRIPD  209

Query  816   GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsiv  995
              + +  +  F GN  LCG+P+                  Q   + +R+   +  +  S+V
Sbjct  210   SLTKMNSSLFAGNKGLCGKPL-----------------PQCKSSKKRNIIIITVVAGSVV  252

Query  996   aglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssr  1175
             +   + A+ + ++       T +  N  E     I     ++S NH  +   +       
Sbjct  253   SLAAIAAVSYIRSGP---TTTSQVKNFQEKNAGNIVGRKEAQSSNHYRKAENAK------  303

Query  1176  ggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNK  1355
                   +  ERG F L +L+ ASAEVLG+G  GS+YKA L + G  +VVKR ++ N + K
Sbjct  304   ---LYFIRNERGRFELQDLLRASAEVLGSGSFGSSYKAVL-LDGRAMVVKRFRQMNNVGK  359

Query  1356  DAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKA  1535
             + F A M ++GML H N+L L+A++YRK+EKL+VS+F P GSL   LH  R    + L  
Sbjct  360   EEFRAHMGRLGMLFHPNLLSLVAFYYRKEEKLLVSDFVPNGSLAGHLHARRAPDQSGLDW  419

Query  1536  ATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPT  1715
              TR+KIIKGVA G+ YL+ E  +  LPHG+LKSSN+LL   +EPLLTDY   P+++    
Sbjct  420   PTRLKIIKGVAKGLAYLYKELPSLTLPHGHLKSSNVLLDHNFEPLLTDYGLMPVINKEHA  479

Query  1716  LQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQ  1883
              Q M A K+PE  Q    + K+DV+ LGI+ILE++TGKFP+ YL   KGG  D+  WV  
Sbjct  480   QQFMVAYKSPEFTQYDRTTTKTDVWSLGILILELLTGKFPANYLKQGKGGNVDLATWVNS  539

Query  1884  AVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
              V +    EV D ++    ++ +G+M+KLL+IG  C E + E+R  +K+A+++I E+++
Sbjct  540   VVREEWTGEVFDKDMKST-KNGEGEMLKLLKIGMCCCEWNTERRWELKDAVEKIEELKE  597



>ref|XP_009379907.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Musa acuminata subsp. malaccensis]
Length=628

 Score =   403 bits (1036),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 237/611 (39%), Positives = 355/611 (58%), Gaps = 23/611 (4%)
 Frame = +3

Query  267   SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDK-TRRWFGVLCHRK-TVTGLRLYNMGL  440
             S  D  VL+ FK ++ +  G  ++W  G +PC+K    W GV+CH   +V+GLRL +M L
Sbjct  25    SSSDSDVLLRFKATVSDPAGSLNSWAAGSTPCNKNVSNWAGVVCHDDGSVSGLRLEDMRL  84

Query  441   AGDID-VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
             +G +  +D L +L GLR ++   N  +GP+P  +K   L++L++  N+FSG IS D FA 
Sbjct  85    SGSLTRIDLLQSLPGLRTLSFMKNDLAGPLPVVEKFNSLRTLYLSMNKFSGAISDDAFAG  144

Query  618   MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
             M+ L+KL LS NGFSG IP S+ +LP+L+EL L+ N FS  +P L  +SL ++++S N L
Sbjct  145   MSWLKKLHLSSNGFSGPIPTSIAQLPKLLELRLDNNRFSGPIPDLQLKSLKLVNMSNNYL  204

Query  798   QGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRW  977
             +G IP G     A  F GN  LCG+P+G  C+    +       A T        SG+  
Sbjct  205   EGRIPDGFRTMDAGLFAGNKALCGDPIGVPCKPLPSESLSNQKLAVTVATVVFIVSGI--  262

Query  978   lllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN-----Hssr  1142
                 +   LLL      +++  E V++ +K + D     + AS  + E +      + S 
Sbjct  263   ----VAVVLLLPQQRQMEHERLEQVQSPKKPSKD----TKFASSPKEEKLESGAAGYDSD  314

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
              S+         G  V V E R  F L +L+ +SAEVLG G  G +YKAAL + G +VVV
Sbjct  315   GSSRKPAKEHEQGRLVFVREGRERFELQDLLKSSAEVLGTGRFGCSYKAAL-LSGRSVVV  373

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR ++ N++ K+ F+  MR+MG L H N+LPL+AY+YRK EKL+V+++ P+ SL   LHG
Sbjct  374   KRFRDMNRVGKEDFEEHMRRMGRLSHPNLLPLVAYYYRKDEKLLVTDYVPRRSLAAALHG  433

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
              R      L   TR+K++KG+A G+ YL+ E     +PHG+LKSSN+LL+ ++EPLLTDY
Sbjct  434   FRAAKVPALDWGTRLKVVKGIAKGLNYLYEELQMLSVPHGHLKSSNVLLSDSFEPLLTDY  493

Query  1683  AFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
             A  P+ +     Q M A K+PE  Q    S KSD++ LG +ILE++TG+      S  K 
Sbjct  494   ALVPVTNQAKAAQSMVAYKSPECKQHGKTSKKSDIWSLGTLILEILTGRISMIDPSQDKE  553

Query  1854  GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEA  2033
               ++  WV     +    +V+D E+  A   S  +M+KLL++G AC E++VEKR  ++E 
Sbjct  554   AVNLAGWVNTVAEEEWIDKVLDREMR-ATRKSGEEMIKLLKVGLACCEANVEKRWELEEV  612

Query  2034  IKRIREIQDVE  2066
             + RI E+++ E
Sbjct  613   LDRIEELKESE  623



>ref|XP_003588623.1| Receptor-like protein kinase [Medicago truncatula]
Length=658

 Score =   404 bits (1037),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 242/623 (39%), Positives = 360/623 (58%), Gaps = 26/623 (4%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDD--VVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVL  392
             IF  F L +   P   + GD    +LI FK  L N   L++ WV   + C+    W G+L
Sbjct  10    IFILFMLFINLEP---TFGDTNGQILIRFKSFLSNANALNN-WVDEANLCN----WAGLL  61

Query  393   CHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
             C      GLRL NMGL G IDVD L  L  L   ++ NN+F GP+P+F KL  L+ LF+ 
Sbjct  62    CTNNKFHGLRLENMGLGGKIDVDTLVELTDLVSFSVNNNTFEGPMPEFKKLVKLRGLFLS  121

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
              N+FSGEIS D F  M  L++++L+ NGF+G+IP SL KLPRL++L L GN F   +P  
Sbjct  122   NNKFSGEISDDSFEGMGNLKRVFLAGNGFNGHIPLSLAKLPRLLDLDLHGNSFGGNIPEF  181

Query  753   AQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD-GGGGAE  929
              Q    + DLS N+L+G IP+ ++   + +F  N  LCG+P+   C     K      + 
Sbjct  182   QQNGFRVFDLSNNQLEGPIPNSLSNEPSTSFSANKGLCGKPLNNPCNIPPTKSIVQTNSV  241

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLV-VQIAS  1106
               T  N +++   +  +++ +   +L   +     Q+ +    RR+   D+ ++ +Q+ S
Sbjct  242   FSTQGNGKKNKKILIVVIVVVSMVVLASILALLFIQSRQ----RRRSEQDQPIIGLQLNS  297

Query  1107  MAR-SESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAY  1283
              +  S S+  +     + + S    G+   V E++G F L +L+ ASAEVLG+G  GS Y
Sbjct  298   ESNPSPSVKVTKSIDLAGDFSKGENGELNFVREDKGGFELQDLLRASAEVLGSGSFGSTY  357

Query  1284  KAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSE  1463
             KA + + G TVVVKR +  N + K  F   M+K+G L H N+LPL+A++Y+K+EK +V +
Sbjct  358   KAIV-LNGPTVVVKRFRHMNNVGKQEFFEHMKKLGSLTHPNLLPLIAFYYKKEEKFLVYD  416

Query  1464  FGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNI  1643
             FG  GSL   LHG        L  +TR+KIIKGVA G+ +L+ EF    LPHG+LKSSN+
Sbjct  417   FGENGSLASHLHGRNSIV---LTWSTRLKIIKGVARGLAHLYKEFPKQNLPHGHLKSSNV  473

Query  1644  LLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDVYCLGIVILEVVT  1814
             +L  ++EPLLT+Y   P+ +     Q M + K+PE       + K+D++CLGI+ILE++T
Sbjct  474   MLNISFEPLLTEYGLVPITNKNHAQQFMASYKSPEVTHFDRPNEKTDIWCLGILILELLT  533

Query  1815  GKFPSQYLSNQKG-GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAAC  1991
             GKFP+ YL + KG  +D+  WV   V +    EV D  I G   + +G+M+KLL+IG  C
Sbjct  534   GKFPANYLRHGKGENSDLATWVNSVVREEWTGEVFDKNIMGT-RNGEGEMLKLLRIGMYC  592

Query  1992  TESDVEKRLSMKEAIKRIREIQD  2060
              E  VE+R   KEA+ +I E+++
Sbjct  593   CEWSVERRWDWKEALDKIEELKE  615



>gb|AES58874.2| LRR receptor-like kinase [Medicago truncatula]
Length=659

 Score =   404 bits (1037),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 242/623 (39%), Positives = 360/623 (58%), Gaps = 26/623 (4%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDD--VVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVL  392
             IF  F L +   P   + GD    +LI FK  L N   L++ WV   + C+    W G+L
Sbjct  11    IFILFMLFINLEP---TFGDTNGQILIRFKSFLSNANALNN-WVDEANLCN----WAGLL  62

Query  393   CHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
             C      GLRL NMGL G IDVD L  L  L   ++ NN+F GP+P+F KL  L+ LF+ 
Sbjct  63    CTNNKFHGLRLENMGLGGKIDVDTLVELTDLVSFSVNNNTFEGPMPEFKKLVKLRGLFLS  122

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
              N+FSGEIS D F  M  L++++L+ NGF+G+IP SL KLPRL++L L GN F   +P  
Sbjct  123   NNKFSGEISDDSFEGMGNLKRVFLAGNGFNGHIPLSLAKLPRLLDLDLHGNSFGGNIPEF  182

Query  753   AQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD-GGGGAE  929
              Q    + DLS N+L+G IP+ ++   + +F  N  LCG+P+   C     K      + 
Sbjct  183   QQNGFRVFDLSNNQLEGPIPNSLSNEPSTSFSANKGLCGKPLNNPCNIPPTKSIVQTNSV  242

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLV-VQIAS  1106
               T  N +++   +  +++ +   +L   +     Q+ +    RR+   D+ ++ +Q+ S
Sbjct  243   FSTQGNGKKNKKILIVVIVVVSMVVLASILALLFIQSRQ----RRRSEQDQPIIGLQLNS  298

Query  1107  MAR-SESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAY  1283
              +  S S+  +     + + S    G+   V E++G F L +L+ ASAEVLG+G  GS Y
Sbjct  299   ESNPSPSVKVTKSIDLAGDFSKGENGELNFVREDKGGFELQDLLRASAEVLGSGSFGSTY  358

Query  1284  KAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSE  1463
             KA + + G TVVVKR +  N + K  F   M+K+G L H N+LPL+A++Y+K+EK +V +
Sbjct  359   KAIV-LNGPTVVVKRFRHMNNVGKQEFFEHMKKLGSLTHPNLLPLIAFYYKKEEKFLVYD  417

Query  1464  FGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNI  1643
             FG  GSL   LHG        L  +TR+KIIKGVA G+ +L+ EF    LPHG+LKSSN+
Sbjct  418   FGENGSLASHLHGRNSIV---LTWSTRLKIIKGVARGLAHLYKEFPKQNLPHGHLKSSNV  474

Query  1644  LLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDVYCLGIVILEVVT  1814
             +L  ++EPLLT+Y   P+ +     Q M + K+PE       + K+D++CLGI+ILE++T
Sbjct  475   MLNISFEPLLTEYGLVPITNKNHAQQFMASYKSPEVTHFDRPNEKTDIWCLGILILELLT  534

Query  1815  GKFPSQYLSNQKG-GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAAC  1991
             GKFP+ YL + KG  +D+  WV   V +    EV D  I G   + +G+M+KLL+IG  C
Sbjct  535   GKFPANYLRHGKGENSDLATWVNSVVREEWTGEVFDKNIMGT-RNGEGEMLKLLRIGMYC  593

Query  1992  TESDVEKRLSMKEAIKRIREIQD  2060
              E  VE+R   KEA+ +I E+++
Sbjct  594   CEWSVERRWDWKEALDKIEELKE  616



>gb|KFK30772.1| hypothetical protein AALP_AA6G024300 [Arabis alpina]
Length=659

 Score =   403 bits (1035),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 237/608 (39%), Positives = 354/608 (58%), Gaps = 17/608 (3%)
 Frame = +3

Query  270   VGDDVVLIEFKESLQ--NTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLA  443
             + D   +  FK+SL      GL  TW     PC     W GVLC+  +V GL+L N+ L+
Sbjct  30    LSDSEAIFNFKKSLVVGEADGLF-TWDAKTPPCT----WAGVLCNGGSVWGLQLENLELS  84

Query  444   GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
             G ID++AL+ L  LR +++ NN F GP P+F KL  LKSL++  N+F G IS D F  M 
Sbjct  85    GSIDIEALTGLTSLRTLSIMNNKFGGPFPEFKKLGALKSLYLSNNQFEGTISGDAFEGMG  144

Query  624   GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
              L+KL LS N F+G IP S+ KLP+L+EL L+GN FS  +P    + L +L+LS N L G
Sbjct  145   WLKKLHLSQNKFTGEIPISMAKLPKLLELRLDGNQFSGQIPEFEHKQL-VLNLSNNALTG  203

Query  804   EIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWll  983
              IP  ++    K FEGN  LCG+P+  +C   L +      E +   +A         + 
Sbjct  204   LIPESLSMMDPKVFEGNKGLCGKPLETECDSLLLEVSPPQLEVRPKSSAIVSLVITSVVT  263

Query  984   lsivaglllvailFNKNQNEEN---VKTRRKDNLDEVLVVQIASMARSES-INHssrrst  1151
                V  +L V  L N+N  ++    V   ++ +L +   ++ A  +R E   N SS  + 
Sbjct  264   ALTVIIILGVIFLLNRNYKKKQPPLVVEAKESSLQKKTGIREAEPSRRERHRNGSSSGNR  323

Query  1152  stegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRL  1331
                 +         + E++  F L +L+ ASAE+LG+G  G++YKA L   G  +VVKR 
Sbjct  324   IGAPAGVENTKLSFLREDKEKFDLPDLLKASAEILGSGCFGASYKAVLSS-GKMMVVKRF  382

Query  1332  KETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRG  1511
             K+ N   +D F   M+++G L+HHN+LP++AY+YRK+EKL+V EF  +GSL + LHG++ 
Sbjct  383   KQMNNAGRDEFQDHMKRLGRLKHHNLLPIVAYYYRKEEKLLVCEFAERGSLAFNLHGNQS  442

Query  1512  TAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFH  1691
                  L   TR+KI+KGVA G+ YLH +  +   PHG+LK+SN+LLT T+EPLLTDY   
Sbjct  443   FGKPSLDWPTRLKIVKGVARGLLYLHEDLPSLMAPHGHLKASNVLLTETFEPLLTDYGLI  502

Query  1692  PLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTD  1862
             PL++       M A K+PE     +++ K+DV+ LGI+ILE++TGKFP+ +L     G D
Sbjct  503   PLINQEKAQDHMVAYKSPEYLLHRRVTKKTDVWGLGILILEILTGKFPANFLRVNLNGED  562

Query  1863  VVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKR  2042
             +V WV  +       ++ D +++   +  +G ++ LL+IG  C E DVEKR  ++EA+K+
Sbjct  563   LVSWVNLSFQGVWAPDLFDKDMSKT-KHCEGTILTLLKIGLKCCEPDVEKRFEIEEAVKK  621

Query  2043  IREIQDVE  2066
             I E+++ E
Sbjct  622   IEELKERE  629



>gb|KDP25034.1| hypothetical protein JCGZ_22569 [Jatropha curcas]
Length=639

 Score =   402 bits (1032),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 228/601 (38%), Positives = 347/601 (58%), Gaps = 29/601 (5%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCD-KTRRWFGVLCHRKTVTGLRLYNMGLAGDI  452
             D   L++FK+SL+N   L + W    +PCD     W GVLC   T+ GL+L +M L G+I
Sbjct  36    DSAALLKFKQSLENKAPLSN-WNSSVNPCDGHLSNWRGVLCWNGTIWGLKLEHMRLTGNI  94

Query  453   DVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLR  632
             DVD L  L   R ++L NN  SGP+PD  KL  LK+L++  N FSG+I AD F  M  L+
Sbjct  95    DVDPLVQLPYFRTLSLMNNELSGPLPDIKKLGRLKALYLSNNGFSGQIPADAFQGMGSLK  154

Query  633   KLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIP  812
             +L++++N F+G+IP+SL  LPRL +L LEGN FS  +P   Q  L  ++L+ N L+G IP
Sbjct  155   RLFMANNEFTGHIPSSLATLPRLTQLRLEGNQFSGPIPDFQQHRLRSINLASNLLEGTIP  214

Query  813   SGMARFGAKAFEGNPELCGEPVGRQCREDLG--KDGGGGAEAQTPENAQRHSSGMRWlll  986
               +++    AF GN +LCG P+   C   +   K   G             ++ ++    
Sbjct  215   ESLSKMNPDAFSGNKDLCGLPLD-ACDSTIHAVKKNAGTIIMIVILVVIMVAAILQ----  269

Query  987   sivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegs  1166
                        +F +  +E   K+    N +++  +   +  R  S       S+     
Sbjct  270   --------CLAMFRRKNDEAEEKSTLSANSNKIAPLHGRNQERDMS-----GESSVHSRR  316

Query  1167  ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNK  1346
             + R      V E+   F L++L+ ASAEVLG+G  G++YKA++   G  +VVKR +  N 
Sbjct  317   ADRADKLTFVTEDIEKFDLNDLLRASAEVLGSGTFGASYKASVSN-GKPIVVKRYRHMNN  375

Query  1347  MNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHND  1526
             + ++ F   MR++G L+H N+LPL A++YR++EKL+V E+ P GSL   LHG+       
Sbjct  376   VGREEFHEHMRRLGRLKHPNLLPLAAFYYRREEKLLVYEYCPYGSLASSLHGNLSLEGQG  435

Query  1527  LKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
             L+  TR++I+KGVA G+ YL++E     +PHG+LKSSN+LL P+ EPLL DYA  P+++ 
Sbjct  436   LEWQTRLRIVKGVAKGLAYLYSELPIL-VPHGHLKSSNVLLDPSLEPLLADYALRPVINP  494

Query  1707  TPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYL-SNQKGGTDVVQW  1874
                   M A K+PE  Q    S+K+D++  GI+ILE++TG+FP  YL S     +D+  W
Sbjct  495   HQAHNLMIAYKSPEYAQSGRTSNKTDIWSFGILILEILTGRFPENYLKSGYDANSDLATW  554

Query  1875  VRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V + V + K  EV D ++ GA ++S G+M+ LL+IG  C E DVE+RL +KE  ++I ++
Sbjct  555   VNKMVTEKKIGEVFDKDMPGA-KNSKGEMINLLKIGLRCCEEDVERRLDIKEVAEQIEQL  613

Query  2055  Q  2057
             +
Sbjct  614   K  614



>ref|XP_010048526.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Eucalyptus grandis]
Length=653

 Score =   401 bits (1030),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 256/634 (40%), Positives = 368/634 (58%), Gaps = 25/634 (4%)
 Frame = +3

Query  189   AVRRIPTFPLIFFSFCLILQCLPLSISVGDDV-VLIEFKESLQNTKGLDDTWVKGKSPC-  362
             A R  PTF  + F   L+L  +  + S   +   L++FK SL +       W  G SPC 
Sbjct  2     APRARPTFWSLLF-VILLLDGVATTFSASSEADSLLKFKSSLDDQSNALANWNSG-SPCI  59

Query  363   DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
                  W GVLC + +V GL+L N GL G+IDVD+L+ L  LR ++  NNSF+GP+P+  K
Sbjct  60    GDQANWIGVLCMKGSVWGLQLENRGLEGEIDVDSLAGLPSLRTLSFMNNSFNGPMPEIKK  119

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             L  LKS+F+  NRFSGEI AD F  M+ L+KL L+ N F G IP+SL +LPRL+EL LEG
Sbjct  120   LGALKSVFLSYNRFSGEIPADSFEGMSYLKKLHLAGNQFEGAIPSSLTQLPRLLELRLEG  179

Query  723   NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
             N F+  +P  AQ +L +LD+S N+L G IP+ +A   + +F GN  LCG P+   C    
Sbjct  180   NQFTGQIPAFAQHNLLLLDVSNNELDGPIPASLANMNSSSFSGNEGLCGAPLS-PCTAAP  238

Query  903   GKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE  1082
                   G+ + T        + + +L+  ++    L      +NQ  ++++     NL  
Sbjct  239   ASSDKKGSSSFTAILIYAIVASVLFLMALVLLIFCLR----RRNQTSQSIEAPPPSNLQ-  293

Query  1083  VLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN  1262
                 + AS      + H S  ++S+   +        V E+R  F L +L+ ASAE+LG+
Sbjct  294   ----KKASFKEEGHVRHGSPDNSSSGKKAENF-KLSFVREDREKFDLQDLLKASAEILGS  348

Query  1263  GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
             G  GS+YKAAL   G  +VVKR ++ N + ++ F   MR++G LRH N+LPL+AY+YRK+
Sbjct  349   GCFGSSYKAAL-FSGSAMVVKRFRQMNNVGREEFQEHMRRLGRLRHPNLLPLVAYYYRKE  407

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+VS++   GSL   LH +       L   TR+K++KGVA G+ YL+ E  +   PHG
Sbjct  408   EKLLVSDYVENGSLAVYLHSNHARGKPALDWPTRLKVVKGVAKGLTYLYNELPSLIAPHG  467

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGI  1793
             +LKSSN+LL  T EPLLTDY   P+++       M A K+PE  Q   I+ K+DV+ LGI
Sbjct  468   HLKSSNVLLATTLEPLLTDYGLIPVINQENAQDLMVAYKSPEYLQNKRITKKTDVWSLGI  527

Query  1794  VILEVVTGKFPSQYL---SNQKGGTDVVQWVRQAV--ADGKESEVIDPEIAGAGEDSDGK  1958
             +ILE++TGKFP+ +L          D+  WVR     AD   +EV D E+    E S+G+
Sbjct  528   LILEILTGKFPANFLQQGQQGSDQDDLATWVRLVAGEADQWPAEVFDKEMRAKSE-SEGE  586

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             M+KLL+IG  C E DVEKR  MKE +++I E+++
Sbjct  587   MLKLLKIGLRCCEGDVEKRWDMKEVVQKIEEVRE  620



>ref|NP_001057063.1| Os06g0198900 [Oryza sativa Japonica Group]
 dbj|BAD36641.1| putative receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 dbj|BAF18977.1| Os06g0198900 [Oryza sativa Japonica Group]
 dbj|BAG92451.1| unnamed protein product [Oryza sativa Japonica Group]
Length=693

 Score =   402 bits (1032),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 244/627 (39%), Positives = 351/627 (56%), Gaps = 45/627 (7%)
 Frame = +3

Query  267   SVGDDVVLIEFKESLQNTKGLDDTWVKG----KSPCDK-TRRWFGVLCHRKTVTGLRLYN  431
             ++ D   L++ K+S  N+  L    +      KSPC   +  W GV+C R  VTGLRL  
Sbjct  27    NMADAEALMQLKKSFTNSSSLSSWLITNTDGDKSPCAPGSHEWHGVVCSRGKVTGLRLNG  86

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             + L G +DV AL     LR ++ A N+FSGP+P  D+L  +KS+F   N+F+G +  D+F
Sbjct  87    LRLGGTVDVGALVGFHNLRSVSFAGNNFSGPLPAVDRLTSIKSMFFSDNQFTGVLPDDFF  146

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
             +K++ L+KLWL HN  SG IPAS+ +   L+ELHL  N FS  +PPL   +L + D+S N
Sbjct  147   SKLSHLKKLWLDHNELSGAIPASIAQATSLLELHLAHNAFSGELPPLPPPALKVFDISWN  206

Query  792   KLQGEIPSGMARFGAKAFEGNPELCGEPVG-RQCREDLGKDGGGGAEAQTPENAQRHSSG  968
              L+G +P    +F A  F GN  LC  P   R C+             Q    +    S 
Sbjct  207   DLEGVVPEAFRKFDAGRFGGNQYLCYVPTSDRPCK-----------RVQAAAASSSKRSP  255

Query  969   MRWlllsivaglllvailFNKNQNEE----NVKTRRKDNLDE---VLVVQIASMARSESI  1127
             M ++ L +   ++ + +    N++      +   R  D LDE   V +V+  S     S 
Sbjct  256   MAFVTLLVSVVVVALVLCLCCNRSSRVHDFDPAHRGGDGLDERPPVYMVKQFSTTGKRSA  315

Query  1128  NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
             +   +R+ S+     R       +E  G  G  +L++ +    G  GL    KAA  VIG
Sbjct  316   SWLGKRTGSSLRGHRRAASAAKADELGG--GAGDLVIVN-NCKGVFGLTDLMKAAAEVIG  372

Query  1308  ---------------LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
                            + VVVKR ++ N+  KDAF+AEM+++G + H N+LP LAYHYR+ 
Sbjct  373   SGGHGSAYKAVMANGVAVVVKRARDMNRATKDAFEAEMKRLGAMSHANLLPPLAYHYRRD  432

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+V E+ PKGSLLY+LHGDRG  +  L   TR+K+  GVA G  +LH E A +++PHG
Sbjct  433   EKLLVYEYIPKGSLLYVLHGDRGMDYAGLDWPTRLKVAVGVARGTAFLHGELAGHEVPHG  492

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGI  1793
             NLKS+NILL P +EPLL D+ +  L++   +   M A +APE   GH +  K+DVYCLGI
Sbjct  493   NLKSANILLAPDFEPLLVDFGYSGLINHMQSPNSMIARRAPECAAGHPVGAKADVYCLGI  552

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             V+LE++TGKFPS YL N KGGTD+V W   A+ADG E ++ D  I  A + +   M +L+
Sbjct  553   VLLELLTGKFPSLYLQNAKGGTDLVMWATSAIADGYERDLFDKAITSAWKFALPDMARLM  612

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREI  2054
             ++   C E+D +KR  MK A  R+ E+
Sbjct  613   RVAVDCVETDADKRPDMKVAAARVEEV  639



>emb|CBI27779.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   397 bits (1020),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 261/337 (77%), Gaps = 7/337 (2%)
 Frame = +3

Query  1065  KDNLDEVLVVQIASMAR--SESINHssrrststegs-ssrggDFVLVNEERGMFGLSELM  1235
             K+NLDEV+ +Q++   R  ++S+  ++  S        +   D V++N+E+G FGL +LM
Sbjct  167   KENLDEVVEIQVSGSTRKGADSLKKANGSSRRGSQHGRASVSDLVMINDEKGSFGLPDLM  226

Query  1236  MASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
              A+AEVLGNGGLGSAYKA +   GL VVVKR++E N++ +D+FDA++RK+G LRH NIL 
Sbjct  227   KAAAEVLGNGGLGSAYKAVMAN-GLAVVVKRMREINRLGRDSFDAQIRKIGRLRHENILT  285

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
              LAYHYRK+EKL++SE+ PKGSLLY++HGDRG +H++L   TR+KII+G+ASGM +LH+E
Sbjct  286   PLAYHYRKEEKLLISEYVPKGSLLYVMHGDRGISHSELNWPTRLKIIQGIASGMNFLHSE  345

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISHKSD  1775
             FA+  LPHGNLKSSNILL   Y PLLTDYAF+PLV+ T   Q MFA +A + H +S K D
Sbjct  346   FASLDLPHGNLKSSNILLDEHYVPLLTDYAFYPLVNATQASQAMFAYRAQDQH-VSPKCD  404

Query  1776  VYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDG  1955
             VYCLGIVILE++TGKFPSQYLSN KGGTDVVQWV+ A+ + +E+E+IDPEI  A E S+ 
Sbjct  405   VYCLGIVILEIITGKFPSQYLSNGKGGTDVVQWVKSAIEENRETELIDPEI--ASEASER  462

Query  1956  KMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             +M +LLQI A CTES+ E RL MKEAI+RI+EI+  +
Sbjct  463   EMQRLLQIAAECTESNPENRLDMKEAIRRIQEIKTAQ  499


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
            L++ K+SL +T  LD +WV   +PC     W G++C    VTGLRL +M L+G+IDVDAL
Sbjct  35   LLKLKKSLVHTGALD-SWVPSSNPCQGP--WDGLICLNGIVTGLRLGSMDLSGNIDVDAL  91

Query  468  SNLQGLRMIALANNSFSGPIPDFDKLRHLKSL  563
             +++GLR I+L NNSFSGP+P F++L  LK +
Sbjct  92   IDIRGLRTISLTNNSFSGPLPAFNRLGSLKEI  123



>gb|EAZ00041.1| hypothetical protein OsI_22042 [Oryza sativa Indica Group]
Length=693

 Score =   401 bits (1030),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 244/627 (39%), Positives = 351/627 (56%), Gaps = 45/627 (7%)
 Frame = +3

Query  267   SVGDDVVLIEFKESLQNTKGLDDTWVKG----KSPCDK-TRRWFGVLCHRKTVTGLRLYN  431
             ++ D   L++ K+S  N+  L    +      KSPC   +  W GV+C R  VTGLRL  
Sbjct  27    NMADAEALMQLKKSFTNSSSLSSWLITNTDGDKSPCAPGSHEWHGVVCSRGKVTGLRLNG  86

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             + L G +DV AL     LR ++ A N+FSGP+P  D+L  +KS+F   N+F+G +  D+F
Sbjct  87    LRLGGTVDVGALVGFHNLRSMSFAGNNFSGPLPAVDRLTSIKSMFFSDNQFTGVLPDDFF  146

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
             +K++ L+KLWL HN  SG IPAS+ +   L+ELHL  N FS  +PPL   +L + D+S N
Sbjct  147   SKLSHLKKLWLDHNELSGAIPASIAQATSLLELHLAHNAFSGELPPLPPPALKVFDISWN  206

Query  792   KLQGEIPSGMARFGAKAFEGNPELCGEPVG-RQCREDLGKDGGGGAEAQTPENAQRHSSG  968
              L+G +P    +F A  F GN  LC  P   R C+             Q    +    S 
Sbjct  207   DLEGVVPEAFRKFDAGRFGGNQYLCYVPTSDRPCK-----------RVQAAAASSSKRSP  255

Query  969   MRWlllsivaglllvailFNKNQNEE----NVKTRRKDNLDE---VLVVQIASMARSESI  1127
             M ++ L +   ++ + +    N++      +   R  D LDE   V +V+  S     S 
Sbjct  256   MAFVTLLVSVVVVALVLCLCCNRSSRVHDFDPAHRGGDGLDERPPVYMVKQFSTTGKRSA  315

Query  1128  NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
             +   +R+ S+     R       +E  G  G  +L++ +    G  GL    KAA  VIG
Sbjct  316   SWLGKRTGSSLRGHRRAASAAKADELGG--GAGDLVIVN-NCKGVFGLTDLMKAAAEVIG  372

Query  1308  ---------------LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
                            + VVVKR ++ N+  KDAF+AEM+++G + H N+LP LAYHYR+ 
Sbjct  373   SGGHGSAYKAVMANGVAVVVKRARDMNRATKDAFEAEMKRLGAMSHANLLPPLAYHYRRD  432

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+V E+ PKGSLLY+LHGDRG  +  L   TR+K+  GVA G  +LH E A +++PHG
Sbjct  433   EKLLVYEYIPKGSLLYVLHGDRGMDYAGLDWPTRLKVAVGVARGTAFLHGELAGHEVPHG  492

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGI  1793
             NLKS+NILL P +EPLL D+ +  L++   +   M A +APE   GH +  K+DVYCLGI
Sbjct  493   NLKSANILLAPDFEPLLVDFGYSGLINHMQSPNSMIARRAPECAAGHPVGAKADVYCLGI  552

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             V+LE++TGKFPS YL N KGGTD+V W   A+ADG E ++ D  I  A + +   M +L+
Sbjct  553   VLLELLTGKFPSLYLQNAKGGTDLVMWATSAIADGYERDLFDKAITSAWKFALPDMARLM  612

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREI  2054
             ++   C E+D +KR  MK A  R+ E+
Sbjct  613   RVAVDCVETDADKRPDMKVAAARVEEV  639



>gb|EAZ36151.1| hypothetical protein OsJ_20461 [Oryza sativa Japonica Group]
Length=719

 Score =   401 bits (1031),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 244/627 (39%), Positives = 351/627 (56%), Gaps = 45/627 (7%)
 Frame = +3

Query  267   SVGDDVVLIEFKESLQNTKGLDDTWVKG----KSPCDK-TRRWFGVLCHRKTVTGLRLYN  431
             ++ D   L++ K+S  N+  L    +      KSPC   +  W GV+C R  VTGLRL  
Sbjct  27    NMADAEALMQLKKSFTNSSSLSSWLITNTDGDKSPCAPGSHEWHGVVCSRGKVTGLRLNG  86

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             + L G +DV AL     LR ++ A N+FSGP+P  D+L  +KS+F   N+F+G +  D+F
Sbjct  87    LRLGGTVDVGALVGFHNLRSVSFAGNNFSGPLPAVDRLTSIKSMFFSDNQFTGVLPDDFF  146

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
             +K++ L+KLWL HN  SG IPAS+ +   L+ELHL  N FS  +PPL   +L + D+S N
Sbjct  147   SKLSHLKKLWLDHNELSGAIPASIAQATSLLELHLAHNAFSGELPPLPPPALKVFDISWN  206

Query  792   KLQGEIPSGMARFGAKAFEGNPELCGEPVG-RQCREDLGKDGGGGAEAQTPENAQRHSSG  968
              L+G +P    +F A  F GN  LC  P   R C+             Q    +    S 
Sbjct  207   DLEGVVPEAFRKFDAGRFGGNQYLCYVPTSDRPCK-----------RVQAAAASSSKRSP  255

Query  969   MRWlllsivaglllvailFNKNQNEE----NVKTRRKDNLDE---VLVVQIASMARSESI  1127
             M ++ L +   ++ + +    N++      +   R  D LDE   V +V+  S     S 
Sbjct  256   MAFVTLLVSVVVVALVLCLCCNRSSRVHDFDPAHRGGDGLDERPPVYMVKQFSTTGKRSA  315

Query  1128  NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
             +   +R+ S+     R       +E  G  G  +L++ +    G  GL    KAA  VIG
Sbjct  316   SWLGKRTGSSLRGHRRAASAAKADELGG--GAGDLVIVN-NCKGVFGLTDLMKAAAEVIG  372

Query  1308  ---------------LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
                            + VVVKR ++ N+  KDAF+AEM+++G + H N+LP LAYHYR+ 
Sbjct  373   SGGHGSAYKAVMANGVAVVVKRARDMNRATKDAFEAEMKRLGAMSHANLLPPLAYHYRRD  432

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+V E+ PKGSLLY+LHGDRG  +  L   TR+K+  GVA G  +LH E A +++PHG
Sbjct  433   EKLLVYEYIPKGSLLYVLHGDRGMDYAGLDWPTRLKVAVGVARGTAFLHGELAGHEVPHG  492

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGI  1793
             NLKS+NILL P +EPLL D+ +  L++   +   M A +APE   GH +  K+DVYCLGI
Sbjct  493   NLKSANILLAPDFEPLLVDFGYSGLINHMQSPNSMIARRAPECAAGHPVGAKADVYCLGI  552

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             V+LE++TGKFPS YL N KGGTD+V W   A+ADG E ++ D  I  A + +   M +L+
Sbjct  553   VLLELLTGKFPSLYLQNAKGGTDLVMWATSAIADGYERDLFDKAITSAWKFALPDMARLM  612

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREI  2054
             ++   C E+D +KR  MK A  R+ E+
Sbjct  613   RVAVDCVETDADKRPDMKVAAARVEEV  639



>ref|XP_008228018.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Prunus mume]
Length=673

 Score =   399 bits (1026),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 238/650 (37%), Positives = 367/650 (56%), Gaps = 28/650 (4%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFS--FCLILQC---LPLSISVGDDV-VLIEFKESLQ--NTKGLDDT  338
             MA + R P     FF   F  +L C   LP    +      L+ FK++LQ  N      +
Sbjct  9     MARLMRAPNPTPTFFVALFIAVLSCMVMLPFGSPMATTTQALMRFKKTLQLGNESATLSS  68

Query  339   WVKGKSPCDKTR-RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSF  515
             W   + PC+  +  W GVLC    V GL+L N+GL G +D++ L+ L  L+ ++  NNS 
Sbjct  69    WDPNEDPCNGNKVNWVGVLCFNGNVRGLQLENLGLQGKLDLEPLTQLPYLKTLSFMNNSL  128

Query  516   SGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             +GP+P+   L+ L+SL++  N FSGEI  D F  M  LRKL+L +N F+G IP+SL   P
Sbjct  129   AGPLPELKNLK-LRSLYLSYNHFSGEIPDDAFEGMILLRKLYLGNNQFTGKIPSSLTTSP  187

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             ++ ++ LEGN FS  +P   Q+SL  L+L+ N+L+G +P G+++    +F GN +LCG P
Sbjct  188   KIFDVGLEGNKFSGQIPDFRQKSLKRLNLANNELEGPVPEGLSKLDPSSFSGNGKLCGPP  247

Query  876   VGRQCREDLGKDGGGG------AEAQTPENAQRHSSGMRWlllsivaglllvailFNK--  1031
             +  +C +                   +   +++ SSG++  L+ +   LLL  I      
Sbjct  248   LAGKCSDPPPPASPPPSAPPSECSGDSCGTSKKPSSGLKIALIVMSILLLLALIAVILIF  307

Query  1032  -NQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEER  1208
              N+  +  +    ++LD+      A+   S+    S   +   +        FV   ++R
Sbjct  308   LNKKRQQSELDVAESLDDSASKYTAAGGSSQMDVKSVEATPHPKKGDLGKLSFV--RDDR  365

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
               F L +L+ ASAE+LG+G  G++YKA   ++   VVVKR K+ N + ++ F   MR++G
Sbjct  366   QKFDLHDLLRASAEILGSGTFGASYKAL--IMTDAVVVKRYKQMNNVGREEFHEHMRRLG  423

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              L H N+LPL+AY+YR++EKL+VS+F   GSL   LHG+  +    L    R+++IKG+A
Sbjct  424   RLTHPNLLPLVAYYYRREEKLLVSDFVENGSLASHLHGNHNSDQPVLDWPIRLRVIKGIA  483

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ YL++   +  +PHG+LKSSN+LL   +EPLL DYA  P+++       M A K+PE
Sbjct  484   RGLTYLYSALPSLVVPHGHLKSSNVLLDENFEPLLNDYALLPVINMEQAQHLMMAYKSPE  543

Query  1749  GHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQ-KGGTDVVQWVRQAVADGKESEVI  1916
               Q   I+ K+DV+CLGI+ILEV+TGKFP  YL        D+  WV   + + + SEV 
Sbjct  544   YAQHRRITKKTDVWCLGIIILEVLTGKFPENYLKQSFDSRADLASWVNGMIKEKRTSEVF  603

Query  1917  DPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             D E+ G G  S G+++KLL+IG  C E DVE+RL + E +++I E+ + E
Sbjct  604   DVEMGGVGS-SKGELLKLLKIGVKCCEEDVERRLDLNEVVEKIDELNEGE  652



>ref|XP_007217637.1| hypothetical protein PRUPE_ppa002419mg [Prunus persica]
 gb|EMJ18836.1| hypothetical protein PRUPE_ppa002419mg [Prunus persica]
Length=674

 Score =   397 bits (1021),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 239/651 (37%), Positives = 366/651 (56%), Gaps = 29/651 (4%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFS--FCLILQC---LPLSISVGDDV-VLIEFKESLQ--NTKGLDDT  338
             MA + R P     FF   F  +L C   LP    +      L+ FK++LQ  N      +
Sbjct  9     MARLMRAPNPTPTFFVALFIAVLSCMVMLPFGSPMATTAEALMRFKKTLQLGNESATLSS  68

Query  339   WVKGKSPCDKTR-RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSF  515
             W   K PC+  +  W GVLC    V GL+L N+GL G +D++ L+ L  L+ ++  NNS 
Sbjct  69    WDPNKDPCNGNKVNWVGVLCFNGNVRGLQLENLGLQGKLDLEPLTRLPYLKTLSFMNNSL  128

Query  516   SGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             +GP+PD   L+ L+S+++  N FSGEI  D F  M  LRKL+L +N F+G IP+SL  LP
Sbjct  129   AGPLPDLKNLK-LRSVYLSYNHFSGEIPDDAFEGMILLRKLYLGNNQFTGKIPSSLTTLP  187

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             ++ ++ LE N FS  +P   Q+ L  L+L+ N+L+G +P  +++    +F GN +LCG P
Sbjct  188   KIFDVGLEENKFSGQIPEFRQKGLKRLNLANNELEGPVPESLSKLDPSSFSGNGKLCGPP  247

Query  876   VGRQCREDLGKDGGGGAEAQTPE-------NAQRHSSGMRWlllsivaglllvailFNK-  1031
             +  +C +           A   E        +++ SSG++  L+ +   LLL  I     
Sbjct  248   LAGKCSDPPPPASPPSPSAPPSECSGDSCGTSKKPSSGLKIALIVVSILLLLALIAVILI  307

Query  1032  --NQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEE  1205
               N+  +  +    ++LD+      A+   S+    S   +   +        FV   ++
Sbjct  308   FLNKKRQQSELDVAESLDDSASKYTAAGGSSQMDVKSVEATPHPKKGDHGKLSFV--RDD  365

Query  1206  RGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKM  1385
             R  F L +L+ ASAE+LG+G  G++YKA   ++   VVVKR K+ N + ++ F   MR++
Sbjct  366   RQRFDLHDLLRASAEILGSGTFGASYKAL--IMTDAVVVKRYKQMNNVGREEFHEHMRRL  423

Query  1386  GMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGV  1565
             G L H N+LPL+AY+YR++EKL+VS+F   GSL   LHG+  +    L    R+++IKG+
Sbjct  424   GRLTHPNLLPLVAYYYRREEKLLVSDFVENGSLASHLHGNHNSDQPVLDWPIRLRVIKGI  483

Query  1566  ASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP  1745
             A G+ YL++   +  +PHG+LKSSN+LL   +EPLL DYA  P+++       M A K+P
Sbjct  484   ARGLTYLYSALPSLVVPHGHLKSSNVLLDENFEPLLNDYALLPVINMEQAQHLMMAYKSP  543

Query  1746  EGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQ-KGGTDVVQWVRQAVADGKESEV  1913
             E  Q   I+ K+DV+CLGI+ILEV+TGKFP  YL        D+  WV   + + + SEV
Sbjct  544   EYAQHRRITKKTDVWCLGIIILEVLTGKFPENYLKQSFDSRADLASWVNGMIKEKRTSEV  603

Query  1914  IDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
              D E+ G G  S G+++KLL+IG  C E DVE+RL + E +++I E+ + E
Sbjct  604   FDVEMGGVGS-SKGELLKLLKIGVKCCEEDVERRLDLTEVVEKIDELNEGE  653



>gb|AET04312.2| LRR receptor-like kinase [Medicago truncatula]
Length=632

 Score =   396 bits (1017),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 241/636 (38%), Positives = 355/636 (56%), Gaps = 42/636 (7%)
 Frame = +3

Query  201   IPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRW  380
             I    L   +FC     LP S +  D  +L+ FK  L N   L++      + C     W
Sbjct  8     ISIIILFMIAFCF----LPSSTADTDAQILVNFKSFLSNADALNNWSNDSINVC----TW  59

Query  381   FGVLCHRKTVT-GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLK  557
              G++C  +T+  GLRL NMGL+G I+VD L  L  L+  ++ NN+F G +P F+K+  L+
Sbjct  60    TGLICINQTILHGLRLENMGLSGTINVDILMKLSNLKSFSVINNNFEGTMPSFNKIVGLR  119

Query  558   SLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSS  737
             +LF+  N+FSGEI  D F  +  L++++L+ NGF G+IP SL +LPRL ++ L GN F  
Sbjct  120   ALFLTKNKFSGEIPDDAFEGLRWLKRVFLAENGFKGHIPKSLAQLPRLYDIDLHGNSFDG  179

Query  738   AVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGG  917
              +P   Q    + +LS N+L+G IP G+       F GN  LCG+P+ + C         
Sbjct  180   NIPDFLQSGFRVFNLSNNQLEGAIPEGLRNEDPSVFAGNKGLCGKPLEQPC---------  230

Query  918   GGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQ  1097
               +E+ +    + +    +   + I     +V ++         ++ RRK   ++     
Sbjct  231   --SESHSAPREEENEKEPKKRHVLISIIAFVVVLILASILALLFIRYRRKKAAEK----S  284

Query  1098  IASMARSESINHssrrststegsssrgg---------DFVLVNEERGMFGLSELMMASAE  1250
             I +M  ++S +H++  ST++   +             D   V  ER  F L +L+ ASAE
Sbjct  285   IWNMENAQSQSHNTNTSTASTSEAKSIVVESKKNKDEDLNFVTNERVEFDLQDLLRASAE  344

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             VLG+G  GS YKA + + G  VVVKR K  NK+ K  F   MR++G L H N+LPL+A++
Sbjct  345   VLGSGSFGSTYKAMV-LTGPVVVVKRFKHMNKVGKKEFYDHMRRLGRLTHPNLLPLVAFY  403

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             Y K EKL++ +F   GSL   LHG     H +L  ATR+KIIKGVA G+ YL+ EF   K
Sbjct  404   YGKDEKLLIHDFAENGSLASHLHG----RHCELDWATRLKIIKGVARGLAYLYREFPDEK  459

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVY  1781
             LPHG+LKSSN++L  ++EP LT+Y    +       Q M   K+PE  Q    S KSDV+
Sbjct  460   LPHGHLKSSNVVLDHSFEPFLTEYGLVEVTDLNHAQQFMVGYKSPEVSQHEGPSEKSDVW  519

Query  1782  CLGIVILEVVTGKFPSQYLSNQKGGT-DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             CLGI+ILE++TGKFP+ YL + KG   D+  WV   V DG   EV+D  I G     +G+
Sbjct  520   CLGILILELLTGKFPANYLRHGKGANEDLAMWVESIVRDGWSGEVLDKSIGGGSRGEEGE  579

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             M+KLL+IG +C E  +E RL  KEA+ +I E+++++
Sbjct  580   MLKLLRIGMSCCEWSLENRLGWKEAVAKIEELKEMD  615



>gb|KHN42785.1| Putative inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=347

 Score =   385 bits (990),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 253/339 (75%), Gaps = 14/339 (4%)
 Frame = +3

Query  1050  VKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSE  1229
             V   R +N +EVL+VQ+ SM                +   ++ GD V+VNEERG+FGL +
Sbjct  19    VSRSRSNNTEEVLMVQVPSM---------RGGVGDKKKEGNKRGDIVMVNEERGVFGLQD  69

Query  1230  LMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNI  1409
             LM ASAEVLGNGGLGS YKA +   GL VVVKR++E NK+ KD FDAEMR+ G +RH NI
Sbjct  70    LMKASAEVLGNGGLGSMYKAVMGT-GLCVVVKRMREMNKIGKDVFDAEMRQFGRIRHRNI  128

Query  1410  LPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLH  1589
             +  LAYHYR++EKL ++E+ PKGSLLY+LHGDRGT+H++L   TR+ I+KG+A G+++L+
Sbjct  129   ITPLAYHYRREEKLFITEYMPKGSLLYVLHGDRGTSHSELTWPTRLNIVKGIARGLKFLY  188

Query  1590  TEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---EGHQI  1760
             +EF+TY LPHGNLKSSN+LLT  YEPLL+DYAF PL++   ++Q +FA K+P   +  ++
Sbjct  189   SEFSTYDLPHGNLKSSNVLLTDDYEPLLSDYAFQPLINPKVSVQALFAFKSPDFVQNQKV  248

Query  1761  SHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAG  1940
             S K+DVYCLG++ILE++TGKFPSQY SN KGGTDVVQW   A+++G E+E+ID E+    
Sbjct  249   SQKTDVYCLGVIILEIITGKFPSQYHSNGKGGTDVVQWAFTAISEGTEAELIDSELPNDA  308

Query  1941  EDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              +S   M+ LL IGA C ES+ E+RL+MKEA++RI E+Q
Sbjct  309   -NSRKNMLHLLHIGACCAESNPEQRLNMKEAVRRIEEVQ  346



>gb|KCW80801.1| hypothetical protein EUGRSUZ_C02173 [Eucalyptus grandis]
Length=643

 Score =   396 bits (1017),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 247/600 (41%), Positives = 354/600 (59%), Gaps = 23/600 (4%)
 Frame = +3

Query  288   LIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
             L++FK SL +       W  G SPC      W GVLC + +V GL+L N GL G+IDVD+
Sbjct  25    LLKFKSSLDDQSNALANWNSG-SPCIGDQANWIGVLCMKGSVWGLQLENRGLEGEIDVDS  83

Query  465   LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
             L+ L  LR ++  NNSF+GP+P+  KL  LKS+F+  NRFSGEI AD F  M+ L+KL L
Sbjct  84    LAGLPSLRTLSFMNNSFNGPMPEIKKLGALKSVFLSYNRFSGEIPADSFEGMSYLKKLHL  143

Query  645   SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
             + N F G IP+SL +LPRL+EL LEGN F+  +P  AQ +L +LD+S N+L G IP+ +A
Sbjct  144   AGNQFEGAIPSSLTQLPRLLELRLEGNQFTGQIPAFAQHNLLLLDVSNNELDGPIPASLA  203

Query  825   RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivagl  1004
                + +F GN  LCG P+   C          G+ + T        + + +L+  ++   
Sbjct  204   NMNSSSFSGNEGLCGAPLS-PCTAAPASSDKKGSSSFTAILIYAIVASVLFLMALVLLIF  262

Query  1005  llvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggD  1184
              L      +NQ  ++++     NL      + AS      + H S  ++S+   +     
Sbjct  263   CLR----RRNQTSQSIEAPPPSNLQ-----KKASFKEEGHVRHGSPDNSSSGKKAENFK-  312

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
                V E+R  F L +L+ ASAE+LG+G  GS+YKAAL   G  +VVKR ++ N + ++ F
Sbjct  313   LSFVREDREKFDLQDLLKASAEILGSGCFGSSYKAAL-FSGSAMVVKRFRQMNNVGREEF  371

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G LRH N+LPL+AY+YRK+EKL+VS++   GSL   LH +       L   TR
Sbjct  372   QEHMRRLGRLRHPNLLPLVAYYYRKEEKLLVSDYVENGSLAVYLHSNHARGKPALDWPTR  431

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +K++KGVA G+ YL+ E  +   PHG+LKSSN+LL  T EPLLTDY   P+++       
Sbjct  432   LKVVKGVAKGLTYLYNELPSLIAPHGHLKSSNVLLATTLEPLLTDYGLIPVINQENAQDL  491

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYL---SNQKGGTDVVQWVRQA  1886
             M A K+PE  Q   I+ K+DV+ LGI+ILE++TGKFP+ +L          D+  WVR  
Sbjct  492   MVAYKSPEYLQNKRITKKTDVWSLGILILEILTGKFPANFLQQGQQGSDQDDLATWVRLV  551

Query  1887  V--ADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                AD   +EV D E+    E S+G+M+KLL+IG  C E DVEKR  MKE +++I E+++
Sbjct  552   AGEADQWPAEVFDKEMRAKSE-SEGEMLKLLKIGLRCCEGDVEKRWDMKEVVQKIEEVRE  610



>ref|XP_009127936.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Brassica rapa]
Length=625

 Score =   394 bits (1011),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 237/617 (38%), Positives = 359/617 (58%), Gaps = 29/617 (5%)
 Frame = +3

Query  237   LILQCLPLSI-SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVT  413
             L+L    LS  S+ +   L++FKESL NTK LD +W     PC  T+RWFG+LC++ +V 
Sbjct  10    LMLSLTALSANSLTEAEALLKFKESLTNTKSLD-SWTLDSEPCGGTQRWFGLLCNKNSVF  68

Query  414   GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGE  593
             GL++  +GL G+IDV  L +L GLR I++ NNSFSG IP+F++L  LKS+++  NRFSG+
Sbjct  69    GLQIEQLGLTGNIDVAPLVDLPGLRTISIMNNSFSGKIPEFNRLTALKSIYLSNNRFSGD  128

Query  594   ISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             I  DYF +M  L+KLWLS+N FSG+IP SL   LP+L+ELHLE N F+  +P   Q  L 
Sbjct  129   IPPDYFTRMLSLKKLWLSNNEFSGHIPLSLATTLPKLMELHLENNQFTGIIPNFTQPGLA  188

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
              ++LS N+L GEIP G++RF A +F GN +LCG  +   C +         A+    ++ 
Sbjct  189   DVNLSNNRLTGEIPPGLSRFKASSFAGNSDLCGAELATTCTQPGISTASISADGDK-KDE  247

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
              +    + +  L I+  L++  + F K +    ++T  +DN ++  +      +R+ +  
Sbjct  248   YKSKYYIAFGTLGILLILIIFFLFFLKKRRTSMLRTSEQDNNEDQQIQVTVDGSRTGASK  307

Query  1131  HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG--------NGGLGSAYK  1286
             H      +         D V+VN+E+G+F L EL+ +SA VLG         G +GSAYK
Sbjct  308   H-----GTPSSFRELRTDLVMVNKEKGVFDLDELLKSSAHVLGAPNGQPNSGGSVGSAYK  362

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   G+ VVVKR+   N+++   F  E++ +G LRH NIL  LAYH R+ EKL+V EF
Sbjct  363   AVI-ASGVKVVVKRVTVMNEVSIGVFAQEIKNLGSLRHKNILTPLAYHSRRDEKLLVFEF  421

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              P  SLL+ L  D+    + L   +R KII+G+A GM YLH E +   LPHGNLKSSN+ 
Sbjct  422   IPNLSLLHRLRSDQSEEDSQLNWPSRFKIIQGIARGMCYLHRELSFLTLPHGNLKSSNVF  481

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISHKSDVYCLGIVILEVVTGKFP  1826
             L    EPL++++    L++     Q + A  + +   +S KSDVY  G V+ E++TGKFP
Sbjct  482   LAEDGEPLISEFGLQRLINPDAQSQSLAAYSSRDA-TVSAKSDVYSFGAVVFEILTGKFP  540

Query  1827  SQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD---GKMVKLLQIGAACT  1994
             +QY   +  GG ++ +W+      G + +++ P +  A         ++  +L+IG  C 
Sbjct  541   TQYGGLDPAGGGNLAEWI------GADLDLLHPTVVTAARGDKMAWDEIENVLRIGVRCI  594

Query  1995  ESDVEKRLSMKEAIKRI  2045
               D ++R SM E ++ +
Sbjct  595   GEDPDRRPSMIEVVEEL  611



>ref|XP_002531377.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF30997.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=666

 Score =   394 bits (1012),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 238/651 (37%), Positives = 365/651 (56%), Gaps = 48/651 (7%)
 Frame = +3

Query  186   AAVRRIPTF----------PLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDD  335
             AAVR  P            PL  F   ++   + +S ++ D   L++FK+SL N   L +
Sbjct  8     AAVRAPPCINITSMACKDKPLFLFLSFVVSAHVVVSSALTDSENLLKFKDSLSNASALAN  67

Query  336   TWVKGKSPCD-KTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNS  512
              W +   PC+  T  W GV+C +  V GL+L  MGL G ID   L +   LR I+  NNS
Sbjct  68    -WSENIKPCNGDTSNWNGVICVKNYVWGLQLERMGLTGKIDFQILESFPELRTISFMNNS  126

Query  513   FSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKL  692
             F GP+P+  KL  L+S+++  N FSGEI  + F  +  L+K++L+HNGF G IP+SL  L
Sbjct  127   FDGPLPEIKKLGALRSIYLSNNHFSGEIPDNAFEGLLKLKKVFLAHNGFEGAIPSSLANL  186

Query  693   PRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGE  872
             P+L++L LEGN FS  +P   ++    L++S N+L G IP  +++F   +F GN  LCG 
Sbjct  187   PKLLDLRLEGNKFSGKLPNFKEK-FASLNVSNNELGGPIPESLSKFDLTSFSGNKGLCGW  245

Query  873   PVGRQCREDLGKDGGGGAE-AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEEN  1049
             P+  QC      DG   +  ++ P  A      +   +           +   + +  + 
Sbjct  246   PLS-QC------DGSNSSSISKKPPLASIVVVAIVVAVAIAAIVGAAFILFTRRKRTSKT  298

Query  1050  VKT---------RRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNE  1202
             ++T         ++K  +++V   Q      SE  +H  +   +             V +
Sbjct  299   IETPPPPPPSNLQKKTGINDV--EQGLQAGSSEQSSHDKKTEITK---------LSFVRD  347

Query  1203  ERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRK  1382
             +R  F L +L+ ASAE+LG+G  GS+YKAAL   G T+VVKR K+ N + K+ F   MR+
Sbjct  348   DRERFDLHDLLKASAEILGSGCFGSSYKAALST-GPTMVVKRFKQMNNVGKEEFQEHMRR  406

Query  1383  MGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKG  1562
             +G LRH N+LPL+AY+YRK+EKL+V+++  KGSL   LHG +     ++  + R+K+ KG
Sbjct  407   LGRLRHPNLLPLVAYYYRKEEKLLVTDYVEKGSLAVHLHGHQALGQPNMDWSIRLKVAKG  466

Query  1563  VASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKA  1742
             +  G+ YLH E  +    HG+LKSSN+L+    EPLLTDY   P+++     + M A ++
Sbjct  467   IGKGLVYLHKELPSIIAAHGHLKSSNVLIDECNEPLLTDYGLVPVINQENAQELMVAYRS  526

Query  1743  PEGHQISH---KSDVYCLGIVILEVVTGKFPSQYLSNQKGG--TDVVQWVRQAVADGKES  1907
             PE  Q+S    K+DV+ LGI+ILE++TGKFP+ +L   KG    D+  WV     +   S
Sbjct  527   PEYLQLSRITKKTDVWNLGILILELLTGKFPTNFLPQGKGNEEEDLASWVNSIPEEEWMS  586

Query  1908  EVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +V D EI  A + ++ +M KLL+IG +C E DVEKRL ++EA++RI ++++
Sbjct  587   KVFDKEIK-ASKSNESEMKKLLKIGLSCCEGDVEKRLDLREAVERINQVKE  636



>emb|CDY53303.1| BnaC02g46420D [Brassica napus]
Length=622

 Score =   392 bits (1006),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 246/629 (39%), Positives = 355/629 (56%), Gaps = 56/629 (9%)
 Frame = +3

Query  237   LILQCLPLSI-SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVT  413
             L+L    LS  S+ +   L++FKESL NTK LD +W     PC +T+RWFG+LC++ +V 
Sbjct  10    LMLSLTALSANSLTEAEALLKFKESLTNTKSLD-SWTLDSEPCGRTQRWFGLLCNKNSVF  68

Query  414   GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGE  593
             GL++  +GL G+IDV  L +L GLR +++ NNSFSG IP+F++L  LKS+++  NRFSG+
Sbjct  69    GLQIEQLGLTGNIDVAPLVDLPGLRTVSIMNNSFSGKIPEFNRLTALKSIYLSNNRFSGD  128

Query  594   ISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             I  DYFA+M  L+KLWLS+N FSG+IP SL   LP+L+ELHLE N F+  +P   Q  L 
Sbjct  129   IPPDYFARMLSLKKLWLSNNEFSGHIPLSLATTLPKLMELHLENNQFTGIIPNFTQPGLA  188

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE------DLGKDGGGGAEA  932
              ++LS N+L GEIP G++RF A +F GN +LCG  +G  C +       +  DG   AE 
Sbjct  189   DVNLSNNRLTGEIPPGLSRFKASSFAGNSDLCGAELGTTCTQPGISTASISVDGDKKAEY  248

Query  933   QTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASM-  1109
             ++           ++ +     G          N+  + +   R   + EV +  I  + 
Sbjct  249   KS-----------KYYIAFGTLGRGGRVCFVPLNKTTQRINKFRLVAMLEVHLFNIPLVT  297

Query  1110  ---ARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG-------  1259
                +RS +  H                D V+VN+E+G+F L EL+ +SA VLG       
Sbjct  298   VDGSRSGASRH-----GKPSSFRELRTDLVMVNKEKGVFDLEELLKSSAHVLGAPNGQPN  352

Query  1260  -NGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
               G +GSAYKA +   G+ VVVKR+   N+++   F  E++ +G LRH NIL  LAYH R
Sbjct  353   SGGSVGSAYKAVI-ASGVKVVVKRVTVMNEVSIGVFAQEIKNLGSLRHKNILTPLAYHSR  411

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             + EKL+V EF P  SLL+ L  +  +    L   +R KII+G+A GM YLH E A   LP
Sbjct  412   RDEKLLVFEFIPNLSLLHRLKSEEDS---QLNWPSRFKIIQGIARGMCYLHGELAFLTLP  468

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISHKSDVYCLGIV  1796
             HGNLKSSNI L    EPL++++    L+S     Q + A  + +   +S KSDVY  G V
Sbjct  469   HGNLKSSNIFLADDGEPLISEFGLQRLISPDAQSQSLAAYSSSDA-TVSAKSDVYTFGAV  527

Query  1797  ILEVVTGKFPSQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV---  1964
             +LE++TGK P QY   +  GG  + +W+      G + +++ P +  A  D   KMV   
Sbjct  528   VLEILTGKSPPQYGGLDPAGGASLAEWI------GSDVDLLHPTVVTAARDD--KMVWDE  579

Query  1965  --KLLQIGAACTESDVEKRLSMKEAIKRI  2045
                +L+IG  C   D ++R SM E +  +
Sbjct  580   IENVLRIGVRCIGEDPDRRPSMIEVVDEL  608



>emb|CDY03637.1| BnaA02g16000D [Brassica napus]
Length=625

 Score =   392 bits (1006),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 237/617 (38%), Positives = 359/617 (58%), Gaps = 29/617 (5%)
 Frame = +3

Query  237   LILQCLPLSI-SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVT  413
             L+L    LS  S+ +   L++FKESL NTK LD +W     PC  T+RWFG+LC++ +V 
Sbjct  10    LMLSLTALSANSLTEAEALLKFKESLTNTKSLD-SWTLDSEPCGGTQRWFGLLCNKNSVF  68

Query  414   GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGE  593
             GL++  +GL G+IDV  L +L GLR I++ NNSFSG IP+F++L  LKS+++  NRFSG+
Sbjct  69    GLQIEQLGLTGNIDVAPLVDLPGLRTISIMNNSFSGKIPEFNQLTALKSIYLSNNRFSGD  128

Query  594   ISADYFAKMTGLRKLWLSHNGFSGNIPASLG-KLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             I  DYFA+M  L+KLWLS+N FSG+IP SL   LP+L+ELHLE N F+  +P   Q  L 
Sbjct  129   IPPDYFARMLSLKKLWLSNNEFSGHIPLSLATTLPKLMELHLENNQFTGIIPNFTQPGLA  188

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
              ++LS N+L GEIP G++RF A +F GN +LCG  +   C +         A+    ++ 
Sbjct  189   DVNLSNNRLTGEIPPGLSRFKASSFAGNSDLCGAELATTCTQPGISTASISADGDK-KDE  247

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
              +    + +  L I+  L++  + F K +    ++T  +DN ++  +      +R+ +  
Sbjct  248   YKSKYYIAFGTLGILFILIIFFLFFLKKRRTSMLRTSEQDNNEDQQIQVTVDGSRTGASR  307

Query  1131  HssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG--------NGGLGSAYK  1286
             H      +         D V+VN+E+G+F L EL+ +SA VLG         G +GSAYK
Sbjct  308   H-----GTPSSFRELRTDLVMVNKEKGVFDLDELLKSSAHVLGAPNGQPNSGGSVGSAYK  362

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A +   G+ VVVKR+   N+++   F  E++ +G LRH NIL  LAYH R+ EKL+V EF
Sbjct  363   AVI-ASGVKVVVKRVTVMNEVSIGVFAQEIKNLGSLRHKNILTPLAYHSRRDEKLLVFEF  421

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              P  SLL+ L  D+    + L   +R KII+G+A GM YLH E +   LPHGNLKSSN+ 
Sbjct  422   IPNLSLLHRLRSDQSEEDSQLNWPSRFKIIQGIARGMCYLHRELSFLTLPHGNLKSSNVF  481

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISHKSDVYCLGIVILEVVTGKFP  1826
             L    EPL++++    L++     Q + A  + +   +S KSDVY  G V+ E++TGK P
Sbjct  482   LAEDGEPLISEFGLQRLINPDAQSQSLAAYSSRDA-TVSAKSDVYSFGAVVFEILTGKSP  540

Query  1827  SQYLS-NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD---GKMVKLLQIGAACT  1994
             +QY   +  GG ++ +W+      G + +++ P +  A         ++  +L+IG  C 
Sbjct  541   TQYGGLDPAGGGNLAEWI------GSDVDLLHPTVVTAARGDKMAWDEIENVLRIGVRCI  594

Query  1995  ESDVEKRLSMKEAIKRI  2045
               D ++R SM E ++ +
Sbjct  595   GEDPDRRPSMIEVVEEL  611



>ref|XP_010454374.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=392

 Score =   380 bits (976),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 234/294 (80%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN ++G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++ ++ 
Sbjct  99    DIIMVNSDKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TNGLSVVVKRIRDMNQLAREP  157

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  158   FDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  217

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+  T   Q
Sbjct  218   RLKIIQGVAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPTNASQ  277

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+ +VA
Sbjct  278   ALFAFKTPEFAQTQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQSSVA  337

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             + KE E+IDPEI     DS  +MV+LL++GAAC  S+ ++RL M+EA++RI ++
Sbjct  338   EQKEEELIDPEIVN-NTDSVRQMVELLRVGAACIASNPDERLDMREAVRRIEQV  390



>ref|XP_003629836.1| Receptor-like protein kinase [Medicago truncatula]
Length=869

 Score =   395 bits (1015),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 241/636 (38%), Positives = 355/636 (56%), Gaps = 42/636 (7%)
 Frame = +3

Query  201   IPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRW  380
             I    L   +FC     LP S +  D  +L+ FK  L N   L++      + C     W
Sbjct  8     ISIIILFMIAFCF----LPSSTADTDAQILVNFKSFLSNADALNNWSNDSINVCT----W  59

Query  381   FGVLCHRKTVT-GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLK  557
              G++C  +T+  GLRL NMGL+G I+VD L  L  L+  ++ NN+F G +P F+K+  L+
Sbjct  60    TGLICINQTILHGLRLENMGLSGTINVDILMKLSNLKSFSVINNNFEGTMPSFNKIVGLR  119

Query  558   SLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSS  737
             +LF+  N+FSGEI  D F  +  L++++L+ NGF G+IP SL +LPRL ++ L GN F  
Sbjct  120   ALFLTKNKFSGEIPDDAFEGLRWLKRVFLAENGFKGHIPKSLAQLPRLYDIDLHGNSFDG  179

Query  738   AVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGG  917
              +P   Q    + +LS N+L+G IP G+       F GN  LCG+P+ + C         
Sbjct  180   NIPDFLQSGFRVFNLSNNQLEGAIPEGLRNEDPSVFAGNKGLCGKPLEQPC---------  230

Query  918   GGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQ  1097
               +E+ +    + +    +   + I     +V ++         ++ RRK   ++     
Sbjct  231   --SESHSAPREEENEKEPKKRHVLISIIAFVVVLILASILALLFIRYRRKKAAEK----S  284

Query  1098  IASMARSESINHssrrststegsssrgg---------DFVLVNEERGMFGLSELMMASAE  1250
             I +M  ++S +H++  ST++   +             D   V  ER  F L +L+ ASAE
Sbjct  285   IWNMENAQSQSHNTNTSTASTSEAKSIVVESKKNKDEDLNFVTNERVEFDLQDLLRASAE  344

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             VLG+G  GS YKA + + G  VVVKR K  NK+ K  F   MR++G L H N+LPL+A++
Sbjct  345   VLGSGSFGSTYKAMV-LTGPVVVVKRFKHMNKVGKKEFYDHMRRLGRLTHPNLLPLVAFY  403

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             Y K EKL++ +F   GSL   LHG     H +L  ATR+KIIKGVA G+ YL+ EF   K
Sbjct  404   YGKDEKLLIHDFAENGSLASHLHG----RHCELDWATRLKIIKGVARGLAYLYREFPDEK  459

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVY  1781
             LPHG+LKSSN++L  ++EP LT+Y    +       Q M   K+PE  Q    S KSDV+
Sbjct  460   LPHGHLKSSNVVLDHSFEPFLTEYGLVEVTDLNHAQQFMVGYKSPEVSQHEGPSEKSDVW  519

Query  1782  CLGIVILEVVTGKFPSQYLSNQKGGT-DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             CLGI+ILE++TGKFP+ YL + KG   D+  WV   V DG   EV+D  I G     +G+
Sbjct  520   CLGILILELLTGKFPANYLRHGKGANEDLAMWVESIVRDGWSGEVLDKSIGGGSRGEEGE  579

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             M+KLL+IG +C E  +E RL  KEA+ +I E+++++
Sbjct  580   MLKLLRIGMSCCEWSLENRLGWKEAVAKIEELKEMD  615



>ref|XP_010696133.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   387 bits (994),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 233/605 (39%), Positives = 344/605 (57%), Gaps = 21/605 (3%)
 Frame = +3

Query  270   VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDK--TRRWFGVLCHRKTVTGLRLYNMGLA  443
             V +   L++FK SL N + + + W    +PC    T +W GV+C    V GL+L NMGL 
Sbjct  40    VTEAEALLKFKSSLTNQEAIPN-WDPSTTPCSNGGTSKWVGVICEYGKVWGLQLQNMGLG  98

Query  444   GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
             G  D+DAL  L  LR ++  NN   GPIPD  +L  L+SLF+  N+FSGEI    FA M 
Sbjct  99    GTPDIDALYQLSELRTLSFKNNKLEGPIPDLHRLPKLRSLFLTNNKFSGEIPEYVFAGMD  158

Query  624   GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
              LR++ L++N F G IP+SL  LP LVEL L+ N F  ++P   Q++L  ++++ N+L+G
Sbjct  159   SLRRVVLTNNAFIGKIPSSLATLPILVELKLDRNQFQGSIPDFQQKNLPSINVANNQLEG  218

Query  804   EIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWll  983
              +P+ + +  AK + GN  LCG P+     E         A A TP    + SS      
Sbjct  219   PLPARLTKLDAKLYSGNKGLCGAPLEPCASET-------AASAPTPITKHKSSS----KT  267

Query  984   lsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststeg  1163
               IV  +LL  ++          K RR   + +  +         E+    S + T T  
Sbjct  268   AIIVVDILLGLVILIVVILLVCQKKRRAKFMKQNTLASQDGNQFVETYVPPSEQRTMTTR  327

Query  1164  sssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETN  1343
               S       V ++R  F LS+L+ ASAEVL +G   S+YK  + + G  +VVKR ++ +
Sbjct  328   KRSDPEKLDFVRDDRKYFDLSDLLTASAEVLESGNFESSYKVEI-IAGELLVVKRFRQMS  386

Query  1344  KMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHN  1523
             K+ ++ F    R MG LRH N+L L+AY+YRK+EKL++ +F   GSL   LHG+R     
Sbjct  387   KVGREDFHEHSRIMGKLRHPNVLALVAYYYRKEEKLLIFDFVDNGSLASHLHGNRSQKDR  446

Query  1524  DLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVS  1703
                   R+KIIKGVA G+ YL++E  +Y +PHG LKSSN+LL  +YEPLL +YA  PL++
Sbjct  447   GFDWPMRLKIIKGVARGLAYLYSELPSYIVPHGYLKSSNVLLNDSYEPLLMNYALQPLIN  506

Query  1704  GTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS-NQKGGTDVVQ  1871
                  Q M A K+PE  Q   ++ K+DV+ LGI+ILEV+TGKFP+ +L+     G ++V 
Sbjct  507   PEHAKQLMVAYKSPEYAQLGRLTRKTDVWSLGILILEVLTGKFPTNFLAVGTVKGENLVA  566

Query  1872  WVRQ-AVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIR  2048
             WV   A A+ K  +V D E+ G     D ++ KLL++G +C   +++ R S+KEA+++I 
Sbjct  567   WVHDIASAEEKGEDVFDKEMGGTHHSQD-EIKKLLKVGFSCCHENLDVRWSIKEAVEKIE  625

Query  2049  EIQDV  2063
             EI++ 
Sbjct  626   EIKET  630



>ref|XP_011011658.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Populus euphratica]
Length=662

 Score =   387 bits (995),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 235/609 (39%), Positives = 363/609 (60%), Gaps = 29/609 (5%)
 Frame = +3

Query  285   VLIEFKESLQNTKGLDDTWVKGKSPCDKTR-RWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
              L++FK+ L N  G  ++W     PC+  R  W GVLC   ++ GL+L +M L+GDID+D
Sbjct  49    ALLQFKDQLANN-GAINSWNPSVKPCEWERSNWVGVLCLNGSIRGLQLEHMALSGDIDLD  107

Query  462   ALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLW  641
             AL+ L   R ++L +N+F GP+PDF KL  LK+L++  NRF+G+I  + F  M  L++L+
Sbjct  108   ALAPLPSFRTLSLMDNNFDGPLPDFKKLGKLKALYLSNNRFTGDIPDNAFEGMGSLKRLY  167

Query  642   LSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGM  821
             L++N  +G IP+SL  LP+L+EL LEGN F   +P   Q+S+  ++++ N+L+G IP  +
Sbjct  168   LANNLLAGKIPSSLATLPKLMELKLEGNQFQGQIPNFQQKSMKTVNVASNELEGPIPEAL  227

Query  822   ARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivag  1001
             +R    +F GN  LCG P+G  C           +   TP++  +  S +  +++ ++  
Sbjct  228   SRLSPHSFAGNKGLCGPPLG-PCIT---------SPPSTPKSTGKQFSILYIVIIILIVL  277

Query  1002  lllvailF-----NKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegs  1166
             L+L AI F     ++ + +  ++ R   + +E     +AS  R     H     TS+   
Sbjct  278   LMLAAIAFAFLLFSRKKCKSRIQ-RTASSPEENSNKMVASYYRDV---HRELSETSSHAK  333

Query  1167  ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNK  1346
              +  G    + ++   F L +L+ ASAEVLG+G  GS+YKA   V+G  VVVKR +  + 
Sbjct  334   KADHGKLTFLKDDIEKFDLQDLLTASAEVLGSGTFGSSYKAV--VVGQPVVVKRYRHMSN  391

Query  1347  MNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHND  1526
             + ++ F   MR++G L+H N+LPL AY+ R+ EKL+V+EF   GSL   LHG+     + 
Sbjct  392   VGREEFHEHMRRLGRLKHPNLLPLAAYYNRRDEKLLVTEFAENGSLASHLHGNHSPEEDG  451

Query  1527  LKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
             L    R+KI+KGVA G+ +L+ E      PHG+LKSSN+LL  ++EPLLTDYA  P+V+ 
Sbjct  452   LHWHIRLKIVKGVARGLAFLYNELPIIA-PHGHLKSSNVLLDESFEPLLTDYALRPVVNP  510

Query  1707  TPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQW  1874
                   M A K+PE  Q    S+K+DV+  GI+ILE++TGKFP  YL+       D+  W
Sbjct  511   EHAHMFMMAYKSPEYAQQSRTSNKTDVWSFGILILEMLTGKFPENYLTPCYNSDADLATW  570

Query  1875  VRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V   V + + SEV D EI G  ++S G+M+KLL+IG +C E DVE+RL +KE +++I  +
Sbjct  571   VNNMVKEKRTSEVFDKEIVGT-KNSKGEMIKLLKIGLSCCEEDVERRLDIKEVVEKIDVL  629

Query  2055  QDVEVFHEL  2081
             ++ +   EL
Sbjct  630   KEGDNDEEL  638



>ref|XP_008242264.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Prunus mume]
Length=633

 Score =   386 bits (991),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 238/295 (81%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VN+E+G FGLS+LM A+AEVLGNGGLGSAYKA +   G++VVVKR+++ N++ +D 
Sbjct  340   ELLMVNDEKGSFGLSDLMKAAAEVLGNGGLGSAYKAVMSN-GMSVVVKRMRDMNRLGRDG  398

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYR++EKL++SE+ PKGSLLYLLHGDRG +H++L    
Sbjct  399   FDAEMRRFGRLRHKNILTPLAYHYRREEKLLISEYIPKGSLLYLLHGDRGISHSELNWPI  458

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G+A GM ++HTEFA+Y LPHGNLKSSN+LL   YEP+L DYA HPL++     Q
Sbjct  459   RLKIIQGIACGMGFIHTEFASYDLPHGNLKSSNVLLNDDYEPVLNDYALHPLINPNNAAQ  518

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  QIS KSDVYCLGI+ILE++TGKFPSQYLSN KGGTDVVQWV+ A+A
Sbjct  519   TMFAFRTPEITESQQISPKSDVYCLGILILEILTGKFPSQYLSNGKGGTDVVQWVQSAMA  578

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + +E E++DPEIA +  DS  +MV+LL+IGA CT SD E+RL ++EAI+RI E+Q
Sbjct  579   EQREEELLDPEIA-SDADSVDQMVQLLKIGADCTLSDPEQRLDIREAIRRIEEVQ  632


 Score =   192 bits (488),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 133/205 (65%), Gaps = 8/205 (4%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWV--KGKSPCDKTRRWFGVLCHR--KTVTGLRLYNMGLA  443
            D   L++FK+SL +   LD  W   +  SPC    +W G++C R    ++GL + +MGL+
Sbjct  26   DQEALLKFKKSLTHAGALD-KWTPDQNSSPC--KAKWTGIVCSRGSNVISGLHISDMGLS  82

Query  444  GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
            G ID DAL ++  LR I   NN+FSG IPDF  L  LKSL + G+ FSGEI  DYF+ MT
Sbjct  83   GKIDFDALKDIPTLRTINFMNNNFSGSIPDFHTLGALKSLLLSGSGFSGEIPKDYFSHMT  142

Query  624  GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
             L+K++L +N F+G IP SLG+L +L ELHLE N F+  +P L Q  L  LDLS NKLQG
Sbjct  143  SLKKIYLGNNNFTGKIPESLGQLNKLEELHLEKNQFTGPIPKLKQ-GLNSLDLSNNKLQG  201

Query  804  EIPSGMARFGAKAFEGNPELCGEPV  878
             IP  M+++  KAFEGN  LCG P+
Sbjct  202  PIPDSMSKYNPKAFEGNEGLCGVPL  226



>ref|XP_002310352.2| hypothetical protein POPTR_0007s15220g [Populus trichocarpa]
 gb|EEE90802.2| hypothetical protein POPTR_0007s15220g [Populus trichocarpa]
Length=664

 Score =   384 bits (987),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 226/606 (37%), Positives = 352/606 (58%), Gaps = 26/606 (4%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR-RWFGVLCHRKTVTGLRLYNMGLAGDI  452
             D   L++FKE L N +G+ + W    +PC++ R  W GVLC    + GL+L +MGLAG+I
Sbjct  36    DSDALLKFKEQLVNNEGISN-WNVSVNPCERDRSNWVGVLCFNGGIWGLQLEHMGLAGNI  94

Query  453   DVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLR  632
             D+DAL+ L   R ++L +N+F GP+PDF KL  LK+L++  NRFSG+I    F  M  L+
Sbjct  95    DLDALAPLPSFRTLSLMDNNFDGPLPDFKKLGKLKALYLSNNRFSGDIPDKAFEGMGSLK  154

Query  633   KLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIP  812
             +L+L++N  +G I +SL  LP+L EL L+GN F   +P   Q+ +   +++ N+L+G IP
Sbjct  155   RLFLANNLLTGKIASSLAILPKLTELKLDGNQFEGQIPNFQQKGMKTANVANNELEGPIP  214

Query  813   SGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsi  992
               ++R    +F GN  LCG P+G  C            +A   + +  +   +  ++L I
Sbjct  215   EALSRLSPNSFAGNKGLCGPPLG-PCI----PSPPSTPKAHGKKFSILYIVIIILIVLLI  269

Query  993   vaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARS--ESINHssrrststegs  1166
             +A +    +LF++ +++   + R  +N + ++      + R   E+ +HS          
Sbjct  270   LAAIAFAFLLFSRKESKRRTQRRASENSNRIMSSYYRDVHREMPETNSHSRITDHGK---  326

Query  1167  ssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNK  1346
                      + ++   F L +L+ ASAEVLG+G  GS+YKA   V G  VVVKR +  N 
Sbjct  327   ------LSFLKDDIEKFDLQDLLRASAEVLGSGTYGSSYKAV--VGGQPVVVKRYRHMNN  378

Query  1347  MNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHND  1526
             + ++ F   MR++G L+H N+LPL AY+YR+ EKL+V+ F   GSL   LHG+     + 
Sbjct  379   VEREEFHEHMRRIGRLKHPNLLPLAAYYYRRDEKLLVTVFAENGSLASHLHGNHSLEEDG  438

Query  1527  LKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
             L    R+KI+KGVA G+ +L+ +      PHG+LKSSN+LL  ++EPLLTDYA  P+++ 
Sbjct  439   LDWRIRLKIVKGVARGLAFLYNQLPIIA-PHGHLKSSNVLLDESFEPLLTDYALRPVINP  497

Query  1707  TPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS-NQKGGTDVVQW  1874
                   M A K+PE  Q    S+K+D++  GI+ILE++TGKFP  YL+       D+  W
Sbjct  498   EHAHVFMMAYKSPEYAQHGRSSNKTDIWSFGILILEILTGKFPENYLTPGYNSDADLATW  557

Query  1875  VRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V   V + + SEV D E+ G  ++S G+M+KLL+IG +C E +VE+R  +KE +  + E 
Sbjct  558   VNNMVKEKRTSEVFDKEMLGT-KNSKGEMIKLLKIGLSCCEQEVERRSDIKEGMHAVLEE  616

Query  2055  QDVEVF  2072
                +VF
Sbjct  617   IIKKVF  622



>ref|XP_009359759.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Pyrus x bretschneideri]
Length=659

 Score =   384 bits (985),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 238/295 (81%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VNEE+G FGL +LM A+AEVLGNGGLGSAYKA +   G +VVVKR++E N++ +D 
Sbjct  366   ELLMVNEEKGTFGLPDLMKAAAEVLGNGGLGSAYKAVMSN-GFSVVVKRMREMNRLGRDG  424

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYR++EKL++SE+ PKGSLLY+LHGDRG +H++L  +T
Sbjct  425   FDAEMRRFGRLRHKNILTPLAYHYRREEKLLISEYIPKGSLLYVLHGDRGISHSELNWST  484

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R++II+G+ASGM ++H EFA+Y LPHGNLKSSNILL   YEP+L DYA HPL++ +   Q
Sbjct  485   RLQIIQGIASGMGFIHIEFASYDLPHGNLKSSNILLKEDYEPVLNDYALHPLINPSNAAQ  544

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  QIS K+DVYCLGIVILE++TGKFPSQYLSN KGGTDVVQWV+ A+A
Sbjct  545   SMFAFRTPEYIESQQISPKADVYCLGIVILEILTGKFPSQYLSNGKGGTDVVQWVQSAMA  604

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + +E E++DPEIA +  DS  +M++LL +GA CT S+ E+RL ++EAI+RI E++
Sbjct  605   EQREQELLDPEIA-SETDSVDQMLQLLMVGADCTTSEPEQRLDLREAIRRIEEVR  658


 Score =   197 bits (500),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 128/202 (63%), Gaps = 2/202 (1%)
 Frame = +3

Query  285  VLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
             L++ K SL       D W    SPC+   +W G++C+   +TGL   NMGL+G+ID+DA
Sbjct  29   ALLKLKNSLSPADNPLDNWEPNTSPCND--KWAGIVCNEDVITGLHFPNMGLSGNIDIDA  86

Query  465  LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
            L ++  LR I + NN FSG IPDF KL  LKSLF+ GN FSGEI  DYF+ +T L+K++L
Sbjct  87   LKDIPTLRTINIMNNKFSGLIPDFHKLGALKSLFLAGNDFSGEIPKDYFSNLTSLKKIYL  146

Query  645  SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
            + N F+G IP SL +L +L +LHLE N F+  +P L    L  LD S NKLQG IP  ++
Sbjct  147  NGNNFTGKIPESLTQLTKLEQLHLEKNHFTGPIPNLKSGVLNSLDFSKNKLQGPIPETLS  206

Query  825  RFGAKAFEGNPELCGEPVGRQC  890
            +F  KAFEGN  LCG  +   C
Sbjct  207  KFDPKAFEGNEGLCGGLLKLSC  228



>ref|XP_007204840.1| hypothetical protein PRUPE_ppa026803mg [Prunus persica]
 gb|EMJ06039.1| hypothetical protein PRUPE_ppa026803mg [Prunus persica]
Length=668

 Score =   383 bits (983),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 237/295 (80%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VN+E+G FGLS+LM A+AEVLGNGGLGSAYKA +   G++VVVKR+++ N++ +D 
Sbjct  375   ELLMVNDEKGSFGLSDLMKAAAEVLGNGGLGSAYKAVMSN-GMSVVVKRMRDMNRLGRDG  433

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYR++EKL++SE+ PKGSLLYLLHGDRG +H++L    
Sbjct  434   FDAEMRRFGRLRHKNILTPLAYHYRREEKLLISEYIPKGSLLYLLHGDRGISHSELNWPI  493

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G+A G+ ++HTEFA+Y LPHGNLKSSN+LL   YEP+L DYA HPL++     Q
Sbjct  494   RLKIIQGIACGLGFIHTEFASYDLPHGNLKSSNVLLNDDYEPVLNDYALHPLINPNTAAQ  553

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  Q S KSDVYCLGI+ILE++TGKFPSQYL+N KGGTDVVQWV+ A+A
Sbjct  554   TMFAFRTPEITESQQTSPKSDVYCLGILILEILTGKFPSQYLTNGKGGTDVVQWVQSAMA  613

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + +E E++DPEIA +  DS  +MV+LL+IGA CT SD E+RL ++EAI+RI E+Q
Sbjct  614   EQREEELLDPEIA-SDADSVDQMVQLLKIGADCTLSDPEQRLDIREAIRRIEEVQ  667


 Score =   197 bits (502),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 134/210 (64%), Gaps = 8/210 (4%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWV--KGKSPCDKTRRWFGVLCHR--KTVTGLRLYNMGLA  443
            D   L++FK+SL     LD  W   +  SPC    +W G++C +    ++GL + NMGL+
Sbjct  26   DQEALLKFKKSLTRAGALD-KWTPDQNSSPC--KAQWTGIVCSKGSNVISGLHISNMGLS  82

Query  444  GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
            G ID DAL ++  LR I   NN+FSG IPDF  L  LKSL + GN FSGEI  DYF+ MT
Sbjct  83   GKIDFDALKDIPTLRTINFMNNNFSGSIPDFHTLGALKSLLLSGNGFSGEIPKDYFSHMT  142

Query  624  GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
             L+K++L +N F+G IP SLG+L +L ELHLE N F+  +P L Q  L  LDLS NKLQG
Sbjct  143  SLKKIYLDNNNFTGKIPESLGQLNKLEELHLEKNQFTGPIPKLKQ-GLNSLDLSNNKLQG  201

Query  804  EIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
             IP  M+++  KAFEGN  LCG P+   C+
Sbjct  202  PIPDSMSKYNPKAFEGNEGLCGVPLKSSCQ  231



>ref|XP_008337835.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At5g20690 [Malus domestica]
Length=660

 Score =   382 bits (981),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 238/295 (81%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VNEE+G FGL +LM A+AEVLGNGGLGSAYKA +   G +VVVKR++E N++ +D 
Sbjct  367   ELLMVNEEKGTFGLPDLMKAAAEVLGNGGLGSAYKAVMSN-GFSVVVKRMREMNRLGRDG  425

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G L H NIL  LAYHYR++EKL++SE+ PKGSLLY+LHGDRG +H++L  +T
Sbjct  426   FDAEMRRFGRLSHKNILTPLAYHYRREEKLLISEYIPKGSLLYVLHGDRGISHSELNWST  485

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R++II+G+A GM ++HTEFA+Y LPHGNLKSSNILL   YEP+L DYA HPL++ + + Q
Sbjct  486   RLQIIQGIACGMGFIHTEFASYDLPHGNLKSSNILLKEDYEPVLNDYALHPLINPSNSAQ  545

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  QIS K+DVYCLGIVILE++TGKFPSQYLSN KGGTDVVQWV+ A+A
Sbjct  546   SMFAFRTPEYIESQQISPKADVYCLGIVILEILTGKFPSQYLSNGKGGTDVVQWVQSAMA  605

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + +E E++DPEIA +  DS  +M++LL +GA CT S+ E+RL ++EAI+RI E++
Sbjct  606   EQREQELLDPEIA-SETDSVDQMLQLLMVGADCTTSEPEQRLDLREAIRRIEEVR  659


 Score =   201 bits (511),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +3

Query  285  VLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
             L++ K SL       D W    SPC+   +W G++C+   +TGL   NMGL+G+ID+DA
Sbjct  29   ALLKLKNSLSPADNPLDNWEPNTSPCND--KWAGIVCNEDVITGLHFPNMGLSGNIDIDA  86

Query  465  LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
            L ++  LR I + NN FSGPIPDF KL  LKS+F+ GN FSGEI  DYF+ +T L+K+++
Sbjct  87   LKDIPTLRTINIMNNKFSGPIPDFHKLGALKSMFLAGNDFSGEIPKDYFSNLTSLKKIYI  146

Query  645  SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
            + N F+G IP SL +L +L +LHLE N F+  +P L    L  LD S NKLQG IP  ++
Sbjct  147  NGNNFTGKIPESLTQLTKLEQLHLEKNQFTGPIPELKSEVLNSLDFSNNKLQGPIPETLS  206

Query  825  RFGAKAFEGNPELCGEPV  878
            +F  KAFEG   LCG P+
Sbjct  207  KFDPKAFEGXEGLCGGPL  224



>ref|XP_008389019.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Malus domestica]
Length=664

 Score =   381 bits (979),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 236/295 (80%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VNEE+G FGL +LM A+AEVLGNGGLGSAYKA +   G +VVVKR++E N++ +D 
Sbjct  371   ELLMVNEEKGTFGLPDLMKAAAEVLGNGGLGSAYKAVMSN-GFSVVVKRMREMNRLGRDG  429

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G L H NIL  LAYHYR++EKL++SE+ PKGSLLY+LHGDRG ++++L   T
Sbjct  430   FDAEMRRFGRLSHKNILTPLAYHYRREEKLLISEYIPKGSLLYVLHGDRGISYSELNWPT  489

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A GM ++HTEFA+Y LPHGNLKSSNILL   YEP+L DYA HPL++ +   Q
Sbjct  490   RLKIVQGIACGMGFIHTEFASYDLPHGNLKSSNILLKEDYEPVLNDYALHPLINPSNAAQ  549

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  Q+S K+DVYCLGIVILE++TGKFPSQYLSN KGGTDVVQWV+ A+A
Sbjct  550   SMFAFRTPEYIESQQVSPKADVYCLGIVILEILTGKFPSQYLSNGKGGTDVVQWVQSAMA  609

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             D +E E++DPEIA +  DS  +M++LL +GA CT+S+ E+RL + EAI+RI E+Q
Sbjct  610   DQREQELLDPEIA-SETDSVDQMLQLLMVGADCTKSEPEQRLDLSEAIRRIEEVQ  663


 Score =   199 bits (506),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 126/198 (64%), Gaps = 2/198 (1%)
 Frame = +3

Query  285  VLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
             L++ K SL       D W    SPC+   +W G++C+    TGL   NMGL+G+ DVDA
Sbjct  30   ALLKLKRSLSPADNPLDNWDPNTSPCND--KWAGIVCNZDVXTGLHFANMGLSGNXDVDA  87

Query  465  LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
            L ++  LR I L NN F GPIPDF KL  LKSLF+ GN FSGEI  DYF+ +T L+K++L
Sbjct  88   LKDIPTLRTINLMNNKFXGPIPDFHKLGVLKSLFLAGNDFSGEIPXDYFSHLTSLKKIYL  147

Query  645  SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
            + N F+G IP SL +L +L ELHLE N F+  +P L    L  LD S NKLQG IP  ++
Sbjct  148  NGNNFTGKIPESLTQLTKLEELHLESNQFTGPIPKLKPGVLNSLDFSNNKLQGPIPETLS  207

Query  825  RFGAKAFEGNPELCGEPV  878
            +F  KAF+GN  LCG P+
Sbjct  208  KFDXKAFDGNEGLCGGPL  225



>ref|XP_009337188.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Pyrus x bretschneideri]
Length=664

 Score =   381 bits (978),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 236/295 (80%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++VNEE+G FGL +LM A+AEVLGNGGLGSAYKA +   G +VVVKR++E N++ +D 
Sbjct  371   ELLMVNEEKGTFGLPDLMKAAAEVLGNGGLGSAYKAVMSN-GFSVVVKRMREMNRLGRDG  429

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G L H NIL  LAYHYR++EKL++SE+ PKGSLLY+LHGDRG ++++L   T
Sbjct  430   FDAEMRRFGRLSHKNILTPLAYHYRREEKLLISEYIPKGSLLYVLHGDRGISYSELNWPT  489

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A GM ++HTEFA+Y LPHGNLKSSNILL   YEP+L DYA HPL++ +   Q
Sbjct  490   RLKIVQGIACGMGFIHTEFASYDLPHGNLKSSNILLKEDYEPVLNDYALHPLINPSNAAQ  549

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA + P   E  Q+S K+DVYCLGIVILE++TGKFPSQYLSN KGGTDVVQWV+ A+A
Sbjct  550   SMFAFRTPEYIESQQVSPKADVYCLGIVILEILTGKFPSQYLSNGKGGTDVVQWVQSAMA  609

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             D +E E++DPEIA +  DS  +M++LL +GA CT+S+ E+RL + EAI+RI E+Q
Sbjct  610   DQREQELLDPEIA-SETDSVDQMLQLLMVGADCTKSEPEQRLDLSEAIRRIEEVQ  663


 Score =   206 bits (523),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 140/232 (60%), Gaps = 7/232 (3%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
            MAAV   P+F  +   F              D   L++ K SL       D W    SPC
Sbjct  1    MAAV---PSFLFLLIFFSSSSHLSLSLSQEQD--ALLKLKRSLSPADNPLDNWDPNTSPC  55

Query  363  DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDK  542
            +   +W G++C++  +TGL   NMGL+G+IDVDAL ++  LR I L NN FSGPIPDF K
Sbjct  56   ND--KWAGIVCNQDVITGLHFANMGLSGNIDVDALKDIPTLRTINLMNNKFSGPIPDFHK  113

Query  543  LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
            L  LKSLF+ GN FSGEI  DYF+ +T L+K++L+ N F+G IP SL +L +L ELHLE 
Sbjct  114  LGVLKSLFLAGNDFSGEIPKDYFSHLTSLKKIYLNGNNFTGKIPESLTQLTKLEELHLES  173

Query  723  NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPV  878
            N F+  +P L    L  LD S NKLQG IP  +++F  KAFEGN  LCG P+
Sbjct  174  NQFTGPIPKLKPGILNSLDFSKNKLQGPIPETLSKFDPKAFEGNEGLCGGPL  225



>ref|XP_007012600.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY30219.1| Leucine-rich repeat protein kinase family protein, putative isoform 
2 [Theobroma cacao]
Length=467

 Score =   374 bits (960),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 232/295 (79%), Gaps = 6/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VN+ +  FGL +LM A+AEVLGNGGLGSAYKA +   GL VVVKR++E N++ KD 
Sbjct  174   DLVMVNDAKEAFGLQDLMKAAAEVLGNGGLGSAYKAVM-ANGLAVVVKRMREMNRLGKDG  232

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYH+R++EKL+VSE+ PKGSLLY+LHGDRG  H +L   T
Sbjct  233   FDAEMRRFGKLRHPNILTPLAYHFRREEKLIVSEYMPKGSLLYVLHGDRGIIHANLNWPT  292

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII G+A G+ +++TEFATY++PHGNLKSSN+LLT  Y+PLL+DYAF PL + +   Q
Sbjct  293   RLKIIHGIARGLSFIYTEFATYEVPHGNLKSSNVLLTENYDPLLSDYAFQPLTNSSNAAQ  352

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI+ILE++TGKFPSQYLSN KGGTD+VQWV+ ++ 
Sbjct  353   GLFAYKSPEYVQYQQVSPKSDVYCLGIIILEIITGKFPSQYLSNGKGGTDIVQWVQTSIT  412

Query  1893  DGKE-SEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             D  +  E+IDPEIA     S  +M++LLQIGAACTE + ++RL MKEAI+RI E+
Sbjct  413   DQNQVEELIDPEIA-KDTGSLNQMLQLLQIGAACTEGNPDQRLHMKEAIRRIEEV  466


 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 1/69 (1%)
 Frame = +3

Query  687  KLPRLVELHLEGNGFSSAVPPLA-QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPEL  863
            +LP LVELHLEGN FS  +PPL     LT L+L+ N L+GEIP+  ++F A +F+ N  L
Sbjct  2    QLPHLVELHLEGNQFSGQIPPLKFPNVLTSLNLTRNNLEGEIPASFSKFNASSFKENEGL  61

Query  864  CGEPVGRQC  890
            CG+P+G  C
Sbjct  62   CGKPLGIDC  70



>ref|NP_197569.2| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q3E991.4|Y5269_ARATH RecName: Full=Probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ACN59372.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92878.1| probable inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=659

 Score =   380 bits (975),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 236/295 (80%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN ++G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++ ++ 
Sbjct  366   DIIMVNTDKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TTGLSVVVKRIRDMNQLAREP  424

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  AT
Sbjct  425   FDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWAT  484

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+  +   Q
Sbjct  485   RLKIIQGVAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPSNASQ  544

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+ +VA
Sbjct  545   ALFAFKTPEFAQTQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQSSVA  604

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + KE E+IDPEI    E S  +MV+LL++GAAC  S+ ++RL M+EA++RI +++
Sbjct  605   EQKEEELIDPEIVNNTE-SMRQMVELLRVGAACIASNPDERLDMREAVRRIEQVK  658


 Score =   169 bits (428),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 130/212 (61%), Gaps = 7/212 (3%)
 Frame = +3

Query  270  VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAG  446
            V +   L+ FK S++ TKG  ++W +G  PC  + +WFG+ C +  TV+G+ +  +GL+G
Sbjct  28   VSESEPLVRFKNSVKITKGDLNSWREGTDPC--SGKWFGIYCQKGLTVSGIHVTRLGLSG  85

Query  447  DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I VD L +L  L+ I L NN  SGP+P F KLR LKSL +  N FSGEI  D+F  M+ 
Sbjct  86   TITVDDLKDLPNLKTIRLDNNLLSGPLPHFFKLRGLKSLMLSNNSFSGEIRDDFFKDMSK  145

Query  627  LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL--AQRSLTILDLSGNKLQ  800
            L++L+L HN F G+IP+S+ +LP+L ELH++ N  +  +PP   + ++L +LDLS N L 
Sbjct  146  LKRLFLDHNKFEGSIPSSITQLPQLEELHMQSNNLTGEIPPEFGSMKNLKVLDLSTNSLD  205

Query  801  GEIPSGMA--RFGAKAFEGNPELCGEPVGRQC  890
            G +P  +A  +  A     N  LCG  V   C
Sbjct  206  GIVPQSIADKKNLAVNLTENEYLCGPVVDVGC  237



>ref|XP_003545559.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610-like [Glycine max]
 gb|KHN24372.1| Putative LRR receptor-like serine/threonine-protein kinase RLK 
[Glycine soja]
Length=645

 Score =   379 bits (972),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 219/568 (39%), Positives = 335/568 (59%), Gaps = 18/568 (3%)
 Frame = +3

Query  378   WFGVLCHR--KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRH  551
             W G+LC+   +T  GLRL+NM L G IDVD L  L  L   ++ NN+F GP+P+F KL  
Sbjct  57    WRGLLCNHTDQTFYGLRLHNMSLGGKIDVDTLLELPTLTSFSVMNNTFEGPMPEFKKLVR  116

Query  552   LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGF  731
             L++LF+  N+FSG+I  D F  MT L++++L+ NGF+G+IP SL  LPRL +L L GN F
Sbjct  117   LRALFLSNNKFSGDIPDDAFEGMTKLKRVFLAENGFTGHIPKSLANLPRLWDLDLRGNSF  176

Query  732   SSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD  911
               ++P   Q+   + +LS N+L+G IP  ++     +F GN  LCG+P+   C E  G +
Sbjct  177   GGSIPEFQQKDFRMFNLSHNQLEGSIPESLSNKDPSSFAGNKGLCGKPMS-PCNEIGGNE  235

Query  912   GGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLV  1091
                 +E   P+++QR  +  R   + I   +++V ++         ++   +  L  +++
Sbjct  236   SR--SEIPYPDSSQRKGNKYR---ILITVIIVIVVVVVASIVALLFIRNHWRKRLQPLIL  290

Query  1092  VQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGL  1271
              +  +   S     S     +++      G    V E++G F L +L+ ASA VLG+G  
Sbjct  291   SKQENSKNSVDFRESQSIDVTSDFKKGGDGALNFVREDKGGFDLQDLLRASAVVLGSGSF  350

Query  1272  GSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKL  1451
             GS YKA + + G TVVVKR +  N   K  F   M+++G L H N+LPL A++YRK++K 
Sbjct  351   GSTYKAMI-LNGPTVVVKRFRHMNNAGKQEFIEHMKRLGSLTHPNLLPLDAFYYRKEDKF  409

Query  1452  VVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLK  1631
             +V ++   GSL   LH   G+    L  +TR+KI+KGVA G+ YL+  F    LPHG+LK
Sbjct  410   LVYDYAENGSLASHLHDRNGSV---LNWSTRLKIVKGVARGLAYLYESFPGQNLPHGHLK  466

Query  1632  SSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVYCLGIVIL  1802
             SSN++L  ++EP LT+Y   P+++ +   + M A KAPE +Q      KSDV+CLGI+IL
Sbjct  467   SSNVVLDHSFEPHLTEYGLVPVMTKSHAQRFMAAYKAPEVNQFGRPNVKSDVWCLGILIL  526

Query  1803  EVVTGKFPSQYLSNQKGG--TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQ  1976
             E++TGKFP+ YL + KGG  +D+  WV   V +    EV D +I G   + +G+M+KLL+
Sbjct  527   ELLTGKFPANYLRHGKGGNNSDLATWVDSVVREEWTGEVFDKDIMGT-RNGEGEMLKLLR  585

Query  1977  IGAACTESDVEKRLSMKEAIKRIREIQD  2060
             IG  C +  VE R   +EA+ +I E+++
Sbjct  586   IGMFCCKWSVESRWDWREALAKIEELKE  613



>ref|XP_002868416.1| hypothetical protein ARALYDRAFT_330185 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44675.1| hypothetical protein ARALYDRAFT_330185 [Arabidopsis lyrata subsp. 
lyrata]
Length=657

 Score =   377 bits (968),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 229/630 (36%), Positives = 344/630 (55%), Gaps = 41/630 (7%)
 Frame = +3

Query  234   CLILQCLPLSISVGDDVVLIEFKESLQ-NTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTV  410
             CL+L     +  + D   +++FK+SL    +    +W     PC     W GVLC+  +V
Sbjct  20    CLLLFFSTPTHGLSDSEAILKFKKSLVFGQENALASWDAKTPPCT----WPGVLCNSGSV  75

Query  411   TGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSG  590
              GL++ N+ L+G ID++ALS L  LR ++  NN F GP P+F KL  LKSL++  N+F G
Sbjct  76    WGLQMENLELSGSIDIEALSGLTSLRTLSFMNNKFGGPFPEFKKLAALKSLYLSNNQFGG  135

Query  591   EISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             +I  + F  M  L+K+ L+ N F+G IP S+ KLP+L+EL L+GN F+  +P   +  L 
Sbjct  136   DIPGNAFEGMGWLKKVHLAQNKFTGEIPTSVAKLPKLLELRLDGNQFTGQIPEF-EHQLH  194

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
             +L+LS N L G IP  ++    K FEGN  LCG+P+  +C           +    P+  
Sbjct  195   LLNLSNNALTGPIPESLSMIDPKVFEGNKGLCGKPLETECDSP--------SRELPPQPG  246

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRK----------DNLDEVLVVQI  1100
              R  S  R  L+       L  ++        N   R K           +L +   ++ 
Sbjct  247   VRPQSSSRGPLVITAIVAALTILIILGVIILLNRNYRNKQPRLVVENGPSSLQKKTSIRE  306

Query  1101  ASMARSESI-----NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNG  1265
             A  +R E       N S         +         + E+R  F L +L+ ASAE+LG+G
Sbjct  307   ADQSRRERQKADHRNGSGTTKRMGTAAGVENTKLSFLREDREKFDLQDLLKASAEILGSG  366

Query  1266  GLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQE  1445
               G++YKA L   G  +VVKR K+ N   +D F   M+++G LRHHN+LP++AY+YRK+E
Sbjct  367   CFGASYKAVLSS-GQMMVVKRFKQMNNAGRDEFQEHMKRLGRLRHHNLLPIVAYYYRKEE  425

Query  1446  KLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGN  1625
             KL+V +F  +GSL   LH         L   TR+KI+KGVA G+ YLH +  +   PHG+
Sbjct  426   KLLVCDFAERGSLAVNLH-----RKPSLDWPTRLKIVKGVARGLSYLHQDLPSLMAPHGH  480

Query  1626  LKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIV  1796
             LKSSN+LLT T+EPLLTDY   P+++       M A ++PE  Q   I+ K+DV+ LGI+
Sbjct  481   LKSSNVLLTKTFEPLLTDYGLIPVLNQEKAQVHMAAYRSPEYLQHRRITKKTDVWGLGIL  540

Query  1797  ILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQ  1976
             ILE++TGKFP  +  +Q    D+  WV           ++D  + G     +G+++KLL+
Sbjct  541   ILEILTGKFPPNF--SQGSEEDLASWVNSGFHGVGAPNLLDKGM-GKTSHCEGQILKLLR  597

Query  1977  IGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             IG +C E DVEKRL + +A+++I  +++ E
Sbjct  598   IGLSCCEPDVEKRLDIGQAVEKIEVLKERE  627



>ref|XP_006400637.1| hypothetical protein EUTSA_v10015893mg [Eutrema salsugineum]
 gb|ESQ42090.1| hypothetical protein EUTSA_v10015893mg [Eutrema salsugineum]
Length=600

 Score =   375 bits (963),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 233/295 (79%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ ++ 
Sbjct  307   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLAREP  365

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR++G LRH N+L  LAYHYR++EKLVVSEF PK SLLY+LHGDRG  H++L   T
Sbjct  366   FDVEMRRLGKLRHPNVLAPLAYHYRREEKLVVSEFMPKSSLLYVLHGDRGIYHSELTWPT  425

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y+LPHGNLKSSN+LL+ TYEPL++DYAF P +      Q
Sbjct  426   RLKIIQGVAHGMQFLHEEFASYELPHGNLKSSNVLLSETYEPLISDYAFLPFLQPNNASQ  485

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  486   AMFAFKTPEFVQSQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVEWVQSSIA  545

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + KE  +IDPEI     DS  +MV++L+IGAAC  S+ ++RL M+E ++RI +++
Sbjct  546   EQKEEGIIDPEIVN-NTDSVQQMVEVLRIGAACIASNPDERLDMRETVRRIEQVK  599


 Score =   169 bits (429),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 146/245 (60%), Gaps = 16/245 (7%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGK  353
            MAAV     FP+      L+L C  +S S   V +   L+ FK S+  TKG  ++W  G 
Sbjct  1    MAAVLSPGFFPI------LLLLCFSISPSLQHVSESEPLVRFKNSVNITKGDLNSWRIGT  54

Query  354  SPCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP  530
             PC    +WFG+ C +  TV+G+ +  +GL+G I+VD L  L  L+ I L NN  SGP+P
Sbjct  55   DPCGG--KWFGIYCQKGLTVSGIHVTRLGLSGTINVDDLKALANLKTIRLDNNLLSGPLP  112

Query  531  DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVEL  710
             F KL  LKSL +  N FSGEI  D+F  M+ L++L+L HN F G IP+S+ +LP L EL
Sbjct  113  HFYKLSGLKSLLLSNNSFSGEIPDDFFKDMSKLKRLFLDHNKFVGRIPSSVMQLPYLEEL  172

Query  711  HLEGNGFSSAVPPL--AQRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPV  878
            HL+GN FS  +PP+    ++L ILDLS N+L+G +P  ++  +      EGN  LCG+ V
Sbjct  173  HLQGNKFSGEIPPVTDTNKNLKILDLSNNQLEGSVPESISDRKNLIMRLEGNVNLCGKAV  232

Query  879  GRQCR  893
              +C+
Sbjct  233  NIECK  237



>ref|XP_004498698.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610-like [Cicer arietinum]
Length=665

 Score =   376 bits (965),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 231/602 (38%), Positives = 347/602 (58%), Gaps = 23/602 (4%)
 Frame = +3

Query  285   VLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
             +LI F+  L N   L++ W+   + C+    W G+LC      GLRL NMGL G IDVD 
Sbjct  31    ILIRFRSFLSNNNALNN-WIDESNLCN----WVGLLCTNNNFYGLRLENMGLGGKIDVDT  85

Query  465   LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
             L  L      ++ NNSF GP+P+F ++  L+ LF+  N+FSGEI  D F  M  L+++ L
Sbjct  86    LLKLSNFVSFSVMNNSFEGPMPEFKRVVKLRGLFLSNNKFSGEILDDAFEGMGNLKRVIL  145

Query  645   SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
             + NGF+G+IP SL KLP+L++L L GN F   +P   Q+S    DLS N+L+G IP  ++
Sbjct  146   AGNGFNGHIPISLAKLPKLLDLDLHGNSFGGNIPEFQQKSFRKFDLSNNQLEGPIPQSLS  205

Query  825   RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQR-HSSGMRWlllsivag  1001
                + +F  N  LCG+P+   C     K      +A + +  Q+ H+  +  +++ I   
Sbjct  206   NEPSSSFSANKGLCGKPLSNPCNNSPTKSIVHPNQAPSSQGKQKKHTKILIVVIIVIAMI  265

Query  1002  lllvailFNKNQNEENVKTRRKDNL--DEVLVVQIASMARSESINHssrrststegsss-  1172
             +L         Q+    + RR+ NL    +L +Q+ S  ++ S+  +      T   S  
Sbjct  266   VLASIASLLFIQSR---RGRRRQNLHLQPILGLQLNSQ-KTPSLKETQSNVDLTGEFSKG  321

Query  1173  -rggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKM  1349
                G+   V E++G F L  L+ ASAEVLG+G  GS YKA + + G T+VVKR +  N +
Sbjct  322   DEHGELNFVREDKGSFDLQSLLRASAEVLGSGSFGSTYKAMV-LNGPTLVVKRFRHMNNV  380

Query  1350  NKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDL  1529
              +  F   M+K+G L H N+LPL+A++YRK EK +V +FG  GSL   LHG  G   N L
Sbjct  381   GRVEFFEHMKKLGSLTHPNLLPLVAFYYRKDEKFLVYDFGENGSLASHLHGRNG---NIL  437

Query  1530  KAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGT  1709
               + R+KIIKGVA G+ +L+ +F +  LPHG+LKSSN++L  +++PLLT+Y   P+ +  
Sbjct  438   TWSNRLKIIKGVARGLSHLYKKFPSQNLPHGHLKSSNVMLNNSFDPLLTEYGLVPITNKN  497

Query  1710  PTLQCMFALKAPEGHQI---SHKSDVYCLGIVILEVVTGKFPSQYLSNQKG--GTDVVQW  1874
                Q M + K+PE       + K+D++CLGI+ILE++TGKFPS YL + KG  G+D+  W
Sbjct  498   HAQQFMASYKSPEVTHFDRPNEKTDIWCLGILILELLTGKFPSNYLRHGKGDQGSDLATW  557

Query  1875  VRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V   V +    EV D ++       +G+M+KLL+IG  C E  VE+R   K A+ +I E+
Sbjct  558   VNSVVREEWTGEVFDKDMMKTRNVGEGEMLKLLRIGMFCCEWSVERRWDWKMALAKIEEL  617

Query  2055  QD  2060
             ++
Sbjct  618   KE  619



>ref|XP_006374738.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP52535.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=653

 Score =   375 bits (963),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 240/643 (37%), Positives = 367/643 (57%), Gaps = 30/643 (5%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
             +A   R  T  L+      +L  +  S    D   L++FK+ L N  G  ++W     PC
Sbjct  7     VAKFARATTSSLVLV-LAFVLSIVVTSFGSPDSDALLKFKDQLANN-GAINSWNPSVKPC  64

Query  363   DKTR-RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
             +  R  W GVLC   ++ GL+L +M L+GDID+DAL+ L   R ++L +N+F GP+PDF 
Sbjct  65    EWERSNWVGVLCLNGSIRGLQLEHMALSGDIDLDALAPLPSFRTLSLMDNNFDGPLPDFK  124

Query  540   KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             KL  LK+L++  NRFSG+I  + F  M  L++L+L++N  +G IP+SL  L +L+EL LE
Sbjct  125   KLGKLKALYLSNNRFSGDIPDNAFEGMGSLKRLYLANNLLTGKIPSSLATLSKLMELKLE  184

Query  720   GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
             GN F   +P   Q+S+  ++++ N+L+G IP  ++R    +F GN  L        C   
Sbjct  185   GNQFQGQIPNFQQKSMKTVNVASNELEGPIPEALSRLSPHSFAGNKGL--------CGPP  236

Query  900   LGKDGGGGAEAQTPE-NAQRHSSGMRWlllsivaglllvai----lFNKNQNEENVKTRR  1064
             LG      +   TP+ N ++ S     +++ IV  +L        LF++ + +  ++ R 
Sbjct  237   LGP--CIPSPPSTPKSNGKKFSILYIVIIILIVLLMLAAIAFAFLLFSRKKCKSRIQ-RT  293

Query  1065  KDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMAS  1244
               + +E     +AS  R     H     TS+    +  G    + ++   F L +L+ AS
Sbjct  294   ASSPEENSNKMVASYYRDV---HRELSETSSHAKKADHGKLTFLKDDIEKFDLQDLLTAS  350

Query  1245  AEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLA  1424
             AEVLG+G  GS+YKA   V+G  VVVKR +  + + ++ F   MR++G L+H N+LPL A
Sbjct  351   AEVLGSGTFGSSYKAV--VVGQPVVVKRYRHMSNVGREEFHEHMRRLGRLKHPNLLPLAA  408

Query  1425  YHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFAT  1604
             Y+ R+ EKL+V+EF   GSL   LHG+     + L    R+KI+KGVA G+ +L+ E   
Sbjct  409   YYNRRDEKLLVTEFAENGSLASHLHGNHSPEEDGLHWHIRLKIVKGVARGLAFLYNELPI  468

Query  1605  YKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSD  1775
                PHG+LKSSN+LL  ++EPLLTDYA  P+V+       M A K+PE  Q    S+K+D
Sbjct  469   IA-PHGHLKSSNVLLDDSFEPLLTDYALRPVVNPEHAHMFMMAYKSPEYAQQSRTSNKTD  527

Query  1776  VYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             ++  GI+ILE++TGKFP  YL+       D+  WV   V + + SEV D EI G  + S 
Sbjct  528   IWSFGILILEMLTGKFPENYLTPCYNSDADLATWVNNMVKEKRTSEVFDKEIVGT-KYSK  586

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHEL  2081
             G+M+KLL+IG +C E DVE+RL +KE +++I  +++ +   EL
Sbjct  587   GEMIKLLKIGLSCCEEDVERRLDIKEVVEKIDVLKEGDEDEEL  629



>ref|XP_007012599.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY30218.1| Leucine-rich repeat protein kinase family protein, putative isoform 
1 [Theobroma cacao]
Length=629

 Score =   374 bits (959),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 232/295 (79%), Gaps = 6/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VN+ +  FGL +LM A+AEVLGNGGLGSAYKA +   GL VVVKR++E N++ KD 
Sbjct  336   DLVMVNDAKEAFGLQDLMKAAAEVLGNGGLGSAYKAVM-ANGLAVVVKRMREMNRLGKDG  394

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYH+R++EKL+VSE+ PKGSLLY+LHGDRG  H +L   T
Sbjct  395   FDAEMRRFGKLRHPNILTPLAYHFRREEKLIVSEYMPKGSLLYVLHGDRGIIHANLNWPT  454

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII G+A G+ +++TEFATY++PHGNLKSSN+LLT  Y+PLL+DYAF PL + +   Q
Sbjct  455   RLKIIHGIARGLSFIYTEFATYEVPHGNLKSSNVLLTENYDPLLSDYAFQPLTNSSNAAQ  514

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI+ILE++TGKFPSQYLSN KGGTD+VQWV+ ++ 
Sbjct  515   GLFAYKSPEYVQYQQVSPKSDVYCLGIIILEIITGKFPSQYLSNGKGGTDIVQWVQTSIT  574

Query  1893  DGKE-SEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             D  +  E+IDPEIA     S  +M++LLQIGAACTE + ++RL MKEAI+RI E+
Sbjct  575   DQNQVEELIDPEIA-KDTGSLNQMLQLLQIGAACTEGNPDQRLHMKEAIRRIEEV  628


 Score =   205 bits (521),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 148/226 (65%), Gaps = 13/226 (6%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDAL  467
            LI+ K SL  ++G  ++W  G SPC +  +W GV+C  +T+ GL L  + LAG +DV AL
Sbjct  35   LIKLKRSL--SQGDLNSWKPGSSPCQQ--KWVGVMCSGQTIVGLHLTGLHLAGPVDVQAL  90

Query  468  SNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLS  647
              L+GLR I+L  NSF+GPIP+F+KL  LK++++  N+FSGEI  DYFA M  L+K+WL+
Sbjct  91   LQLRGLRTISLVRNSFTGPIPEFNKLGALKAIYLSHNQFSGEIPNDYFASMGSLKKVWLN  150

Query  648  HNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-QRSLTILDLSGNKLQGEIPSGMA  824
             N  +G IP SL +LP LVELHLEGN FS  +PPL     LT L+L+ N L+GEIP+  +
Sbjct  151  DNKLTGKIPESLMQLPHLVELHLEGNQFSGQIPPLKFPNVLTSLNLTRNNLEGEIPASFS  210

Query  825  RFGAKAFEGNPELCGEPVGRQC--------REDLGKDGGGGAEAQT  938
            +F A +F+ N  LCG+P+G  C         +  G++ G G+ A+ 
Sbjct  211  KFNASSFKENEGLCGKPLGIDCDKVQQSGASKPSGQNQGSGSSAKV  256



>ref|XP_002877261.1| hypothetical protein ARALYDRAFT_347421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53520.1| hypothetical protein ARALYDRAFT_347421 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   374 bits (959),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 233/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  340   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  398

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H +L  AT
Sbjct  399   FDTEMQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHAELTWAT  458

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+       
Sbjct  459   RLKIIQGVARGMDFLHEEFASYELPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASH  518

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     QIS KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  519   ALFAFKSPEFVQNQQISPKSDVYCLGIIVLEVMTGKFPSQYLNNGKGGTDIVEWVQSSIA  578

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  DS  +MV+LL+IGA+C  S+  +R +MKE ++RI ++
Sbjct  579   QHKEEELIDPEIA-SNTDSTKQMVELLRIGASCIASNPNERQNMKEIVRRIEKV  631


 Score =   175 bits (443),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 137/229 (60%), Gaps = 7/229 (3%)
 Frame = +3

Query  267  SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR-KTVTGLRLYNMGLA  443
            +V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C + +TV+G+ +  +GL+
Sbjct  22   NVSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQKGQTVSGIHVTRLGLS  79

Query  444  GDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
            G I+++ L +L  LR I L NN  SGP+P F KL  LKSL +  N FSGEI+ D+F +  
Sbjct  80   GTINIEDLKDLPNLRTIRLDNNLLSGPLPPFYKLPGLKSLLLSNNSFSGEIADDFFKETP  139

Query  624  GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA--QRSLTILDLSGNKL  797
             L++++L +N  SG IPASL +L  L ELH++GN FS  +P L    + L  LDLS N L
Sbjct  140  QLKRVFLDNNRLSGKIPASLMQLAGLEELHMQGNQFSGEIPSLTDGNKVLKSLDLSNNDL  199

Query  798  QGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQT  938
            +GEIP  ++  +     FEGN +LCG P+   C E     G G  +  T
Sbjct  200  EGEIPISISERKNLEMKFEGNQKLCGSPLNIVCDEKPSSTGSGNEKNNT  248



>gb|KHN30797.1| Putative LRR receptor-like serine/threonine-protein kinase RLK 
[Glycine soja]
Length=639

 Score =   374 bits (959),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 227/576 (39%), Positives = 333/576 (58%), Gaps = 31/576 (5%)
 Frame = +3

Query  378   WFGVLCHR--KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRH  551
             W G+LC+   +T  GLRL NM L G+IDVD L  L  L   ++ NN+F GPIP+F KL  
Sbjct  47    WRGLLCNHTDQTFYGLRLENMSLGGNIDVDTLFELPTLTSFSVMNNTFEGPIPEFKKLVK  106

Query  552   LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGF  731
             L++LF+  N+FSG+I  D F  MT L++++L+ NGF+G+IP SL  LPRL +L L GN F
Sbjct  107   LRALFLSNNKFSGDIPDDAFEGMTKLKRVFLAENGFTGHIPKSLANLPRLWDLDLRGNSF  166

Query  732   SSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD  911
                +P   Q+     +LS N+L+G IP G++     +F GN  LCG+P+   C E +G++
Sbjct  167   GGNIPEFRQKVFRNFNLSNNQLEGPIPKGLSNKDPSSFAGNKGLCGKPMS-PCNE-IGRN  224

Query  912   GGGGAEAQTPENAQRHSSGMRWlllsivaglllvail-----FNKNQNEENVKTRRKDNL  1076
                 +E   P + QR  +  R L+  I+   ++V        F +NQ        R+  L
Sbjct  225   ESR-SEVPNPNSPQRKGNKHRILITVIIVVAVVVVASIVALLFIRNQ--------RRKRL  275

Query  1077  DEVLVVQIASMARSESINHssrrststegsssrgg-DFVLVNEERGMFGLSELMMASAEV  1253
             + +++ +  +   S     S      T         +   V EE+G F L +L+ ASA V
Sbjct  276   EPLILSKKENSKNSGGFKESQSSIDLTSDFKKGADGELNFVREEKGGFDLQDLLRASAVV  335

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKE-TNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             LG+G  GS YKA + + G TVVVKR +   N + K  F   M+++G L H N+LPL A++
Sbjct  336   LGSGSFGSTYKAMI-LNGPTVVVKRFRHMNNNVGKQEFIEHMKRLGSLTHPNLLPLAAFY  394

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             YRK++K ++ ++   GSL   LHG   +    L  +TR+KIIKGVA G+ YL+    +  
Sbjct  395   YRKEDKFLIYDYAENGSLASHLHGRNNSM---LTWSTRLKIIKGVARGLAYLYESLPSQN  451

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVY  1781
             LPHG+LKSSN++L  ++EP LT+Y   P++S +   Q M A KAPE  Q      KSDV+
Sbjct  452   LPHGHLKSSNVILDHSFEPHLTEYGLVPVMSKSHAQQFMAAYKAPEVIQFGRPNVKSDVW  511

Query  1782  CLGIVILEVVTGKFPSQYLSNQKG---GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             CLGI+ILE++TGKFP+ YL + KG     D+  WV   V +    EV D +I G   + +
Sbjct  512   CLGIMILELLTGKFPANYLRHGKGRNNNADLATWVDSVVREEWTGEVFDKDIMGT-RNGE  570

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             G+M+KLL+IG  C +  VE R   +EA+ +I E+++
Sbjct  571   GEMLKLLRIGMFCCKWSVESRWDWREALGKIEELKE  606



>ref|XP_010425800.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=631

 Score =   373 bits (958),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 231/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  338   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  A 
Sbjct  397   FDIEMQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWAI  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  457   RLKIIQGVARGMDFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  516

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     QIS KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  517   ALFAFKSPEFVQNQQISPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSIA  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA    DS  +MV+LLQIGAAC  S+  +R +MKE ++RI  +
Sbjct  577   QHKEEELIDPEIA-INTDSMQQMVELLQIGAACITSNPNERQNMKEIVRRIERV  629


 Score =   186 bits (472),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 146/244 (60%), Gaps = 11/244 (5%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             C IL C+  + S   V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    LCFILLCILFTPSLQHVSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  64

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I+V+ L +L  LR I L NN  SGP+P F KL  LKSL +  N
Sbjct  65   GQTVSGIHVTRLGLSGTINVEDLKDLPNLRTIRLDNNLLSGPLPHFFKLHGLKSLLLSNN  124

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             FSGEIS D+F +   L++++L +N  SG IP+SL +L  L ELH++GN FS  +PPLA 
Sbjct  125  SFSGEISDDFFKETPQLKRVFLDNNRLSGKIPSSLMQLSGLEELHMQGNQFSGEIPPLAD  184

Query  759  RSLTI--LDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
             +  I  LDLS N L+GEIP  +A  +     FEGN +LCG P+  +C ED     G   
Sbjct  185  GNTIIKSLDLSNNNLEGEIPKSIAERKNLEMKFEGNQKLCGPPLNTKC-EDKPSSTGEKN  243

Query  927  EAQT  938
            E  T
Sbjct  244  EVTT  247



>ref|XP_006601075.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610-like [Glycine max]
Length=650

 Score =   373 bits (958),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 227/576 (39%), Positives = 333/576 (58%), Gaps = 31/576 (5%)
 Frame = +3

Query  378   WFGVLCHR--KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRH  551
             W G+LC+   +T  GLRL NM L G+IDVD L  L  L   ++ NN+F GPIP+F KL  
Sbjct  58    WRGLLCNHTDQTFYGLRLENMSLGGNIDVDTLFELPTLTSFSVMNNTFEGPIPEFKKLVK  117

Query  552   LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGF  731
             L++LF+  N+FSG+I  D F  MT L++++L+ NGF+G+IP SL  LPRL +L L GN F
Sbjct  118   LRALFLSNNKFSGDIPDDAFEGMTKLKRVFLAENGFTGHIPKSLANLPRLWDLDLRGNSF  177

Query  732   SSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD  911
                +P   Q+     +LS N+L+G IP G++     +F GN  LCG+P+   C E +G++
Sbjct  178   GGNIPEFRQKVFRNFNLSNNQLEGPIPKGLSNKDPSSFAGNKGLCGKPMS-PCNE-IGRN  235

Query  912   GGGGAEAQTPENAQRHSSGMRWlllsivaglllvail-----FNKNQNEENVKTRRKDNL  1076
                 +E   P + QR  +  R L+  I+   ++V        F +NQ        R+  L
Sbjct  236   ESR-SEVPNPNSPQRKGNKHRILITVIIVVAVVVVASIVALLFIRNQ--------RRKRL  286

Query  1077  DEVLVVQIASMARSESINHssrrststegsssrgg-DFVLVNEERGMFGLSELMMASAEV  1253
             + +++ +  +   S     S      T         +   V EE+G F L +L+ ASA V
Sbjct  287   EPLILSKKENSKNSGGFKESQSSIDLTSDFKKGADGELNFVREEKGGFDLQDLLRASAVV  346

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKE-TNKMNKDAFDAEMRKMGMLRHHNILPLLAYH  1430
             LG+G  GS YKA + + G TVVVKR +   N + K  F   M+++G L H N+LPL A++
Sbjct  347   LGSGSFGSTYKAMI-LNGPTVVVKRFRHMNNNVGKQEFIEHMKRLGSLTHPNLLPLAAFY  405

Query  1431  YRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYK  1610
             YRK++K ++ ++   GSL   LHG   +    L  +TR+KIIKGVA G+ YL+    +  
Sbjct  406   YRKEDKFLIYDYAENGSLASHLHGRNNSM---LTWSTRLKIIKGVARGLAYLYESLPSQN  462

Query  1611  LPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVY  1781
             LPHG+LKSSN++L  ++EP LT+Y   P++S +   Q M A KAPE  Q      KSDV+
Sbjct  463   LPHGHLKSSNVILDHSFEPHLTEYGLVPVMSKSHAQQFMAAYKAPEVIQFGRPNVKSDVW  522

Query  1782  CLGIVILEVVTGKFPSQYLSNQKG---GTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             CLGI+ILE++TGKFP+ YL + KG     D+  WV   V +    EV D +I G   + +
Sbjct  523   CLGIMILELLTGKFPANYLRHGKGRNNNADLATWVDSVVREEWTGEVFDKDIMGT-RNGE  581

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             G+M+KLL+IG  C +  VE R   +EA+ +I E+++
Sbjct  582   GEMLKLLRIGMFCCKWSVESRWDWREALGKIEELKE  617



>ref|XP_006290165.1| hypothetical protein CARUB_v10003833mg [Capsella rubella]
 gb|EOA23063.1| hypothetical protein CARUB_v10003833mg [Capsella rubella]
Length=660

 Score =   374 bits (959),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 232/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++ ++ 
Sbjct  367   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-TNGLSVVVKRIRDMNQLAREP  425

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  426   FDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  485

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G+A GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  486   RLKIIQGIAHGMKFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  545

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+ +V 
Sbjct  546   ALFAFKTPEFVQTQQVSHKSDVYCLGIIILEILTGKFPSQYLNNGKGGTDIVQWVQSSVE  605

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             + KE E+IDPEI    E S  +MV+LL++GAAC  S+ ++RL M+EA++RI ++
Sbjct  606   EQKEEELIDPEILNNTE-SVRQMVELLRVGAACIASNPDERLDMREAVRRIEQV  658


 Score =   177 bits (450),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/241 (42%), Positives = 142/241 (59%), Gaps = 9/241 (4%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
            MAAV       L+ F FC  +   P    V +   L+ FK S++ TKG  ++W  G  PC
Sbjct  1    MAAVLNPGFNILLLFLFCFSIT--PSLQHVSESEPLVRFKNSVKITKGDLNSWRIGTDPC  58

Query  363  DKTRRWFGVLCHRK-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
              + +WFG+ C +  TV+G+ +  +GL+G I VD L +L  L+ I L NN  SGP+P F 
Sbjct  59   --SGKWFGIYCQKGLTVSGIHVTRLGLSGSITVDDLKDLPNLKTIRLDNNFLSGPLPHFF  116

Query  540  KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
            KLR LKSL +  N FSG I  D+F  MT L++L+L HN  +GNIP+S+ +LP+L ELHL+
Sbjct  117  KLRGLKSLMLSNNSFSGVIPDDFFKDMTKLKRLFLDHNLLTGNIPSSIMQLPQLEELHLQ  176

Query  720  GNGFSSAVPPL--AQRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQ  887
            GN F+  +PP   + +SL  LDLS N LQG +P  +   +  A     N  LCG+ +  +
Sbjct  177  GNNFTGEIPPEIGSMKSLKTLDLSTNDLQGSVPETLENRKNLAANLSENAGLCGKMLDIE  236

Query  888  C  890
            C
Sbjct  237  C  237



>ref|XP_010514707.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=631

 Score =   372 bits (956),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 231/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  338   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM+  G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  A 
Sbjct  397   FDIEMQHFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWAI  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  457   RLKIIQGVARGMDFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  516

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     QIS KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  517   ALFAFKSPEFVQNQQISPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSIA  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA    DS  +MV+LLQIGAAC  S+ ++R +MKE ++RI  +
Sbjct  577   QHKEEELIDPEIA-INTDSMQQMVELLQIGAACIASNPDERQNMKEIVRRIERV  629


 Score =   178 bits (452),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/244 (42%), Positives = 143/244 (59%), Gaps = 11/244 (5%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             C IL C+  + S   V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    LCFILLCILFTSSLQHVSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  64

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I+V+ L +L  LR I L NN  SGP+P F  L  LKSL +  N
Sbjct  65   GQTVSGIHVTRLGLSGTINVEDLKDLPNLRTIRLDNNLLSGPLPPFFMLHGLKSLLLSNN  124

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-  755
             FSGEIS D+F +   L++++L +N  SG IP+SL +L  + ELH++GN FS  +PP A 
Sbjct  125  SFSGEISDDFFKETPQLKRVFLDNNRLSGKIPSSLMQLLGIEELHMQGNQFSGEIPPPAA  184

Query  756  -QRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
                L  LDLS N L+GEIP  +A  +     FEGN +LCG P+  +C ED     G   
Sbjct  185  GNTILKSLDLSNNNLEGEIPKSIAERKNLEMKFEGNQKLCGPPLSTKC-EDKPSSTGEKN  243

Query  927  EAQT  938
            E  T
Sbjct  244  EVTT  247



>ref|NP_189874.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB86675.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|ABE65985.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59326.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77758.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=633

 Score =   371 bits (953),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 232/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ ++A
Sbjct  340   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLAREA  398

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  AT
Sbjct  399   FDTEMQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWAT  458

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  459   RLKIIQGVARGMDFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  518

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI++LEV+TGKFPSQYL+  KGGTD+V+WV+ ++A
Sbjct  519   ALFAFKSPEFVQNQQVSPKSDVYCLGIIVLEVMTGKFPSQYLNTGKGGTDIVEWVQSSIA  578

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  DS  +MV+LL+IGAAC  S+  +R +MKE ++RI  +
Sbjct  579   QHKEEELIDPEIA-SNTDSIKQMVELLRIGAACIASNPNERQNMKEIVRRIERV  631


 Score =   183 bits (465),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/248 (42%), Positives = 146/248 (59%), Gaps = 13/248 (5%)
 Frame = +3

Query  210  FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
            F LI FSF   LQ      +V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+
Sbjct  9    FLLICFSFTPSLQ------NVSESEPLVRFKRSVNITKGDLNSWRTGTDPCNG--KWFGI  60

Query  390  LCHR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
             C + +TV+G+ +  +GL+G I+++ L +L  LR I L NN  SGP+P F KL  LKSL 
Sbjct  61   YCQKGQTVSGIHVTRLGLSGTINIEDLKDLPNLRTIRLDNNLLSGPLPPFFKLPGLKSLL  120

Query  567  IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
            +  N FSGEI+ D+F +   L++++L +N  SG IPASL +L  L ELH++GN F+  +P
Sbjct  121  LSNNSFSGEIADDFFKETPQLKRVFLDNNRLSGKIPASLMQLAGLEELHMQGNQFTGEIP  180

Query  747  PLA--QRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDG  914
            PL    + L  LDLS N L+GEIP  ++  +     FEGN  LCG P+  +C E     G
Sbjct  181  PLTDGNKVLKSLDLSNNDLEGEIPITISDRKNLEMKFEGNQRLCGSPLNIECDEKPSSTG  240

Query  915  GGGAEAQT  938
             G  +  T
Sbjct  241  SGNEKNNT  248



>ref|XP_008228165.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Prunus mume]
Length=714

 Score =   373 bits (958),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 230/295 (78%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++NEE+G+FGL +LM A+AEVLGNGGLGS+YKA +   G  VVVKR++E N M KD 
Sbjct  370   ELVMLNEEKGVFGLPDLMKAAAEVLGNGGLGSSYKAVM-ANGFAVVVKRMREMNGMGKDG  428

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYRK EKL++ E+ PK SLLY+LHGDRG +H++L    
Sbjct  429   FDAEMRRFGSLRHWNILTPLAYHYRKDEKLLIYEYIPKSSLLYILHGDRGQSHDELDWPA  488

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G A G+ Y+HTEFA+  +PHGNLKSSNILL P YEPLL+D+AF PL++     Q
Sbjct  489   RLKIIQGTAKGLAYIHTEFASCDVPHGNLKSSNILLGPDYEPLLSDFAFGPLINTANISQ  548

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  +   +S K DVYCLGI+ILE++TGKFPSQYL+N KGG DV+QWVR A++
Sbjct  549   ALFAYKAPEAAEHGRVSPKCDVYCLGIIILEILTGKFPSQYLNNGKGGLDVIQWVRSAIS  608

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +G+ESE++DPEI+   + S G M KLL IGAACTES+  +RL M+EA+ RI ++Q
Sbjct  609   EGRESELLDPEISST-KGSLGDMEKLLHIGAACTESNPNQRLDMREAVTRIEQVQ  662


 Score =   229 bits (583),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 161/237 (68%), Gaps = 2/237 (1%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLP-LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
            MAA R     P       +I   LP ++ S+ +   L++ KES +N + L+ +W    +P
Sbjct  1    MAATRVFYHRPHHLLFSSIIFFVLPCIAYSLAEPEALLKLKESFKNAEALN-SWTPDTAP  59

Query  360  CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
            C +  +W G++C    V GLRL  MGLAG+ID   L+ ++GLR ++ ANN+FSGP+P+F+
Sbjct  60   CARNTQWAGLICADGIVIGLRLGGMGLAGEIDTKVLAEIKGLRTMSFANNNFSGPMPEFN  119

Query  540  KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
             L  +K L++ GN+F+GEI +++F KM  LRKLWLS+N F+GNIP+SLG +P L+ELHLE
Sbjct  120  TLGPVKGLYLSGNQFTGEIPSNFFVKMESLRKLWLSNNKFTGNIPSSLGTIPNLLELHLE  179

Query  720  GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             NGFS ++P + Q +L  L++S NKL+GE+P+ M++F A +F GN  LCG  +G++C
Sbjct  180  DNGFSGSIPVINQSTLVSLNMSNNKLEGEVPASMSKFEASSFAGNAGLCGGNLGKEC  236



>ref|XP_007217312.1| hypothetical protein PRUPE_ppa016164mg [Prunus persica]
 gb|EMJ18511.1| hypothetical protein PRUPE_ppa016164mg [Prunus persica]
Length=707

 Score =   373 bits (957),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 231/295 (78%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++NEE+G+FGL +LM A+AEVLGNGGLGS+YKA +   G  VVVKR++E N M KD 
Sbjct  363   ELVMLNEEKGVFGLPDLMKAAAEVLGNGGLGSSYKAVM-ANGFAVVVKRMREMNGMGKDG  421

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYRK+EKL++ E+ PK SLLY+LHGDRG +H++L    
Sbjct  422   FDAEMRRFGSLRHWNILTPLAYHYRKEEKLLIYEYIPKSSLLYILHGDRGPSHDELDWPA  481

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G A G+ Y+HTEFA+  +PHGNLKSSNILL P YEPLL+D+AF PL++     Q
Sbjct  482   RLKIIQGTAKGLAYIHTEFASCDVPHGNLKSSNILLGPDYEPLLSDFAFGPLINTANVAQ  541

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  +   +S K DVYCLGI+ILE++TGKFPS YL+N KGG DV+QWVR A++
Sbjct  542   ALFAYKAPEAAEHGRVSPKCDVYCLGIIILEILTGKFPSLYLNNGKGGLDVIQWVRSAIS  601

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +G+ESE++DPEI+   + S G+M KLL IGAACTES+  +RL M+EA+ RI ++Q
Sbjct  602   EGRESELLDPEISST-KASLGEMEKLLHIGAACTESNPNQRLDMREAVTRIEQVQ  655


 Score =   225 bits (573),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 150/210 (71%), Gaps = 1/210 (0%)
 Frame = +3

Query  261  SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGL  440
            S S+ +   L++ KES +N + L+ +W    +PC +  +W G++C    VTGLRL  MGL
Sbjct  20   SYSLAEPEALLKLKESFKNAEALN-SWTPDTAPCARNTQWAGLICADGIVTGLRLGGMGL  78

Query  441  AGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKM  620
            AG+ID   L+ ++GLR ++ ANN+FSGP+P+F+ L  +K L++ GN+F+GEI +++F KM
Sbjct  79   AGEIDTKVLAEIKGLRTMSFANNNFSGPMPEFNTLGPVKGLYLSGNQFTGEIPSNFFVKM  138

Query  621  TGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQ  800
              LRKLWLS+N F+GNIP SL  +P L+ELHLE NGFS ++P + Q +L  L++S NKL+
Sbjct  139  ESLRKLWLSNNKFTGNIPPSLATIPNLLELHLEDNGFSGSIPVINQSTLVSLNMSNNKLE  198

Query  801  GEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
            GE+P+ M++F A +F GN  LCG  +G++C
Sbjct  199  GEVPASMSKFEASSFAGNAGLCGGKLGKEC  228



>gb|ABA18095.1| lrr transmembrane protein kinase [Olimarabidopsis pumila]
Length=631

 Score =   370 bits (951),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 232/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  338   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  AT
Sbjct  397   FDIEMQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWAT  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  457   RLKIIQGVARGMDFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  516

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI+ILEV+TGKFPSQYL+  KGGTD+V+WV+ ++A
Sbjct  517   ALFAFKSPEFVQNQQVSPKSDVYCLGIIILEVMTGKFPSQYLNTGKGGTDIVEWVQSSIA  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  DS  +M++L++IGAAC  S+  +R +MKE ++RI  +
Sbjct  577   QHKEEELIDPEIA-SNTDSIQQMIELVRIGAACIASNPNERQNMKEIVRRIERV  629


 Score =   180 bits (457),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 140/230 (61%), Gaps = 10/230 (4%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             C IL C   + S   V +   L+ FK S+  TKG  ++W  G +PC+   +WFG+ C +
Sbjct  7    LCFILFCFSFTPSLQNVRESEPLLRFKTSVNITKGDLNSWRTGTNPCNG--KWFGIYCQK  64

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I+V+ L +L  LR I L NN  SGP+P F KL  LKSL +  N
Sbjct  65   GQTVSGIHVTRLGLSGTINVEDLKDLPNLRTIRLDNNLLSGPLPPFFKLPGLKSLLLSNN  124

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             FSGEI+ D+F +   L++++L +N  SG IP+SL +L  L ELH++GN FS  +PPL  
Sbjct  125  SFSGEIADDFFKETPQLKRVFLDNNRLSGKIPSSLMQLSGLEELHMQGNQFSGEIPPLTD  184

Query  759  RSLTI--LDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCRE  896
             +  I  LDLS N L+GEIP  +A  +     FEGN +LCG P+   C E
Sbjct  185  GNKVIKSLDLSNNNLEGEIPKSIAERKNLEMKFEGNQKLCGPPLNTICEE  234



>gb|KFK33835.1| hypothetical protein AALP_AA5G066100 [Arabis alpina]
Length=632

 Score =   370 bits (950),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 235/295 (80%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ ++A
Sbjct  339   DIIMVNTEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLAREA  397

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  398   FDVELQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWPT  457

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM +LH EF +Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+  +   Q
Sbjct  458   RLKIIQGVARGMMFLHEEFGSYELPHGNLKSSNVLLSETYEPLISDYAFLPLLQPSNASQ  517

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  518   ALFAFKSPEFAKSQQVSPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQTSIA  577

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
               KE E+IDPEIA +  DS  +MV+LL+IGAAC  S+ ++R +MKE ++RI +I+
Sbjct  578   QKKEEELIDPEIA-SNTDSMKQMVELLRIGAACIASNPDERENMKETVRRIEQIK  631


 Score =   174 bits (442),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 138/229 (60%), Gaps = 10/229 (4%)
 Frame = +3

Query  270  VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR-KTVTGLRLYNMGLAG  446
            V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C + +TV+G+ +  +GL+G
Sbjct  23   VSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQKGQTVSGIHVTRLGLSG  80

Query  447  DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I+V+ L +L  LR I L NN  SGP+P F KL+ LKSL +  N FSGEI+ D+F     
Sbjct  81   IINVEDLKDLPNLRTIRLDNNLLSGPLPPFFKLQGLKSLLLSNNSFSGEIADDFFKNTPQ  140

Query  627  LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL--AQRSLTILDLSGNKLQ  800
            L++++L +N FSG IP S+ +LP + ELHL+GN FS  +PP   + + L  LD S N L+
Sbjct  141  LKRVFLDNNRFSGKIPTSVMQLPGIEELHLQGNQFSGEIPPFTDSNKVLKSLDFSNNLLE  200

Query  801  GEIPSGMA--RFGAKAFEGNPELCGEPVGRQC---REDLGKDGGGGAEA  932
            GEIP  ++  +     F GN +LCG+P+  +C    E  G  GG    A
Sbjct  201  GEIPKSISERKNLQMNFLGNQKLCGQPLNVECVAKPEFTGSPGGNNQVA  249



>ref|XP_004288996.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Fragaria vesca subsp. vesca]
Length=687

 Score =   372 bits (954),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 234/295 (79%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + ++V++ RG FGL +LM A+AEVLGNGGLGSAYKA +   GL+VVVKR++E N++ ++ 
Sbjct  394   ELLMVSDLRGPFGLPDLMKAAAEVLGNGGLGSAYKAVMGN-GLSVVVKRMREMNRLGREG  452

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR+ G LRH NIL  LAYHYR++EKL++S++ P GSLLY+LHGDRGT+H++L  +T
Sbjct  453   FDAEMRRFGRLRHRNILTPLAYHYRREEKLLISDYVPGGSLLYVLHGDRGTSHSELTWST  512

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GME+LHTEFA Y LPHGNLKSSNILL   YEP+L DYA HPLV+ +   Q
Sbjct  513   RLKIIQGVAKGMEFLHTEFAAYDLPHGNLKSSNILLQEDYEPVLNDYALHPLVNPSNAAQ  572

Query  1722  CMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K P   E  +IS K+DVYCLGIV+LE++TGKFPSQYLSN KGG DVVQWV+ A A
Sbjct  573   SLFAFKTPEYLESQEISPKADVYCLGIVVLEILTGKFPSQYLSNGKGGIDVVQWVQSATA  632

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + +E E++DPEI    E S  +M++LL+IGA CTES  ++R  +K+AIKRI E++
Sbjct  633   EQREQELLDPEIESNTE-SVKQMLQLLKIGADCTESKPDQRPDIKDAIKRILEVR  686


 Score =   186 bits (471),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 137/239 (57%), Gaps = 28/239 (12%)
 Frame = +3

Query  258  LSISVGDDVVLIEFKESLQNTKGLDDTWV---KGKSPCDKTRRWFGVLCHR-KTVTGLRL  425
            L +S+ +   L++ K+SL NT  LDD+WV      SPC     W GV C    TV  L+L
Sbjct  21   LLVSLSEQEALLQLKKSLTNTTALDDSWVPTPDSTSPCQSQTSWNGVYCGSGTTVVNLKL  80

Query  426  YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
             NMGL+G ID +AL+ L+GLR + L NN F+G IPDF KL  L+SL +    FSGEI AD
Sbjct  81   SNMGLSGTIDFEALTQLKGLRGLYLDNNHFAGDIPDFHKLVSLRSLSLNNTDFSGEIPAD  140

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP-------------  746
            +F+KM  LR++ LS+N FSG IP S+ KL  L EL+L+ N FS  +P             
Sbjct  141  FFSKMNSLRRVTLSNNNFSGKIPESITKLKNLKELNLDNNYFSGEIPDSLAELNGLATLH  200

Query  747  ----------PLAQRSLTILDLSGNKLQGEIPSGMA-RFGAKAFEGNPELCGEPVGRQC  890
                      P  + +L  L+L+ N L GEIP  M+ R+    F+GN  LCG+P+  QC
Sbjct  201  LENNQLSGEIPHFKETLEDLNLANNTLTGEIPDEMSTRYTPDKFQGNEGLCGDPLENQC  259



>ref|XP_010503020.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Camelina sativa]
Length=631

 Score =   369 bits (948),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 229/294 (78%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  338   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM+  G +RH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L  A 
Sbjct  397   FDIEMQHFGKIRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWAI  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  457   RLKIIQGVARGMDFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  516

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     QIS KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  517   ALFAFKSPEFVQNQQISPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSIA  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA    DS  +MV+LLQIGA C  S+  +R +MKE ++RI  +
Sbjct  577   QHKEEELIDPEIA-INTDSMQQMVELLQIGAVCIASNPNERQNMKEIVRRIERV  629


 Score =   183 bits (464),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/244 (43%), Positives = 145/244 (59%), Gaps = 11/244 (5%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             C IL C+  + S   V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    LCFILLCILFTSSLQHVSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  64

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I+V+ L +L  LR I L NN  SGP+P F  L  LKSL +  N
Sbjct  65   GQTVSGIHVTRLGLSGTINVEDLKDLPNLRTIRLDNNLLSGPLPPFFMLHGLKSLLLSNN  124

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             FSGEIS DYF +   L++++L +N  SG IP+SL +L  L ELH++GN FS  +PP A+
Sbjct  125  SFSGEISDDYFKETPQLKRVFLDNNRLSGKIPSSLMQLSGLEELHMQGNQFSGEIPPPAE  184

Query  759  RS--LTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
             +  L  LDLS N L+GEIP  +A  +     FEGN +LCG P+  +C ED     G   
Sbjct  185  GNTILKSLDLSNNNLEGEIPKSIAERKNLEMKFEGNQKLCGPPLSTKC-EDKPSSTGEKN  243

Query  927  EAQT  938
            E  T
Sbjct  244  EVTT  247



>ref|XP_006292595.1| hypothetical protein CARUB_v10018834mg [Capsella rubella]
 gb|EOA25493.1| hypothetical protein CARUB_v10018834mg [Capsella rubella]
Length=631

 Score =   369 bits (947),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 230/294 (78%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  338   DIIMVNNEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EM++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L    
Sbjct  397   FDIEMQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGVYHSELTWTI  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM +LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  457   RLKIIQGVARGMNFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPLLQPNNASQ  516

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     QIS KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ ++A
Sbjct  517   ALFAFKSPEFVQNQQISPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSIA  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPE+A +  DS  +MV+LL+IGAAC  S+  +R +MKE ++RI  +
Sbjct  577   QHKEEELIDPELA-SNTDSMQQMVELLRIGAACIASNPNERNNMKEIVRRIERV  629


 Score =   187 bits (475),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 143/236 (61%), Gaps = 10/236 (4%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             C IL C+  + S   V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    ICFILFCISFTPSLQHVSESEPLVRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  64

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I+V+ L +L  LR I L NN  SGP+P F KL  LKSL +  N
Sbjct  65   GQTVSGIHVTRLGLSGTINVEDLKDLPNLRTIRLDNNLLSGPLPLFYKLPGLKSLLLSNN  124

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             FSGEIS D+F +   L++++L +N  SG IPASL +L  L ELH++GN FS  +PPL +
Sbjct  125  SFSGEISDDFFKETPQLKRVFLDNNRLSGKIPASLMQLSGLEELHMQGNQFSGEIPPLTE  184

Query  759  --RSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQCREDLGKDG  914
              + L  LDLS N L+GEIP  +A  +     FEGN +LCG P+  +C E     G
Sbjct  185  GNKILKSLDLSNNNLEGEIPKSIAERKNLQMKFEGNQKLCGPPLNTKCEEQPSSTG  240



>ref|XP_010450371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Camelina sativa]
Length=643

 Score =   368 bits (944),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 218/590 (37%), Positives = 330/590 (56%), Gaps = 30/590 (5%)
 Frame = +3

Query  336   TWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSF  515
             +W     PC     W GVLC+  +V GL++ N+ L+G ID++ALS L  LR ++  NN F
Sbjct  41    SWDAKTPPCT----WPGVLCNSGSVWGLQIENLELSGSIDIEALSGLTSLRTLSFRNNKF  96

Query  516   SGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
              GP P+F KL  LKSL++  N+F G+I  + F  M  L+K+ L+ N F+G IP S+ KLP
Sbjct  97    GGPFPEFKKLAALKSLYLSNNQFEGDIPDNAFEGMAWLKKVHLAQNKFTGQIPTSVTKLP  156

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             +L+EL L+GN F+  +P      L +++LS N L G IP  ++    K FEGN  L    
Sbjct  157   KLLELRLDGNQFTGQIPEFGHE-LHLINLSNNALTGPIPESLSMMDPKVFEGNKGL----  211

Query  876   VGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVK  1055
                 C + L  +     +   P+   R  S  R  L+  +   +L  ++          +
Sbjct  212   ----CGKPLETECDSPFKELPPQPEVRPKSSSRDPLVIKIIVTVLAILIILGVIIVLINR  267

Query  1056  TRRKDNLDEVLVVQIASMARSESINHssrrst----------stegsssrggDFVLVNEE  1205
               RK  L   +    +S+ +   I  + +             S   +         + E+
Sbjct  268   NYRKKQLTLAVETGPSSLQKKIGIRDADQTRRGRHKSDHRNGSATTTGVENTKLSFLRED  327

Query  1206  RGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKM  1385
             R  F L +L+ ASAE+LG+G  G++YKA L   G  +VVKR K+ N   +D F   M+++
Sbjct  328   REKFDLQDLLKASAEILGSGCFGASYKAVLSS-GQMMVVKRFKQMNNAGRDEFQEHMKRL  386

Query  1386  GMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGV  1565
             G LR+HN+LP++AY+YRK+EKL+V +F  +GSL   LH ++   +  L   TR+KI+KGV
Sbjct  387   GRLRNHNLLPIVAYYYRKEEKLLVCDFAERGSLAVNLHSNQSLGNPSLDWPTRLKIVKGV  446

Query  1566  ASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP  1745
             A G+ YLH +  +   PHG+LKSSN+LLT  +EPLLTDY   PL++       M A ++P
Sbjct  447   ARGLLYLHHDLPSLMAPHGHLKSSNVLLTKAFEPLLTDYGLIPLINQEKAQVHMAAYRSP  506

Query  1746  E--GHQ-ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVI  1916
             E   HQ I+ K+DV+ LGI+ILE++TGKFP+ +  +Q    D+  WV           + 
Sbjct  507   EYLQHQRITKKTDVWQLGILILEILTGKFPANF--SQGSEEDLASWVNLGFHGEWAPNLF  564

Query  1917  DPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             D E+ G     +G+++KLL+IG +C E DVEKRL + EA+++I E+++ E
Sbjct  565   DKEM-GKTSHCEGQILKLLRIGLSCCEPDVEKRLDIVEAVEKIEELREQE  613



>emb|CDY12339.1| BnaA06g20050D [Brassica napus]
Length=629

 Score =   367 bits (941),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 228/294 (78%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  336   DIIMVNSEKGAFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLTRDA  394

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  395   FDVELQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  454

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF P +      Q
Sbjct  455   RLKIIQGVARGMQFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPFLQPNNASQ  514

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ +V 
Sbjct  515   ALFAFKSPEFAQNQQVSPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSVE  574

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  DS   MV+LL+IGAAC  S+ + R +MKE + RI  I
Sbjct  575   QHKEEELIDPEIA-SNTDSLQLMVELLRIGAACIASNPDDRENMKETVTRIERI  627


 Score =   174 bits (441),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 140/228 (61%), Gaps = 11/228 (5%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             CL+L C   + S   V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    LCLLL-CFSFTPSLQHVSESEPLMRFKSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  63

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I ++ L++L  LR I L NN  SGP+P F KL  L+SL +  N
Sbjct  64   GQTVSGIHVTKLGLSGIIHIEDLNDLPNLRTIRLDNNLLSGPLPPFFKLHGLRSLLLSNN  123

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-  755
             FS EI+ D+F  M  L++++L +N F+G IPAS+ +LP L ELHL+GN FS  +P L  
Sbjct  124  SFSEEIADDFFKDMQQLKRVFLDNNRFAGKIPASVMQLPGLEELHLQGNQFSGEIPLLTD  183

Query  756  -QRSLTILDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQC  890
                L  LDLS N L+GEIP  +A  +     F+GN +LCG+P+  +C
Sbjct  184  GNTVLKSLDLSNNNLEGEIPKSIAERKNLQMNFQGNQKLCGQPLNIKC  231



>ref|XP_006419171.1| hypothetical protein EUTSA_v10002439mg [Eutrema salsugineum]
 gb|ESQ37607.1| hypothetical protein EUTSA_v10002439mg [Eutrema salsugineum]
Length=635

 Score =   367 bits (941),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 232/294 (79%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  342   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLARDA  400

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  401   FDVELQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  460

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y+LPHGNLKSSN+LL+ TYEPL++DYAF PL+      Q
Sbjct  461   RLKIIQGVARGMQFLHEEFASYELPHGNLKSSNVLLSETYEPLISDYAFLPLLQSNNASQ  520

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ + A
Sbjct  521   ALFAFKSPEFAQKQQVSPKSDVYCLGIILLEVLTGKFPSQYLNNGKGGTDIVEWVQSSFA  580

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  +S  +MV+LL+IGA C  S+ ++R +MKE ++RI  I
Sbjct  581   QHKEEELIDPEIA-SNTNSLQQMVELLRIGATCIASNPDERENMKETVRRIEGI  633


 Score =   172 bits (436),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 133/222 (60%), Gaps = 7/222 (3%)
 Frame = +3

Query  270  VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR-KTVTGLRLYNMGLAG  446
            V +   L+ FK S+  TKG  ++W  G  PC+   +WFG+ C + +TV+G+ +  +GL+G
Sbjct  23   VSESEPLVRFKTSVNITKGDLNSWRTGTDPCNG--KWFGIYCQKGQTVSGIHVTRLGLSG  80

Query  447  DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             IDV+ L +L  LR I L NN  SGP+P F KL  LKSL +  N FSGEI+ D+F     
Sbjct  81   IIDVENLKDLPNLRTIRLDNNLLSGPLPPFFKLHGLKSLLLSNNSFSGEIADDFFKDTPQ  140

Query  627  LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL--AQRSLTILDLSGNKLQ  800
            L++++  +N F+G IP S+ +L  L ELHL+GN FS  +P L  + + L  LDLS N L+
Sbjct  141  LKRVFFDNNRFTGRIPTSVMQLAGLEELHLQGNEFSGEIPSLTDSNKILKSLDLSNNNLE  200

Query  801  GEIPS--GMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
            GEIP   G  +     F+GN +LCG+P+  +C       G G
Sbjct  201  GEIPKSIGERKNLQMNFQGNEKLCGQPLNIKCDHKPSSTGSG  242



>ref|XP_009123261.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Brassica rapa]
Length=629

 Score =   366 bits (939),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 228/294 (78%), Gaps = 5/294 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ NK+ +DA
Sbjct  336   DIIMVNSEKGAFGLPDLMKAAAEVLGNGSLGSAYKAVM-ANGLSVVVKRIRDMNKLTRDA  394

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+++ G LRH N+L  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  395   FDVELQRFGKLRHPNVLTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  454

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA+Y LPHGNLKSSN+LL+ TYEPL++DYAF P +      Q
Sbjct  455   RLKIIQGVARGMQFLHEEFASYDLPHGNLKSSNVLLSETYEPLISDYAFLPFLQPNNASQ  514

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K+PE     Q+S KSDVYCLGI++LEV+TGKFPSQYL+N KGGTD+V+WV+ +V 
Sbjct  515   ALFAFKSPEFAQNQQVSPKSDVYCLGIILLEVMTGKFPSQYLNNGKGGTDIVEWVQSSVE  574

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               KE E+IDPEIA +  DS   MV+LL+IGAAC  S+ + R +MKE + RI  I
Sbjct  575   QHKEEELIDPEIA-SNTDSLQLMVELLRIGAACIASNPDDRETMKETVTRIEGI  627


 Score =   173 bits (438),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 141/228 (62%), Gaps = 11/228 (5%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
             CL+L C   + S   V +   L+ F  S+  TKG  ++W  G  PC+   +WFG+ C +
Sbjct  7    LCLLL-CFSFTPSLQHVSESEPLMRFTSSVNITKGDLNSWRTGTDPCNG--KWFGIYCQK  63

Query  402  -KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
             +TV+G+ +  +GL+G I ++ L++L  LR I L NN  SGP+P F KL  L+SL +  N
Sbjct  64   GQTVSGIHVTKLGLSGIIHIEDLNDLPNLRTIRLDNNLLSGPLPPFFKLHGLRSLLLSNN  123

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
             FS EI+ D+F  M  L++++L +N F+G IPAS+ +LP L ELHL+GN FS  +P L  
Sbjct  124  SFSEEIADDFFKDMQQLKRVFLDNNRFAGKIPASVMQLPGLEELHLQGNQFSGEIPLLTD  183

Query  759  RSLTI--LDLSGNKLQGEIPSGMA--RFGAKAFEGNPELCGEPVGRQC  890
             ++ +  LDLS N L+GEIP  +A  +     F+GN +LCG+P+  +C
Sbjct  184  GNMVLKSLDLSNNNLEGEIPKSIAERKNLQMNFQGNQKLCGQPLNIKC  231



>ref|XP_010435432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Camelina sativa]
Length=657

 Score =   366 bits (940),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 224/625 (36%), Positives = 342/625 (55%), Gaps = 31/625 (5%)
 Frame = +3

Query  234   CLILQCLPLSISVGDDVVLIEFKESLQ-NTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTV  410
             CL+L     +  + D   ++  K+SL         +W     PC     W GVLC+  +V
Sbjct  20    CLLLLFSTATHGLSDSEAILNIKKSLVVGQANALASWDAKTLPCT----WPGVLCNSGSV  75

Query  411   TGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSG  590
              GL++ N+ L+G ID++ALS L  LR ++  NN F GP P+F KL  LKSL++  N+F G
Sbjct  76    WGLQIENLELSGSIDIEALSGLTSLRTLSFRNNKFGGPFPEFKKLAALKSLYLSNNQFEG  135

Query  591   EISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             +I  + F  M  L+K+ L+ N F+G IP S+ KLP+L+EL L+GN F+  +P      L 
Sbjct  136   DIPDNAFEGMAWLKKVHLAQNKFTGQIPTSVTKLPKLLELRLDGNQFTGQIPEFGHE-LH  194

Query  771   ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENA  950
             +++LS N L G IP  ++    K FEGN  L        C + L  +     +   P+  
Sbjct  195   LINLSNNALTGPIPESLSMMDPKVFEGNKGL--------CGKPLETECDSPFKELPPQPE  246

Query  951   QRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN  1130
              R  S  R  L+  +   +L  ++          +  RK  L   +    +S+ +   I 
Sbjct  247   VRPKSSSRDPLVIKIIVTVLAILIILGVIIVLINRNYRKKQLTLAVETGPSSLQKKIGIR  306

Query  1131  Hssrrst----------stegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSA  1280
              + +             S   +         + E+R    L +L+ ASAE+LG+G  G++
Sbjct  307   DADQTRRGRHKSDHRNGSATTTGVENTKLSFLREDREKIDLQDLLKASAEILGSGCFGAS  366

Query  1281  YKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVS  1460
             YKA L   G  +VVKR K+ N   +D F   M+++G LR+HN+LP++AY+YRK+EKL+V 
Sbjct  367   YKAVLSS-GQMMVVKRFKQMNNAGRDEFQEHMKRLGRLRNHNLLPIVAYYYRKEEKLLVC  425

Query  1461  EFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSN  1640
             +F  +GSL   LH ++   +  L   TR+KI+KGVA G+ YLH +  +   PHG+LKSSN
Sbjct  426   DFAERGSLAVNLHSNQSLGNPSLDWPTRLKIVKGVARGLLYLHHDLPSLMAPHGHLKSSN  485

Query  1641  ILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE--GHQ-ISHKSDVYCLGIVILEVV  1811
             +LLT  +EPLLTDY   PL++       M A ++PE   HQ I+ K+DV+ LGI+ILE++
Sbjct  486   VLLTKAFEPLLTDYGLIPLINQEKAQVHMAAYRSPEYLQHQRITKKTDVWQLGILILEIL  545

Query  1812  TGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAAC  1991
             TGKFP+ +  +Q    D+  WV           + D E+ G     +G+++KLL+IG +C
Sbjct  546   TGKFPANF--SQGSEEDLASWVNLGFHGEWAPNLFDKEM-GKTSHCEGQILKLLRIGLSC  602

Query  1992  TESDVEKRLSMKEAIKRIREIQDVE  2066
              E DVEKRL + EA+++I E+++ E
Sbjct  603   CEPDVEKRLDIIEAVEKIEELREQE  627



>gb|KEH18496.1| receptor-like kinase, putative [Medicago truncatula]
Length=727

 Score =   364 bits (935),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 237/318 (75%), Gaps = 12/318 (4%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++N E+G+FGL +LM ASAEVLGNGG GS+YKA +   G+ VVVKR +E N + KD 
Sbjct  379   ELVMMNNEKGVFGLPDLMKASAEVLGNGGFGSSYKAVM-ANGVAVVVKRTRELNALGKDG  437

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEM+K+G L+H N+L  LAYHYRK EKLV+SE+ P+GSLLYLLHGDRG +H +L   T
Sbjct  438   FDAEMKKLGRLKHWNVLTPLAYHYRKDEKLVISEYVPRGSLLYLLHGDRGPSHAELDWNT  497

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A GM YLHTE+ +  LPHGNLKSSN+LL P YEPLL DY F  LV+ +    
Sbjct  498   RLKIVQGIAKGMHYLHTEYPSSDLPHGNLKSSNVLLGPDYEPLLIDYGFIHLVNPSSFTN  557

Query  1722  CMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              + A KAPE    +QIS + DVYCLG+VILE++TGKFPSQYLSN KGGTDVVQWV  A++
Sbjct  558   TLLAFKAPEALQHNQISPRCDVYCLGVVILEILTGKFPSQYLSNGKGGTDVVQWVASAIS  617

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVF  2072
             +G+E E++DPEIA + ++   +M +L+ IGAACTES+ + RL M EA++RI EI+   V 
Sbjct  618   EGREVELLDPEIA-SNKNPLSEMKQLVHIGAACTESNPQNRLDMMEAVRRIEEIKTNGV-  675

Query  2073  HELPFPDEIREAE*VEDL  2126
                   D+++E   +E L
Sbjct  676   ------DQVQELRTIEVL  687


 Score =   216 bits (549),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 139/208 (67%), Gaps = 1/208 (0%)
 Frame = +3

Query  267  SVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAG  446
            S+ +   L+  K S  N   L+ +W     PC +  +W GV+C+   VTGLRL  MGL G
Sbjct  29   SLSETEALLNLKNSFSNANALN-SWFANTLPCTEDDQWEGVVCYNGLVTGLRLEGMGLFG  87

Query  447  DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             IDVDAL  L+GLR I+  NNSF+G IP+ +++  LK++F+ GN+FSG I  +YF +M  
Sbjct  88   KIDVDALLELKGLRTISFMNNSFTGSIPELNRIGFLKAMFLSGNKFSGHIPKEYFQRMKS  147

Query  627  LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
            L+K+WLS+N F+G+IP+SL ++P+LVELHLE N FS  +P L   SL I D+S N L+GE
Sbjct  148  LKKVWLSNNEFTGDIPSSLAEIPQLVELHLEKNQFSGNIPNLNNPSLMIFDVSNNNLEGE  207

Query  807  IPSGMARFGAKAFEGNPELCGEPVGRQC  890
            +P G+ RF   +F GN  LCGE +G+ C
Sbjct  208  VPQGLLRFNGNSFLGNSGLCGEKMGKIC  235



>emb|CDY36051.1| BnaC03g41470D [Brassica napus]
Length=680

 Score =   362 bits (930),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 232/644 (36%), Positives = 354/644 (55%), Gaps = 37/644 (6%)
 Frame = +3

Query  216   LIFFSFCLILQC-LPLSISVGDDVV-------LIEFKESLQNTKGLDDTWVKGKSPCDK-  368
             L F +F +I+ C + + IS    VV       L+ FK++L N   +  +W    +PC + 
Sbjct  20    LPFIAFLIIVLCQVTMVISQEHKVVPGSDADCLLRFKDTLTNASVIS-SWDPLTAPCKRN  78

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             +  WFGVLC    V GL+L  M L G +D++ L  ++ LR ++  NN+F+G +P   KL 
Sbjct  79    SPNWFGVLCFTGYVWGLQLEGMDLTGKLDLEPLVPIKNLRTLSFMNNNFNGAMPSVKKLV  138

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
              L+SL++  N F+GEI AD F  M  L+KL L++N F G IP+SL  LP L+E+ L GN 
Sbjct  139   SLRSLYLSNNWFTGEIPADAFDGMNHLKKLLLANNAFRGKIPSSLASLPMLLEVKLNGNQ  198

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
             F   +P    ++L +     N L+G IP  +      +F GN  LC  P+       +  
Sbjct  199   FQGNIPDFKPKNLKLASFENNDLEGPIPQSLRDMDPGSFAGNKALCDPPL-------ISC  251

Query  909   DGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRK-------  1067
                  + A  P +            ++IV  ++ + +L            RRK       
Sbjct  252   SAASWSIADPPPSFTEKDKIQTMFTVAIVLIVIGIILLLISLVIFILQNRRRKILSACPS  311

Query  1068  ---DNLDEVLVVQIASMAR-SESINHssrrststegsssrggDFVLVNEERGMFGLSELM  1235
                D +++    Q   + R +ES+N  + R     G+    G  + + E+   F L +L+
Sbjct  312   AGQDRIEKYNYDQSMHVERGAESVNSYTSRRGGGGGAVPDQGKLLFLQEDIQKFDLQDLL  371

Query  1236  MASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
              ASAEVLG+G  G++YKA +   G T+VVKR K  N + +D F   +R++G LRH N+LP
Sbjct  372   RASAEVLGSGSFGASYKAGINS-GQTLVVKRYKHMNNVGRDEFHEHIRRLGRLRHPNLLP  430

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
             L+AY+YR++EKL+++EF P  SL   LH +       L   TR+KII+GVA G+ YL  E
Sbjct  431   LVAYYYRREEKLLIAEFMPNRSLARHLHANHSVDQPGLDWPTRLKIIQGVAKGLGYLFKE  490

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QISH  1766
               T  +PHG+LKSSN++L  ++EPLLTDYA  P+++   +   M A K+PE     QI+ 
Sbjct  491   LPTLTIPHGHLKSSNVVLDESFEPLLTDYALRPVMNSEQSHNLMIAYKSPEYSLKGQITK  550

Query  1767  KSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGE  1943
             K+DV+CLG++ILE++TG+FP  YL         +  WV   V + K  +V D E+ G  +
Sbjct  551   KTDVWCLGVLILELLTGRFPENYLRQGYDANMSLETWVSNMVKEKKTGDVFDKEMTGK-K  609

Query  1944  DSDGKMVKLLQIGAACTESDVEKRLSMKEA---IKRIREIQDVE  2066
             +   +M+ LL+IG +C E D E+R+ MK+A   I+R+RE QD++
Sbjct  610   NCKAEMLSLLKIGLSCCEEDEERRMEMKDAVEKIERLREGQDLD  653



>ref|XP_006452838.1| hypothetical protein CICLE_v10007699mg [Citrus clementina]
 gb|ESR66078.1| hypothetical protein CICLE_v10007699mg [Citrus clementina]
Length=651

 Score =   362 bits (928),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 232/297 (78%), Gaps = 5/297 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D  ++N+++  FGL++LM A+AEVLGNGGLGS+YKAA+   GLTVVVKR++E N++ +D 
Sbjct  356   DLSMINDDKDPFGLADLMKAAAEVLGNGGLGSSYKAAM-ANGLTVVVKRIREMNQLGRDT  414

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR++G ++H NIL  LAYH+R+ EKLVVSE+ PKGSLL+LLHG++G +H +L   T
Sbjct  415   FDAEMRRLGRIKHPNILAPLAYHFRRDEKLVVSEYMPKGSLLFLLHGEKGISHAELNWPT  474

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+ IIKGVA+G+ ++H+EFA+Y+LPHGNLKSSN+LL+  Y PLL D+AFHPL +     Q
Sbjct  475   RLNIIKGVANGLSFIHSEFASYELPHGNLKSSNVLLSQDYVPLLGDFAFHPLTNPNHAAQ  534

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA  +PE     Q+S KSDVYCLGI+ILEV+TGKFPSQYLSN KGG DVV+ V   + 
Sbjct  535   TMFAYISPEYIQHQQLSPKSDVYCLGILILEVITGKFPSQYLSNAKGGIDVVELVSSLIG  594

Query  1893  D-GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             D  + +E+IDPEI+   E+S G MV+LL+IG ACTES+  KRL ++EA+K I EI D
Sbjct  595   DQDRVAELIDPEISANAENSIGMMVQLLKIGLACTESEPAKRLDLEEALKMIEEIHD  651


 Score =   194 bits (493),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 138/215 (64%), Gaps = 6/215 (3%)
 Frame = +3

Query  261  SISVGDDVVLIEFKESLQNTKGLDDTWVKG--KSPCDKTRRWFGVLCHRKTVTGLRLYNM  434
            + S+ D+  LI FK+SL +  G+ D+W      +PC  T +W GV+C    V+ L L NM
Sbjct  23   TFSLPDNQALILFKKSLVHN-GVLDSWDPKPISNPC--TDKWQGVMCINGVVSSLFLQNM  79

Query  435  GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
             L+G IDV+AL  + GL  I+L NN F+G IP+F+KL  L +L++  N FS EI  D+FA
Sbjct  80   SLSGTIDVEALRQIAGLTSISLQNNFFTGAIPEFNKLGALNALYLSSNNFSEEIPDDFFA  139

Query  615  KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ-RSLTILDLSGN  791
             MT L+KLWL +N F+G IP SL  L  L ELHL GNGFS  +P   Q  S+  LD S N
Sbjct  140  PMTPLQKLWLDNNKFTGKIPDSLMNLQNLTELHLHGNGFSGLIPETIQPTSIVSLDFSNN  199

Query  792  KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
             L+GEIP G+++FG K F  N +LCG+P+ +QC +
Sbjct  200  NLEGEIPKGLSKFGPKPFADNDKLCGKPLRKQCNK  234



>gb|KDO73854.1| hypothetical protein CISIN_1g006306mg [Citrus sinensis]
Length=651

 Score =   361 bits (927),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 176/297 (59%), Positives = 232/297 (78%), Gaps = 5/297 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D  ++N+++  FGL++LM A+AEVLGNGGLGS+YKAA+   GLTVVVKR++E N++ +D 
Sbjct  356   DLSMINDDKDPFGLADLMKAAAEVLGNGGLGSSYKAAM-ANGLTVVVKRIREMNQLGRDT  414

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR++G ++H NIL  LAYH+R+ EKLVVSE+ PKGSLL+LLHG++G +H +L   T
Sbjct  415   FDAEMRRLGRIKHPNILAPLAYHFRRDEKLVVSEYMPKGSLLFLLHGEKGISHAELNWPT  474

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+ IIKGVA+G+ ++H+EFA+Y+LPHGNLKSSN+LL+  Y PLL D+AFHPL +     Q
Sbjct  475   RLNIIKGVANGLSFIHSEFASYELPHGNLKSSNVLLSQDYVPLLGDFAFHPLTNPNHVAQ  534

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA  +PE     Q+S KSDVYCLGI+ILEV+TGKFPSQYLSN KGG DVV+ V   + 
Sbjct  535   TMFAYISPEYIQHQQLSPKSDVYCLGILILEVITGKFPSQYLSNAKGGIDVVELVSSLIG  594

Query  1893  D-GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             D  + +E+IDPEI+   E+S G MV+LL+IG ACTES+  KRL ++EA+K I EI D
Sbjct  595   DQDRVAELIDPEISANAENSIGMMVQLLKIGLACTESEPAKRLDLEEALKMIEEIHD  651


 Score =   195 bits (496),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 138/215 (64%), Gaps = 6/215 (3%)
 Frame = +3

Query  261  SISVGDDVVLIEFKESLQNTKGLDDTWVKG--KSPCDKTRRWFGVLCHRKTVTGLRLYNM  434
            + S+ D+  LI FK+SL +  G+ D+W      +PC  T +W GV+C    V+ L L NM
Sbjct  23   TFSLPDNQALILFKKSLVHN-GVLDSWDPKPISNPC--TDKWQGVMCINGVVSSLFLQNM  79

Query  435  GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
             L+G IDV+AL  + GL  IAL NN F+G IP+F+KL  L +L++  N FS EI  D+FA
Sbjct  80   SLSGTIDVEALRQIAGLTSIALQNNFFTGAIPEFNKLGALNALYLSSNNFSEEIPDDFFA  139

Query  615  KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ-RSLTILDLSGN  791
             MT L+KLWL +N F+G IP SL  L  L ELHL GNGFS  +P   Q  S+  LD S N
Sbjct  140  PMTPLQKLWLDNNKFTGKIPDSLMNLQNLTELHLHGNGFSGLIPETIQPTSIVSLDFSNN  199

Query  792  KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
             L+GEIP G+++FG K F  N +LCG+P+ +QC +
Sbjct  200  NLEGEIPKGLSKFGPKPFADNDKLCGKPLRKQCNK  234



>ref|XP_010034802.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Eucalyptus grandis]
 gb|KCW53520.1| hypothetical protein EUGRSUZ_J02800 [Eucalyptus grandis]
Length=677

 Score =   362 bits (929),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 180/296 (61%), Positives = 231/296 (78%), Gaps = 6/296 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKET-NKMNKD  1358
             D VL+++E+G+FG+++LM A+AEVLGNGGLGS+YKA +   G+TVV KR++ET +  +KD
Sbjct  354   DLVLLSDEKGVFGMADLMKAAAEVLGNGGLGSSYKAVM-ANGVTVVAKRIRETADGKSKD  412

Query  1359  AFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAA  1538
              FDAEMRK+G L+H N+L  LAYHYRK EKL+V E+ PKGSLLY LHGDRG +H DL   
Sbjct  413   EFDAEMRKLGRLKHPNVLTPLAYHYRKDEKLLVCEYVPKGSLLYALHGDRGPSHGDLNWP  472

Query  1539  TRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTL  1718
              R+KIIKGVA G+ +LH E ++  LPHGNLKSSNILL   YEPLL DY F  L+  +   
Sbjct  473   VRLKIIKGVAKGIGFLHDELSSSSLPHGNLKSSNILLNSEYEPLLADYGFSSLLGTSHVP  532

Query  1719  QCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAV  1889
             Q +FA KAPE  +   +S K DVYCLG+VILE++TGKFPSQYLSN KGGTDV++WVR A+
Sbjct  533   QALFACKAPEVARFGGLSPKCDVYCLGVVILEMLTGKFPSQYLSNGKGGTDVIEWVRSAI  592

Query  1890  ADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +DG+E+E+ DPEIA +  +S  +M KLL IGAACTE++ E+RL M+EAI+RI E+Q
Sbjct  593   SDGREAELFDPEIANS-TNSFPEMEKLLHIGAACTEANPEQRLDMREAIRRIEEMQ  647


 Score =   236 bits (601),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 162/241 (67%), Gaps = 6/241 (2%)
 Frame = +3

Query  183  MAAVRRI-PTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
            M A R I P+  L+  S  LIL   P + S+     L++ K S  N++ L+ +W+    P
Sbjct  1    MVAARLIGPS--LVVLSIVLILP--PTTYSMSQSDALLKLKRSFANSQALE-SWLPSSDP  55

Query  360  CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
            C     W GV+C+   VTGLRL  M L+G +DVDAL+ + GLR ++  NNSFSGPIP+F+
Sbjct  56   CGNEDSWVGVVCYNGIVTGLRLGKMSLSGKVDVDALTEITGLRSLSFVNNSFSGPIPEFN  115

Query  540  KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
            +L  LK+++I GN+FSGEI ADYF+ M  L+KLWLS+N F+G IP+S  +L  L+ELHLE
Sbjct  116  RLGALKAIYISGNQFSGEIPADYFSNMGSLKKLWLSNNKFTGTIPSSAARLTHLIELHLE  175

Query  720  GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED  899
             N FSSA+P     +L  LDLS N+L+G+IP  +++F A +FEGN  LCGE +G++C ++
Sbjct  176  NNEFSSAIPSFDAPALVSLDLSNNQLEGKIPPSLSKFDASSFEGNSGLCGEKIGKECPKE  235

Query  900  L  902
            +
Sbjct  236  V  236



>ref|XP_007140993.1| hypothetical protein PHAVU_008G158100g [Phaseolus vulgaris]
 gb|ESW12987.1| hypothetical protein PHAVU_008G158100g [Phaseolus vulgaris]
Length=644

 Score =   358 bits (920),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 232/614 (38%), Positives = 346/614 (56%), Gaps = 31/614 (5%)
 Frame = +3

Query  249   CLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH-RKTVTGLRL  425
             C   S+   +  +L+ FK SL N K L + W    S C+    W G+LC   +T  GLRL
Sbjct  19    CFEPSLGDTNAQILMRFKGSLSNGKALTN-WGNESSLCN----WTGLLCRANQTFYGLRL  73

Query  426   YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
              +MGL G I+V+ L  L  L   ++ NN+F GP+P+F KL  L++LF+  N+FSG+I  D
Sbjct  74    EHMGLGGTINVETLFELPTLVSFSVINNTFEGPMPEFKKLVRLRALFLSNNKFSGDIPDD  133

Query  606   YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
              F  M  L++++L+ NGF+G IP SL  LPRL++L L  NGF   +P   Q+   + +LS
Sbjct  134   AFEGMRKLKRVFLAENGFTGRIPKSLANLPRLLDLDLRRNGFGGNIPEFQQQDFRVFNLS  193

Query  786   GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQT----PENAQ  953
              N+L+G+IP  ++     +F GN  LCG+P+   C         GG E+++    P++ Q
Sbjct  194   YNQLEGQIPESLSNMYPSSFAGNEGLCGKPLS-YCNHY------GGNESRSMEPNPDSPQ  246

Query  954   RHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINH  1133
             R     R   + I   +++  + F    +   +   R+      +V +  +  +S     
Sbjct  247   RKGKKHR---ILITVIIVVAVVAFASILSLLFIHNHRRKRFQPGIVAKQRNSQKSAGFKE  303

Query  1134  ssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLT  1313
             S     + +     G +   V E++G F L EL+ ASA VLG+G  GS+YKA + + G T
Sbjct  304   SENVDLTADFKGGDG-ELNFVREDKGGFDLQELLRASAVVLGSGSFGSSYKAMI-LGGPT  361

Query  1314  VVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYL  1493
             VVVKR +  N + K  F   M+++G L H N+LPL A++YRK++K +V +F   GSL   
Sbjct  362   VVVKRFRHMNNVGKQEFSEHMQRLGSLTHPNLLPLAAFYYRKEDKFLVYDFAENGSLASQ  421

Query  1494  LHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLL  1673
             LHG   +    L  +TR+KIIKGVA G+ YL   F    LPHG+LKSSN++L  ++EP L
Sbjct  422   LHGRNDSV---LTWSTRLKIIKGVARGLAYLCENFPGKSLPHGHLKSSNVVLDHSFEPHL  478

Query  1674  TDYAFHPLVSGTPTLQCMFALKAPEGHQISH---KSDVYCLGIVILEVVTGKFPSQYLSN  1844
             T+Y    ++S +   + M A KAPE  +      KSDV+CLGI+ILEV+TGKFP+ YL  
Sbjct  479   TEYGLVEVMSKSHAQKFMAAYKAPEISKFGRPNVKSDVWCLGILILEVLTGKFPANYLRP  538

Query  1845  QKGGT--DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRL  2018
              KGG   D+  WV   V +    EV D +I G   + +G+M+KLL+IG  C +  V  R 
Sbjct  539   GKGGNNADLATWVDSVVREEWTGEVFDKDILGT-RNGEGEMMKLLRIGMFCCKWSVGNRW  597

Query  2019  SMKEAIKRIREIQD  2060
               +EA+ +I E+++
Sbjct  598   DWREAVAKIEEVKE  611



>ref|XP_009111239.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Brassica rapa]
Length=673

 Score =   358 bits (920),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 227/635 (36%), Positives = 354/635 (56%), Gaps = 23/635 (4%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVV--------LIEFKESLQNTKGLDDTWVKGKSPCD-K  368
             L F +F +I  C  + +   +  V        L+ FK++L N   +  +W    +PC  K
Sbjct  20    LAFITFFIIGLCPAIMVMSQEHKVVPGSDADSLLRFKDTLANASVIS-SWDPSTAPCKRK  78

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             +  WFGVLC    V GL+L  MGL G +D++ L+ ++ LR ++  NN+F G +P   KL 
Sbjct  79    SSNWFGVLCFAGHVWGLQLEGMGLTGKLDLEPLTPIKDLRTLSFMNNNFDGAMPSVKKLV  138

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
              LKSL++  NRF+GEI AD F  M  L+KL L++N F GN+P+SL  LP L+E+ L GN 
Sbjct  139   SLKSLYLSNNRFTGEIPADAFDGMHHLKKLLLANNAFRGNVPSSLASLPLLLEVRLNGNQ  198

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRED---  899
             F  A+P   Q+ L +     N L+G IP  +      +F GN +LC  P+   C  D   
Sbjct  199   FQGAIPDFKQKDLKLASFENNDLEGPIPESLRNMDPGSFAGNKDLCDPPLS-SCSGDSWF  257

Query  900   LGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLD  1079
                      E ++  N+    + +  ++  I+  +  V  +F+  + ++ +        D
Sbjct  258   FLDPPSTSTEKKSKSNSFYTIAIVLIVIGVILVIISFVVCVFH-TRKQKCLSAYPSAGQD  316

Query  1080  EVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLG  1259
                       A +E    S    T+   +       + + E+   F L +L+ ASAEVLG
Sbjct  317   RTYKYSYDQPADTERAAESVTSYTTKRVTVPDQDKLLFLQEDIQRFDLQDLLRASAEVLG  376

Query  1260  NGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRK  1439
             +G  G++YKA +   G T+VVKR K  N + +D F   +R++G L H N+LPL+AY+YR+
Sbjct  377   SGCFGASYKAGISS-GKTLVVKRYKHMNNVGRDEFHEHIRRLGKLSHPNLLPLVAYYYRR  435

Query  1440  QEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPH  1619
             +EKL+++EF P  SL   LHG+       L   TR+KII+GV  G+ YL  E  T  +PH
Sbjct  436   EEKLLIAEFMPNRSLASHLHGNHSVDQPGLDWPTRLKIIQGVGKGLGYLFKELPTLTIPH  495

Query  1620  GNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE----GHQISHKSDVYCL  1787
             G+LKSSN++L  ++EPLLTDYA  P+++   +   M A K+PE    GH I+ K+DV+CL
Sbjct  496   GHLKSSNVVLDKSFEPLLTDYALRPVMNSEQSHNLMIAYKSPEYSLKGH-ITKKTDVWCL  554

Query  1788  GIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMV  1964
             G++ILE++TG+FP  YLS        +V WV   V + K S+V D E+ G  ++   +M+
Sbjct  555   GVLILELITGRFPENYLSKGYDANMSLVTWVSDMVKEKKTSDVFDKEMIGK-KNCKAEML  613

Query  1965  KLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEV  2069
              LL+IG +C E D E+R+ M++A+++I  +++ ++
Sbjct  614   SLLKIGLSCCEEDEERRMEMRDAVEKIERLRESDI  648



>ref|XP_009788384.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Nicotiana sylvestris]
Length=648

 Score =   357 bits (917),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 227/293 (77%), Gaps = 5/293 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D  +VN+++G FGL++LM A+AEVLGNG LGS+YKA L   GLTVVVKR+KE NK+ KD 
Sbjct  333   DLTMVNDDKGEFGLADLMKAAAEVLGNGPLGSSYKA-LMANGLTVVVKRIKEMNKIGKDG  391

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAE+R++G LRH NIL LLAYHYRK+EKL V E+ PKGSLL+LLHGDRG  H +L    
Sbjct  392   FDAEVRRLGRLRHKNILTLLAYHYRKEEKLFVYEYIPKGSLLFLLHGDRGIPHAELNWPV  451

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A G+ YLHTE A+  LPHG+LKSSNIL+   +EP+LT Y F+ L++     Q
Sbjct  452   RLKIVQGIAQGLSYLHTELAS-DLPHGDLKSSNILINTDHEPILTGYGFYTLINNAHAAQ  510

Query  1722  CMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              + A K+PE    HQ++ KSDVYCLGIVILE++TGKFPSQYL+  KGG D+VQWV+ A+A
Sbjct  511   ALIAFKSPEAVQNHQVTPKSDVYCLGIVILEILTGKFPSQYLNTGKGGIDIVQWVKSAIA  570

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIRE  2051
             +G+E+E+ DP+I  + ++S  +M +LL IGAAC ES+ ++R+++ E I+RI E
Sbjct  571   EGREAELYDPDIIASAKNSTSQMKELLHIGAACVESNPQQRINITEVIRRIEE  623


 Score =   222 bits (565),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 144/212 (68%), Gaps = 1/212 (0%)
 Frame = +3

Query  261  SISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGL  440
            SISV     L++ K+S  N + LD +W     PCDK  RW GV+C  + V  + L  M L
Sbjct  26   SISVTHTEALLKLKQSFTNAESLD-SWKPETDPCDKNSRWIGVICQNQIVRSVLLGRMNL  84

Query  441  AGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKM  620
            +G+IDVD+LS L GLR ++  +N FSGPIP+F+++  LK L++  N+FSGEI ++YF KM
Sbjct  85   SGNIDVDSLSQLSGLRTLSFRSNLFSGPIPEFNRMGALKGLYLSANQFSGEIPSNYFDKM  144

Query  621  TGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQ  800
              L+KLWLS N F+G IP+S+ +L  L+ELHLE N FS  +P L Q +L  LDLS N L+
Sbjct  145  QSLKKLWLSGNKFTGEIPSSILQLHHLIELHLENNQFSGPIPTLNQSTLLSLDLSNNNLK  204

Query  801  GEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
            GEIP  ++RF A +F+GN E+CGE +G+ C +
Sbjct  205  GEIPESLSRFNASSFKGNAEVCGEKLGKVCDQ  236



>ref|XP_009135668.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 isoform X1 [Brassica rapa]
Length=681

 Score =   358 bits (918),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 229/645 (36%), Positives = 353/645 (55%), Gaps = 39/645 (6%)
 Frame = +3

Query  216   LIFFSFCLILQC-LPLSISVGDDVV-------LIEFKESLQNTKGLDDTWVKGKSPCDK-  368
             L F +F +I+ C + + IS    VV       L+ FK++L N   +  +W    +PC + 
Sbjct  21    LSFITFVIIVLCQVTMVISQEQKVVPGSDADCLLRFKDTLTNASVIS-SWDPLTAPCKRN  79

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             +  WFGVLC    V GL+L  M L G +D++ L  ++ LR ++  NN+F+G +P   KL 
Sbjct  80    SPNWFGVLCFTGNVWGLQLEGMDLTGKLDLEPLVPIKNLRTLSFMNNNFNGAMPSVKKLV  139

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
              L+SL++  N F+GEI AD F  M  L+KL L++N F G IP+SL  LP L+E+ L GN 
Sbjct  140   SLRSLYLSNNWFTGEIPADAFDGMNHLKKLLLANNAFRGKIPSSLASLPMLLEVKLNGNQ  199

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
             F   +P    ++L +     N L+G IP  +      +F GN  L        C   L  
Sbjct  200   FQGNIPDFKPKNLKLASFENNDLEGPIPQSLRDMDPGSFAGNKAL--------CDPPLIS  251

Query  909   DGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRK-------  1067
                       P  +      ++ +    +  +++  IL   +     ++ RR+       
Sbjct  252   CSAASWSIPDPPPSFTEKDKIQTMFTVAIVLIVIGIILLLISLVVFILQNRRRKVLSACP  311

Query  1068  ----DNLDEVLVVQIASMAR-SESINHssrrststegsssrggDFVLVNEERGMFGLSEL  1232
                 D +++    Q   + R +ES+N  + R     G+    G  + + E+   F L +L
Sbjct  312   SAGQDRIEKYNYDQSMHVERGAESVNSYTSRRGGGGGAVPDQGKLLFLQEDIQRFDLQDL  371

Query  1233  MMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNIL  1412
             + ASAEVLG+G  G++YKA +   G T+VVKR K  N + +D F   +R++G L H N+L
Sbjct  372   LRASAEVLGSGSFGASYKAGINS-GQTLVVKRYKHMNNVGRDEFHEHIRRLGRLSHPNLL  430

Query  1413  PLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHT  1592
             PL+AY+YR++EKL+++EF P  SL   LH +       L   TR+KII+GVA G+ YL  
Sbjct  431   PLVAYYYRREEKLLIAEFMPNRSLARHLHANHSVDQPGLDWPTRLKIIQGVAKGLGYLFK  490

Query  1593  EFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QIS  1763
             E  T  +PHG+LKSSN++L  ++EPLLTDYA  P+++   +   M A K+PE     QI+
Sbjct  491   ELPTLTIPHGHLKSSNVVLDESFEPLLTDYALRPVMNSEQSHNLMIAYKSPEYSLKGQIT  550

Query  1764  HKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAG  1940
              K+DV+CLG++ILE++TG+FP  YL         +V WV   V + K  +V D E+ G  
Sbjct  551   KKTDVWCLGVLILELLTGRFPENYLRQGYDANMSLVTWVSNMVKEKKTGDVFDKEMTGK-  609

Query  1941  EDSDGKMVKLLQIGAACTESDVEKRLSMKEA---IKRIREIQDVE  2066
             ++   +M+ LL+IG +C E D E+R+ MK+A   I+R+RE QD++
Sbjct  610   KNCKAEMLSLLKIGLSCCEEDEERRMEMKDAVEKIERLREGQDLD  654



>emb|CDX82258.1| BnaA03g35630D [Brassica napus]
Length=681

 Score =   357 bits (916),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 229/645 (36%), Positives = 353/645 (55%), Gaps = 39/645 (6%)
 Frame = +3

Query  216   LIFFSFCLILQC-LPLSISVGDDVV-------LIEFKESLQNTKGLDDTWVKGKSPCDK-  368
             L F +F +I+ C + + IS    VV       L+ FK++L N   +  +W    +PC + 
Sbjct  21    LSFITFVIIVLCQVTMVISQEQKVVPGSDADCLLRFKDTLTNASVIS-SWDPLTAPCKRN  79

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             +  WFGVLC    V GL+L  M L G +D++ L  ++ LR ++  NN+F+G +P   KL 
Sbjct  80    SPNWFGVLCFTGNVWGLQLEGMDLTGKLDLEPLIPIKNLRTLSFMNNNFNGAMPSVKKLV  139

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
              L+SL++  N F+GEI AD F  M  L+KL L++N F G IP+SL  LP L+E+ L GN 
Sbjct  140   SLRSLYLSNNWFTGEIPADAFDGMNHLKKLLLANNAFRGKIPSSLASLPMLLEVKLNGNQ  199

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
             F   +P    ++L +     N L+G IP  +      +F GN  L        C   L  
Sbjct  200   FQGNIPDFKPKNLKLASFENNDLEGPIPQSLRDMDPGSFAGNKAL--------CDPPLIS  251

Query  909   DGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRK-------  1067
                       P  +      ++ +    +  +++  IL   +     ++ RR+       
Sbjct  252   CSAASWSIPDPPPSFTEKDKIQTMFTVAIVLIVIGIILLLISLVVFILQNRRRKILSACP  311

Query  1068  ----DNLDEVLVVQIASMAR-SESINHssrrststegsssrggDFVLVNEERGMFGLSEL  1232
                 D +++    Q   + R +ES+N  + R     G+    G  + + E+   F L +L
Sbjct  312   SAGQDRIEKYNYDQSMHVERGAESVNSYTSRRGGGGGAVPDQGKLLFLQEDIQRFDLQDL  371

Query  1233  MMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNIL  1412
             + ASAEVLG+G  G++YKA +   G T+VVKR K  N + +D F   +R++G L H N+L
Sbjct  372   LRASAEVLGSGSFGASYKAGINS-GQTLVVKRYKHMNNVGRDEFHEHIRRLGRLSHPNLL  430

Query  1413  PLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHT  1592
             PL+AY+YR++EKL+++EF P  SL   LH +       L   TR+KII+GVA G+ YL  
Sbjct  431   PLVAYYYRREEKLLIAEFMPNRSLARHLHANHSVDQPGLDWPTRLKIIQGVAKGLGYLFK  490

Query  1593  EFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGH---QIS  1763
             E  T  +PHG+LKSSN++L  ++EPLLTDYA  P+++   +   M A K+PE     QI+
Sbjct  491   ELPTLTIPHGHLKSSNVVLDESFEPLLTDYALRPVMNSEQSHNLMIAYKSPEYSLKGQIT  550

Query  1764  HKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAG  1940
              K+DV+CLG++ILE++TG+FP  YL         +V WV   V + K  +V D E+ G  
Sbjct  551   KKTDVWCLGVLILELLTGRFPENYLRQGYDANMSLVTWVSNMVKEKKTGDVFDKEMTGK-  609

Query  1941  EDSDGKMVKLLQIGAACTESDVEKRLSMKEA---IKRIREIQDVE  2066
             ++   +M+ LL+IG +C E D E+R+ MK+A   I+R+RE QD++
Sbjct  610   KNCKAEMLSLLKIGLSCCEEDEERRMEMKDAVEKIERLREGQDLD  654



>ref|XP_010488804.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Camelina sativa]
Length=647

 Score =   355 bits (912),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 219/624 (35%), Positives = 338/624 (54%), Gaps = 28/624 (4%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQ--NTKGLDDTWVKGKSPCDKTRRWFGV  389
             L+F S   ++  L +     +   L++FK SL      GL  +W +    C    +W GV
Sbjct  6     LVFLSIVYLV--LVVVHGASETESLLKFKNSLVIGRENGLK-SWHRRNPTC----KWIGV  58

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
             LC R  V GL+L N  L+G +D++AL+ L+ LR ++  NN   GP P+F KL  LKSL++
Sbjct  59    LCDRGFVWGLQLENFELSGYLDIEALTGLKSLRSLSFMNNKLGGPFPEFKKLVALKSLYL  118

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
               N+F  +I  D F  M  L+KL L HN F G IPASL   P+L+EL L+GN F+  +P 
Sbjct  119   SNNQFDVKIPKDAFDGMGWLKKLHLEHNKFRGEIPASLANSPKLLELRLDGNRFTGQIPE  178

Query  750   LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE  929
                +   +L+LS N L G IP  ++    K FEGN  LC +P+  +C           + 
Sbjct  179   FTHKP-HMLNLSNNALAGPIPKILSTMDPKFFEGNNGLCEKPLDTKCSSPY-------SL  230

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEV----LVVQ  1097
             +  P++  +  S M   +++ V   L V ++        N + ++K +L         +Q
Sbjct  231   SPEPKDNSKKKSSMFLYIVAAVVAALAVILIIIGVIIFLNHRRKKKQSLLTAEPGPSSLQ  290

Query  1098  I-ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLG  1274
             + A +  SE    S                   + +++G F L +L+ ASAE+LG+G  G
Sbjct  291   LRAGIQESEKGQSSYHSQNRAAKRMIHTTKLSFLRDDKGKFELQDLLKASAEILGSGCFG  350

Query  1275  SAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLV  1454
             ++YK  L   G  +VVKR K  N    + F   M+++G L H N+LP++AY+Y+K+EKL 
Sbjct  351   ASYKTLLSN-GSLMVVKRFKHMNNAGTEEFQEHMKRLGRLNHENLLPIVAYYYKKEEKLF  409

Query  1455  VSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKS  1634
             VS+F  KGSL   LHG +      L   TR  I+KGV  G+ YLH    +   PHG+LKS
Sbjct  410   VSDFVGKGSLAAHLHGHKSLGQPSLDWPTRFNIVKGVGQGLLYLHKNLPSLMAPHGHLKS  469

Query  1635  SNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILE  1805
             SN+LL   +EPLL DY   P+++     + M A K+PE     +++ K+DV+ LG++ILE
Sbjct  470   SNVLLNENFEPLLMDYGLIPMINEESAQELMVAYKSPEYLKQSRVTKKTDVWGLGVLILE  529

Query  1806  VVTGKFPSQYLSNQKGG-TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIG  1982
             ++TGK P  +  N K    D+  WV+ +       E+ D E+ G   + + +++KLL+IG
Sbjct  530   ILTGKIPESFPQNSKDSEEDLASWVKSSFRGEWTPELFDQEM-GKTNNCEAEILKLLRIG  588

Query  1983  AACTESDVEKRLSMKEAIKRIREI  2054
              +C E DVEKRL ++EA++++ ++
Sbjct  589   LSCCEVDVEKRLDIREAVEKMEDL  612



>ref|XP_008453523.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Cucumis melo]
Length=648

 Score =   355 bits (911),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 238/637 (37%), Positives = 361/637 (57%), Gaps = 52/637 (8%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDD--TWVKGKSPC-----DKTR  374
             LI  S  +I+ C   S S   D  L++FK SL+ +   D    W  G S       DK  
Sbjct  11    LIVISSEIIVSC---SASTDADA-LLKFKSSLEISSNKDALVNWGSGGSSSSPCSGDKAN  66

Query  375   RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHL  554
              W G+LC +  V GL+L NMGL G+ID+++L  +  LR ++L NN F G +PD  +L  L
Sbjct  67    -WVGILCEKGNVWGLKLENMGLKGNIDIESLEGVPHLRSLSLMNNEFEGSLPDVKRLGAL  125

Query  555   KSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFS  734
             KSL++  N FSG I  D+F+ M  L+K+ L++N   G IP SL +L RL+EL LEGN FS
Sbjct  126   KSLYLSRNHFSGNIPGDFFSSMLSLKKVHLAYNQLEGQIPWSLVELHRLLELRLEGNKFS  185

Query  735   SAVPPLAQRSLTILDLSGN-KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD  911
               +P   Q+++   ++S N +L G+IP  ++R    +F                   G +
Sbjct  186   GQIPNFQQKTIKSFNVSNNDQLHGQIPQILSRLDPSSFS------------------GIE  227

Query  912   GGGGAEAQTPENAQRHSS---------GMRWlllsivaglllvailFNKNQNEENVKTRR  1064
             G  GA  + P NA +  S          +   LL+I AG+++++     + NEE+    +
Sbjct  228   GLCGAPLKKPCNAAKVPSIGSIIMVSIAVTLALLAIGAGIVILSRCNQSSSNEEDPANGK  287

Query  1065  KDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMAS  1244
               +  E     +   A  +S +  S   + T   S+       V E+   F LS+L+ AS
Sbjct  288   SPSASE-----LDPGAGVKSPDRGSSNGSVTGKRSADSAKLSFVREDSERFDLSDLLKAS  342

Query  1245  AEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLA  1424
             AE+LG+G  GS+YKAAL   G  +VVKR K+ N + ++ F   MR++G L+H N+LPL+A
Sbjct  343   AEILGSGCFGSSYKAAL-TNGPVMVVKRFKQMNNVGREEFQEHMRRIGRLKHTNLLPLVA  401

Query  1425  YHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFAT  1604
             Y+Y+K+EKL+++++  KGSL   LHG +      L    R+KIIKGV  G+ YL++E  +
Sbjct  402   YYYKKEEKLLITDYVEKGSLAVQLHGHKAVGQPALDWPARLKIIKGVGKGLRYLYSELPS  461

Query  1605  YKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSD  1775
                PHG+LKSSN+LL   YEPLL+DY   P+V+     + M A K+PE  Q   I+ K+D
Sbjct  462   LITPHGHLKSSNVLLKANYEPLLSDYGLIPVVNQEHAHELMVAYKSPEYSQQSRITKKTD  521

Query  1776  VYCLGIVILEVVTGKFPSQYLSNQKGG--TDVVQWVRQAVADGKESEVIDPEIAGAGEDS  1949
             V+  G++ILE+++G+FP+ +L   K G   D+  WV+        + V D E+ G  + S
Sbjct  522   VWSFGLLILEILSGQFPANFLHQNKSGEEEDLASWVKSIPEKEWNTRVFDKEM-GPTKSS  580

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +G+M+KLL+I  AC ESD EKRL ++EA+++I E+++
Sbjct  581   EGEMMKLLRIAMACCESDFEKRLDLREAVEKIEEVKE  617



>gb|KDO64959.1| hypothetical protein CISIN_1g0456521mg, partial [Citrus sinensis]
Length=548

 Score =   352 bits (902),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 229/295 (78%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + VLVN ++G+FGL +LM A+AEVLGNGGLGS+YKA +   G+TVVVKR+KE++ M +DA
Sbjct  222   ELVLVNGQKGVFGLPDLMKAAAEVLGNGGLGSSYKAMM-ADGVTVVVKRMKESSAMARDA  280

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+R++G LRH N+L  LAYHYR  EKL+V E+ P GSLLYLLHGDRG +H++L    
Sbjct  281   FDTEVRRLGRLRHSNVLAPLAYHYRTDEKLLVYEYIPGGSLLYLLHGDRGPSHDELTWPA  340

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A G+ YLHTE A   LPHGNLKSSNI ++P  EPL++++ F+ +++     Q
Sbjct  341   RLKIVQGIARGIGYLHTELAHLDLPHGNLKSSNIFISPENEPLISEFGFYTMINSANLAQ  400

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  Q   ++ K DVYCLGI+ILE++TGKFPSQYL+N  GG DVV+WV  A +
Sbjct  401   ALFAYKAPEAIQSGKVTPKCDVYCLGIIILEILTGKFPSQYLTNGNGGIDVVEWVASAFS  460

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +G+ ++++DPEIA +  +S G+M +LL+IG ACT+SD E+RL M+EA++RI EIQ
Sbjct  461   EGRVTDLLDPEIA-SSTNSPGEMEQLLEIGRACTQSDPEQRLEMREAVRRIVEIQ  514


 Score =   127 bits (319),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +3

Query  552  LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGF  731
            L+++++  N+FSGEI   YF +M  LRKLW S+N F G +P SL KLP L ELHLE N F
Sbjct  2    LRAIYLDKNQFSGEIPPGYFDEMGALRKLWFSNNKFRGRLPPSLFKLPHLTELHLESNQF  61

Query  732  SSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
            +  +P   Q +L  L+LS NKL+GEIP+ + RF A +F GN  LCG+ +G +CR
Sbjct  62   NGTIPSFDQPTLVRLNLSSNKLEGEIPASLLRFNASSFSGNAGLCGKNLGVECR  115



>gb|KFK26292.1| hypothetical protein AALP_AA8G229000 [Arabis alpina]
Length=654

 Score =   355 bits (910),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/295 (58%), Positives = 225/295 (76%), Gaps = 8/295 (3%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D ++VN E+G FGL +LM A+AEVLGNG LGSAYKA +   GL+VVVKR+++ N++  + 
Sbjct  364   DIIMVNSEKGSFGLPDLMKAAAEVLGNGSLGSAYKAVMSN-GLSVVVKRIRDMNQLACEP  422

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR+ G LRH NIL  LAYHYR++EKLVVSE+ PK SLLY+LHGDRG  H++L   T
Sbjct  423   FDVEMRRFGKLRHPNILTPLAYHYRREEKLVVSEYMPKSSLLYVLHGDRGIYHSELTWPT  482

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+GVA GM++LH EFA Y+LPHGNLKSSN+LL   YEP+++DYAF PL+      Q
Sbjct  483   RLKIIQGVAHGMQFLHEEFAAYELPHGNLKSSNVLLNENYEPVISDYAFLPLLQPNNASQ  542

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K PE     Q+SHKSDVYCLGI+ILE++TGKFPSQYL+N KGGTD+VQWV+   +
Sbjct  543   ALFAFKTPEFAQNQQVSHKSDVYCLGIIILEIMTGKFPSQYLNNGKGGTDIVQWVQ---S  599

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + KE E+IDPE+      S  +M+++L++G AC  S+  +RL MKE ++RI +++
Sbjct  600   EQKEEELIDPEMVN-NTASVQQMLEMLRVGVACIASNPNERLDMKETVRRIEQVK  653


 Score =   184 bits (468),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 139/228 (61%), Gaps = 10/228 (4%)
 Frame = +3

Query  231  FCLILQCLPLSIS---VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
            F L+L C  +S S   + +   LI FK S+  TKG  ++W +G  PC    +WFG+ C +
Sbjct  9    FFLLLLCFSISPSLQNISESEPLIRFKSSVNITKGDLNSWREGTDPCGG--KWFGIYCQK  66

Query  402  K-TVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
              TV+G+ +  +GL+G IDVD L  L  L+ + L NN  SG IP F KL  LKSL +  N
Sbjct  67   GLTVSGIHVTMLGLSGTIDVDDLKALPNLKTVRLDNNLLSGRIPHFSKLTGLKSLMLSNN  126

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA-  755
             FSG+I  D+F  MT L++L+L HN F G IP+S+ +LP L ELHL+GN FS  +PP+  
Sbjct  127  SFSGKIPDDFFKDMTKLKRLFLDHNKFVGKIPSSIMQLPNLEELHLQGNRFSGQIPPMTD  186

Query  756  -QRSLTILDLSGNKLQGEIP-SGMARFGAK-AFEGNPELCGEPVGRQC  890
              + L I+DLS N L+GE+P S M R   +  FEGN  LCGE    +C
Sbjct  187  INKKLKIIDLSNNNLEGEVPKSIMDRKNLQMKFEGNGFLCGEGTDLEC  234



>ref|XP_004305762.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Fragaria vesca subsp. vesca]
Length=725

 Score =   357 bits (915),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 232/302 (77%), Gaps = 5/302 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++NEE+G+FGL++LM A+AEVLGNGG+GS+YKA +   GL VVVKR++E N M+++ 
Sbjct  374   ELVMLNEEKGVFGLTDLMKAAAEVLGNGGMGSSYKAVM-ANGLAVVVKRIREMNAMSREG  432

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR++G LRH N+L  LAYHYRK+EKL+V E+ PK SLLYLLHGDRG++H+ L    
Sbjct  433   FDAEMRRLGTLRHWNVLTPLAYHYRKEEKLLVYEYIPKSSLLYLLHGDRGSSHDQLNWPA  492

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G A GM ++H E + Y LPHG+LKSSN+L+ P YEPLL+++AF P+++ +    
Sbjct  493   RLKIIQGTARGMGFIHNECSGYDLPHGDLKSSNVLIGPDYEPLLSEFAFAPMINSSHLPH  552

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  +   +S K DV+CLG++ILE +TGKFPSQYL++ +GGTDVVQWVR A+A
Sbjct  553   ALFAYKAPEASEYGLVSPKCDVFCLGVLILETLTGKFPSQYLNHGQGGTDVVQWVRSAMA  612

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVF  2072
             + +E E++DPEI+   + S  +M KLL IGAACTE+D  +RL M EAI+RI +I  V   
Sbjct  613   ERREMELLDPEISNE-QGSISEMEKLLHIGAACTENDPRQRLDMMEAIRRIEQINAVGTS  671

Query  2073  HE  2078
              E
Sbjct  672   EE  673


 Score =   212 bits (540),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 146/226 (65%), Gaps = 8/226 (4%)
 Frame = +3

Query  216  LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
            +IF SF       PL+ S+ D   L++FK+SL N   LD +WV   +PC    +W G +C
Sbjct  18   IIFLSFS------PLTYSITDAEALLKFKQSLTNASALD-SWVPNSAPCTSGTQWAGTVC  70

Query  396  HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQG  575
                VTGLRL  MGL+G +D  +L  ++ LR +++ NN+FSG IPDF+ +  LK++++ G
Sbjct  71   FNGNVTGLRLGGMGLSGTLDFKSLIEVKSLRSMSVKNNNFSGSIPDFNVIGPLKAIYLSG  130

Query  576  NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
            N+FSGEI +D+F  M  LRK+WL  N FSG IPASL + P L  L LE N FS ++P ++
Sbjct  131  NQFSGEIPSDFFTDMDSLRKVWLDRNNFSGKIPASLAETPNLQVLRLEDNEFSGSLPDMS  190

Query  756  QRSLTILDLSGNKLQGEIPSGMA-RFGAKAFEGNPELCGEPVGRQC  890
            Q +LT+L++S NKL+GEIP  +  +F    F GN  LCG  VG++C
Sbjct  191  QVTLTVLNVSNNKLEGEIPKSLQDKFDKTVFSGNSGLCGLNVGKEC  236



>ref|XP_010467136.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Camelina sativa]
Length=647

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 218/624 (35%), Positives = 338/624 (54%), Gaps = 28/624 (4%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQ--NTKGLDDTWVKGKSPCDKTRRWFGV  389
             L+F S   ++  L +   V +   L++FK SL      GL  +W +    C    +W GV
Sbjct  6     LVFLSIVYLV--LVVVHGVSETESLLKFKNSLVIGRANGLK-SWDRRNPTC----KWTGV  58

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
             LC R  V GL+L N  L+G +D++AL+ L+ LR ++  NN   GP P+F KL  LKSL++
Sbjct  59    LCDRGFVWGLQLENFELSGTLDIEALTGLKSLRSLSFMNNKLGGPFPEFKKLVALKSLYL  118

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
               N+F  +I  D F  M  L+KL L HN F G IPASL   P+L+EL L+GN F+  +P 
Sbjct  119   SNNQFDVKIPKDAFDGMGWLKKLHLEHNKFRGEIPASLANSPKLLELRLDGNRFTGQIPE  178

Query  750   LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE  929
                +   +L+LS N L G IP  ++    K FEGN  LC +P+   C           + 
Sbjct  179   FTHKP-HMLNLSNNALAGPIPKILSTMDPKFFEGNNGLCEKPLDTNCSSPY-------SL  230

Query  930   AQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEV----LVVQ  1097
             +  P++  +  S M   +++ V   L V ++        N + ++K +L         +Q
Sbjct  231   SPEPKDNSKKKSSMFLYIVAAVVAALAVILIIIGVIICLNRRRKKKQSLLTAEPGPSSLQ  290

Query  1098  I-ASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLG  1274
             + A +  SE    S                   + +++G F L +L+ ASAE+LG+G  G
Sbjct  291   LRAGIQESEKGQSSYHSQNRAAKRMIHTTKLSFLRDDKGKFELQDLLKASAEILGSGCFG  350

Query  1275  SAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLV  1454
             ++YK  L   G  +VVKR K  N    + F   M+++G L H N+LP++AY+Y+K+EKL 
Sbjct  351   ASYKTLLSN-GSLMVVKRFKHMNNAGTEEFQEHMKRLGRLNHENLLPIVAYYYKKEEKLF  409

Query  1455  VSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKS  1634
             VS+F  KGSL   LHG +      L   TR+ I+KGV  G+ YLH    +   PHG+LKS
Sbjct  410   VSDFVGKGSLAAHLHGHKSLGQPSLDWPTRLNIVKGVGQGLLYLHKNLPSLMAPHGHLKS  469

Query  1635  SNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILE  1805
             SN+LL   +EPLL DY   P+++     + M A K+PE     +++ K+DV+ LG++ILE
Sbjct  470   SNVLLNENFEPLLMDYGLIPMINEESAQELMVAYKSPEYLKQSRVTKKTDVWGLGVLILE  529

Query  1806  VVTGKFPSQYLSNQKGG-TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIG  1982
             ++TGK P  +    K    D+  WV+ +       E+ D ++ G   + + +++KLL+IG
Sbjct  530   ILTGKIPESFPQISKDSEEDLASWVKSSFRGEWTPELFDQDM-GKTNNCEAEILKLLRIG  588

Query  1983  AACTESDVEKRLSMKEAIKRIREI  2054
              +C E DVEKRL ++EA++++ ++
Sbjct  589   LSCCEVDVEKRLDIREAVEKMEDL  612



>ref|XP_009135669.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 isoform X2 [Brassica rapa]
Length=658

 Score =   353 bits (905),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 221/617 (36%), Positives = 340/617 (55%), Gaps = 31/617 (5%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDK-TRRWFGVLCHRKTVTGLRLYNMGLAGDI  452
             D   L+ FK++L N   +  +W    +PC + +  WFGVLC    V GL+L  M L G +
Sbjct  26    DADCLLRFKDTLTNASVIS-SWDPLTAPCKRNSPNWFGVLCFTGNVWGLQLEGMDLTGKL  84

Query  453   DVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLR  632
             D++ L  ++ LR ++  NN+F+G +P   KL  L+SL++  N F+GEI AD F  M  L+
Sbjct  85    DLEPLVPIKNLRTLSFMNNNFNGAMPSVKKLVSLRSLYLSNNWFTGEIPADAFDGMNHLK  144

Query  633   KLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIP  812
             KL L++N F G IP+SL  LP L+E+ L GN F   +P    ++L +     N L+G IP
Sbjct  145   KLLLANNAFRGKIPSSLASLPMLLEVKLNGNQFQGNIPDFKPKNLKLASFENNDLEGPIP  204

Query  813   SGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsi  992
               +      +F GN  L        C   L            P  +      ++ +    
Sbjct  205   QSLRDMDPGSFAGNKAL--------CDPPLISCSAASWSIPDPPPSFTEKDKIQTMFTVA  256

Query  993   vaglllvailFNKNQNEENVKTRRK-----------DNLDEVLVVQIASMAR-SESINHs  1136
             +  +++  IL   +     ++ RR+           D +++    Q   + R +ES+N  
Sbjct  257   IVLIVIGIILLLISLVVFILQNRRRKVLSACPSAGQDRIEKYNYDQSMHVERGAESVNSY  316

Query  1137  srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTV  1316
             + R     G+    G  + + E+   F L +L+ ASAEVLG+G  G++YKA +   G T+
Sbjct  317   TSRRGGGGGAVPDQGKLLFLQEDIQRFDLQDLLRASAEVLGSGSFGASYKAGINS-GQTL  375

Query  1317  VVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLL  1496
             VVKR K  N + +D F   +R++G L H N+LPL+AY+YR++EKL+++EF P  SL   L
Sbjct  376   VVKRYKHMNNVGRDEFHEHIRRLGRLSHPNLLPLVAYYYRREEKLLIAEFMPNRSLARHL  435

Query  1497  HGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLT  1676
             H +       L   TR+KII+GVA G+ YL  E  T  +PHG+LKSSN++L  ++EPLLT
Sbjct  436   HANHSVDQPGLDWPTRLKIIQGVAKGLGYLFKELPTLTIPHGHLKSSNVVLDESFEPLLT  495

Query  1677  DYAFHPLVSGTPTLQCMFALKAPEGH---QISHKSDVYCLGIVILEVVTGKFPSQYLSN-  1844
             DYA  P+++   +   M A K+PE     QI+ K+DV+CLG++ILE++TG+FP  YL   
Sbjct  496   DYALRPVMNSEQSHNLMIAYKSPEYSLKGQITKKTDVWCLGVLILELLTGRFPENYLRQG  555

Query  1845  QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSM  2024
                   +V WV   V + K  +V D E+ G  ++   +M+ LL+IG +C E D E+R+ M
Sbjct  556   YDANMSLVTWVSNMVKEKKTGDVFDKEMTGK-KNCKAEMLSLLKIGLSCCEEDEERRMEM  614

Query  2025  KEA---IKRIREIQDVE  2066
             K+A   I+R+RE QD++
Sbjct  615   KDAVEKIERLREGQDLD  631



>ref|XP_006426704.1| hypothetical protein CICLE_v10027353mg [Citrus clementina]
 gb|ESR39944.1| hypothetical protein CICLE_v10027353mg [Citrus clementina]
Length=653

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 229/295 (78%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + VLVN ++G+FGL +LM A+AEVLGNGGLGS+YKA +   G+TVVVKR+KE++ M +DA
Sbjct  315   ELVLVNGQKGVFGLPDLMKAAAEVLGNGGLGSSYKAMM-ADGVTVVVKRMKESSAMARDA  373

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+R++G LRH N+L  LAYHYR  EKL+V E+ P GSLLYLLHGDRG +H++L    
Sbjct  374   FDTEVRRLGRLRHSNVLAPLAYHYRADEKLLVYEYIPGGSLLYLLHGDRGPSHDELTWPA  433

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A G+ YLHTE A   LPHGNLKSSNI ++P  EPL++++ F+ +++     Q
Sbjct  434   RLKIVQGIARGIGYLHTELAHLDLPHGNLKSSNIFISPENEPLISEFGFYTMINSANLAQ  493

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  Q   ++ K DVYCLGI+ILE++TGKFPSQYL+N  GG DVV+WV  A +
Sbjct  494   ALFAYKAPEAIQSGKVTPKCDVYCLGIIILEILTGKFPSQYLTNGNGGIDVVEWVASAFS  553

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +G+ ++++DPEIA +  +S G+M +LL+IG ACT+SD E+RL M+EA++RI EIQ
Sbjct  554   EGRVTDLLDPEIA-SSTNSPGEMEQLLEIGRACTQSDPEQRLEMREAVRRIVEIQ  607


 Score =   206 bits (524),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDA  464
            L++ K S  N K LD +W+   +PC      W GV+C    VTGL + ++GL+G IDVDA
Sbjct  7    LLKLKSSFTNAKALD-SWMPSTAPCRGGEEEWSGVVCSEGIVTGLYINSLGLSGKIDVDA  65

Query  465  LSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWL  644
            L+ L GLR  ++ANNSFSG  P+F +L  L+++++  N+FSGEI   YF +M  LRKLW 
Sbjct  66   LTELTGLRTFSVANNSFSGKTPEFSRLGGLRAIYLDKNQFSGEIPPGYFDEMGALRKLWF  125

Query  645  SHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA  824
            S+N F G +P SL KLP L ELHLE N F+  +P   Q +L  L+LS NKL+GEIP+ + 
Sbjct  126  SNNKFRGRLPPSLFKLPHLTELHLESNQFNGTIPSFDQPTLVRLNLSSNKLEGEIPASLL  185

Query  825  RFGAKAFEGNPELCGEPVGRQCR  893
            RF A +F GN  LCG+ +G +CR
Sbjct  186  RFNASSFSGNAGLCGKNLGVECR  208



>ref|XP_008802490.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Phoenix dactylifera]
Length=688

 Score =   353 bits (906),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/304 (58%), Positives = 223/304 (73%), Gaps = 5/304 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V+VNEE+G+FGL++LM ASAEVLGNGGLGS YKA +   GL V VKR++E N++ KDA
Sbjct  350   ELVMVNEEKGVFGLADLMKASAEVLGNGGLGSTYKAVM-ASGLAVAVKRMREMNRVGKDA  408

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F  ++R +G LRH N+L  LA+HYRK+EKLV SE+ PKGSL ++LHGDRG  H  L   T
Sbjct  409   FQEQIRLLGRLRHPNVLTPLAFHYRKEEKLVASEYVPKGSLAFILHGDRGPDHRALDWPT  468

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KII+G+A GM YLH E A   +PHGNLKS N+LL P +EPLL DY F  LV+ +    
Sbjct  469   RLKIIRGIARGMAYLHGELAALDVPHGNLKSGNVLLGPDFEPLLVDYGFLGLVTQSQASH  528

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MFA K+PE  Q   +S KSDVYCLG+VILEV+TGKFPSQYL+N KGGTDVVQW   A+A
Sbjct  529   VMFAYKSPETLQDRHVSPKSDVYCLGVVILEVLTGKFPSQYLNNTKGGTDVVQWTASAIA  588

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVF  2072
             + +E+E++DPEI G    S+  MV+LLQ+GAAC   D ++R +MKE ++ I EI  V  F
Sbjct  589   ENREAELLDPEITGGDMASEPVMVRLLQLGAACAGVDPDERPNMKEVVQFIEEIT-VGPF  647

Query  2073  HELP  2084
               LP
Sbjct  648   GPLP  651


 Score =   196 bits (498),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 136/234 (58%), Gaps = 14/234 (6%)
 Frame = +3

Query  207  TFPLIFFSFCLILQCLPLSIS---------VGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
              PL+ F F + + C   +             D + L++ K+S  N  GL      G  P
Sbjct  4    VLPLVCFLFLIAISCPSAAAQEVVAEGKAPTSDLLALLQLKDSFANAGGLSSWSANGSLP  63

Query  360  CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPD-F  536
            C    +W GV C    V GL L N+GL+G ID+DAL+ L+GLR I   NNSFSGP+P   
Sbjct  64   C----KWTGVFCTNNVVIGLNLANLGLSGKIDIDALAPLKGLRAINFNNNSFSGPLPAAL  119

Query  537  DKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHL  716
             +L  LKS+++ GN+FSG I +D FA M+ L+KLWL HN FSG +P+SL  L  L+EL L
Sbjct  120  SRLGALKSIYLAGNKFSGSIPSDLFAPMSHLKKLWLDHNDFSGPVPSSLANLAYLMELLL  179

Query  717  EGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPV  878
            + N F  A+P  + ++L   + + NKL G IP+ +A F A AF+GN  LCG P+
Sbjct  180  DDNAFEGAIPDFSSKALKTFNAANNKLSGPIPASLAHFDAAAFQGNTALCGAPL  233



>ref|XP_010424673.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK, partial [Camelina sativa]
Length=689

 Score =   351 bits (900),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 206/582 (35%), Positives = 322/582 (55%), Gaps = 23/582 (4%)
 Frame = +3

Query  336   TWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSF  515
             +W +    C    +W GVLC R  V GL+L N  L+G +D++AL+ L+ LR ++  NN  
Sbjct  87    SWDRRNPTC----KWIGVLCDRGFVWGLQLENFELSGSLDIEALTGLKSLRSLSFMNNKL  142

Query  516   SGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
              GP P+F KL  LKSL++  N+F  +I  D F  M  L+KL L HN F G IPASL   P
Sbjct  143   GGPFPEFKKLVALKSLYLSNNQFDVKIPKDAFDGMGWLKKLHLEHNKFRGEIPASLANSP  202

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             +L+EL L+GN F+  +P    +   +L+LS N L G IP  ++    K FEGN  LC +P
Sbjct  203   KLLELRLDGNRFAGQIPEFTHKP-HMLNLSNNALAGPIPKILSTMDPKFFEGNNGLCEKP  261

Query  876   VGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVK  1055
             +  +C           + +  P++  +  S M   +++ V   L V ++        N +
Sbjct  262   LDTKCSSPY-------SLSPEPKDNSKKKSSMFLYIVAAVVAALAVILIVIGVIIFLNRR  314

Query  1056  TRRKDNLDEV----LVVQI-ASMARSESINHssrrststegsssrggDFVLVNEERGMFG  1220
              ++K +L         +Q+ A +  SE    S                   + +++G F 
Sbjct  315   RKKKQSLLTAEPGPSSLQLRAGIQESEKGQSSYHSQNRAAKRMIHTTKLSFLRDDKGKFE  374

Query  1221  LSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRH  1400
             L +L+ ASAE+LG+G  G++YK  L   G  +VVKR K  N    + F   M+++G L H
Sbjct  375   LQDLLKASAEILGSGCFGASYKTLLSN-GSLMVVKRFKHMNNAGTEEFQEHMKRLGRLNH  433

Query  1401  HNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGME  1580
              N+LP++AY+Y+K+EKL VS+F  KGSL   LHG +      L   TR+ I+KGV  G+ 
Sbjct  434   ENLLPIVAYYYKKEEKLFVSDFVGKGSLAAHLHGHKSLGQPSLDWPTRLNIVKGVGQGII  493

Query  1581  YLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---G  1751
             YL+    +   PHG+LKSSN+LL+  +EPLL DY   P+++     + M A K+PE    
Sbjct  494   YLNKNLPSLMAPHGHLKSSNVLLSENFEPLLMDYGLLPMINEESAQELMVAYKSPEYLKQ  553

Query  1752  HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADGKESEVIDPEI  1928
              +++ K+DV+ LG++ILE++TGK P  +  N K    D+  WV+ +       E+ D E+
Sbjct  554   SRVTKKTDVWGLGVLILEILTGKIPESFPQNSKDSEEDLASWVKSSFRGEWTPELFDQEM  613

Query  1929  AGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              G   + + +++KLL+IG +C E DV+KRL ++EA++++ ++
Sbjct  614   -GKTNNCEAEILKLLRIGLSCCEVDVDKRLDIREAVEKMEDL  654



>ref|XP_006466144.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Citrus sinensis]
Length=676

 Score =   350 bits (899),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 228/295 (77%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + VLVN ++G+FGL +LM A+AEVLGNGGLGS+YKA +   G+TVVVKR+KE++ M +DA
Sbjct  338   ELVLVNGQKGVFGLPDLMKAAAEVLGNGGLGSSYKAMM-ADGVTVVVKRMKESSAMARDA  396

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+R++G LRH N+L  LAYHYR  EKL+V E+ P GSLLYLLHGDRG +H++L    
Sbjct  397   FDTEVRRLGRLRHSNVLAPLAYHYRTDEKLLVYEYIPGGSLLYLLHGDRGPSHDELTWPA  456

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A G+ YLHTE A   LPHGNLKSSNI ++P  EPL++++ F  +++     Q
Sbjct  457   RLKIVQGIARGIGYLHTELAHLDLPHGNLKSSNIFISPENEPLISEFGFCTMINSANLAQ  516

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA KAPE  Q   ++ K DVYCLGI+ILE++TGKFPSQYL+N  GG DVV+WV  A +
Sbjct  517   ALFAYKAPEAIQSGKVTPKCDVYCLGIIILEILTGKFPSQYLTNGNGGIDVVEWVASAFS  576

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +G+ ++++DPEIA +  +S G+M +LL+IG ACT+SD E+RL M+EA++RI EIQ
Sbjct  577   EGRVTDLLDPEIA-SSTNSPGEMEQLLEIGRACTQSDPEQRLEMREAVRRIVEIQ  630


 Score =   212 bits (539),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 144/228 (63%), Gaps = 7/228 (3%)
 Frame = +3

Query  213  PLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGV  389
            P+  FS        P++ S+ +   L++ K S  N K LD +W+   +PC      W GV
Sbjct  11   PIFLFSITF-----PVTFSMSESEALLKLKSSFTNAKALD-SWMPSTAPCRGGEEEWSGV  64

Query  390  LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
            +C +  VTGL + +MGL+G IDVDAL+ L GLR  ++ANNSFSG IP+F +L  L+++++
Sbjct  65   VCLKGIVTGLYINSMGLSGKIDVDALTELTGLRTFSVANNSFSGKIPEFSRLGGLRAIYL  124

Query  570  QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
              N+FS EI   YF +M  LRKLW S+N F G +P SL  LP L ELHLE N F+  +P 
Sbjct  125  DKNQFSSEIPPGYFDEMGALRKLWFSNNKFRGRLPPSLFNLPHLTELHLESNQFNGTIPS  184

Query  750  LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
              Q +L  L+LS NKL+GEIP+ + RF A +F GN  LCG+ +G +CR
Sbjct  185  FDQPTLVGLNLSSNKLEGEIPASLLRFNASSFSGNAGLCGKNLGVECR  232



>ref|XP_010685280.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Beta vulgaris subsp. vulgaris]
Length=668

 Score =   348 bits (894),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 224/296 (76%), Gaps = 6/296 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D  +VN+E+G+FGL++LM ASAEVLGNGG+GSAYKA +   G  V VKR++E N++ KD 
Sbjct  372   DLTMVNDEKGVFGLADLMKASAEVLGNGGMGSAYKAIM-ANGFGVAVKRMRELNRLEKDE  430

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD E+RK+  LRH N+L  LAYHYRK+EKLVV E+ PKGSL Y+LHGDRGT+H +L   T
Sbjct  431   FDVEIRKLASLRHKNVLTPLAYHYRKEEKLVVYEYVPKGSLHYILHGDRGTSHEELNWPT  490

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KIIKG+  G+ YLH++ +TY+LPHGNLKSSNI++    EPL++DY F+P+ +     Q
Sbjct  491   RLKIIKGITEGLCYLHSQLSTYELPHGNLKSSNIMINVENEPLISDYGFNPMTNPNVATQ  550

Query  1722  CMFALKAPE--GHQ--ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAV  1889
              +F  ++PE   HQ  +S K DVYCLG+VILE++TGKFPSQYL+  KGGTDVVQWV  A+
Sbjct  551   ALFGYRSPEMIQHQAKVSPKCDVYCLGVVILEILTGKFPSQYLNTTKGGTDVVQWVASAI  610

Query  1890  ADGKESEVIDPEIAGA-GEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +G+E+E++DP+I G+    S   MVK+L IG +CT+S+ +KR S+ +  +RI+ +
Sbjct  611   EEGREAELLDPDIIGSQSTSSKDNMVKMLHIGTSCTQSNCDKRPSLIQVKERIQRV  666


 Score =   232 bits (592),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 164/246 (67%), Gaps = 4/246 (2%)
 Frame = +3

Query  183  MAAVRRIPTF-PLIFFSFCLILQCLP-LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKS  356
            MA +    TF PL+  SF   +  L   + S+ D   L++FK SL  ++ L+ +W    +
Sbjct  1    MAIIIVNQTFMPLLLPSFIFFIILLSSRTQSISDAEALLKFKSSLSPSEALN-SWSPNTT  59

Query  357  PC-DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPD  533
            PC DK   W G++C +  V GLRL NMGL+G+IDV+AL+NL GLR ++  +N+F+GP+P 
Sbjct  60   PCQDKNSHWNGIVCFQGNVIGLRLKNMGLSGNIDVNALANLPGLRTLSFEDNNFTGPMPQ  119

Query  534  FDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELH  713
            F++L  LK++++  N+FSGEIS+D+F+KM  L+K+WL++N FSG IP+SL +L  L+ELH
Sbjct  120  FNRLGALKAIYLSNNKFSGEISSDFFSKMESLKKIWLANNTFSGEIPSSLAQLRNLLELH  179

Query  714  LEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
            LE N FS  +PPL Q  L  LDLS N LQG+IP  +  F A  F GNP+LCGE +G+ C 
Sbjct  180  LENNQFSGVLPPLKQPPLVSLDLSNNILQGQIPMSLLNFKASTFVGNPKLCGEIIGKDCT  239

Query  894  EDLGKD  911
              +  +
Sbjct  240  TPVANE  245



>ref|XP_010937370.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Elaeis guineensis]
Length=937

 Score =   352 bits (902),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 217/292 (74%), Gaps = 4/292 (1%)
 Frame = +3

Query  1188  VLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFD  1367
             V+VNEE+G+FGLS+LM ASAEVLGNG LGSAYKA +   GL + VKR++E N++ KD FD
Sbjct  351   VMVNEEKGVFGLSDLMKASAEVLGNGSLGSAYKAVM-ASGLALAVKRMREMNRVGKDTFD  409

Query  1368  AEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRI  1547
               MR++G LRH N+L  LA+HYRK+EKL+VSE+  KGSLLY+LHGDRG  H  L+  TR+
Sbjct  410   EHMRRLGRLRHPNVLTPLAFHYRKEEKLIVSEYVQKGSLLYILHGDRGPDHMALEWPTRL  469

Query  1548  KIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCM  1727
             KII+G+A GM YLH E A   +PHGNLKS N+LL P +EP+L DY F  L++ +     M
Sbjct  470   KIIRGIARGMAYLHVELAALDVPHGNLKSGNVLLGPDFEPMLVDYGFSGLINPSQASHVM  529

Query  1728  FALKAPEGHQISH---KSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADG  1898
             F+ K+PE  Q  H   KSDVYCLG+V+LEV+TGKFPS YL+N KGGTDVVQW   A+A+ 
Sbjct  530   FSHKSPETLQYRHVSPKSDVYCLGVVMLEVLTGKFPSHYLNNTKGGTDVVQWTASAIAEN  589

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             +E+E++DP I    + S+ KMV+LLQ+G AC + D E+R  MKE ++ I EI
Sbjct  590   REAELLDPAITAKNKASELKMVRLLQLGVACADVDPEQRPDMKEVVRLIEEI  641


 Score =   191 bits (484),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 127/199 (64%), Gaps = 5/199 (3%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDID  455
            D   L++ K+S  +  GL      G  PC+    W GV C   +++GL L ++GL+G ID
Sbjct  39   DGSALLQLKDSFTDAGGLSSWSANGGPPCN----WTGVFCTNNSISGLNLASLGLSGKID  94

Query  456  VDALSNLQGLRMIALANNSFSGPIPD-FDKLRHLKSLFIQGNRFSGEISADYFAKMTGLR  632
            +DAL++L+GLR I L NNSFSGP+P    +L  LKSL+I GN+FSG I +D FA +  L+
Sbjct  95   IDALASLKGLRSINLNNNSFSGPLPTALSRLGALKSLYISGNKFSGSIPSDVFASIRRLK  154

Query  633  KLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIP  812
            KLWL HN FSG +P+SL  L  L+EL ++ N F  A+P  + ++L   +   NKL G IP
Sbjct  155  KLWLDHNNFSGPVPSSLASLGYLIELRIDDNAFEGAIPDFSSKALRTFNAKNNKLSGPIP  214

Query  813  SGMARFGAKAFEGNPELCG  869
            + +ARF A AF+GN  LCG
Sbjct  215  ASLARFDATAFQGNAGLCG  233



>ref|XP_004510527.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Cicer arietinum]
Length=717

 Score =   344 bits (882),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/293 (57%), Positives = 219/293 (75%), Gaps = 5/293 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++NEE+G+FGLS+LM ASAEVLGNGG GS+YK  +   G+ VVVKR +E N +    
Sbjct  365   ELVMMNEEKGVFGLSDLMKASAEVLGNGGFGSSYKVVMAN-GVAVVVKRSRELNALXXXX  423

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
                  +K+G L+H NIL  LAYHYRK EKLV+SE+ P+GSLL+LLHGDRG +H++L   T
Sbjct  424   XXXXXKKLGRLKHWNILTPLAYHYRKDEKLVISEYVPRGSLLFLLHGDRGASHSELDWQT  483

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A GM+YLHTE ++  LPHGNLKSSN+LL P YEPLL DY F  +V+ +    
Sbjct  484   RLKIVQGIAKGMKYLHTELSSSDLPHGNLKSSNVLLGPDYEPLLIDYGFIHMVNPSSFSH  543

Query  1722  CMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA K PE    +QIS + DVYC G++ILE++TGKFPSQYL N KGGTDVVQWV  A+ 
Sbjct  544   TLFAYKVPEASQHNQISPRCDVYCFGVIILEILTGKFPSQYLINGKGGTDVVQWVASAIC  603

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIRE  2051
             +G+E E++DPEI+ +  +S  +M KL+ IGAACTES+V  RL M EA++RI E
Sbjct  604   EGREVELLDPEIS-SDRNSLSEMEKLIHIGAACTESNVSMRLDMMEAVRRIEE  655


 Score =   218 bits (554),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 149/237 (63%), Gaps = 9/237 (4%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFF-SFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSP  359
            MAA+     F LIF  +F +I  C     S+ +   L+  K SL N   LD+ W+    P
Sbjct  1    MAAIFHSYLFILIFIINFSMI--C-----SISESEALLSLKNSLSNADALDN-WIASTLP  52

Query  360  CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
            C +  +W GV+C+   VTGLRL  MGL G IDVDAL  L+ LR I+  NNSFSG IP+ +
Sbjct  53   CSEDDQWEGVVCYNGFVTGLRLVGMGLLGKIDVDALLELKALRTISFVNNSFSGSIPELN  112

Query  540  KLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLE  719
            ++  LK++++ GN FSG I  +YF +M  L+K+WLS+N F+G+IP+SL ++P L+ELHLE
Sbjct  113  RIGFLKAMYLSGNNFSGHIPKEYFMRMKSLKKVWLSNNQFTGDIPSSLSEVPNLIELHLE  172

Query  720  GNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             N FS  +P L   +L  L++S NKL+GE+P  + RF   +F GN  LCGE  G  C
Sbjct  173  NNQFSGNIPNLNNPALVKLNVSNNKLEGEVPESLLRFNESSFAGNSGLCGEKFGSTC  229



>ref|XP_009398949.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Musa acuminata subsp. malaccensis]
Length=649

 Score =   340 bits (872),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 220/302 (73%), Gaps = 6/302 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V++NE++G F L+++M ASAEVLGNGGLGSAYKAA+   GLTVVVKR+++ N++ K+A
Sbjct  351   ELVMINEDKGAFSLTDMMKASAEVLGNGGLGSAYKAAM-ANGLTVVVKRMRDANRIGKEA  409

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FD EMR++G LRH N+L  LAYHYRK+EKL+VSE+ P GSL Y+LHGDRG  ++ L   T
Sbjct  410   FDGEMRRIGKLRHPNVLTPLAYHYRKEEKLIVSEYVPMGSLRYVLHGDRGPNYHALDWPT  469

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI +G+A GM YLH E A+  +PHGNLKS+N+LL   +EP++TD+    LV      Q
Sbjct  470   RLKIARGMARGMAYLHAELASLDVPHGNLKSANVLLGDDFEPMITDHGLAALVGAAQASQ  529

Query  1722  CMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              MF+ + PEG Q   +S KSDVYCLGIVILE++TGKFPSQY++N KGGTDVVQW   A+A
Sbjct  530   VMFSYRTPEGTQHRLVSPKSDVYCLGIVILELITGKFPSQYINNTKGGTDVVQWAASAIA  589

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVF  2072
             + +E+E++D  I  A   S G MV+LL++GAAC + D E+R  M +    I EI D    
Sbjct  590   EKREAELLDRVI--ASHPSTGDMVRLLRVGAACVDPDPEQRPEMADVAVLIGEIADAAAV  647

Query  2073  HE  2078
              +
Sbjct  648   EQ  649


 Score =   187 bits (476),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 132/228 (58%), Gaps = 10/228 (4%)
 Frame = +3

Query  225  FSFCLILQCLPLS---------ISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRR  377
            F F L++  + L+          S+ D   L+  K+S ++      +W     PC    +
Sbjct  10   FVFYLLIHLMVLAQPAAADGTAASMTDATALLLLKDSFKDAADALSSWSSSTPPCGPPSQ  69

Query  378  WFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPD-FDKLRHL  554
            W GV+C    V GLRL N+GL+G I+VDALS+ +GLR ++L NN+ SGP+P     +R +
Sbjct  70   WLGVICLHGIVIGLRLANLGLSGTINVDALSHFKGLRSVSLNNNNLSGPLPPGLASVRTM  129

Query  555  KSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFS  734
            +S F+  NRF GEI    F+ M+ L+KLWL HN FSG IP S+    +L EL L+ N F 
Sbjct  130  RSFFLSHNRFDGEIPDAVFSSMSRLKKLWLDHNQFSGPIPTSIFNATKLTELRLDDNAFD  189

Query  735  SAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPV  878
              +P L   SL   + S N+L G IP+ +ARF A +F GNP+LCG P+
Sbjct  190  GLIPSLNLSSLKSFNASNNRLTGPIPASLARFDASSFAGNPDLCGPPL  237



>ref|XP_008659160.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Zea mays]
 gb|AFW85423.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=713

 Score =   335 bits (859),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 215/294 (73%), Gaps = 4/294 (1%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VNE +G+FGL++LM A+AEV+G+GGLGSAYKA +   G+ VVVKR ++ N+  KDA
Sbjct  352   DLVMVNESKGVFGLTDLMKAAAEVIGSGGLGSAYKAVM-ANGVAVVVKRSRDMNRATKDA  410

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F++EM+++G +RH N+LP LAYHYRK EKL+V E+ PKGSLLY+LHGDRG  +  L   T
Sbjct  411   FESEMKRLGAMRHANLLPPLAYHYRKDEKLLVYEYIPKGSLLYVLHGDRGMDYAALDWPT  470

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+K+  GVA G  +LHT  A ++ PHGNLKS+N+LL P +EPLL D+ F  L+S   +  
Sbjct  471   RLKVAVGVARGTAFLHTALAGHEAPHGNLKSANVLLAPDFEPLLVDFGFSSLISHMQSPN  530

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              +FA +APE   GH +S  +DVYCLG+V+LE++TGKFP+QYL N KGGTD+V W   A+A
Sbjct  531   SLFAYRAPECAAGHPVSAMADVYCLGVVLLELLTGKFPAQYLQNAKGGTDLVVWATSAMA  590

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             DG E ++ DP I  A + +   M +L+Q+   C E+D+EKR  MKEA+ R+ E+
Sbjct  591   DGYERDLFDPAIMAAWKFALPDMTRLMQVAVDCVETDLEKRPEMKEALVRVEEV  644


 Score =   155 bits (393),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 128/216 (59%), Gaps = 6/216 (3%)
 Frame = +3

Query  270  VGDDVVLIEFKESLQNTKGLDDTWVKGK----SPC-DKTRRWFGVLCHRKTVTGLRLYNM  434
            + D   L++ K+S  N+  L    +  K    SPC   +  W GV+C    VTGLRL  +
Sbjct  32   MNDVEALMQLKKSFTNSSSLSSWLITDKDGNRSPCAPDSHHWHGVVCSHGVVTGLRLNGL  91

Query  435  GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
             L G I+V++L++   LR I+ A+N+FSGP+P F +++ LKS+++  N+F+G I  D+F 
Sbjct  92   KLGGTIEVNSLASFPRLRSISFASNNFSGPLPAFHQIKALKSMYLSNNQFTGSIPDDFFV  151

Query  615  KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNK  794
             ++ L+KLWL+ N  SG+IPAS+ +   L+EL L+ N F+  +P +   +L  L++S N 
Sbjct  152  NLSHLKKLWLNDNQLSGSIPASISQATSLLELRLDRNAFTGELPSVPPPALKSLNVSDND  211

Query  795  LQGEIPSGMARFGAKAFEGNPELCGEPVG-RQCRED  899
            L+G +P    +F A  F GN  LC  P   + C+ +
Sbjct  212  LEGVVPEAFRKFDASRFAGNEYLCFVPTRVKPCKRE  247



>emb|CDY33451.1| BnaC01g32740D [Brassica napus]
Length=756

 Score =   335 bits (859),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 229/636 (36%), Positives = 341/636 (54%), Gaps = 59/636 (9%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVV--------LIEFKESLQNTKGLDDTWVKGKSPCD-K  368
             L F +F +I+ C  + +   +  V        L+ FK++L N   +  +W    +PC  K
Sbjct  20    LAFITFLIIVLCPAIMVMSQEHKVVPGSDADSLLRFKDTLANASVIS-SWDPSTAPCKRK  78

Query  369   TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLR  548
             +  WFGVLC    V GL+L  MGL G +D++ L+ ++ LR ++  NN+F G +P   KL 
Sbjct  79    SSNWFGVLCFAGHVWGLQLEEMGLTGKLDLEPLTPIKDLRTLSFMNNNFDGAMPSVKKLV  138

Query  549   HLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNG  728
              LKSL++  NRF+GEISAD F  M  L+KL L++N F G +P+SL  LP L+E+ L GN 
Sbjct  139   SLKSLYLSNNRFTGEISADAFDGMHHLKKLLLANNAFRGKVPSSLASLPLLLEVRLNGNQ  198

Query  729   FSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE-DLG  905
             F  A+P   Q+ L                 +A F     EG       P+    R  D G
Sbjct  199   FQGAIPDFKQKDLK----------------LASFENNDLEG-------PIPESLRNMDPG  235

Query  906   KDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEV  1085
                G       P ++    SG  W  L   +          K     +  T     +   
Sbjct  236   SFAGNKDLCDPPLSS---CSGDSWFFLDPPSTST------EKKNKSSSFYTIAIVLIVIG  286

Query  1086  LVVQIASMARS-ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN  1262
             +++ I S+ R+ ES+       T+   +       + + E+   F L +L+ ASAEVLG+
Sbjct  287   VILVIISLVRAAESVT----SYTTRRVTVQDQDKLLFLQEDIQRFDLQDLLRASAEVLGS  342

Query  1263  GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
             G  G++YKA +   G T+VVKR K  N + +D F   +R++G L H N+LPL+AY+YR++
Sbjct  343   GCFGASYKAGISS-GKTLVVKRYKHMNNVGRDEFHEHIRRLGKLSHPNLLPLVAYYYRRE  401

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+++EF P  SL   LH +       L   TR+ II+GVA G+ YL  E  T  +PHG
Sbjct  402   EKLLIAEFMPNRSLASHLHANHSVDQPGLDWPTRLNIIQGVAKGLGYLFKELPTLTIPHG  461

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE----GHQISHKSDVYCLG  1790
             +LKSSN++L   +EPLLTDYA  P+++   +   M A K+PE    GH I+ K+DV+CLG
Sbjct  462   HLKSSNVVLNKAFEPLLTDYALRPVMNSEQSHNLMIAYKSPEYSLKGH-ITKKTDVWCLG  520

Query  1791  IVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             ++ILE++TG+FP  YLS        +V WV   V + K S+V D E+ G  ++   +M+ 
Sbjct  521   VLILELITGRFPENYLSKGYDANMSLVTWVSDMVKEKKTSDVFDKEMIGK-KNCKAEMLS  579

Query  1968  LLQIGAACTESDVEKRLSMKEA---IKRIREIQDVE  2066
             LL+IG +C E D E+R+ M +A   I+R+RE  D +
Sbjct  580   LLKIGLSCCEEDEERRMEMTDAVEKIERLRESSDTD  615



>ref|XP_011012022.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Populus euphratica]
Length=737

 Score =   333 bits (854),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 224/301 (74%), Gaps = 4/301 (1%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             + V+VN E+G+FGL +LM ASAEVLGNGG+GS YKA +   G+ VVVKR +E N ++KD 
Sbjct  379   ELVIVNNEKGVFGLPDLMKASAEVLGNGGMGSLYKAQM-ANGVMVVVKRTREMNTLSKDQ  437

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAE+RK+G L H NIL  LA+ YR  EKL+V E+ PKGSLLYLLHGDRGT+H +L    
Sbjct  438   FDAEIRKLGRLNHTNILTPLAFLYRPDEKLLVYEYMPKGSLLYLLHGDRGTSHAELNWFV  497

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI++G+A G+ YLHT+ A+  LPHGNLKSSN+ L+   EPLL+++   PL+S     Q
Sbjct  498   RLKIVQGIARGLGYLHTKLASSSLPHGNLKSSNVFLSNDNEPLLSEFGHSPLISPPMLAQ  557

Query  1722  CMFALKAPEGHQ--ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
              +F  KAPE  Q  +S   DVYCLGI++LE++TGKFPSQYL+  +GGTDVVQW+  AV+D
Sbjct  558   ALFGYKAPEAAQYGVSPMCDVYCLGIIVLEILTGKFPSQYLNKARGGTDVVQWMESAVSD  617

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFH  2075
             G+E++++DPEIA +  +S G+M +LL IGAAC + + ++RL + +AI+ I+ I+  +  H
Sbjct  618   GRETDLLDPEIA-SSTNSLGQMRQLLGIGAACVKRNPQQRLDITDAIQMIQSIKLEDSNH  676

Query  2076  E  2078
             E
Sbjct  677   E  677


 Score =   233 bits (594),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 152/231 (66%), Gaps = 4/231 (2%)
 Frame = +3

Query  210  FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGV  389
            FP +F  F L      L+ SV D   L+  K+S  N   L  +W+ G  PC++   W G+
Sbjct  37   FPFLFIVFTLHFS---LTCSVSDSEALLRLKKSFTNAGALS-SWISGSVPCNRQTHWNGL  92

Query  390  LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
            LC    VTGL+L NMGL+G I+VDAL+ +QGLR ++ A NSF+G IP+ ++L HLK++++
Sbjct  93   LCFNGIVTGLQLENMGLSGTINVDALATMQGLRSLSFARNSFTGAIPELNRLGHLKAIYL  152

Query  570  QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
            +GN+FSGEI +D+F+KM  L+K+WLS N F+G IP SL +LPRL ELHLE N FS  +P 
Sbjct  153  RGNQFSGEIPSDFFSKMKSLKKVWLSDNKFTGGIPPSLAELPRLSELHLENNQFSGTIPS  212

Query  750  LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
            + Q +L   D+S N L+GEIP  +A F   +F+GN  LCG+  GR C   +
Sbjct  213  IDQPTLMSFDVSNNILEGEIPPNLAIFNYSSFDGNDHLCGDRFGRGCENTM  263



>ref|XP_004964582.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Setaria italica]
Length=696

 Score =   330 bits (847),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/295 (54%), Positives = 211/295 (72%), Gaps = 5/295 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VN  +G FGL++LM A+AEV+G+GGLGSAYKA +   G+ VVVKR ++ N+  KDA
Sbjct  345   DLVMVNNSKGAFGLADLMKAAAEVIGSGGLGSAYKAVM-ANGVAVVVKRARDMNRATKDA  403

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+AEMR++G +RH N+LP LAYHYR  EKL+V E+ PKGSLLY+LHGDRG  +  L    
Sbjct  404   FEAEMRRLGAVRHANLLPPLAYHYRSDEKLLVYEYIPKGSLLYVLHGDRGMDYAALDWPM  463

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+K+  GVA G  +LH E A +++PHGNLKS+NILL P +EPLL D+ F  L++  P+ Q
Sbjct  464   RLKVAVGVARGAAFLHAELADHEVPHGNLKSANILLAPDFEPLLADFGFSGLINHAPSTQ  523

Query  1722  -CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAV  1889
               MFA  APE   GH +S KSDVYCLG+V+LE++TGKFP+QYL N KGGTD+V W   A+
Sbjct  524   SSMFARCAPECVAGHPVSAKSDVYCLGVVLLELLTGKFPTQYLHNAKGGTDLVMWATSAM  583

Query  1890  ADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             ADG E +++DP I    + +   M +L+Q+   C E+D EKR  MKE   R+ E+
Sbjct  584   ADGFERDLLDPAIMAKWKFAQQDMTRLIQVAVDCVEADPEKRPDMKEVAARVEEV  638


 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 117/185 (63%), Gaps = 2/185 (1%)
 Frame = +3

Query  351  KSPC-DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPI  527
            KSPC   +  W GV+C    VTGLRL  + L G IDV+AL++   LR ++ A N+FSGP+
Sbjct  60   KSPCAPDSHEWHGVVCSGGRVTGLRLSGLELGGTIDVNALASFPRLRSVSFARNNFSGPL  119

Query  528  PDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVE  707
            P F +L+ LKS+++  N+FSG I   +F  ++ L+KLWL+ N  +G+IPAS+ +   L+E
Sbjct  120  PAFHQLKALKSMYLSNNQFSGSIPEGFFGNLSHLKKLWLNGNQLNGSIPASITQATSLLE  179

Query  708  LHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG-R  884
            LHL+ N F+  +PP    +L  L++SGN L+G +P    +F A  F GN  LC  P   +
Sbjct  180  LHLDRNAFTGELPPAPPPALKSLNVSGNDLEGVVPEAFRKFDASRFAGNEYLCYVPTNTK  239

Query  885  QCRED  899
            QC+ +
Sbjct  240  QCKRE  244



>ref|XP_009400107.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Musa acuminata subsp. malaccensis]
Length=657

 Score =   328 bits (842),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 215/293 (73%), Gaps = 4/293 (1%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              V+VNE +G+FGLS+LM A AEV+G+GGLGSAYKA +   G+ +VVKR+++  ++ K++F
Sbjct  316   LVMVNEGKGVFGLSDLMKAEAEVMGSGGLGSAYKAVM-ANGMALVVKRVRDMTRVGKESF  374

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
             DAEM ++G L H N+LP LAYHYRK EKL+V E  PKGSLLY+LHGDRG  H  L   TR
Sbjct  375   DAEMARLGRLTHPNVLPPLAYHYRKDEKLLVYEHIPKGSLLYVLHGDRGLDHASLDWPTR  434

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI++G+A G+ ++H      + PHGNLKS+N+LL+  +EPLL DY F PLV+       
Sbjct  435   LKIVRGIAQGLAHIHAVLPFIEAPHGNLKSANVLLSLNFEPLLVDYGFLPLVNPAQAATV  494

Query  1725  MFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M AL++PE   G  IS + DVYCLG++ILE++TGKFPSQYL+N KGGTDVV W   A+ +
Sbjct  495   MQALRSPEVLAGRPISPRCDVYCLGVLILELLTGKFPSQYLTNVKGGTDVVNWATTAIGE  554

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             G+E+EV+DP I   G+ S  +M +L+ +G  CTE+D ++RL +K+A+ RI E+
Sbjct  555   GREAEVLDPAIMSGGKSSVPEMKRLVHVGVECTEADPDRRLVLKDAVDRIEEV  607


 Score =   186 bits (472),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 133/217 (61%), Gaps = 3/217 (1%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGKS--PCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K S  N+  L  +W +G S  PCD    W GV+C    + GL L +MGL+G I+VD
Sbjct  7    LLLLKGSFTNSARLS-SWTQGSSSGPCDPKAPWDGVVCLHGVINGLHLADMGLSGSINVD  65

Query  462  ALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLW  641
            ALS+  GLR ++  +N+FSGP+P   +L  LK++++  N+FSG I  D+F  MT L+KLW
Sbjct  66   ALSHFTGLRSVSFIDNNFSGPVPALGRLHALKAIYLSRNQFSGPIPGDFFDSMTRLKKLW  125

Query  642  LSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGM  821
            L+ N F+G IPASL K   L+ELHLE N F+ ++P L   SLT  ++S NKL+G IP   
Sbjct  126  LNGNAFTGPIPASLAKATALLELHLEDNDFTGSIPALDLPSLTSFNVSNNKLEGPIPDIF  185

Query  822  ARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEA  932
             +F A +F  N +LCGE +G      +  +G G   A
Sbjct  186  TKFNASSFLVNKDLCGEQLGGSPCRKVAHNGSGRVAA  222



>ref|XP_010917473.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive leucine-rich 
repeat receptor-like protein kinase At5g20690 [Elaeis guineensis]
Length=696

 Score =   328 bits (842),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/293 (53%), Positives = 214/293 (73%), Gaps = 4/293 (1%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              V+VN+ RG+FGLS+LM A+AEVLG+GGLGS YKA +   G+ VVVKR+++ N++ K+ F
Sbjct  352   LVVVNDGRGVFGLSDLMKAAAEVLGSGGLGSCYKAVMGN-GVAVVVKRVRDMNRVGKETF  410

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
             D EMR++G L+H N+LP LAYH+RK EKL+VSEF  KGSLLYLLHGDRG  H  L   TR
Sbjct  411   DVEMRQLGRLQHPNVLPPLAYHFRKDEKLLVSEFVTKGSLLYLLHGDRGADHAALDWGTR  470

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             + I KG+A G+ YLH E  +  +PHGNLKS+N+LLT  + P+L DY F PLV+ +     
Sbjct  471   LGIAKGIARGLAYLHEELKSVDIPHGNLKSANVLLTADFNPVLVDYGFVPLVNPSTASAT  530

Query  1725  MFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             +FA K+PE      +S KSDVYCLG+++LE++TGKFPSQYL+N KGGTDVV W   A+++
Sbjct  531   LFAYKSPESLHHRHVSPKSDVYCLGVILLELLTGKFPSQYLTNAKGGTDVVLWATSAISE  590

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             G+E+E++DP I    + S  +M +LL++G  C E ++++R  + EA  +I E+
Sbjct  591   GREAELLDPAIVAGAKKSVPEMKRLLRVGVECVEPELDRRPEVAEAAAKIEEV  643


 Score =   159 bits (403),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 123/209 (59%), Gaps = 4/209 (2%)
 Frame = +3

Query  255  PLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKS--PCDKTRRWFGVLCHRK-TVTGLRL  425
            P  ++  +   L+  K+S  N   L  +W  G S  PC     W GV+C  + T+T L L
Sbjct  25   PAVVTYSEVNALLLLKQSFTNATALS-SWDSGNSSHPCKSDPGWAGVICSPEGTITNLNL  83

Query  426  YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
              MGL+G ++ DAL +L+ LR ++   NS SG +P   +L  L++ F+  N+FSG +  D
Sbjct  84   ARMGLSGRVNADALLSLKDLRSLSFDENSLSGTLPPLRQLPALRAAFLSRNQFSGSLPDD  143

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
            +F  MT L++LWL  N  +G IP SL +   L EL LE N F+ ++P LA  SL+  ++S
Sbjct  144  FFKDMTRLKRLWLHGNALAGPIPTSLSQATNLQELRLENNRFTGSLPALALPSLSSFNVS  203

Query  786  GNKLQGEIPSGMARFGAKAFEGNPELCGE  872
             N L+GEIP+  ++F + +FEGN  LCGE
Sbjct  204  NNDLEGEIPTTFSKFNSSSFEGNSRLCGE  232



>ref|XP_006656738.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like, partial [Oryza brachyantha]
Length=643

 Score =   325 bits (833),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/294 (52%), Positives = 210/294 (71%), Gaps = 4/294 (1%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VN  +G FGL++LM A+AEV+G+GGLGSAYKA +   G+ VVVKR ++ N+  KDA
Sbjct  289   DLVIVNNCKGAFGLTDLMKAAAEVIGSGGLGSAYKAVM-ANGVAVVVKRARDMNRATKDA  347

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+AEM+++G +RH N+LP LAYHYRK EKL+V E+ PKGSLLY+LHGDRG  +  L    
Sbjct  348   FEAEMKRLGAVRHANLLPPLAYHYRKDEKLLVYEYIPKGSLLYVLHGDRGVDYAALDWPM  407

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+K+  GVA G  +LHT  A +++PHGNLKS+NILL P +EPLL D+ +  L++ T +  
Sbjct  408   RLKVAVGVARGTAFLHTALAGHEVPHGNLKSANILLAPDFEPLLVDFGYSGLINHTQSAN  467

Query  1722  CMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              M A +APE   GH +  K+DVYCLG+V+LE++TGKFPSQYL N KGGTD+V W   A+A
Sbjct  468   SMIAHRAPECVAGHLVGAKADVYCLGVVLLEILTGKFPSQYLHNAKGGTDLVMWATSAIA  527

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             DG E ++ DP +  A + +   M +L+ +   C E DV+KR  MK+A  R+ E+
Sbjct  528   DGYERDLFDPAMMAAWKFALPDMTRLMHVAVDCVEMDVDKRPDMKQAAARVEEV  581


 Score =   160 bits (406),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 131/223 (59%), Gaps = 8/223 (4%)
 Frame = +3

Query  252  LPLSIS--VGDDVVLIEFKESLQNTKGLDDTWVKGK----SPCDK-TRRWFGVLCHRKTV  410
            LP +++  + D   L++ K+S  N+  L    +  K    SPC   +  W GV+C R TV
Sbjct  1    LPPAVAQDMTDAEALMQLKKSFTNSSSLSSWLITSKDGDKSPCAPGSHEWHGVVCTRGTV  60

Query  411  TGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSG  590
            TGLRL  + L G IDVDAL + + LR ++LA+N+FSG +P  D+L  LKS+F+  N+F+G
Sbjct  61   TGLRLSGLHLGGTIDVDALVSFRRLRSVSLASNNFSGDLPGVDRLTALKSMFLSDNQFTG  120

Query  591  EISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLT  770
             +  D+F+K+  L+KLWL  N  SG IPAS+ +   L+EL LE N FS  +PPL   +L 
Sbjct  121  ALPDDFFSKLNHLKKLWLDGNQLSGPIPASIAQATSLIELRLEHNAFSGELPPLPPPALK  180

Query  771  ILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG-RQCRE  896
            + D+S N L G +P    +F A  F  N  LC  P   R CR 
Sbjct  181  VFDISWNDLDGVVPEAFRKFDAGKFGSNQYLCYVPTSDRPCRR  223



>ref|XP_008792889.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Phoenix dactylifera]
Length=702

 Score =   326 bits (835),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 155/290 (53%), Positives = 211/290 (73%), Gaps = 4/290 (1%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              VLVN+ RG+FGL +LM A+AEVLG+GGLGS YKA +   G+ VVVKR+++ N++ K+ F
Sbjct  358   LVLVNDTRGVFGLPDLMKAAAEVLGSGGLGSCYKAVMGN-GVAVVVKRVRDMNRVGKETF  416

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
             D EMR++G L+H N+L  LAYH+RK EKL+ SEF  KGSLLYLLHGDRG  H  L   TR
Sbjct  417   DVEMRRLGRLQHPNVLTPLAYHFRKDEKLLASEFVTKGSLLYLLHGDRGADHAALDWGTR  476

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             ++I +G+A G+ YLH E  +  +PHGNLKSSN+LLT  ++P+L DY F PLV+ +     
Sbjct  477   LRIAQGIAQGLAYLHAELNSVDIPHGNLKSSNVLLTADFKPVLVDYGFVPLVNPSTASVT  536

Query  1725  MFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             +FA K+PE      +S KSDVYCLG+++LE++TGKFPSQYL+N KGGTDVV W   A+A+
Sbjct  537   LFAYKSPESLLHRHVSPKSDVYCLGVILLELLTGKFPSQYLTNAKGGTDVVLWATSAIAE  596

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
             G+E+E++DP I    + S  +M +LL++G  C E D ++R  +KEA  +I
Sbjct  597   GREAELLDPAIVAGAKKSVPEMKRLLRVGVECVEPDPDRRPEVKEAASKI  646


 Score =   151 bits (382),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 122/201 (61%), Gaps = 4/201 (2%)
 Frame = +3

Query  285  VLIEFKESLQNTKGLDDTWVKGKS--PCDKTRRWFGVLCHRK-TVTGLRLYNMGLAGDID  455
             L+  K+S  N   L  +W  G S  PC     W G++C R+ TVT L L  MGL+G ID
Sbjct  38   ALLLLKQSFTNATALS-SWGSGNSSHPCKSNPGWAGIICSREGTVTNLNLARMGLSGRID  96

Query  456  VDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRK  635
             DAL +L+ LR ++L  NS SG +P   +L  L+++F+  N+FSG I  D+F  MT L+K
Sbjct  97   ADALLSLKSLRSLSLDENSLSGTLPPLRQLPALRAVFLSHNQFSGSIPDDFFKGMTRLKK  156

Query  636  LWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            LWL  N  +G IP SL +   L EL LE N F+  +  +A  SL+  ++S N L+GEIP+
Sbjct  157  LWLQGNALTGPIPTSLSQATNLEELRLENNRFTGPLAAIALSSLSSFNVSNNDLEGEIPT  216

Query  816  GMARFGAKAFEGNPELCGEPV  878
             +++F + +F+GN  LCG P+
Sbjct  217  TLSKFNSSSFDGNSRLCGAPL  237



>gb|KHN16700.1| Putative LRR receptor-like serine/threonine-protein kinase RLK 
[Glycine soja]
Length=533

 Score =   320 bits (820),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 213/567 (38%), Positives = 303/567 (53%), Gaps = 46/567 (8%)
 Frame = +3

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
             MGL G IDVD+L  L  LR ++  NN F G  P+   L  LKS+++  N+FSGEI +  F
Sbjct  1     MGLKGLIDVDSLKGLPYLRTLSFMNNDFEGAWPEIQHLIGLKSIYLSNNKFSGEIPSRTF  60

Query  612   AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
               +  L+K+ LS+N F+G +P SL  LPRL+EL LEG                      N
Sbjct  61    EGLQWLKKVHLSNNHFTGAVPTSLVLLPRLIELRLEG----------------------N  98

Query  792   KLQGEIPSGMARFGAKAFE-GNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSG  968
             K  G IP   +    K+F   N EL  E   R C    G  G   +++ T          
Sbjct  99    KFNGPIPYFSSHNKLKSFSVANNELSNE---RLCG---GPLGACNSKSSTLSIVVALVVV  152

Query  969   MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASM--ARSESINHssr  1142
                +++     L  +        + EN  +    N   V  +   SM   RS S NHS R
Sbjct  153   CVAVIMIAAVVLFSLHRRRKNQVSVENPASGFGGNKGRVRELGSESMRSTRSISSNHSRR  212

Query  1143  rststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVV  1322
                              + ++R  F + EL+ ASAE+LG+G   S+YKAAL + G T+VV
Sbjct  213   GDQM---------KLSFLRDDRQRFDMQELLRASAEILGSGCFSSSYKAAL-LNGPTIVV  262

Query  1323  KRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHG  1502
             KR K+ N + K+ F   MR++G L H N+LP +AY+YRK+EKLVV+++   GSL   LHG
Sbjct  263   KRFKQMNNVGKEEFQEHMRRIGRLTHPNLLPPVAYYYRKEEKLVVTDYVQNGSLAVRLHG  322

Query  1503  DRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDY  1682
              +      L    R+KI+KG+A G+E L+ +  +   PHGNLKSSN+LLT ++EPLLTDY
Sbjct  323   HQSIGEPSLDWPIRLKIVKGIAKGLENLYKDMPSLIAPHGNLKSSNVLLTESFEPLLTDY  382

Query  1683  AFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG  1853
                P+++       M   K+PE  Q   I+ K+DV+CLGI+ILE++TGKFP+ +L   KG
Sbjct  383   GLVPVINQDLAQDIMVIYKSPEYLQQGRITKKTDVWCLGILILEILTGKFPANFLQKGKG  442

Query  1854  G-TDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKE  2030
                 +  WV   V +   ++V D E+ GA  +S+G+M KLL+I   C E DV+KR  +KE
Sbjct  443   SEVSLASWVHSVVPEQWTNDVFDQEM-GATMNSEGEMGKLLKIALNCVEGDVDKRWDLKE  501

Query  2031  AIKRIREIQDVEVFHELPFPDEIREAE  2111
             A+++I EI+  +   E  F     EA+
Sbjct  502   AVEKILEIKQRDNDQEDFFTSYASEAD  528



>ref|XP_009417809.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Musa acuminata subsp. malaccensis]
Length=710

 Score =   323 bits (827),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/294 (51%), Positives = 212/294 (72%), Gaps = 4/294 (1%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             D V+VN+ +G FGL +LM A+AEV+G+GGLGSAYKA +   G+ VVVKR+++ N++ K+A
Sbjct  381   DLVMVNDRKGAFGLPDLMKAAAEVMGSGGLGSAYKAVM-ANGVAVVVKRIRDMNRVGKEA  439

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             FDAEMR++G   H N+LP LAYHYRK EKL+V E+ PKGSL+Y+LHGDRG  ++ L   T
Sbjct  440   FDAEMRRLGCFVHPNLLPPLAYHYRKDEKLLVYEYIPKGSLMYVLHGDRGLDYSSLDWPT  499

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI +GVA G+ YLH E    + PHGNLKSSN+LL P +EPLL DY F PLV+      
Sbjct  500   RLKIARGVARGLAYLHAEQPPVEAPHGNLKSSNVLLAPDFEPLLVDYGFLPLVNPAQAPT  559

Query  1722  CMFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              M A ++PE      +  +SDVYCLG+++LE++TGKFPSQYL + +GGTDVV W   A+ 
Sbjct  560   TMQAHRSPEALADRPVDPRSDVYCLGVILLELLTGKFPSQYLDSAEGGTDVVHWATYAIG  619

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             +G+E+E++ P +    + S   M +LL++   CT+ + ++R+ ++EA++RI E+
Sbjct  620   EGREAEILGPALVAGAQSSMPDMKRLLRVAVDCTDPEPDRRIELREAVERIEEV  673


 Score =   171 bits (432),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 125/209 (60%), Gaps = 1/209 (0%)
 Frame = +3

Query  270  VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGD  449
            + D   L+  K+S  N   L        +PC+ +  W GVLC    VT L L  MGL+G 
Sbjct  56   LSDTNALLLLKDSFTNATALSSWTPTNSNPCNPSSPWRGVLCLHDIVTALHLSEMGLSGS  115

Query  450  IDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGL  629
            I+VDALS   GLR++  ANNSFSGPIP   +L  LK++++  N FS  I  D+F  MT L
Sbjct  116  INVDALSRFTGLRIVNFANNSFSGPIPPLGRLHALKAIYLSRNHFSDAIPTDFFDGMTRL  175

Query  630  RKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEI  809
            +KLWL+ N F+G IP SL K   L+EL LE N FS ++P L   SL+ L+LS N L+G I
Sbjct  176  KKLWLNDNAFTGLIPYSLSKATALLELRLEDNHFSGSIPALILPSLSSLNLSNNHLEGAI  235

Query  810  PSGMARFGAKAFEGNPELCGEPVGRQ-CR  893
            P   + F A +F GN +LCGE +  Q C+
Sbjct  236  PDVYSSFNASSFLGNKDLCGEQLDSQSCK  264



>ref|XP_002882256.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58515.1| hypothetical protein ARALYDRAFT_896266 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   317 bits (811),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 221/636 (35%), Positives = 335/636 (53%), Gaps = 32/636 (5%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTW-VKGKSP  359
             M   R++    + FF F L      L     D   L+  ++S+   +G    W +   SP
Sbjct  1     MKYKRKLSLSVVFFFVFYLAAVTSDLD---SDRRALLAVRKSV---RGRPLLWNMSASSP  54

Query  360   CDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DF  536
             C+    W GV C    VT LRL   GL G + +  + NL  L+ ++L  NS SGPIP DF
Sbjct  55    CN----WHGVTCDAGRVTALRLPGAGLFGSLPIGGIGNLTQLKTLSLRFNSVSGPIPADF  110

Query  537   DKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHL  716
               L  L+ L++QGN FSGEI +  F  +  L +L L  N FSG IP ++    RLV L+L
Sbjct  111   SNLVLLRYLYLQGNDFSGEIPSFLFT-LPNLIRLNLGENKFSGRIPDNVNSATRLVTLYL  169

Query  717   EGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
             E N  S  +P +  R L   ++S N+L G IP+ ++ +   AFEGN  LCG+P+     E
Sbjct  170   ERNQLSGPIPEITLR-LQQFNVSSNQLNGSIPNSLSTWPRTAFEGN-TLCGKPLNTCEAE  227

Query  897   DLGKDGGGGAEAQTPENAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTR  1061
                 D GG       +++ + S+G     +   ++ ++  LL++  L  K + EENV  R
Sbjct  228   SPSGDAGGPNTPPKVKDSDKLSAGAIAGIVIGCVVGLLLLLLILFCLCRKRKKEENVPAR  287

Query  1062  RKDNLDEVLVVQIASMA-RSESINHssrrststegsssrggDFVLVNEERGMFGLSELMM  1238
                N++  +    +S A   E +        +   S     D     +  G F L  L+ 
Sbjct  288   ---NVEAPVAAPTSSAAIPKERVVDVPPAKATASESGVVSKDLTFFVKSFGEFDLDGLLK  344

Query  1239  ASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPL  1418
             ASAEVLG G +GS+YKA+    GL V VKRL++     K+ F   ++ +G + H N++ L
Sbjct  345   ASAEVLGKGTVGSSYKASFD-HGLVVAVKRLRDVVVPEKE-FRERLQVLGSMSHANLVTL  402

Query  1419  LAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEF  1598
             +AY++ + EKL+V E+  +GSL  LLHG++G     L   TR  I  G A  + YLH+  
Sbjct  403   IAYYFSRDEKLLVFEYMSRGSLSALLHGNKGNGRTPLNWETRAGIAVGAARAISYLHSRD  462

Query  1599  ATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHK  1769
             AT    HGN+KSSNILL+ +YE  ++DY   P++S T     +   +APE     +IS K
Sbjct  463   ATTS--HGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQK  520

Query  1770  SDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDS  1949
             +DVY  G++ILE++TGK P+    N++ G D+ +WV+        S+V+DPE+     +S
Sbjct  521   ADVYSFGVLILELLTGKSPTHQQLNEE-GVDLPRWVQSVTDQQSPSDVLDPELTRYQPES  579

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +  +++LL+IG +CT    + R SM E  + I E+ 
Sbjct  580   NENIIRLLKIGMSCTAQFPDSRPSMAEVTRLIEEVS  615



>ref|XP_002436644.1| hypothetical protein SORBIDRAFT_10g006480 [Sorghum bicolor]
 gb|EER88011.1| hypothetical protein SORBIDRAFT_10g006480 [Sorghum bicolor]
Length=717

 Score =   315 bits (807),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 213/296 (72%), Gaps = 6/296 (2%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGS--AYKAALPVIGLTVVVKRLKETNKMNK  1355
             D V+VNE +G+FGL++LM A+AEV+G+GG G   AYKA +   G+ VVVKR ++ N+  K
Sbjct  352   DLVMVNESKGVFGLTDLMKAAAEVIGSGGGGLGSAYKAVM-ANGVAVVVKRSRDMNRTTK  410

Query  1356  DAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKA  1535
             DAF+AEM+++G +RH N+LP LAYHYRK EKL+V E+ PKGSLLY+LHGDRG  +  L  
Sbjct  411   DAFEAEMKRLGAMRHANLLPPLAYHYRKDEKLLVYEYIPKGSLLYVLHGDRGMDYAALDW  470

Query  1536  ATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPT  1715
              TR+++  GVA G  +LHT  A ++ PHGNLKSSN+LL P +EPLL D+ F  L+S   +
Sbjct  471   PTRLRVAVGVARGTAFLHTALAGHEAPHGNLKSSNVLLAPDFEPLLVDFGFSGLISHMQS  530

Query  1716  LQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQA  1886
                +FA +APE   GH +S  +DVYCLG+V+LE++TGKFPSQYL N KGGTD+V W   A
Sbjct  531   PSSLFAYRAPECVAGHPVSAMADVYCLGVVLLELLTGKFPSQYLQNAKGGTDLVMWATSA  590

Query  1887  VADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             +ADG E ++ DP +  A + +   M +L+Q+   C ++D+EKR  MKEA+ R+ E+
Sbjct  591   MADGYERDLFDPALMAAWKFALPDMTRLMQVAVDCVQTDLEKRPEMKEALARVEEV  646


 Score =   162 bits (409),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 125/207 (60%), Gaps = 7/207 (3%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWV-----KGKSPCDK-TRRWFGVLCHRKTVTGLRLYNMG  437
            D   L++ K S  N+     +W+       KSPC   +  W GV+C    VTGLRL  + 
Sbjct  31   DAEALMQLKTSFTNSS-SLSSWLITDKEGSKSPCAPGSHHWHGVVCSGGAVTGLRLNGLK  89

Query  438  LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
            L G I+V++LS+   LR I+ A N+FSGP+P F +++ LKS+F+  N+FSG I  D+FA 
Sbjct  90   LGGTIEVNSLSSFPRLRSISFARNNFSGPLPAFHQVKALKSMFLSDNQFSGSIPDDFFAS  149

Query  618  MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
            ++ L+KLWL+ N  SG+IPAS+ +   L+ELHL+ N F+  +P +   +L  L++S N L
Sbjct  150  LSHLKKLWLNGNQLSGSIPASISQATSLLELHLDRNAFTGELPAVPPPALKSLNVSDNDL  209

Query  798  QGEIPSGMARFGAKAFEGNPELCGEPV  878
            +G +P    +F A  F+GN  LC  P 
Sbjct  210  EGVVPEAFRKFNASRFDGNEYLCFVPT  236



>ref|NP_186938.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9M8T0.1|Y3288_ARATH RecName: Full=Probable inactive receptor kinase At3g02880; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26971.1|AC018363_16 putative protein kinase [Arabidopsis thaliana]
 gb|AAK50106.1|AF372969_1 AT3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|AAP21160.1| At3g02880/F13E7_17 [Arabidopsis thaliana]
 gb|ACN59311.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE73873.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=627

 Score =   307 bits (786),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 216/630 (34%), Positives = 331/630 (53%), Gaps = 41/630 (7%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTW-VKGKSPCDKTRRWFGVLC  395
             + F F   L  +   +   D   L+  + S+   +G    W +   SPC+    W GV C
Sbjct  11    VVFLFVFYLAAVTSDLE-SDRRALLAVRNSV---RGRPLLWNMSASSPCN----WHGVHC  62

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
                 VT LRL   GL G + +  + NL  L+ ++L  NS SGPIP DF  L  L+ L++Q
Sbjct  63    DAGRVTALRLPGSGLFGSLPIGGIGNLTQLKTLSLRFNSLSGPIPSDFSNLVLLRYLYLQ  122

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP--  746
             GN FSGEI +  F  +  + ++ L  N FSG IP ++    RLV L+LE N  S  +P  
Sbjct  123   GNAFSGEIPSLLFT-LPSIIRINLGENKFSGRIPDNVNSATRLVTLYLERNQLSGPIPEI  181

Query  747   --PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
               PL Q      ++S N+L G IPS ++ +   AFEGN  LCG+P+   C  +    G  
Sbjct  182   TLPLQQ-----FNVSSNQLNGSIPSSLSSWPRTAFEGN-TLCGKPLD-TCEAESPNGGDA  234

Query  921   GAEAQTPE--NAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTRRKDNLD  1079
             G     PE  ++ + S+G     +   ++ ++  LL++  L  K + EENV +R   N++
Sbjct  235   GGPNTPPEKKDSDKLSAGAIVGIVIGCVVGLLLLLLILFCLCRKRKKEENVPSR---NVE  291

Query  1080  EVLVVQIASMA-RSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVL  1256
               +    +S A   E++        +   S +   D     +  G F L  L+ ASAEVL
Sbjct  292   APVAAATSSAAIPKETVVVVPPAKATGSESGAVNKDLTFFVKSFGEFDLDGLLKASAEVL  351

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             G G +GS+YKA+    GL V VKRL++     K+ F   +  +G + H N++ L+AY++ 
Sbjct  352   GKGTVGSSYKASFEH-GLVVAVKRLRDVVVPEKE-FRERLHVLGSMSHANLVTLIAYYFS  409

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             + EKL+V E+  KGSL  +LHG++G     L   TR  I  G A  + YLH+   T    
Sbjct  410   RDEKLLVFEYMSKGSLSAILHGNKGNGRTPLNWETRAGIALGAARAISYLHSRDGTTS--  467

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCL  1787
             HGN+KSSNILL+ +YE  ++DY   P++S T     +   +APE     +IS K+DVY  
Sbjct  468   HGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEITDARKISQKADVYSF  527

Query  1788  GIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             G++ILE++TGK P+    N++ G D+ +WV+        S+V+DPE+     + +  +++
Sbjct  528   GVLILELLTGKSPTHQQLNEE-GVDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENIIR  586

Query  1968  LLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             LL+IG +CT    + R SM E  + I E+ 
Sbjct  587   LLKIGMSCTAQFPDSRPSMAEVTRLIEEVS  616



>ref|XP_004292489.1| PREDICTED: probable inactive receptor kinase At1g48480-like [Fragaria 
vesca subsp. vesca]
Length=617

 Score =   305 bits (781),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 223/645 (35%), Positives = 331/645 (51%), Gaps = 53/645 (8%)
 Frame = +3

Query  204   PTFPLIFFSFCLILQCLPLSISVGDDVV-----LIEFKESLQNTKGLDDTW-VKGKSPCD  365
             P   L F    L+  CL L+ S  DD+      L+ F+ ++    G    W V   +PC 
Sbjct  4     PPPKLAFVLVLLLTSCLGLTASTNDDLASDREALLSFRAAV---GGRSTLWNVTETNPCS  60

Query  366   KTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDK  542
                 W GV C    VT LR    GL G + +  L NL  LR ++L  N+  G IP D   
Sbjct  61    ----WSGVTCVSDRVTELRAPGWGLNGPLPL-GLGNLTQLRALSLRRNALYGQIPNDLAN  115

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             L  L SL++QGNRFSG I  ++   +  + +L LSHN FSG I     KL +LV LHLEG
Sbjct  116   LLKLDSLYLQGNRFSGPI-PEFIFGLQSMERLDLSHNNFSGQISPGFSKLSKLVSLHLEG  174

Query  723   NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
             N  + ++P L    L   ++S N+L G +P  ++ +  +AF GN +LCG+P+   C    
Sbjct  175   NQLNGSIPELDLPLLGQFNVSYNRLNGSVPGKLSGWPVEAFAGNLQLCGKPLTTACN---  231

Query  903   GKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailF-----NKNQNEENV----K  1055
                   G   Q+ +N Q     +  +++  + G L++  +F      K + E+       
Sbjct  232   ------GTGTQSSKN-QLSGGAIAGIVIGCLVGFLIIVAIFYFLCGRKKKGEQGANYVAS  284

Query  1056  TRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELM  1235
             T R     EV    + S +   SI      ++            V       +F L +L+
Sbjct  285   TSRSSQAVEVAKGSLESSSAEYSIAQKGNVNSK---------HLVFFGNAVKVFDLEDLL  335

Query  1236  MASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
              ASAEVLG G  G+AYKAAL  +G+++ VKRLKE     K+ F  +M ++G + H N++P
Sbjct  336   RASAEVLGKGTFGTAYKAALE-MGVSMAVKRLKEVIVSEKE-FKDKMDEIGHMEHVNLVP  393

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
             L AY+Y + EKL+V ++ P GSL  LLHG+RG+    L   TR  I  G A  + YLH+ 
Sbjct  394   LRAYYYSRDEKLLVYDYMPMGSLSALLHGNRGSGRTPLNWETRSGIAVGAARAITYLHSH  453

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISH  1766
               T  + HGN+KSSNILLT +YE  ++D+      S   T   +   +APE    ++I+ 
Sbjct  454   GPT--ISHGNIKSSNILLTSSYEACVSDFCLAHFASPASTPNRVSGYRAPEVTDTNKITQ  511

Query  1767  KSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGED  1946
             K+DVY  G+++LE++TGK P+Q L  ++ G D+ +WV   V +    EV D E+    ++
Sbjct  512   KADVYSFGVLLLELLTGKPPTQALMTEE-GVDLPRWVHSVVREEWTVEVFDLELLRY-QN  569

Query  1947  SDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHEL  2081
              + +MV+LLQI   CT    +KR SM E   +I E+    + H L
Sbjct  570   VEDEMVQLLQIALECTVQYPDKRPSMAEVASQIEELYSASLKHGL  614



>ref|XP_006297231.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
 gb|EOA30129.1| hypothetical protein CARUB_v10013240mg [Capsella rubella]
Length=617

 Score =   305 bits (780),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 208/624 (33%), Positives = 326/624 (52%), Gaps = 42/624 (7%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTW-VKGKSPCDKTRRWFGVLC  395
             + F F   L  +   +   D   L+  + S+   +G    W +   SPC+    W GV C
Sbjct  12    VVFLFVFYLAAVTSDLE-SDRRALVALRNSV---RGRPLLWNMSASSPCN----WHGVHC  63

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
                 VT LRL   GL G + +  + NL  L+ ++L  NS SGPIP DF  L  L+ L++Q
Sbjct  64    DAGRVTALRLPGAGLFGSLPIGGIGNLTELQTLSLRFNSLSGPIPPDFSNLVLLRYLYLQ  123

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP--  746
             GN FSGEI +  F  +  + ++ L  N  SG IP ++    RLV L+LE N  S  +P  
Sbjct  124   GNAFSGEIPSFLFT-LPNVIRINLGENKLSGRIPDNVNSAARLVTLYLERNQLSGPIPEI  182

Query  747   --PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
               PL Q      ++S N+L G IP+ ++ +   AFEGN  LCG+P+   C         G
Sbjct  183   TLPLQQ-----FNVSSNQLDGPIPNSLSAWPRTAFEGN-TLCGKPLN-LC---------G  226

Query  921   GAEA-QTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQ  1097
             GAE   TP   ++ S+ +    ++ +    ++ +L          + R+K+       V+
Sbjct  227   GAEGPNTPPGKKKDSNKLSAGAIAGIVIGCVLVLLLLLLILLCLCRKRKKEENPPARNVE  286

Query  1098  --IASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGL  1271
               +A+ A + +I   +        S     D     +  G F L  L+ ASAEVLG G +
Sbjct  287   APVAAPASTAAIPKETVAGVPPSESGVVSKDLTFFVKSFGEFNLDGLLKASAEVLGKGTV  346

Query  1272  GSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKL  1451
             GS+YKA+    GL V VKRL++     K+ F   ++ +G + H N++ L+AY++ + EKL
Sbjct  347   GSSYKASFDH-GLVVAVKRLRDVVVPEKE-FRERLQVLGSMSHPNLVTLIAYYFSRDEKL  404

Query  1452  VVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLK  1631
             +V EF  +GSL  LLHG++G+    L   TR+ +  G A  + Y+H+  AT    HGN+K
Sbjct  405   LVVEFLSRGSLSALLHGNKGSGRTPLNWETRVSVALGAAKAISYIHSRDATTS--HGNIK  462

Query  1632  SSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVIL  1802
             SSNILL+ +YE  ++DY   P++S T     +   +APE     +IS K+DVY  G++IL
Sbjct  463   SSNILLSESYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADVYSFGVLIL  522

Query  1803  EVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIG  1982
             E++TGK P+    N++ G D+ +WV+        S+V+DPE+     + +  +++LL+IG
Sbjct  523   ELLTGKSPTHQQLNEE-GVDLPRWVQSVTEQQSPSDVLDPELTRYQPEGNENIIRLLKIG  581

Query  1983  AACTESDVEKRLSMKEAIKRIREI  2054
              +CT    + R SM +  + I E+
Sbjct  582   MSCTAQYPDSRPSMADVTRLIEEV  605



>emb|CDY49655.1| BnaC09g41330D [Brassica napus]
Length=617

 Score =   304 bits (778),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 219/631 (35%), Positives = 330/631 (52%), Gaps = 46/631 (7%)
 Frame = +3

Query  207   TFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFG  386
             T  L  F F L L  +   ++  D   LI  ++ +     L   W     PC     W G
Sbjct  6     TLGLSVFFFLLSLATVTSDLA-ADRRALIALRDGVHGRPLL---WNLTAPPCT----WGG  57

Query  387   VLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSL  563
             V C    V+ LRL  +GL+G + + A+ NL  L  ++   NS +GPIP DF  L  L+ L
Sbjct  58    VQCDAGRVSALRLPGVGLSGPLPI-AIGNLTQLHTVSFRFNSLTGPIPPDFANLTLLRYL  116

Query  564   FIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAV  743
             ++QGN FSGEI +  F  +  + ++ L+ N FSG+IP ++    RL  L+LE N  +  +
Sbjct  117   YLQGNAFSGEIPSFLFT-LPNVIRINLAQNNFSGSIPVNVNSANRLATLYLEDNQLTGPI  175

Query  744   P----PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKD  911
             P    PL Q      ++S N+L G IP  ++     AFEGN  LCG+P+   C       
Sbjct  176   PEIKIPLQQ-----FNVSSNQLNGSIPDQLSGMPITAFEGN-SLCGKPLA-ACSVT----  224

Query  912   GGGGAEAQTPENAQRHSSG------MRWlllsivaglllvailFNKNQNEENVKTRRKDN  1073
              G G E      + + S+G      +  +L  I+  LLL  +   KN+ E NV++R   N
Sbjct  225   -GNGTETTGKGKSDKLSAGAIVGIVIAGVLGLILLLLLLFCLCRKKNKKENNVESR---N  280

Query  1074  LDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEV  1253
             ++    V  +S   + ++ +      +    +    D     +  G F L  L+ ASAEV
Sbjct  281   IEAAAPVPASSAKETSTVANVPPPVATPSSGAPVSKDLTFFVKSFGQFDLDGLLKASAEV  340

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LG G  GS+YKA+    GL V VKRL++     K+ F  +M+ +G + H N++ L+AY++
Sbjct  341   LGKGTFGSSYKASFDH-GLVVAVKRLRDVVVPEKE-FREKMQALGSISHVNLVTLIAYYF  398

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
              + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  G A  + YLH+  AT   
Sbjct  399   SRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRDATTS-  457

Query  1614  PHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYC  1784
              HGN+KSSNILL+ +YE  ++DY   P++S T T   +   +APE     +IS K+DVY 
Sbjct  458   -HGNIKSSNILLSESYEAKVSDYCLAPMISPTSTPNRIEGYRAPEVTDARRISQKADVYS  516

Query  1785  LGIVILEVVTGKFPS-QYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKM  1961
              G++ILE++TGK P+ Q LS +  G D+ +WV         S+V DPE+    +  +  M
Sbjct  517   FGVLILELLTGKSPTHQQLSEE--GVDLPRWVSSITEQQSTSDVFDPELTRYQDGDNENM  574

Query  1962  VKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             ++LL+IG +CT    + R SM E  + I E+
Sbjct  575   IRLLKIGISCTAQYPDSRPSMPEVTRLIEEV  605



>ref|XP_006408370.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
 gb|ESQ49823.1| hypothetical protein EUTSA_v10020304mg [Eutrema salsugineum]
Length=622

 Score =   302 bits (773),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 211/627 (34%), Positives = 328/627 (52%), Gaps = 35/627 (6%)
 Frame = +3

Query  207   TFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFG  386
             +  + FF F L L  +   +   D   L+  + S+   +G    W    SPC     W G
Sbjct  8     SLSVFFFIFFLYLAAVTSDLE-SDRQALVVLRNSV---RGRPLLWNMSASPCT----WHG  59

Query  387   VLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSL  563
             V C    VT LRL   GL G + V  + NL  L+ ++L  NS SGPIP DF  L  L+ L
Sbjct  60    VHCDAGRVTELRLPGSGLFGSLPVGGIGNLTELQTLSLRFNSLSGPIPSDFSNLVLLRYL  119

Query  564   FIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAV  743
             ++QGN FSGEI +  F  +  + ++ L  N  SG IP ++    RL  L+LE N  +  +
Sbjct  120   YLQGNSFSGEIPSFLFT-LPNIIRINLGENNLSGPIPDNVNSATRLATLYLERNQLTGPI  178

Query  744   PPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGG  923
             P +   +L   ++S N+L G IP  ++ F   AF+GN  LCG+P+   C           
Sbjct  179   PEITI-TLQQFNVSSNQLNGSIPDSLSGFPQAAFQGN-SLCGKPLN-PCDATAESPNSPP  235

Query  924   AEAQTPENAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVL  1088
               +   +++ + S+G     +   ++ ++  L ++  L  K + EENV +R   N++  +
Sbjct  236   GPSPGKKDSDKLSAGAIAGIVIACVVVLLVLLFILFCLCRKRKKEENVPSR---NIEAPV  292

Query  1089  V--VQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGN  1262
             V     A++ R  + N       +   S +   D     +  G F L  L+ ASAEVLG 
Sbjct  293   VAPTSAAAIPRETAGN----VPPAKAESGAVNKDLTFFVKSFGEFDLDGLLKASAEVLGK  348

Query  1263  GGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQ  1442
             G +GS+YKA+    GL V VKRL++     KD F   ++ +G + H N++ L+AY++ + 
Sbjct  349   GTVGSSYKASFDH-GLVVAVKRLRDVVVPEKD-FRERLQVLGSMSHANLVTLIAYYFSRD  406

Query  1443  EKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHG  1622
             EKL+V E+  +GSL  LLHG++G+    L   TR  I  G A  + YLH+  +T    HG
Sbjct  407   EKLLVFEYMSRGSLSALLHGNKGSGRTQLNWETRAGIALGAARAISYLHSRDSTTS--HG  464

Query  1623  NLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGI  1793
             N+KSSNILL+ +YE  ++DY   P++S T     +   +APE     +IS K+DVY  G+
Sbjct  465   NIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKADVYSFGV  524

Query  1794  VILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLL  1973
             +ILE++TGK P+    N++ G D+ +WV+        S+V DPE+     + +  M++LL
Sbjct  525   LILELLTGKSPTHQQLNEE-GVDLPRWVQSITDQQSPSDVFDPELTRYQSEGNENMIRLL  583

Query  1974  QIGAACTESDVEKRLSMKEAIKRIREI  2054
             +IG +CT    + R SM E  + I E+
Sbjct  584   KIGMSCTAQYPDSRPSMAEVTRLIEEV  610



>gb|KFK37686.1| hypothetical protein AALP_AA3G015500 [Arabis alpina]
Length=618

 Score =   300 bits (769),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 198/574 (34%), Positives = 312/574 (54%), Gaps = 24/574 (4%)
 Frame = +3

Query  354   SPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-  530
             SPCD    W GV C    VT LRL   GL G + +  + NL  L+ ++L  N+ SG IP 
Sbjct  50    SPCD----WHGVRCVAGRVTQLRLPGAGLFGSLPIGGIGNLTELQTLSLRFNALSGSIPS  105

Query  531   DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVEL  710
             DF  L  L++L++QGN FSGEI +  F  +  + ++ L  NGF+G IP ++    +L+ L
Sbjct  106   DFANLVVLRNLYLQGNAFSGEIPSFLFT-LPNIIRMNLGENGFTGRIPDNVNSATKLITL  164

Query  711   HLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             +LE N  + ++P +    L   ++S N+L G +P  ++ F   AFEGN  LCG P+   C
Sbjct  165   YLEKNQLTGSIPEITVL-LKQFNVSSNQLNGSVPKSLSEFPRSAFEGNSLLCGSPLN-PC  222

Query  891   REDLGKDGGGGAEAQTPENAQRHS---SGMRWlllsivaglllvailFNKNQNEENVKTR  1061
              ED+  +    +     +  +  +   +G+    +  +  LLL+ +   + + EEN   R
Sbjct  223   -EDVVVESPSSSPVGKKKKDKLSAGAIAGIVVGCVVGLLLLLLLLVCLCRRKKEENGAPR  281

Query  1062  RKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMA  1241
                N++  +VV   S A +     ++        S     D +   +  G F L  L+ A
Sbjct  282   ---NVEAPVVVAPTSSAAAVP-KETAVVVPPVTESGVVSKDLIFFVKSFGEFNLDGLLKA  337

Query  1242  SAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLL  1421
             SAEVLG G +GS+YKA+    GL V VKRL++     K+ F  +++ +G + H N++ L+
Sbjct  338   SAEVLGKGTVGSSYKASFD-HGLVVAVKRLRDVVVPEKE-FREKLQVLGSMSHANLVTLI  395

Query  1422  AYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFA  1601
             AY++ + EKL+V E+  +GSL  LLHG++G     L   TR  I  G A  + Y+H+  +
Sbjct  396   AYYFSRDEKLLVFEYMSRGSLSALLHGNKGNGRTPLNWETRAGIALGAARAISYIHSRDS  455

Query  1602  TYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKS  1772
             T    HGN+KSSNILL+ +YE  ++DY   P++S T     +   +APE     +IS K+
Sbjct  456   TTS--HGNIKSSNILLSKSYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDARKISQKA  513

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             DVY  G++ILE++TGK P+    N++ G D+ +WV+        S+V DPE+     + +
Sbjct  514   DVYSFGVLILELLTGKSPTHQQLNEE-GVDLPRWVQSITEQQTPSDVFDPELTRYQSEGN  572

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               M++LL+IG +CT    +KR SM E  + I E+
Sbjct  573   ENMIRLLKIGMSCTAQYPDKRPSMVEVTRLIEEV  606



>ref|XP_006400197.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
 gb|ESQ41650.1| hypothetical protein EUTSA_v10012966mg [Eutrema salsugineum]
Length=628

 Score =   301 bits (770),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 214/637 (34%), Positives = 336/637 (53%), Gaps = 55/637 (9%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             + FF FCL+     L     D   LI  ++ +     L   W     PC     W GV C
Sbjct  11    VFFFFFCLVAVKSDLE---ADRRALIALRDGVHGRPLL---WNLTAPPCT----WGGVQC  60

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
             +   VT LRL  +GL+G + + A+ NL  L  ++   N+ +GPIP DF  L  L+ L++Q
Sbjct  61    NAGRVTALRLPGVGLSGPLPI-AIGNLTQLETLSFRFNALTGPIPPDFANLTLLRYLYLQ  119

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP--  746
             GN FSGEI +  F  +  + ++ L+ N FSG IP ++    RL  L+L+ N  + ++P  
Sbjct  120   GNAFSGEIPSFLFT-LPSVIRINLAQNNFSGRIPDNVNSATRLATLYLQDNQLTGSIPEI  178

Query  747   --PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGG  920
               PL Q      ++S N+L G IP  ++     AFEGN  LCG+P+   C   +    G 
Sbjct  179   KIPLQQ-----FNVSSNQLNGSIPDPLSGMPKTAFEGN-SLCGKPLD-ACSVTVA---GN  228

Query  921   GAEAQTPENAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEV  1085
             G +     N+ + S+G     +    + ++   L++  L  K + E+NV++R   N++  
Sbjct  229   GTKTVGKGNSDKLSAGAIAGIVIACFVVLLLLFLILFCLCRKKKKEDNVQSR---NIEAA  285

Query  1086  LV-VQIASMARSESINHss---------rrststegsssrggDFVLVNEERGMFGLSELM  1235
              V    A++A+  ++ +++                 + +   D     +  G F L  L+
Sbjct  286   PVPTSSAAVAKESAVANAAHPVANGAPPSSENGASKTPAVSKDLTFFVKSLGEFDLDGLL  345

Query  1236  MASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILP  1415
              ASAEVLG G LGS+YKA+    GL V VKRL++     K+ F  +M+ +G L H N++ 
Sbjct  346   KASAEVLGKGTLGSSYKASFD-HGLVVAVKRLRDVVVPEKE-FREKMQVLGSLSHVNLVT  403

Query  1416  LLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTE  1595
             L+AY++ + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  G A  + YLH+ 
Sbjct  404   LIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSR  463

Query  1596  FATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISH  1766
              AT    HGN+KSSN+LL+ ++E  ++DY   P++S T T   +   +APE     +IS 
Sbjct  464   DATTS--HGNIKSSNVLLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQ  521

Query  1767  KSDVYCLGIVILEVVTGKFPS-QYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGE  1943
             K+DVY  G+++LE++TGK P+ Q L+ +  G D+ +WV         S+V DPE+     
Sbjct  522   KADVYSFGVLLLELLTGKSPTHQQLTEE--GVDLPRWVSSITEQQSPSDVFDPELTRYQA  579

Query  1944  DSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             D +  M++LL+IG +CT    + R SM E  + I E+
Sbjct  580   DGNENMIRLLKIGISCTAQYPDSRPSMPEVTRLIEEV  616



>ref|XP_010525076.1| PREDICTED: probable inactive receptor kinase At5g16590 [Tarenaya 
hassleriana]
Length=624

 Score =   298 bits (762),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 219/629 (35%), Positives = 325/629 (52%), Gaps = 50/629 (8%)
 Frame = +3

Query  222   FFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR  401
              F FCL      L     D + LI  +  +     L   W     PC     W GV C  
Sbjct  16    LFFFCLTAVTSDLE---SDRLALIALRNGVHGRPLL---WNLSAPPCT----WGGVHCDA  65

Query  402   KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGN  578
               VT LRL  +G+AG + + A+ NL  LR ++L  N  +GPIP DF  L  L+ L++QGN
Sbjct  66    NRVTELRLPGVGMAGPLPI-AIGNLTELRTLSLRLNRLTGPIPPDFANLTLLRYLYLQGN  124

Query  579   RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP----  746
              FSGEI A  F  +  L ++ L+ N FSG IP ++    RL  L+LE N  +  +P    
Sbjct  125   TFSGEIPAFLFT-LPNLIRINLAQNNFSGRIPDNVNSAARLATLYLEQNQLTGPIPDITI  183

Query  747   PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
             PL Q      ++S N+L G IP  ++     AFEGN  LCG+P+      DL      G 
Sbjct  184   PLQQ-----FNVSYNQLNGSIPDRLSVLPRNAFEGN-SLCGKPL------DLCGGSSSGG  231

Query  927   EAQT--PENAQRHSSG------MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE  1082
                T  P       SG      +   +  ++  L+++ +L  K + EEN++ RR   ++ 
Sbjct  232   GNTTLPPAGKSDKLSGGAIAGIVIACVFGLLLILVILFLLCRKRKKEENIEPRR---VEA  288

Query  1083  VLVVQIASMARSESINHs--srrststegsssrggDFVLVNEERGMFGLSELMMASAEVL  1256
              +    A++A+    +     + + S   SS+   D V   +  G F L  L+ ASAEVL
Sbjct  289   PVATSTAAVAKQTVADAPPPEKAAASEPASSAVSKDLVFFVKSYGEFDLDGLLKASAEVL  348

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             G G LGS+YKA+    G+ V VKRL++     K+ F   ++ +G   H N++ LLAY++ 
Sbjct  349   GKGTLGSSYKASFDH-GMVVAVKRLRDVVVPEKE-FRERLQMLGSFSHVNLVTLLAYYFS  406

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             + EKL+V E+ P+GSL  LLHG++G+    L   TR  I  G A  + Y+H+        
Sbjct  407   RDEKLLVYEYMPRGSLSALLHGNKGSGRTPLNWETRAGIALGAARAISYIHSRDTMTS--  464

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCL  1787
             HGN+KSSN+LL+ +YE  ++DY   PL+S       +   +APE     +IS K+DVY  
Sbjct  465   HGNIKSSNVLLSESYEAKVSDYCLAPLISPASAPNRIDGYRAPEVTDARRISQKADVYSF  524

Query  1788  GIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             G++ILE++TGK P+    N++ G D+ +WV+       +S+V DPE+     D +  M++
Sbjct  525   GVLILELLTGKSPTHQQLNEE-GVDLPRWVQSVAEQQSQSDVFDPELTRYQSDGNENMIR  583

Query  1968  LLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             LL+IG  CT    +KR SM E  + I EI
Sbjct  584   LLKIGIGCTAQYPDKRPSMAEVTRLIEEI  612



>ref|XP_006351525.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g68400-like [Solanum tuberosum]
Length=608

 Score =   297 bits (760),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 196/633 (31%), Positives = 318/633 (50%), Gaps = 64/633 (10%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGVL  392
             ++FF+  L+++      +  D   L++ ++S+ N+  LD        PC +   +W G+ 
Sbjct  5     ILFFALFLVVESAEFFPNERD--ALLQLRDSV-NSSVLDLHSHWTGPPCYNNQSKWAGIS  61

Query  393   CHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQ  572
             C    V  L L  + L G +    L ++  L  I+  NN   GP+P+   L +L+ +F  
Sbjct  62    CSNGHVNQLVLEGIQLTGSLPPTFLLHIAYLTKISFRNNLLYGPVPNLTGLIYLEFVF--  119

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
                                    LS N FSG IP    +L +L EL L+GN    ++PP 
Sbjct  120   -----------------------LSENRFSGLIPFGYTELKKLTELELQGNDLEGSIPPF  156

Query  753   AQRSLTILDLSGNKLQGEIPSG--MARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
              Q++L   ++S NKL+G IP    + RF    +E N  LCGE VG  C   +       A
Sbjct  157   DQQTLIDFNVSSNKLEGPIPETPVLKRFSKSCYENNANLCGEVVGIPC--SISPASPPKA  214

Query  927   EAQTPENAQRHSSGMRWlllsivaglllva----ilFNKNQNEENVKTRRKDNLDEVLVV  1094
              ++  +N  +  S         V  L+ +       F +++  E     ++ N+    VV
Sbjct  215   PSEKKKNGLKVWSIALIAAAVAVLVLISIMFILFRYFRRSKRMETQGEDKQGNISIENVV  274

Query  1095  QIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLG  1274
             + +  ++S                  +  D +   ++  +F + +L+ ASAEVLG G L 
Sbjct  275   KRSYWSKS-------------TEDPEKTLDLIFFEKDMSVFDMDDLLRASAEVLGKGKLS  321

Query  1275  SAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLV  1454
             + YKA L   G  V VKRLKE N ++K  F   ++ +G L+H N++ +L+++Y K+EKL+
Sbjct  322   TTYKAILES-GSVVAVKRLKEMNSLSKKEFTQLVQLLGKLKHENLVEMLSFYYSKEEKLI  380

Query  1455  VSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKS  1634
             V E+ P+G L  LLH +RG     L    RI +IK VA G+ +LH    ++K+PHGN++S
Sbjct  381   VYEYVPQGDLFGLLHENRGIGRQPLNWTARISLIKDVAKGLNFLHQSLQSHKVPHGNIRS  440

Query  1635  SNILL----TPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGI  1793
              N+L+    +  Y   LTDY F PL+    +L+ +   K+PE   G +++ K+D+YC GI
Sbjct  441   KNVLIQQDQSKNYHSKLTDYGFFPLLPSKESLRKIAVGKSPEFSQGKKLTRKADIYCFGI  500

Query  1794  VILEVVTGKFPSQYLSNQKGGT-----DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             ++LEV+TGK P +  S + G T     D+ +WVR  V +   ++++D EI    E  D +
Sbjct  501   LLLEVITGKVPGELFSPENGVTSYVDDDLSEWVRTVVNNDWSTDILDMEILAQKEGYD-E  559

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             M+KL ++   CT+   EKR  M E ++RI EI+
Sbjct  560   MLKLTELALQCTDEAPEKRPKMSEVLRRIEEIE  592



>ref|XP_002972265.1| hypothetical protein SELMODRAFT_267563 [Selaginella moellendorffii]
 gb|EFJ26351.1| hypothetical protein SELMODRAFT_267563 [Selaginella moellendorffii]
Length=580

 Score =   296 bits (758),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 193/592 (33%), Positives = 292/592 (49%), Gaps = 39/592 (7%)
 Frame = +3

Query  291   IEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALS  470
             + FK S   +  L  +W  G  PC  +  W GV C +  +  L L  + LAG +   AL+
Sbjct  1     MAFKASADVSNRLT-SWGNG-DPC--SGNWTGVKCVQGRIRYLILEGLELAGSMQ--ALT  54

Query  471   NLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSH  650
              LQ LR+++L  NS +G +PD    R+L SL++  N FSGE+     + +  L +L LS 
Sbjct  55    ALQDLRIVSLKGNSLNGTLPDLTNWRYLWSLYLHHNDFSGELPPS-LSNLVHLWRLNLSF  113

Query  651   NGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARF  830
             N FSG IP  +    RL+ L LE N FS A+P L   +LT  +++ N+L GEIP  +  F
Sbjct  114   NDFSGQIPPWINSSRRLLTLRLENNQFSGAIPDLRLVNLTEFNVANNRLSGEIPPSLRNF  173

Query  831   GAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglll  1010
                AF GNP LCG P+                E   P                       
Sbjct  174   SGTAFLGNPFLCGGPLAACTVIPATPAPSPAVENIIPATP--------------------  213

Query  1011  vailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFV  1190
                    ++  E  +TR +     ++ + +   A  +          S +   +     V
Sbjct  214   ------TSRPNEGRRTRSRLGTGAIIAIVVGDAATIDEKTDFPASQYSAQVPEAERSKLV  267

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              V+ +   F L +L+ ASAE+LG G  G+AYKA L   G  V VKRLK+     +  F+ 
Sbjct  268   FVDSKAVGFDLEDLLRASAEMLGKGSFGTAYKAVLE-DGTIVAVKRLKDITISGRKEFEQ  326

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              M  +   RH N++ L+AY+Y K+EKL+V +F P G+L  LLHG+RG     L   TR+K
Sbjct  327   HMELIAKFRHPNVVKLIAYYYAKEEKLLVYDFMPNGNLYTLLHGNRGPGRKPLDWTTRVK  386

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I  G A G+ ++H +    K+PHGN+KSSN+LL       + D+    L+  T     + 
Sbjct  387   IALGAAKGLAFIHRQPGAQKIPHGNIKSSNVLLDKDGNACIADFGLA-LLMNTAAASRLV  445

Query  1731  ALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGK  1901
               +AP   E  +IS K DVY  G+++LE++TGK P+Q  + Q    D+ +WV+  V +  
Sbjct  446   GYRAPEHAESKKISFKGDVYSFGVLLLELLTGKAPAQSHTTQGENIDLPRWVQSVVREEW  505

Query  1902  ESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              +EV D E+    ++ + +MV +LQ+G  C     + R  M + +K I +I+
Sbjct  506   TAEVFDIELMKY-KNIEEEMVAMLQVGMVCVSQSPDDRPKMSQVVKMIEDIR  556



>ref|XP_002324958.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03523.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=621

 Score =   297 bits (760),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 209/630 (33%), Positives = 320/630 (51%), Gaps = 64/630 (10%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSIS--------VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKT  371
             LIF S  +IL    L +S        V D   L+ F   + +   L   W    S C   
Sbjct  3     LIFDSLTVILVSFLLLLSHGRVDSEPVQDKQALLAFLSKVPHENRLQ--WNASASVCT--  58

Query  372   RRWFGVLC--HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDK  542
               WFG+ C  ++  V  LRL  +GL G I  + L  +  LR+++L +N  SG IP DF  
Sbjct  59    --WFGIECDANQSFVYSLRLPGVGLIGSIPPNTLGRMSQLRVLSLRSNRLSGEIPSDFSN  116

Query  543   LRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEG  722
             L  L+SL++Q N F+G+       ++T L +L LS N F+G+IP S+  L  L  L L+ 
Sbjct  117   LTLLRSLYLQNNVFTGDFPPS-LTRLTRLSRLDLSSNNFTGSIPFSVNNLTHLTGLLLQN  175

Query  723   NGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDL  902
             N F+ ++P +   +LT  ++S N L G IP  +A+F A +F GN +LCG P+        
Sbjct  176   NHFAGSLPSVNPLNLTDFNVSNNSLNGSIPQVLAKFPASSFSGNLQLCGRPLPPCNPFFP  235

Query  903   GKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE  1082
                         P ++ +                        K Q     KT +      
Sbjct  236   SPAPSPSEIPPGPPSSHK------------------------KKQRSRPAKTPKPTATAR  271

Query  1083  VLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGM--FGLSELMMASAEVL  1256
              + V+  + +  + I   S  +   +          LV  E G+  F L +L+ ASAEVL
Sbjct  272   AVAVEAGTSSSKDDITGGSAEAERNK----------LVFFEGGIYSFDLEDLLRASAEVL  321

Query  1257  GNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYR  1436
             G G +G++YKA L   G TVVVKRLK+     +D F+ +M  +G ++H N++PL AY+Y 
Sbjct  322   GKGSVGTSYKAVLEE-GTTVVVKRLKDVVVTKRD-FETQMEVLGKIKHDNVVPLRAYYYS  379

Query  1437  KQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLP  1616
             K EKL+VS+F P GSL  LLHG RG+    L    R++I    A G+ +LH      K+ 
Sbjct  380   KDEKLLVSDFMPVGSLSALLHGSRGSGRTPLDWDNRMRIAMSTARGLAHLHI---AGKVI  436

Query  1617  HGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---EGHQISHKSDVYCL  1787
             HGN+KSSNILL P  +  ++DY  +PL   +     +   +AP   E  +++ KSDVY  
Sbjct  437   HGNIKSSNILLRPDNDACVSDYGLNPLFGTSTPPSRVAGYRAPEVVETRKVTFKSDVYSF  496

Query  1788  GIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVK  1967
             G+++LE++TGK P+Q  S  + G D+ +WV+  V +   +EV D E+     + + +MV+
Sbjct  497   GVLLLELLTGKAPNQA-SLGEEGIDLPRWVQSVVREEWTAEVFDVELMRY-HNIEEEMVQ  554

Query  1968  LLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             LLQI  AC  +  ++R +M+E ++ I ++ 
Sbjct  555   LLQIAMACVSTVPDQRPAMQEVVRMIEDMN  584



>gb|EPS62777.1| hypothetical protein M569_12011, partial [Genlisea aurea]
Length=618

 Score =   295 bits (754),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 211/613 (34%), Positives = 323/613 (53%), Gaps = 37/613 (6%)
 Frame = +3

Query  273   GDDVVLIEFKESLQNTKGLDDTW-VKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGD  449
             GD   L+  + ++    G    W V    PC+    W GV+C    VT LRL    L G 
Sbjct  24    GDRAALLALRSAV---AGRTLLWNVTLSDPCN----WLGVVCENNRVTVLRLPAASLTGV  76

Query  450   IDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I  + +SNL  LR ++L  N  SG +P D  KL  L++L++QGN+F+G +    F+ +  
Sbjct  77    IPENTISNLGSLRTLSLRLNHLSGALPGDLYKLSELRNLYLQGNQFAGTLPESLFS-LHS  135

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
             L +L L+ NGFSG IP+    L  L  L LE N F+ ++P +   +L   ++S N ++G 
Sbjct  136   LVRLDLASNGFSGEIPSDFNNLTHLRTLSLENNQFNGSLPEITLPNLEQFNVSFNNVKGS  195

Query  807   IPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlll  986
             +P G+ R    AF G   LCG+P+   C   L       +E  TP +   H   +    +
Sbjct  196   VPLGLRRNPQNAFLGT-SLCGKPLDNSCPNSLQSPAKTPSE--TPNSGGEHKKKLSGGAI  252

Query  987   sivaglllvailFN------KNQNEENVKT--RRKDNLDEVLVVQIASMARSES-----I  1127
               +    ++ +L        +N+ E+N        D+L     VQ    A SE      I
Sbjct  253   GGIVIGSILLLLLFLLFILCRNRTEKNKAKAGSVDDDLPATKKVQENGKAISEPDAARPI  312

Query  1128  NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
                    ++ +  S+        N +R +F L EL+ ASAEVLG G  G+AYKA L   G
Sbjct  313   PSQINGFSAAKTDSASKKLAFFGNSQR-VFDLEELLRASAEVLGKGTFGTAYKAVLEE-G  370

Query  1308  LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLL  1487
               V VKRLKE N  +++ F  ++  +G + H N++PL AY++ K+EKL+V ++   GSL 
Sbjct  371   SVVAVKRLKEVNLSDRE-FKEKIENVGAMDHQNVVPLRAYYFSKEEKLLVYDYMQMGSLS  429

Query  1488  YLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEP  1667
              LLHG+RG     L    R  I  G A G+EYLH++ +     HGN+KSSNILL  +Y+P
Sbjct  430   ALLHGNRGVGSTPLSWKIRKTIALGAARGIEYLHSQGSNTS--HGNIKSSNILLNNSYQP  487

Query  1668  LLTDYAFHPLV-SGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQY  1835
              ++D+  + LV   T +   +   +APE     ++S ++DVY  G+++LE++TGK P+Q 
Sbjct  488   RVSDFGLNHLVGPSTASPARVAGYRAPEVTDPRRVSQQADVYSFGVILLELLTGKAPTQS  547

Query  1836  LSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKR  2015
             L+N++ G D+ +WV+  V +   SEV D E+       D +MV+LLQ+G  CT    ++R
Sbjct  548   LANEE-GVDLPRWVQSVVREEWTSEVFDIELLRYNTVED-EMVQLLQLGIDCTVRYPDQR  605

Query  2016  LSMKEAIKRIREI  2054
              ++ E  KRI E+
Sbjct  606   PAISEVAKRIEEL  618



>gb|AAA33715.1| receptor kinase [Petunia integrifolia subsp. inflata]
Length=720

 Score =   296 bits (759),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 218/659 (33%), Positives = 326/659 (49%), Gaps = 67/659 (10%)
 Frame = +3

Query  237   LILQCLPLSISVGDDVVLIEFKESLQNT--KGLD--DTWVKGKSPCDKTR-RWFGVLCHR  401
             LI+  +P + S  +   L+ FK SL  +  +G +   +W+   SPC      W GVLC+ 
Sbjct  72    LIIDHVPDAKSSSE--ALLNFKSSLSTSSPRGHEVLGSWIPSNSPCSGNNGNWLGVLCYE  129

Query  402   KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPI---PDFDKLRHLKSLFIQ  572
               V GL+L N+ L+G ID+D+L  L  LR ++  NNSF G        +   H     I 
Sbjct  130   GDVWGLQLENLDLSGVIDIDSLLPLHFLRTLSFMNNSFKGQCLIGISLEPSSHCTCPIIA  189

Query  573   GNRFSGEISADY---FAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAV  743
                 S  +   Y      + G + +   H    G +      LP++ EL LE N F+ ++
Sbjct  190   SPVRSRMMLPGYDLSQEALFGKQPIQRQHPHLPGYL------LPQVFELSLENNRFTGSI  243

Query  744   PPLAQRSLTILDLSGNKLQGEIPSGMARF------GAKAFEGNP--ELCGEPVGRQCRED  899
             P      L +L+LS N+L+G IP  ++        G K   G P    C  P       D
Sbjct  244   PHFPPNVLKVLNLSNNQLEGPIPPALSLMDPTTFSGNKGLCGKPLESACNSPSQEANNPD  303

Query  900   LGKDGGGGAEAQTP---ENAQRHSSGM--------------------RWlllsivaglll  1010
                      ++ T    ++  R S  M                    R    S       
Sbjct  304   SRNSSTISGQSSTDVIRKSPTRLSKVMLIVAVCLVVLCLLIVLILIIRRRSHSSSQNPQP  363

Query  1011  vailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFV  1190
             V   ++ N  ++N  T    + D V +    S   + S N  S  + +   +++  G   
Sbjct  364   VESNYSNNDRDQNAFTSSAPD-DHVTL----SGNSTYSNNQHSNSNKAEAPTAAVVGKLS  418

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              V ++R  F L +L+ ASAEVLG+G LGS+YKA L + G  VVVKR K+ N + K+ F  
Sbjct  419   FVRDDRPRFDLQDLLRASAEVLGSGNLGSSYKALL-MDGQAVVVKRFKQMNHVAKEDFHE  477

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MR++G L H N+LPL+AY+YRK+EKL+V ++   GSL   LHG++      L  ++R+K
Sbjct  478   HMRRLGRLTHPNLLPLVAYYYRKEEKLLVYDYASNGSLASHLHGNQSR----LDWSSRLK  533

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I+KGVA  + YLH E  +  LPHG+LKSSN+LL     P+L DY   PLV+       + 
Sbjct  534   IVKGVAKALAYLHNELPSLALPHGHLKSSNVLLDKYLNPVLMDYTLVPLVNLAQVQHLLV  593

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKG-GTDVVQWVRQAVADG  1898
             A KAPE  Q   I+ K+DV+ LGI+ILE +TGKFP+ YL+   G GT++  WV   + D 
Sbjct  594   AYKAPEYAQQGRITRKTDVWSLGILILETLTGKFPTNYLALSTGYGTELATWVDTIIRDN  653

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFH  2075
             + +   D E+    +DS G++ KL  IG AC + D++ R  +KE ++ I+ + D +  H
Sbjct  654   ESA--FDKEM-NTTKDSQGQIRKLFDIGVACCQEDLDTRWDLKEVVQSIQSLNDKDHGH  709



>ref|XP_010032718.1| PREDICTED: probable inactive receptor kinase At3g02880 [Eucalyptus 
grandis]
Length=662

 Score =   294 bits (752),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 201/593 (34%), Positives = 295/593 (50%), Gaps = 40/593 (7%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCH--RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNS  512
             W     PCD    W GV C   R+ V  LR   MGLAG I    ++NL  L+ I+  +NS
Sbjct  74    WNLSLPPCD----WTGVFCDSARQKVIELRFPAMGLAGGIPAGTIANLTQLQTISFHSNS  129

Query  513   FSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKL  692
              SGP+PD   L  L++L++Q N FSG +    FA +  L +L L+ N  SG IP + G L
Sbjct  130   LSGPLPDLASLSELRNLYLQSNSFSGGLPPSLFA-LPNLVRLNLASNKLSGEIPPAFGNL  188

Query  693   PRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGE  872
              RL  L LE N F+  +P L   +L   ++S N+L G IPS ++     AF GN  LCG 
Sbjct  189   TRLKTLFLEDNQFTGPIPDL-NLTLDQFNVSSNQLTGPIPSALSTKPPSAFAGN-SLCGP  246

Query  873   PVGRQCREDLGKDGGGGAEA--------QTPENAQRHSSGMRWlllsivaglllvailFN  1028
             P+        G    GGA A                     R            +     
Sbjct  247   PLQSCNATGNGNKLSGGAIAGIVIGSVIGLFLILLVLIILCRRKSRGGGEKPKSLESQAA  306

Query  1029  KNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEER  1208
             +    E  +TR   ++ E      A ++  +S+N S                F    +  
Sbjct  307   RGAEAEIAQTREAKSVGEPKASSAAVISGDKSVNKSLV--------------FFGKGDAV  352

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
               F L +L+ ASAEVLG G  G+ YKA L   G+TV VKRLK+ + + +  F   MR+ G
Sbjct  353   AAFDLEDLLRASAEVLGRGTFGTTYKATLET-GITVAVKRLKDLS-VGEAEFRERMRQTG  410

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              + H N++ L AY+Y K E+L+V E+ P GSL  LLHG+       L   TR  I  G A
Sbjct  411   AVEHENLVGLRAYYYNKDERLLVYEYLPIGSLSALLHGNSVVGRTPLNWDTRCDIALGAA  470

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ +LH++ A     HGN+KSSN+LLT +Y+  ++D++  P+ +       +   +APE
Sbjct  471   RGIAHLHSQDAVTS--HGNIKSSNVLLTKSYKARVSDFSLAPIANLIAAPNRIDGYRAPE  528

Query  1749  ---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
                 H++S K+DVY  G+++LE++TGK P+  L N++ G D+ +WV+  V +   +EV D
Sbjct  529   VTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEE-GVDLPRWVQSVVKEEWTAEVFD  587

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
              E+    +D +  MV+LLQ+   C     +KR  M + + +I EI    + HE
Sbjct  588   DELLRY-QDVEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEICRSSMLHE  639



>ref|XP_010502431.1| PREDICTED: probable inactive receptor kinase At3g02880 [Camelina 
sativa]
Length=629

 Score =   292 bits (748),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 208/640 (33%), Positives = 329/640 (51%), Gaps = 63/640 (10%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTW-VKGKSPCDKTRRWFGVLC  395
             + F F   L  +   +   D   L+  + S+   +G    W +   SPCD    W GV C
Sbjct  12    VVFLFVFYLAAVTSDLE-SDRRALVVLRNSV---RGRTLLWNMSAPSPCD----WHGVHC  63

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALA-NNSFSGPIP-DFDKLRHLKSLFI  569
                 VT LRL   GL G + +  + NL  L+ ++L  N++ SGPIP DF  L  L+ L++
Sbjct  64    DAGRVTALRLPGAGLFGSLPIGGIGNLTELQTLSLRFNSALSGPIPSDFSNLVLLRYLYL  123

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP-  746
             QGN FSGEI +  F  +  + ++ L  N FSG IP ++    RLV L+LE N  +  +P 
Sbjct  124   QGNAFSGEIPSFLFT-LPNVIRINLGENKFSGRIPDNVNSATRLVTLYLERNQLTGPIPE  182

Query  747   ---PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGG  917
                PL Q      ++S N+L G IPS ++ +   AFEGN  LCG+P+   C  D   + G
Sbjct  183   ITLPLQQ-----FNVSSNQLDGSIPSSLSSWPPTAFEGN-TLCGKPLN-LCGGDAAPEPG  235

Query  918   GGAEAQTPENAQRHSSG------MRWlllsivaglllvailFNKNQNEENVKTRRKDNL-  1076
                     +++ + S+G      +  ++  ++  L+L  +   + + EEN + R  +   
Sbjct  236   PNPPPPEKKDSDKLSTGAIVGIVIGCVVGLLLLLLILFCLCRKRKKKEENGQARNVEAPV  295

Query  1077  -----------DEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGL  1223
                        +   VV  A    SES                   D +   +  G F L
Sbjct  296   AAPATAAAIPKERAAVVPPAKATSSES--------------GVVSKDLIFFVKSFGEFDL  341

Query  1224  SELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHH  1403
               L+ ASAEVLG G +GS+YKA+    GL V VKRL++     K+ F   ++ +G + H 
Sbjct  342   DGLLKASAEVLGKGTVGSSYKASFDH-GLIVAVKRLRDVVVPEKE-FRERLQVLGSMSHP  399

Query  1404  NILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEY  1583
             N++ L+AY++ + EKL+V E+  +GSL  +LHG++G     L   TR+ +  G A  +++
Sbjct  400   NLVTLIAYYFSRDEKLLVFEYMSRGSLSAILHGNKGNGRTPLNWETRVGVALGAARAIKF  459

Query  1584  LHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GH  1754
             LH+  AT    HGN+KSSN+LL+ +YE  ++DY   P++S T     +   +APE     
Sbjct  460   LHSRDATTS--HGNIKSSNVLLSESYEAKVSDYGLAPIISSTSAPNRIDGYRAPEVTDAR  517

Query  1755  QISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAG  1934
             +IS K+DVY  G++ILE++TGK P+    N++ G D+ +WV+        SEV+DPE+  
Sbjct  518   KISQKADVYSFGVLILELLTGKSPTHQQLNEE-GVDLPRWVQSVTDQQSPSEVLDPELTR  576

Query  1935  AGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
                + +  +++LL+IG +CT    + R SM +  + I E+
Sbjct  577   YQPEGNENIIRLLKIGMSCTAQYPDSRPSMADVTRLIEEV  616



>gb|KFK25876.1| hypothetical protein AALP_AA8G173700 [Arabis alpina]
Length=619

 Score =   291 bits (746),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 194/585 (33%), Positives = 306/585 (52%), Gaps = 33/585 (6%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFS  518
             W     PC     W GV C+   VT LRL  +GL+G + + A+ NL  L  ++   N+ +
Sbjct  43    WNLTAPPCT----WGGVQCNSGRVTSLRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALT  97

Query  519   GPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             GPIP DF  L  L+ L++QGN FSGEI +  F  +  + ++ L+ N FSG IP ++    
Sbjct  98    GPIPPDFSNLTLLRYLYLQGNAFSGEIPSFLFTSLPNVIRINLAQNNFSGRIPDNVNSAT  157

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             RL  L+L+ N  +  +P + +  L   ++S N+L G IP  ++      FEGN  LCG+P
Sbjct  158   RLATLYLQDNQLTGPIPEI-KILLQQFNVSFNQLNGSIPDPLSGLPKAVFEGN-SLCGKP  215

Query  876   VGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVK  1055
             +     E   + G G         + + S+G    +  IV       +LF         K
Sbjct  216   L-----EACAETGNGTVITPGKGKSDKLSAG---AIAGIVIACFFGLLLFFLILFCLCRK  267

Query  1056  TRRKDNLDEVLVVQIASMARSESI---------NHssrrststegsssrggDFVLVNEER  1208
              +++DN++   +   A +A+  ++         N ++        +     D     +  
Sbjct  268   RKKQDNVESRSIEAAAPVAKESAVVGNVPTSVANGAAPVVNGGSKNPVVSKDLTFFVKSF  327

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
             G F L  L+ ASAEVLG G  GS+YKA+    GL V VKRL++     K+ F  +++ +G
Sbjct  328   GEFDLDGLLKASAEVLGKGTFGSSYKASFEH-GLVVAVKRLRDVVVPEKE-FREKLQILG  385

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              + H N++ L+AY++ + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  G A
Sbjct  386   SISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAA  445

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
               + YLH+   T    HGN+KSSNILL+ +YE  ++DY   P++S T T   +   +APE
Sbjct  446   RAISYLHSRDPTTS--HGNIKSSNILLSESYEAKVSDYGLAPMISPTSTPNRIDGYRAPE  503

Query  1749  ---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
                  +IS K+DVY  G+++LE++TGK P+    N++ G D+ +WV         S+V D
Sbjct  504   VTDARRISQKADVYSFGVLLLELLTGKSPTHQQLNEE-GVDLPRWVSSITEQQSPSDVFD  562

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             PE+     + +  M++LL+IG +CT    + R +M E  + I E+
Sbjct  563   PELTRYQAEGNENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEV  607



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score =   293 bits (749),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 197/582 (34%), Positives = 315/582 (54%), Gaps = 26/582 (4%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCHRKT--VTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNS  512
             W    S C     W G+ C  K   V+ LRL  +GL G +  + L  L  LR+++L +N 
Sbjct  55    WNSSASACT----WVGITCDDKQSYVSALRLPGVGLVGPVPPNTLGRLSQLRVLSLRSNR  110

Query  513   FSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGK  689
               GPIP DF  L  L+SL++QGN+FSGE       ++  L +L LS N F+G IP ++  
Sbjct  111   LFGPIPSDFSNLTLLRSLYLQGNQFSGEFPPG-LTRLVRLTRLDLSSNNFTGPIPFTVTN  169

Query  690   LPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCG  869
             L  L  L LE NGFS ++P ++  +L   ++S NKL G +P+ +++F   AF GN  LCG
Sbjct  170   LTHLTGLFLENNGFSGSLPSISAGNLRSFNVSNNKLNGSVPASLSKFPDSAFTGNLNLCG  229

Query  870   EPVGRQCREDLGKDGGGGAEAQTPE--NAQRHSSGMRWlllsivaglllvailFNKNQNE  1043
             +P+   C              +TP    A + S  +    +  +A    +A+        
Sbjct  230   KPLA-PCNPFFPAPA---PSPETPPVIPAHKKSKKLSTAAIVAIAVGSALALFLLLLVLL  285

Query  1044  ENVKTRRKDNLDEVLVVQIA--SMARSESINHssrrststegsssrggDFVLVNEERGMF  1217
               ++ RR+    +     +A  S+A +E+   SS+   +   + +     V  +     F
Sbjct  286   LCIRKRRRQQQAKPPKPPVAARSVAVAEAGTSSSKDDITGGSTEAERNKLVFFDGGVYSF  345

Query  1218  GLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLR  1397
              L +L+ ASAEVLG G +G++YKA L   G TVVVKRLK+   + K  F+ +M  +G ++
Sbjct  346   DLEDLLRASAEVLGKGSVGTSYKAVLEE-GTTVVVKRLKDV-VVTKREFEMQMEVLGKIK  403

Query  1398  HHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGM  1577
             H N++PL A+++ K EKL+V ++   GSL  LLHG RG+    L    R+KI    A G+
Sbjct  404   HDNVVPLRAFYFSKDEKLLVYDYMAAGSLSALLHGSRGSGRTPLDWDNRMKIALSAARGI  463

Query  1578  EYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---E  1748
              +LH    + K+ HGN+KSSNILL P ++  ++D+  +PL   +     +   +AP   E
Sbjct  464   AHLH---VSGKVVHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEVVE  520

Query  1749  GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEI  1928
               +++ KSDVY  G+++LE++TGK P+Q  S  + G D+ +WV+  V +   +EV D E+
Sbjct  521   TRKVTFKSDVYSFGVLLLELLTGKAPNQA-SLGEEGIDLPRWVQSVVREEWTAEVFDVEL  579

Query  1929  AGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
                  + + +MV+LLQI  AC  +  ++R +M+E ++ I ++
Sbjct  580   MRY-HNIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDM  620



>ref|XP_006287270.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
 gb|EOA20168.1| hypothetical protein CARUB_v10000461mg [Capsella rubella]
Length=626

 Score =   291 bits (745),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 210/636 (33%), Positives = 325/636 (51%), Gaps = 53/636 (8%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             + FF  CL+     L     D   LI  ++ +     L   W     PC     W GV C
Sbjct  11    VFFFFLCLVSVTSDLE---ADRRALIALRDGVHGRPLL---WNLTAPPCT----WGGVQC  60

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
                 VT LRL  +GL+G + + A+ NL  L  ++   N+ +GP+P DF  L  L+ L++Q
Sbjct  61    ESGRVTALRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQ  119

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP--  746
             GN FSGEI +  F  +  + ++ L+ N FSG IP ++    RL  L+LE N  +  +P  
Sbjct  120   GNAFSGEIPSFLFT-LPNIIRINLAQNNFSGRIPDNVNAATRLATLYLEDNQLTGPIPEI  178

Query  747   --PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDG-G  917
               PL Q      ++S N+L G IP  ++     AF GN  LCG+P+     E    +G G
Sbjct  179   KIPLQQ-----FNVSSNQLNGSIPDPLSGMPKNAFLGN-LLCGKPL-----EACSVNGTG  227

Query  918   GGAEAQTPENAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDE  1082
              G E        + S+G     +   +L ++   L++  L  + + EENV++R   N++ 
Sbjct  228   NGTETPVKGKKDKLSTGAIIGIVIACVLGLLLLFLILFCLCRRKKKEENVQSR---NIEA  284

Query  1083  VLVVQIASMARSESIN--------HssrrststegsssrggDFVLVNEERGMFGLSELMM  1238
               V   ++    ES +                   + +   D     +  G F L  L+ 
Sbjct  285   APVPTSSAAVAKESADVPTPVTNGAPHSSENGASKTPAVSKDLTFFVKSFGEFDLDGLLK  344

Query  1239  ASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPL  1418
             ASAEVLG G  GS+YKA+    GL V VKRL++     K+ F  +++ +G + H N++ L
Sbjct  345   ASAEVLGKGTFGSSYKASFEH-GLVVAVKRLRDVVVPEKE-FREKLQVLGSISHANLVTL  402

Query  1419  LAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEF  1598
             +AY++ + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  G A  + YLH+  
Sbjct  403   IAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAGIALGAARAISYLHSRD  462

Query  1599  ATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHK  1769
             AT    HGN+KSSNILL+ T+E  ++DY   P++S T T   +   +APE     +IS K
Sbjct  463   ATTS--HGNIKSSNILLSETFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQK  520

Query  1770  SDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDS  1949
             +DVY  G++ILE++TGK P+    +++ G D+ +WV         S+V DPE+     + 
Sbjct  521   ADVYSFGVLILELLTGKSPTHQQLHEE-GVDLPRWVSSITEQQTPSDVFDPELTRYQSEG  579

Query  1950  DGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             +  M++LL+IG +CT    + R +M E  + I E+ 
Sbjct  580   NENMIRLLKIGISCTAQYPDSRPTMPEVTRLIEEVS  615



>ref|XP_006849766.1| hypothetical protein AMTR_s00024p00252010 [Amborella trichopoda]
 gb|ERN11347.1| hypothetical protein AMTR_s00024p00252010 [Amborella trichopoda]
Length=644

 Score =   291 bits (745),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 201/296 (68%), Gaps = 5/296 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              V VN E+  F +++LM A+AE+LG G  GS+YKA +   G  VVVKRL+E     +D F
Sbjct  316   LVFVNGEKEAFRMTDLMKAAAEILGTGSFGSSYKAVMGT-GKVVVVKRLREMEGAGQDGF  374

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
             +AEMR++G LRH NI+  LAYHYR +EKL+V ++   GSLLY+LHGDRG     L   TR
Sbjct  375   EAEMRRLGRLRHRNIMAPLAYHYRMEEKLLVYDYVGNGSLLYILHGDRGPGKASLDWPTR  434

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KII+G+A GM YLH E  +  +PHG+LKSSNIL+    EPLLTD+ F PL      +Q 
Sbjct  435   LKIIRGIARGMSYLHRELISSDVPHGHLKSSNILIDSEAEPLLTDFGFAPLADPNLAVQA  494

Query  1725  MFALKAPEG---HQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             + A ++PE     Q+S KSD++  GIVILEV+TGKFPSQYL++ KGGTD+  WV  AV++
Sbjct  495   LAAYRSPEFIELRQVSPKSDIWAFGIVILEVLTGKFPSQYLNSGKGGTDLPWWVSSAVSE  554

Query  1896  GKESEVIDPEI-AGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
              K  EVIDP+I + +   S  +MV++L IG ACTE + E R  M E  +RI EI++
Sbjct  555   NKAMEVIDPDILSSSSRGSSREMVRVLHIGLACTEPNPEDRPDMWEVERRIEEIRE  610


 Score =   189 bits (480),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 140/213 (66%), Gaps = 1/213 (0%)
 Frame = +3

Query  261  SISVGDDVVLIEFKESLQNTKGLDDTWVKGKS-PCDKTRRWFGVLCHRKTVTGLRLYNMG  437
            ++S+ +   L++FK+S+++  G   +W    S PC +   W GV+C+   V+G+RL N+ 
Sbjct  30   ALSLSEAEALLKFKKSIEDPLGALSSWAPNSSDPCSRNGTWVGVVCYSGIVSGIRLGNLS  89

Query  438  LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
            LAG+IDV AL+ L GLR ++L  N  SGP+P FDKL  LKSL++  N+F+GEI   +F+ 
Sbjct  90   LAGEIDVSALAGLHGLRSVSLVRNLLSGPMPAFDKLGALKSLYLSRNQFTGEIRTAFFSN  149

Query  618  MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
            M  L+K+WL  N FSG IP SLG L  L+ELHLEGN FS  +P + Q  L   ++S N L
Sbjct  150  MNSLKKVWLDGNEFSGEIPTSLGSLNHLLELHLEGNQFSGTIPTMNQTGLKSFNVSENLL  209

Query  798  QGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
            QG++P+ +A+FG  AF GN +LCG P+   C E
Sbjct  210  QGQVPANLAKFGMGAFAGNVKLCGGPLDEVCAE  242



>ref|XP_009126125.1| PREDICTED: probable inactive receptor kinase At5g16590 [Brassica 
rapa]
 emb|CDX85498.1| BnaA02g03150D [Brassica napus]
Length=613

 Score =   287 bits (735),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 205/623 (33%), Positives = 322/623 (52%), Gaps = 40/623 (6%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             L  F F L L  +   +   D   LI  ++ +    G    W     PC     W GV C
Sbjct  9     LSVFFFLLTLAAVTSDLE-SDRRALIALRDGVH---GRPLLWNLTAPPCT----WGGVQC  60

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
             +   VT LRL  +GL+G + + A+ NL  L  ++   N+ +GP+P DF  L  L+ L++Q
Sbjct  61    NAGRVTALRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALTGPLPADFANLTLLRYLYLQ  119

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
             GN FS EI +  F  +  + ++ L+ N FSG IP ++    RL  L+LE N  +  +P +
Sbjct  120   GNAFSEEIPSFLF-DLPNVIRINLAQNNFSGQIPVNVNSATRLATLYLEDNQLTGPIPEI  178

Query  753   AQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEA  932
               + L   ++S N+L G IP  ++     AFEGN  LCG+P+        GK        
Sbjct  179   KLK-LQQFNVSSNQLNGSIPDPLSGMPKTAFEGN-SLCGKPLAACAVAGKGK--------  228

Query  933   QTPENAQRHSSGMRW-----lllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQ  1097
                  + + S+G+        +  ++   L++  L  K + E NV++R  +      V  
Sbjct  229   -----SDKLSAGVIAGIVIGCVAVLILLCLILFCLCRKKKKENNVESRNIEAAAAAPVPA  283

Query  1098  IASMARS-ESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLG  1274
               +   + E++       +S  G++    D     +  G+F L  L+ ASAEVLG G  G
Sbjct  284   AVAKETTVENVPPPVANGSSENGAAKNSKDLTFFVKSFGVFDLDGLLKASAEVLGKGAFG  343

Query  1275  SAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLV  1454
             S+YKA+    GL V VKRL++     K+ F  +++ +G + H N++ L+AY++ + EKLV
Sbjct  344   SSYKASFEH-GLVVAVKRLRDVVVPEKE-FKEKLQVLGSISHPNLVALIAYYFSRDEKLV  401

Query  1455  VSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKS  1634
             V E+  +GSL  LLHG++G+  + L   TR  I  G A  + YLH+  AT    HGN+KS
Sbjct  402   VFEYMSRGSLSALLHGNKGSGRSPLSWETRAGIALGAARAISYLHSRDATTS--HGNIKS  459

Query  1635  SNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILE  1805
              NILL+ +YE  ++DY   P++S T T   +   +APE     +IS K+DVY  G++ILE
Sbjct  460   CNILLSESYEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARRISQKADVYSFGVLILE  519

Query  1806  VVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGA  1985
             ++TGK P+    N++ G D+ +WV         S+V DPE+     + +  M++LL+IG 
Sbjct  520   LLTGKSPTHQQLNEE-GVDLPRWVSSITEQQSPSDVFDPELTRYQAEGNENMIRLLKIGI  578

Query  1986  ACTESDVEKRLSMKEAIKRIREI  2054
             +CT    + R SM E  + I E+
Sbjct  579   SCTAQYPDSRPSMAEVTRLIEEV  601



>gb|KHG20593.1| putative inactive receptor kinase -like protein [Gossypium arboreum]
Length=606

 Score =   286 bits (733),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 207/580 (36%), Positives = 309/580 (53%), Gaps = 32/580 (6%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFS  518
             W    SPC     W GV C +  V  LRL  MGL+G + + A+ NL  L+ ++L  N+ S
Sbjct  43    WNLSSSPCS----WTGVNCVQNRVVELRLPGMGLSGQLPI-AIGNLTQLQTLSLRFNALS  97

Query  519   GPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             G IP DF KL  L++L++QGN FSG+I    F  +  L +L L++N FSG IP S+    
Sbjct  98    GSIPSDFAKLTTLRNLYLQGNGFSGQIPGFLFT-LQNLIRLNLANNNFSGTIPESVNNST  156

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             RL  L LE N  S ++P +   SL  L++S N+L G IP G++     AF+GN  LCG+P
Sbjct  157   RLGTLFLENNHLSGSIPDIELPSLVQLNVSFNQLNGSIPKGLSGKPKSAFQGN-SLCGKP  215

Query  876   -VGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENV  1052
              V     E  G    GGA A           G+    +  V  +L++ I   + +  +  
Sbjct  216   LVSCDGTESSGSKLSGGAIA-----------GIVVGCVLGVLLVLILLICLCRRKGGKKT  264

Query  1053  KTRRKDNLDEVLVVQIASMARSESINH---ssrrststegsssrggDFVLVNEERGMFGL  1223
             +TR         +   A  A  ES N    +       +  SS     V       +F L
Sbjct  265   ETREIAPAKLAEIEIPADKAAGESDNRNGGALSGVVKNDAKSSGNKKLVFFGNAPRVFDL  324

Query  1224  SELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHH  1403
              +L+ ASAEVLG G  G+AYKA L  +G+ V VKRLK+     K+ F  +M  +G + H 
Sbjct  325   EDLLRASAEVLGKGTFGTAYKATLD-MGVVVAVKRLKDVVVSEKE-FKEKMEVVGAMDHQ  382

Query  1404  NILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEY  1583
             N++PL A+++   EKL+V ++   GSL  LLHG++G     L   TR  I  G A G+ Y
Sbjct  383   NLVPLRAHYFSADEKLLVYDYMSTGSLSALLHGNKGAGRTPLNWDTRSSIALGAAKGIAY  442

Query  1584  LHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAP---EGH  1754
             LH++     + HGN+KSSNILLT +YE  ++D+    L   T T   +   +AP   +  
Sbjct  443   LHSKGP--GISHGNIKSSNILLTTSYEARVSDFGLAQLSGPTSTPNRVDGYRAPDVTDAR  500

Query  1755  QISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAG  1934
             ++S K+DVY  G+++LE++TGK P+  L+N++ G D+ +WV+  V +   +EV D E+  
Sbjct  501   KVSQKADVYSFGVLLLELLTGKAPTHALTNEE-GVDLPRWVQSVVREEWTAEVFDLELLR  559

Query  1935  AGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               ++ +  MV+LLQ+   CT    +KR +M E  ++I E+
Sbjct  560   Y-QNVEEDMVQLLQLANNCTAQYPDKRPAMDEVTRQIEEL  598



>ref|XP_010317542.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g68400 [Solanum lycopersicum]
Length=608

 Score =   285 bits (730),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 191/640 (30%), Positives = 320/640 (50%), Gaps = 78/640 (12%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTK-GLDDTWVKGKSPCDKTR-RWFGV  389
             ++FF+  L+++      +  D   L++ ++S+ ++   L   W     PC   + +W G+
Sbjct  5     ILFFALFLVVESAEFFPNERD--ALLQLRDSVNSSVVDLHSHWTG--PPCYYNQSKWAGI  60

Query  390   LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
              C    V  L L  + L G +    L ++  L  I+  NN F GP+P+   L  L+ +F+
Sbjct  61    SCSDGHVNQLVLEGIQLTGSLPPTFLLHITYLTKISFRNNLFYGPVPNLTGLIDLEFVFL  120

Query  570   QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
               NRFS                         G IP    +L +L +L L+GN    ++PP
Sbjct  121   SDNRFS-------------------------GLIPFGYVELKKLTDLELQGNELEGSIPP  155

Query  750   LAQRSLTILDLSGNKLQGEIPSG--MARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGG  923
               Q+SL   ++S NKL+G IP    + RF   ++E N  L        C E +G      
Sbjct  156   FNQQSLIGFNVSSNKLEGPIPETPVLKRFSKSSYENNANL--------CGEVVGIPCSIS  207

Query  924   AEAQTPENAQRHSSGMR-Wlllsivaglllvail---------FNKNQNEENVKTRRKDN  1073
               +     +++  +G++ W +  I A + ++ ++         F +++ +      ++ N
Sbjct  208   PASPPKAPSEKKKNGLKVWSIALIAAAVTVLVLVSIMFIFFRYFRRSKRKGTQGEDKQGN  267

Query  1074  LDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEV  1253
             +    VV+ +  ++S                  +  D +   ++  +F + +L+ ASAEV
Sbjct  268   ISIENVVKRSYWSKS-------------TEDPEKTLDLIFFEKDMSVFDMDDLLRASAEV  314

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LG G L + YKA L   G  V VKRLKE N ++K  F  +++ +G L+H N++ +++++Y
Sbjct  315   LGKGKLSTTYKAILES-GSVVAVKRLKEMNSLSKKEFTQQIQLLGKLKHENLVEMMSFYY  373

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKL  1613
              K EKL+V E+ P+G L  LLH +RG     L    RI IIK VA G+ +LH    + K+
Sbjct  374   SKDEKLIVYEYVPQGDLFELLHENRGIGRQPLNWTARISIIKDVAKGLNFLHQSLQSQKV  433

Query  1614  PHGNLKSSNILL----TPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKS  1772
             PHGN++S N+L+       Y   LTDY F PL+    +L+ +   K+PE   G +++ K+
Sbjct  434   PHGNIRSKNVLIQQDQNKNYHSKLTDYGFFPLLPSKESLRKLAVGKSPEFSQGKKLTRKA  493

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGT-----DVVQWVRQAVADGKESEVIDPEIAGA  1937
             D+YC GI++LEV+TGK P +  S + G T     D+ +WVR  V +   ++++D EI   
Sbjct  494   DIYCFGILLLEVITGKIPGELFSPENGVTSYVDDDLSEWVRTVVNNDWSTDILDMEILAQ  553

Query  1938  GEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
              E  D +M+KL Q+   CT+   EKR  M E ++RI EI+
Sbjct  554   KEGYD-EMLKLTQLALQCTDEAPEKRPKMSEVLRRIEEIE  592



>ref|XP_004287382.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Fragaria 
vesca subsp. vesca]
Length=654

 Score =   285 bits (729),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 204/609 (33%), Positives = 320/609 (53%), Gaps = 30/609 (5%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC--HRKTVTGLRLYNMGLAGD  449
             D   L+EF   + + K +   W    S C     W GV C  ++  V  +RL  +GL G 
Sbjct  31    DKQALLEFINQMPHAKRVQ--WNNSVSACS----WVGVKCDNNQSFVYSVRLPGVGLVGP  84

Query  450   IDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I  + LS L  LR+++L  N  +G +P DF  L  L++L++QGN  +GE       ++  
Sbjct  85    IPPNTLSRLGQLRVLSLRLNRLTGSVPSDFGNLTLLRNLYLQGNDLTGEFPP-VLTRLGR  143

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
             L +L LS N F+G IP ++  L +L  L L+ N FS ++P ++   L   ++S NKL G 
Sbjct  144   LVRLDLSANNFTGTIPFAVNNLTQLTGLFLQNNEFSGSLPSIST-GLDGFNVSNNKLNGS  202

Query  807   IPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlll  986
             IP+ + +F A AF GN +LCG P+ R C        G  +   TP     H    +    
Sbjct  203   IPTTLQKFPATAFAGNLDLCGVPL-RSCNPFFP---GPASAPVTPPIIPVHKKSKKLSTA  258

Query  987   sivaglllvailFNKNQNEENVKTR-RKDNLDEVLVVQIASMARS----ESINHssrrst  1151
             +IVA ++   + F        +  R R+ N          + ARS    E+   SS+   
Sbjct  259   AIVAIVIGSILAFCLLLLILLLCIRKRRRNRSPKSTKPPVAAARSVPAAEAGTSSSKDDI  318

Query  1152  stegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRL  1331
             +   + +     V  N     F L +L+ ASAEVLG G +G++YKA L   G TVVVKRL
Sbjct  319   TGTSTEAERNKLVFFNGGIYSFDLEDLLRASAEVLGKGSVGTSYKAVLEE-GTTVVVKRL  377

Query  1332  KETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRG  1511
             K+   + K  FD  M  +G ++H N++PL A+++ K EKL+V ++   GSL  LLHG RG
Sbjct  378   KDV-VVTKKEFDMTMEVLGKIKHDNVVPLRAFYFSKDEKLLVYDYMTAGSLSALLHGSRG  436

Query  1512  TAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFH  1691
             +    L    R++I    A G+ +LH      K+ HGN+KSSNILL P ++  ++D+  +
Sbjct  437   SGRTPLDWDNRMRIALSAARGLAHLH---VAGKVVHGNIKSSNILLRPDHDATISDFGLN  493

Query  1692  PLVSGTPTLQCMFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTD  1862
             PL   +     +   +AP   E  +++ KSDVY  G+++LE++TGK P+Q  S  + G D
Sbjct  494   PLFGTSTPPNRVAGYRAPEVVETRKVTFKSDVYSFGVLLLELLTGKAPNQA-SLGEEGID  552

Query  1863  VVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKR  2042
             + +WV+  V +   +EV D E+    ++ + +MV+LLQI  AC  +  ++R +M+E ++ 
Sbjct  553   LPRWVQSVVREEWTAEVFDVELMRY-QNIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRM  611

Query  2043  IREIQDVEV  2069
             I ++   E 
Sbjct  612   IEDMNRAET  620



>ref|NP_197162.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
 sp|Q9FMD7.1|Y5659_ARATH RecName: Full=Probable inactive receptor kinase At5g16590; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10186.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAS49054.1| At5g16590 [Arabidopsis thaliana]
 gb|AAS76757.1| At5g16590 [Arabidopsis thaliana]
 dbj|BAF00775.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59369.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92314.1| leucine-rich repeat protein 1 [Arabidopsis thaliana]
Length=625

 Score =   283 bits (723),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 207/633 (33%), Positives = 326/633 (52%), Gaps = 48/633 (8%)
 Frame = +3

Query  216   LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             + FF  CL+     L     D   LI  ++ +     L   W     PC     W GV C
Sbjct  11    VFFFFICLVSVTSDLE---ADRRALIALRDGVHGRPLL---WNLTAPPCT----WGGVQC  60

Query  396   HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
                 VT LRL  +GL+G + + A+ NL  L  ++   N+ +GP+P DF  L  L+ L++Q
Sbjct  61    ESGRVTALRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQ  119

Query  573   GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPL  752
             GN FSGEI +  F  +  + ++ L+ N F G IP ++    RL  L+L+ N  +  +P +
Sbjct  120   GNAFSGEIPSFLFT-LPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEI  178

Query  753   AQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEA  932
               + L   ++S N+L G IP  ++     AF GN  LCG+P+      D     G G   
Sbjct  179   KIK-LQQFNVSSNQLNGSIPDPLSGMPKTAFLGN-LLCGKPL------DACPVNGTGNGT  230

Query  933   QTPE---NAQRHSSG-----MRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVL  1088
              TP     + + S+G     +    + ++   L+V  L  K + E+ V++R      E  
Sbjct  231   VTPGGKGKSDKLSAGAIVGIVIGCFVLLLVLFLIVFCLCRKKKKEQVVQSRSI----EAA  286

Query  1089  VVQIASMARSESIN-------HssrrststegsssrggDFVLVNEERGMFGLSELMMASA  1247
              V  +S A ++  N       + +  +  ++  ++   D     +  G F L  L+ ASA
Sbjct  287   PVPTSSAAVAKESNGPPAVVANGASENGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASA  346

Query  1248  EVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAY  1427
             EVLG G  GS+YKA+    GL V VKRL++     K+ F  +++ +G + H N++ L+AY
Sbjct  347   EVLGKGTFGSSYKASFDH-GLVVAVKRLRDVVVPEKE-FREKLQVLGSISHANLVTLIAY  404

Query  1428  HYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATY  1607
             ++ + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  G A  + YLH+  AT 
Sbjct  405   YFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATT  464

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDV  1778
                HGN+KSSNILL+ ++E  ++DY   P++S T T   +   +APE     +IS K+DV
Sbjct  465   S--HGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADV  522

Query  1779  YCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             Y  G++ILE++TGK P+    +++ G D+ +WV         S+V DPE+     DS+  
Sbjct  523   YSFGVLILELLTGKSPTHQQLHEE-GVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNEN  581

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             M++LL IG +CT    + R +M E  + I E+ 
Sbjct  582   MIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVS  614



>ref|XP_010105639.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC05427.1| putative inactive receptor kinase [Morus notabilis]
Length=639

 Score =   280 bits (716),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 204/574 (36%), Positives = 307/574 (53%), Gaps = 34/574 (6%)
 Frame = +3

Query  354   SPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-  530
             SPC     W GV C    V+ LRL   GL+GD+      NL  L+ ++L  N+ SGPIP 
Sbjct  53    SPCS----WLGVRCDSIGVSELRLPGAGLSGDLPA-GFGNLTRLQKLSLRFNALSGPIPA  107

Query  531   DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVEL  710
             D   L  L  L ++GN FSG++  D+   M  L +L L+ N FSG I    G L RLV L
Sbjct  108   DLGNLSGLSELHLEGNFFSGQV-PDFLFGMKSLVRLNLADNIFSGEISPRFGNLKRLVVL  166

Query  711   HLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             +L  N F+ ++P +    L   ++S N+L G IP  +ARF A +F GN  LCG+P+ + C
Sbjct  167   YLGNNSFTGSIPDIDLPELDQFNVSFNRLNGSIPDKLARFSADSFLGN-FLCGKPL-KSC  224

Query  891   REDLGKDGGGGAEAQTPENAQRHSSG--MRWlllsivaglllvailFNKNQNEENVKTRR  1064
                   DG G  E +  + +     G  M  ++  ++   +L+ +   K + E+ +  + 
Sbjct  225   ------DGSGTGEKKDNKLSTGAIVGIVMGCVIGVLIILAILIFLCRRKEKGEKEIIPK-  277

Query  1065  KDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMAS  1244
                + EV + +  +   SES++       S +  +    + V        F L +L+ AS
Sbjct  278   ---MTEVEIPKGKAAMESESLS-GDYSKVSAKRGAGGIRNLVFFGNTIREFDLEDLLRAS  333

Query  1245  AEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLA  1424
             AEVLG G  G+ YKA+L  +G++V VKRLKE     K+ F   M ++G + H N++PL A
Sbjct  334   AEVLGKGTFGTTYKASLE-MGISVAVKRLKEGTAPEKE-FRERMEQVGRMDHENLVPLRA  391

Query  1425  YHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFAT  1604
             Y+Y + EKL+V ++ P GSL  LLHG  G     L   TR  I  G A G+ YLH+  ++
Sbjct  392   YYYSRDEKLLVYDYLPMGSLSALLHGSNGAGRTPLNWETRSGIALGAARGIAYLHSHGSS  451

Query  1605  YKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFA-LKAPE---GHQISHKS  1772
                 HGN+KSSNILLT +YE  ++D+    L +  PT     A  +APE    H++S K+
Sbjct  452   ----HGNIKSSNILLTRSYEARVSDFGLAHLANPDPTPNHRVAGYRAPEVTDPHKVSPKA  507

Query  1773  DVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSD  1952
             DVY  G+++LE++TGK P+    N + G D+ +WV+  V +    EV D E+    ++ +
Sbjct  508   DVYSFGVLLLELLTGKPPTHSQLNDE-GVDLPRWVQSVVREEWTVEVFDLELLRY-QNVE  565

Query  1953  GKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
              +MV+LLQ+   CT    +KR  M    +RI E+
Sbjct  566   DEMVELLQLALDCTVQYPDKRPPMAVVTRRIEEL  599



>ref|XP_001774015.1| predicted protein [Physcomitrella patens]
 gb|EDQ61205.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   278 bits (712),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 191/606 (32%), Positives = 309/606 (51%), Gaps = 37/606 (6%)
 Frame = +3

Query  270   VGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGD  449
             +G D   +    +  + KG    W      C+    W G+ C    VT +RL   G  G+
Sbjct  2     LGADTRALLVFSNFHDPKGTKLRWTNASWTCN----WRGITCFGNRVTEVRLPGKGFRGN  57

Query  450   IDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I   +LS +  LR+++L  N  +G  P +     +L+SL++ GN F G +  D  A    
Sbjct  58    IPTGSLSLISELRIVSLRGNWLTGSFPGELGNCNNLESLYLAGNDFYGPLPNDLHAVWPR  117

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
             L  L L +N  +G IP SLG LP+L  L+L  N FS ++PPL   +LTI +++ N L G 
Sbjct  118   LTHLSLEYNRLNGVIPESLGLLPQLFMLNLRNNFFSGSIPPLNLANLTIFNVANNNLSGP  177

Query  807   IPSGMARFGAKAFEGNPEL--------CGEPVGRQ-----CREDLGKDGGGGAEAQTPEN  947
             +P+ +++F A ++ GNP L        C  P+           ++ K+GG      T   
Sbjct  178   VPTTLSKFPAASYLGNPGLCGFPLESVCPSPIAPSPGPIAVSTEVAKEGGD-KPLSTGAV  236

Query  948   AQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESI  1127
             A     G+    L + +  L+  + + K    ++ K   +D   E          R + +
Sbjct  237   AGIVVGGV--AALVLFSLALIFRLCYGKKGQLDSAKATGRDVSRE--------RVRDKGV  286

Query  1128  NHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIG  1307
             +      +S           V  + ++  F L +L+ ASAEVLG G +G+AYKA L   G
Sbjct  287   DEQGEEYSSAGAGELERNKLVFFDGKKYSFNLEDLLRASAEVLGKGSVGTAYKAILE-DG  345

Query  1308  LTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLL  1487
               + VKRLK+     KD F+++++ +G L H N++PL AY++ K EKL+V ++ P GSL 
Sbjct  346   TIMAVKRLKDVTTGKKD-FESQIQAVGKLLHKNLVPLRAYYFSKDEKLLVYDYMPMGSLS  404

Query  1488  YLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEP  1667
              LLHG+RG++   L   +R+KI  G A G+ YLH +  + K  H N+KSSNILL+   + 
Sbjct  405   ALLHGNRGSSRTPLDWLSRVKIALGAARGLAYLHAQGGS-KFAHANIKSSNILLSRDLDA  463

Query  1668  LLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYL  1838
              ++DY    L++ +     +   +APE     +++ KSDVY  G+++LE++TGK P+Q  
Sbjct  464   CISDYGLAQLLNSSSAASRIVGYRAPEVTDARKVTQKSDVYSFGVLLLELLTGKAPTQAA  523

Query  1839  SNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRL  2018
              N + G D+ +WV+  V +   +EV D E+    ++ + +MV +LQI   C +   E+R 
Sbjct  524   LNDE-GIDLPRWVQSVVREEWTAEVFDLELMRY-QNIEEEMVSMLQIAMQCVDPVPERRP  581

Query  2019  SMKEAI  2036
              M   +
Sbjct  582   KMNNVL  587



>ref|XP_010420358.1| PREDICTED: probable inactive receptor kinase At5g16590 [Camelina 
sativa]
Length=633

 Score =   280 bits (715),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 196/596 (33%), Positives = 305/596 (51%), Gaps = 48/596 (8%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFS  518
             W     PC     W GV C    VT LRL  +GL+G + + A+ NL  L  ++   N+ +
Sbjct  50    WNLTAPPCT----WGGVQCESGRVTALRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALN  104

Query  519   GPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             GP+P DF  L  L+ L++QGN FSGEI +  F  +  + ++ L+ N FSG IP ++    
Sbjct  105   GPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFT-LPNIIRINLAQNNFSGRIPDNVNSAT  163

Query  696   RLVELHLEGNGFSSAVP----PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPEL  863
             RL  L+LE N  +  +P    PL Q      ++S N+L G IP  ++     AF GN  L
Sbjct  164   RLATLYLEDNQLTGPIPEIKIPLQQ-----FNVSSNQLNGSIPDPLSGMPKTAFLGNLLL  218

Query  864   CGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSG------MRWlllsivaglllvailF  1025
             CG+P+          + G G   +      + S+G      +  +   I+  L+L  +  
Sbjct  219   CGKPLDACSVNGTATETGTGKGKK-----DKLSTGAIIGIVIACVFGLILLFLILFCLCR  273

Query  1026  NKNQNEENVKTRRKDNLDEVLVVQIASMARSESIN----------Hssrrststegsssr  1175
              + + E NV++R   N++   V    +    ES +                  +  +   
Sbjct  274   KRKKEENNVQSR---NIEAAPVPTSTAAVAKESADVPPPVANGNGAPHSSENGSSKNLPV  330

Query  1176  ggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNK  1355
               D     +  G F L  L+ ASAEVLG G  GS+YKA+    GL V VKRL++     K
Sbjct  331   SKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDH-GLVVAVKRLRDVVVPEK  389

Query  1356  DAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKA  1535
             + F  +++ +G + H N++ L+AY++ + EKLVV E+  +GSL  LLHG++G+  + L  
Sbjct  390   E-FREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNW  448

Query  1536  ATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPT  1715
              TR  I  G A  + YLH+  AT    HGN+KSSNILL+ ++E  ++DY   P++S T T
Sbjct  449   ETRAGIALGAARAISYLHSRDATTS--HGNIKSSNILLSESFEAKVSDYCLAPMISPTST  506

Query  1716  LQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQA  1886
                +   +APE     +IS K+DVY  G++ILE++TGK P+    +++ G D+ +WV   
Sbjct  507   PNRIDGYRAPEVTDARRISQKADVYSFGVLILELLTGKSPTHQQLHEE-GVDLPRWVSSI  565

Query  1887  VADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
                    +V DPE+     + +  MV+LL+IG +CT    + R +M E  + I E+
Sbjct  566   TEQQSPLDVFDPELTRYQAEGNENMVRLLKIGISCTAQYPDSRPTMTEVTRLIEEV  621



>dbj|BAK05854.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=691

 Score =   281 bits (718),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 198/317 (62%), Gaps = 30/317 (9%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+N+  G FGL ++M ASAEVLGNG LGSAYKAA+   G+TV VKR+++ N++ ++ 
Sbjct  372   EFVLMNKSSGEFGLQDMMKASAEVLGNGTLGSAYKAAM-RNGITVAVKRMRDMNRVGREE  430

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  +R +G L H N+L  L YHYRK+EKL+VSE  P+GSLLY+LHGD+      L    
Sbjct  431   FENHLRVLGELHHPNVLAPLGYHYRKEEKLIVSEIMPRGSLLYVLHGDQSPNRVVLDWPA  490

Query  1542  RIKIIKGVASGMEYLHTEF------------ATYKLP-----HGNLKSSNILLTPTYEPL  1670
             R++I  GVA GM YLH +             A + +P     HGNLKS NILL    EP 
Sbjct  491   RLRIALGVARGMAYLHEKLNMPTMRFVSMDDADFDVPPPPPLHGNLKSGNILLDANLEPH  550

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---------ISHKSDVYCLGIVILEVVTGKF  1823
             + DY F PLV+     Q MFA ++PE            +S +SDVYC G+V+LE++TG+F
Sbjct  551   IVDYGFFPLVNAPQAPQAMFAFRSPEAVAALQQQQRVPVSARSDVYCFGVVLLELITGRF  610

Query  1824  PSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESD  2003
             PSQYL N +GGTDVV W   AV D KE E+IDP I  AG    G  V+L++I   CT+  
Sbjct  611   PSQYLLNARGGTDVVHWAAAAVTDSKEHELIDPVIVRAG---GGSAVQLVRIAVECTDPA  667

Query  2004  VEKRLSMKEAIKRIREI  2054
              E R +M+E  + + E+
Sbjct  668   PESRPNMEEVARMVEEV  684


 Score =   154 bits (390),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 118/201 (59%), Gaps = 5/201 (2%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTW--VKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K S ++     + W  +   +PC+ +R W GV C++ ++ GLRL ++ L+G  D  
Sbjct  41   LMRLKASFKDPTNALEAWSPLSPPAPCNASRPWPGVQCYKGSLIGLRLVHLNLSGPFDFA  100

Query  462  ALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
            AL+NL GL  I L  N+F+GP+P     +R L++L++  N F+G I  D FA M  L+KL
Sbjct  101  ALANLPGLHSINLRRNAFAGPLPASLATVRSLRALYLSHNAFTGPIPGDMFANMRWLKKL  160

Query  639  WLSHNGFSGNIP-ASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            +L +N  SG +P AS+   PRL+ELHL+ N     VP     SL + ++S N+L G +P 
Sbjct  161  YLDNNDLSGALPAASIAGAPRLLELHLDHNQIEGTVPEQLPASLRLFNVSHNRLTGVLPR  220

Query  816  GM-ARFGAKAFEGNPELCGEP  875
             + ARF    F GNP LCG P
Sbjct  221  AVAARFNESGFAGNPALCGAP  241



>ref|NP_001170153.1| uncharacterized protein LOC100384085 [Zea mays]
 gb|ACN36005.1| unknown [Zea mays]
Length=331

 Score =   269 bits (688),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 195/311 (63%), Gaps = 24/311 (8%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+N+    FGL +LM ASAEVLGNG LGSAYKAA+   G+TV VKRL++ N++ ++ 
Sbjct  20    EFVLLNDHIPAFGLPDLMKASAEVLGNGTLGSAYKAAMRN-GVTVAVKRLRDMNRVGREE  78

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  ++ +G L H N+LP + YHYRK+EKL+VSE+ P+GSLLY+LHGD+      L    
Sbjct  79    FEQHVQMLGGLHHPNVLPPVGYHYRKEEKLIVSEYMPRGSLLYILHGDQSPNRLILDWQG  138

Query  1542  RIKIIKGVASGMEYLHTEFAT-----------------YKLPHGNLKSSNILLTPTYEPL  1670
             R+++  GV  G+ +LH                         P+GNLKS NILL    EP 
Sbjct  139   RLRVAVGVVRGLAFLHERLGIPAGRLVSMDGADFDAPPPPPPYGNLKSGNILLDADMEPR  198

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L DY F PLV+     Q MFA ++PEG     +S +SDVYCLG+V+LE+VTG+FPSQYL 
Sbjct  199   LVDYGFFPLVNAAQAPQAMFAFRSPEGTTRGVVSARSDVYCLGVVLLELVTGRFPSQYLL  258

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
             N +GGTDVV W   AVA+G E +++DP IA          V LL++G  C   + E+RLS
Sbjct  259   NARGGTDVVNWAATAVAEGGERDLVDPAIA---AAGRDAAVSLLRVGVRCANPEPERRLS  315

Query  2022  MKEAIKRIREI  2054
             + EA   + EI
Sbjct  316   VAEAASMVEEI  326



>ref|XP_007141918.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
 gb|ESW13912.1| hypothetical protein PHAVU_008G236900g [Phaseolus vulgaris]
Length=644

 Score =   278 bits (711),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 212/619 (34%), Positives = 310/619 (50%), Gaps = 31/619 (5%)
 Frame = +3

Query  219   IFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCH  398
             IFF+       +  S    D   L+  + +L     L +T     +PC     W GV C 
Sbjct  10    IFFTLLTCFFAIADSDLASDRAGLVSLRSALGGRTLLWNT--TQTTPCS----WTGVTCT  63

Query  399   RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQG  575
                VT LRL  MGL+G +    L NL  L+ ++L  N+ +G IP DF  L+ L++L++QG
Sbjct  64    NGRVTLLRLPAMGLSGSLP-SGLGNLTELQTLSLRFNALTGRIPADFVNLKALRNLYLQG  122

Query  576   NRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLA  755
             N FSGE+    FA +  L +L L  N FSG I      L RL  L+LE N F+ ++P L+
Sbjct  123   NFFSGEVPDAVFA-LQNLVRLNLGSNNFSGEISPKFNGLTRLSTLYLERNNFTGSIPDLS  181

Query  756   QRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC---REDLGKDGGGGA  926
                L   ++S N L G IP+  +R    AF GN  LCG+P+ + C    E       GGA
Sbjct  182   VPPLDQFNVSYNSLNGSIPNRFSRVDQTAFLGN-SLCGKPL-QLCPGTEEKRKSKLSGGA  239

Query  927   EAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIAS  1106
              A     +      +  LL  +              +N+E+V T ++D   EV   +   
Sbjct  240   IAGIVIGSVFGLLLILLLLFFLCRK--------RSGKNDESVTTGKRDVEGEVSRDKSVE  291

Query  1107  MARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYK  1286
                S S    S   +  + S       V       +F L EL+ ASAEVLG G  G+ YK
Sbjct  292   SGNSGSAVAGSVEKSEVQSSGGGDKSLVFFGNVNRVFSLDELLRASAEVLGKGTFGTTYK  351

Query  1287  AALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEF  1466
             A L  +G++V VKRLK+     ++ F  ++ ++G + HHN++PL  Y + + EKLVV ++
Sbjct  352   ATLE-MGVSVAVKRLKDVTATERE-FREKIEQVGKMVHHNLVPLRGYFFSRDEKLVVYDY  409

Query  1467  GPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNIL  1646
              P GSL  LLH + G     L   TR  I  G A G+ Y+H+   T    HGN+KSSNIL
Sbjct  410   MPMGSLSALLHANGGVGRTPLNWETRSAIALGAARGIAYIHSHGPTSS--HGNIKSSNIL  467

Query  1647  LTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTG  1817
             LT ++E  ++D+    L   T T   +   +APE     ++S K+DVY  GI++LE++TG
Sbjct  468   LTKSFEARVSDFGLAYLALPTSTPNRVSGYRAPEITDARKVSQKADVYSFGIMLLELLTG  527

Query  1818  KFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTE  1997
             K P+    N + G D+ +WV+  V     ++V D E+    +  + +MVKLLQ+   CT 
Sbjct  528   KAPAHSSLNDE-GVDLPRWVQSVVQGEWNTDVFDMELLRY-QSVEEEMVKLLQLALECTA  585

Query  1998  SDVEKRLSMKEAIKRIREI  2054
                +KR SM     +I EI
Sbjct  586   QYPDKRPSMDVVESKIEEI  604



>ref|XP_002868800.1| hypothetical protein ARALYDRAFT_356181 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45059.1| hypothetical protein ARALYDRAFT_356181 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   276 bits (707),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 192/588 (33%), Positives = 306/588 (52%), Gaps = 38/588 (6%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFS  518
             W     PC     W GV C    VT LRL  +GL+G + + A+ NL  L  ++   N+ +
Sbjct  46    WNLSAPPCT----WGGVQCDSGRVTALRLPGVGLSGPLPI-AIGNLTKLETLSFRFNALN  100

Query  519   GPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
             GP+P DF  L  L+ L++QGN FSGEI +  F  +  + ++ L+ N FSG IP ++    
Sbjct  101   GPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFT-LPNIIRINLAQNNFSGRIPDNVNSAT  159

Query  696   RLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEP  875
             RL  L+L+ N  +  +P +  + L   ++S N+L G IP  ++     AF GN  LCG+P
Sbjct  160   RLATLYLQDNQLTGPIPEIKIK-LQQFNVSSNQLNGSIPDPLSGMPKTAFLGN-LLCGKP  217

Query  876   VGRQCREDLGKDGGGGAEAQTPENAQRHSSG----MRWlllsivaglllvailFNKNQNE  1043
             +      D     G G        + + S+G    +       +    L+     + + +
Sbjct  218   L------DACPVNGNGTVTPLKGKSDKLSAGAIAGIVIGCFLGLLLFFLILFCLCRKKKK  271

Query  1044  ENVKTRRKDNLDEVLVVQIASMARSES--------INHssrrststegsssrggDFVLVN  1199
             E V++R   N++   +   ++    ES        + + +        +     D     
Sbjct  272   EEVRSR---NIEAAPIPTSSAAVAKESAVANGPPPVANGAPHLNGASKNPVVSKDLTFFV  328

Query  1200  EERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMR  1379
             +  G F L  L+ ASAEVLG G  GS+YKA+    GL + VKRL++     K+ F  +++
Sbjct  329   KSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDN-GLVLAVKRLRDVVVPEKE-FREKLQ  386

Query  1380  KMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIK  1559
              +G + H N++ L+AY++ + EKLVV E+  +GSL  LLHG++G+  + L   TR  I  
Sbjct  387   VLGSISHPNLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRAAIAL  446

Query  1560  GVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALK  1739
             G A  + YLH+  AT    HGN+KSSNILL+ ++EP ++DY F P++S T T   +   +
Sbjct  447   GAARAISYLHSRDATTS--HGNIKSSNILLSESFEPKVSDYCFAPMISPTSTPNRIDGYR  504

Query  1740  APE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESE  1910
             APE     +IS K+DVY  G++ILE++TGK P+    +++ G D+ +WV         S+
Sbjct  505   APEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEE-GVDLPRWVSSITEQQSPSD  563

Query  1911  VIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             V DPE+     D +  M+KLL++G +CT    + R +M E  + I E+
Sbjct  564   VFDPELTRYQSDINENMIKLLKMGISCTAQYPDSRPTMLEVTRLIEEV  611



>ref|XP_009396580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g31250 [Musa acuminata subsp. malaccensis]
Length=645

 Score =   276 bits (707),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 204/297 (69%), Gaps = 5/297 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              + V E RG FGL +L+ ASAEVLG+G  GS+YKA L + G +VVVKR KE N + ++ F
Sbjct  319   LLFVGERRGTFGLQDLLRASAEVLGSGNFGSSYKAIL-LDGPSVVVKRFKEMNGVGREYF  377

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H N+LPL+AY+YRK+EKL++S++ P GSL ++L+G+R +  + L   TR
Sbjct  378   QEHMRRLGRLSHPNLLPLVAYYYRKEEKLLISDYIPNGSLAHMLYGNRTSRTSPLDWPTR  437

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KIIKGVA G+ YL+ E     +PHG+LKSSN+LL  ++EP+LTDYA  P+++     + 
Sbjct  438   LKIIKGVARGLAYLYEELPMLTVPHGHLKSSNVLLDLSFEPILTDYALAPVMNKAHASEL  497

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M A K+PE  Q    S KSDV+ LGI++LE++TG+FP+ +L   + GTD+ +WV   + +
Sbjct  498   MVAYKSPECAQHGKPSTKSDVWSLGILMLEILTGRFPANHLRPGRAGTDLAKWVSSVIRE  557

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
                 EV D  + G   +S+G+M+KLL+I  AC E+DV +R  M  A++RI E+++ E
Sbjct  558   EWTGEVFDGTMKGT-RNSEGEMLKLLRIAMACCETDVRRRCEMAAALERIEELKERE  613


 Score =   166 bits (421),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 124/207 (60%), Gaps = 4/207 (2%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGVLCHRK-TVTGLRLYNMGLAGD  449
            D   L+EFKE+  +    D  W     PC +   +W GV C +   V+ LRL +M L+G 
Sbjct  32   DRSALLEFKETTLSPAPSD--WGGQDGPCINNVSKWTGVYCDKDGRVSVLRLESMNLSGT  89

Query  450  IDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGL  629
            + +DALS L  LR ++ +NNS  G IP+  KL +LKS+++  NRF+GEI    F+ M GL
Sbjct  90   LTLDALSELPNLRSLSFSNNSLEGSIPNVTKLPNLKSIYLSMNRFAGEIPDGMFSAMLGL  149

Query  630  RKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEI  809
            + LWLS N FSG+IP+SL    +L EL L+GN F   +P L Q +L ++++S N L+G I
Sbjct  150  KVLWLSQNNFSGSIPSSLTAPKKLAELRLDGNKFEGQIPALWQPNLQLVNVSFNDLEGPI  209

Query  810  PSGMARFGAKAFEGNPELCGEPVGRQC  890
            P  ++   A  FEGN  LCG P+   C
Sbjct  210  PERLSNMSASWFEGNKNLCGPPLAVSC  236



>ref|XP_008457025.1| PREDICTED: probable inactive receptor kinase RLK902 [Cucumis 
melo]
Length=643

 Score =   276 bits (707),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 201/610 (33%), Positives = 311/610 (51%), Gaps = 47/610 (8%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTW-VKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDI  452
             D   L+ F+ ++     L+  W +   SPC     W GV C R  V  LRL  MGL+G++
Sbjct  28    DRAALVGFRAAMGGRPRLE--WNLSDVSPCS----WAGVNCDRNGVFELRLPAMGLSGEL  81

Query  453   DVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGL  629
              +  L NL  L+ ++L  N+ SG IP DF+ LR L++L++QGN FSGEI    F  +  L
Sbjct  82    PM-GLGNLTQLQTLSLRFNALSGRIPADFENLRGLRNLYLQGNLFSGEIPPFLF-DLQNL  139

Query  630   RKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEI  809
              +L ++ N F+G I +    L RL  L+L+ N F+  VP L   +L   ++S N+L G I
Sbjct  140   VRLNMADNNFTGEISSGFNNLSRLATLYLQNNRFTGVVPEL-NLTLEQFNVSFNQLNGSI  198

Query  810   PSGMARFGAKAFE-----GNPELCGEPVGRQCREDLGKDGG-------GGAEAQTPENAQ  953
             P+ ++ F A +FE     G P L       +        GG       GG          
Sbjct  199   PTKLSSFPASSFEGNFLCGAPLLLCNSTATEPSPKSKLSGGAIAGIVIGGLFVLALILVV  258

Query  954   RHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINH  1133
                   R                  K++ +E V++R +  +       +   +   +I+H
Sbjct  259   LILVCQRKSK--------------EKSETKEVVRSRGEVEVPGEKTTTVEGSSERINIDH  304

Query  1134  ssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLT  1313
                  +ST+GS       V       +F L +L+ ASAEVLG G  G+AYKA L   G+ 
Sbjct  305   LIAPKSSTKGSERDK-KLVFFGNVGNVFDLEDLLRASAEVLGKGTFGTAYKATLET-GMV  362

Query  1314  VVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYL  1493
             V VKRLKE     K+ F  +M + G +++ N++P  AY+Y ++EKL+V ++ P GSL  L
Sbjct  363   VAVKRLKEMTAAEKE-FREKMEEAGRMKNENLVPFRAYYYSREEKLLVYDYMPMGSLSAL  421

Query  1494  LHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLL  1673
             LHG R +    L    R  I  GV  G+ YLH++  T  + HGN+KSSNILLT +YE  +
Sbjct  422   LHGSRESGRTPLNWEARCGIALGVGRGIHYLHSQGPT--ISHGNIKSSNILLTRSYEACV  479

Query  1674  TDYAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSN  1844
             +DY    L     T   +   +APE     ++SHK+DVY  G+++LE++TGK P+  + +
Sbjct  480   SDYGLAQLAMAPSTPSRVAGYRAPEVTDSRKVSHKADVYSFGVLLLEMLTGKSPTHSIFH  539

Query  1845  QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSM  2024
             ++   D+ +WV+  V +   +EV D ++    ++ + +MV+LL++   CT    + R  M
Sbjct  540   EE-AVDLPRWVQSVVQEEWTAEVFDEQLLRY-QNVEEEMVQLLELALQCTVPYPDNRPGM  597

Query  2025  KEAIKRIREI  2054
              E + RI E+
Sbjct  598   DEIVGRIEEL  607



>ref|XP_002449883.1| hypothetical protein SORBIDRAFT_05g024870 [Sorghum bicolor]
 gb|AAM94320.1| putative receptor kinase [Sorghum bicolor]
 gb|EES08871.1| hypothetical protein SORBIDRAFT_05g024870 [Sorghum bicolor]
Length=690

 Score =   277 bits (709),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 196/311 (63%), Gaps = 24/311 (8%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+NE+   FGL +LM ASAEVLGNG LGSAYKAA+   G+TV VKRL++ N+  +D 
Sbjct  376   EFVLLNEDIPAFGLPDLMKASAEVLGNGTLGSAYKAAM-RNGVTVAVKRLRDMNRFGRDE  434

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  +  +G LRH N+LP + YHYRK+EKL+VSE+ P+GSLLY+LHGD+      L    
Sbjct  435   FEQHVHMLGQLRHPNVLPPVGYHYRKEEKLIVSEYMPRGSLLYILHGDQSPNRVILDWQG  494

Query  1542  RIKIIKGVASGMEYLHTEFAT-----------------YKLPHGNLKSSNILLTPTYEPL  1670
             R++I  GV  G+ +LH                         PHGNLKS NILL    EPL
Sbjct  495   RVRIAVGVVRGLAFLHERLGIPAGRLVSMDGADFDAPPPPPPHGNLKSGNILLGADMEPL  554

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L DY F PLV+     Q MFA ++PEG     +S +SDVYCLG+V+LE+VTG+FPSQYL 
Sbjct  555   LVDYGFFPLVNAAQAPQAMFAFRSPEGTTRGVVSARSDVYCLGVVLLELVTGRFPSQYLL  614

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
             + +GGTDVV W   AVA+G E+E++DP IA          V+LL++G  C   + E R S
Sbjct  615   SARGGTDVVHWAATAVAEGGEAELVDPAIA---AAGGDAAVRLLRVGVHCASPEPECRPS  671

Query  2022  MKEAIKRIREI  2054
             + EA   + EI
Sbjct  672   VAEAAWMVEEI  682


 Score =   149 bits (375),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 116/201 (58%), Gaps = 5/201 (2%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGKS--PCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K+S  +  G  + W       PCD    W GV C++ ++ G+RL +M L+G  D  
Sbjct  41   LVNLKKSFTDPTGRLEAWSATSPFPPCDAASPWPGVQCYKGSLVGVRLTHMNLSGTFDFG  100

Query  462  ALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
            A++ L  L  + L +N+ SGP+P     LR L++L++  N FSG I AD FA M  L+KL
Sbjct  101  AIAKLPRLHSVNLKHNALSGPLPASLGTLRGLRALYLSSNNFSGPIPADVFANMRWLKKL  160

Query  639  WLSHNGFSGNIPA-SLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            +L +N  +G +PA ++ K PRL+ELHL+ N     VP     SL   ++S N+L G IP 
Sbjct  161  YLDNNRITGPLPADAIAKAPRLMELHLDRNQIDGPVPFKLPESLKRFNVSHNRLSGTIPQ  220

Query  816  GMA-RFGAKAFEGNPELCGEP  875
             +A R+ A +F GNP LCG P
Sbjct  221  SVAERYDASSFAGNPGLCGSP  241



>gb|KGN53699.1| hypothetical protein Csa_4G107410 [Cucumis sativus]
Length=637

 Score =   274 bits (701),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 195/636 (31%), Positives = 309/636 (49%), Gaps = 48/636 (8%)
 Frame = +3

Query  210   FPLIFFSFCLILQCLPLSISV-----GDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR  374
             F L+FF+  L+   +   +       GD+   +   ++  N   L+  W       ++  
Sbjct  3     FSLLFFAAILLSGSVVAQVDTIVGFNGDERDALYALKATFNDTFLNRNWTGTHCHNNQPP  62

Query  375   RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHL  554
              W+G+ C    VT + L ++GL G ++  A +    L +++L NNS SG           
Sbjct  63    LWYGLQCVDGRVTAISLDSLGLVGKMNFRAFNKFTELSVLSLKNNSLSG-----------  111

Query  555   KSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFS  734
                    N FS       F     ++ + LS N F G+IP SL  L  L  L L+ N F+
Sbjct  112   -------NVFS-------FTSNQKMKTIDLSFNAFDGSIPVSLVSLTSLESLQLQNNRFT  157

Query  735   SAVPPLAQRSLTILDLSGNKLQGEIPSG--MARFGAKAFEGNPELCGEPVGRQCREDLGK  908
              ++P   Q SL + ++S N L G IP    +  FGA ++ GNP LCG P    C   +  
Sbjct  158   GSIPEFNQSSLAVFNVSNNNLNGFIPRTKVLQSFGAGSYVGNPGLCGPPSDAVCNSIIK-  216

Query  909   DGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVL  1088
               G  A A  P+  +  +         I+  +L++ + F  N     +  ++   L E L
Sbjct  217   --GSKATAAPPDTNKATNDNSSSKAHVILLLILVIVLFFVANLLLLLLYFKKHRELKE-L  273

Query  1089  VVQIASMARSESINHssrrststegsssrggDF-----VLVNEERGMFGLSELMMASAEV  1253
             + ++ S    E  N S    +      +          ++  EE   F L +L+ ASAE 
Sbjct  274   IKKLGSNETKEKKNESMTDISIQNQQPAEAAAADEGGKLIFTEEGENFQLGDLLKASAEG  333

Query  1254  LGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHY  1433
             LG G  G++YKA L      +VVKRL++   +  D F  +++ +  LRH N+LPL+AY Y
Sbjct  334   LGKGIFGNSYKAMLEGRS-PIVVKRLRDLKPLTVDEFMKQVQLIAKLRHPNLLPLVAYFY  392

Query  1434  RKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLH--TEFATY  1607
              K+EKL++ ++  KG+L   +HG RG      + ++R+ + +GVA  +E+LH  ++  T 
Sbjct  393   TKEEKLLLYKYAEKGNLFDRIHGRRGVGRVPFRWSSRLIVAQGVARALEFLHLNSKPNTI  452

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDV  1778
              +PHGNLKSSN+LL    E L++DY F  L++     QCM + ++PE  Q   +S KSDV
Sbjct  453   NVPHGNLKSSNVLLGENDEVLVSDYGFASLIALPIAAQCMVSYRSPEYQQMKRVSRKSDV  512

Query  1779  YCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             +  G +++E++TGK  S     +  G D+  WV +AV +   +E+ D EIA       G 
Sbjct  513   WSFGCLLIELLTGKISSHSAPEESHGIDLCAWVNRAVREEWTAEIFDSEIASQRSAIPG-  571

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             M+ LLQI   C+    +KR  M E  K I  I+ +E
Sbjct  572   MLNLLQIAIHCSNVSPDKRPEMSEVAKEIENIKLIE  607



>gb|KDP33412.1| hypothetical protein JCGZ_06983 [Jatropha curcas]
Length=619

 Score =   273 bits (697),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/294 (49%), Positives = 194/294 (66%), Gaps = 6/294 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              V  +R  F L +L+ ASAEVLG G  GS+YKA L   G  +VVKR +E N  NK+ F  
Sbjct  294   FVRNDRERFDLQDLLRASAEVLGTGNFGSSYKAVL-FDGPAMVVKRFREMNNANKEEFYE  352

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              + ++G L H N+LPL+A++YRK EKL++S+F   GSL   LHG RG+    L   TR+K
Sbjct  353   HITRLGTLSHRNLLPLVAFYYRKDEKLLISDFIENGSLASHLHGKRGSGQAGLDWPTRLK  412

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             IIKGVA G+ YL+ EF +  LPHG+LKSSN+LL  T+EPLLTDYA  PLV+    L+ M 
Sbjct  413   IIKGVARGLTYLYKEFPSLTLPHGHLKSSNVLLDHTFEPLLTDYALVPLVNKDHALKVMV  472

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT-DVVQWVRQAVADG  1898
             A K+PE  Q    + K+DV+ LGI+ILE++TGKFP+ YL   KGG  D+  WV   V + 
Sbjct  473   AYKSPEFTQSDRTTRKTDVWSLGILILEMLTGKFPANYLRQGKGGNADLASWVNSVVREE  532

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                EV D E+ G  ++ +G+M+KLL+IG  C E  VE+R  ++EA+ +I E++D
Sbjct  533   WTGEVFDMEMRGT-KNGEGEMLKLLKIGMCCCEWRVERRWDLREAVDKIEELKD  585


 Score =   144 bits (363),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 116/207 (56%), Gaps = 4/207 (2%)
 Frame = +3

Query  267  SVGDD--VVLIEFKESLQNTKGLDDTWVKGKSPCD-KTRRWFGVLCHRKTVTGLRLYNMG  437
            S GD+  V+L+ FK SL N   L +      +PC   T  W G+ C    +  L L  M 
Sbjct  6    SFGDNNAVILLAFKNSLSNPSKLYNWNDTINNPCSGDTANWVGLHCSDDNIDKLTLEGMD  65

Query  438  LAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAK  617
            L+G ID+D+L  L  LR ++L NNSF GP+P  +KL  L++L++  N+FSG I    FA 
Sbjct  66   LSGKIDIDSLVQLPKLRALSLKNNSFEGPLPPVNKLTSLRALYLSYNKFSGIIPDYAFAG  125

Query  618  MTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKL  797
            M  L +L+L +N F+G IP+SL  L +LV L LE N F   +P   Q+  T+ +++ N L
Sbjct  126  MNSLTQLYLGNNDFTGPIPSSLVPLSKLVRLSLENNQFQGEIPDF-QQEFTLFNVANNHL  184

Query  798  QGEIPSGMARFGAKAFEGNPELCGEPV  878
             G +P  +A        GN  LCG+P+
Sbjct  185  TGHVPVALAGVDPSLLAGNDGLCGKPL  211



>ref|XP_004979747.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690-like [Setaria italica]
Length=672

 Score =   274 bits (700),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 198/312 (63%), Gaps = 25/312 (8%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+ ++   FGL +LM ASAEVLGNG LGSAYKAA+   G+TV VKR+++ N+  ++ 
Sbjct  359   EFVLLTDDIPAFGLPDLMKASAEVLGNGTLGSAYKAAM-RNGVTVAVKRMRDMNRAGREE  417

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  +  +G LRH N+LP + YHYRK+EKL+VSE+ P GSLLY+LHGD+      L    
Sbjct  418   FEQHVHMLGELRHPNVLPPVGYHYRKEEKLIVSEYMPHGSLLYILHGDQSPNRVVLDWPA  477

Query  1542  RIKIIKGVASGMEYLHTEFAT-----------------YKLPHGNLKSSNILLTPTYEPL  1670
             R +I  GVA G+ +LH +                       PHGNLKS NILL    EP 
Sbjct  478   RARIAVGVARGLAFLHEKLGIPAGRLVSMDGADFDAPPPPPPHGNLKSGNILLDADMEPR  537

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L DY F PLV+     Q MFA ++PEG     +S +SDVYCLG+V+LE+VTG+FPSQYL 
Sbjct  538   LVDYGFFPLVNAAQAPQAMFAFRSPEGATRGAVSARSDVYCLGVVLLELVTGRFPSQYLL  597

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEI-AGAGEDSDGKMVKLLQIGAACTESDVEKRL  2018
             + +GGTDVV W   AVA+G E E++DP I AG G D+    V+LL++G  C + + E R 
Sbjct  598   SARGGTDVVHWAAGAVAEGGERELVDPAIAAGGGCDA---AVRLLRVGVHCAKPEPECRP  654

Query  2019  SMKEAIKRIREI  2054
             ++ EA   + EI
Sbjct  655   TVAEAAWMVEEI  666


 Score =   144 bits (364),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 116/206 (56%), Gaps = 6/206 (3%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWVKGKS--PCDKTRRWFGVLCHRKTVTGLRLYNMGLAGD  449
            D   L+  K+SL +  G  D W       PCD    W GV C++  + GLRL +M L+G 
Sbjct  34   DAAALLRLKQSLSDPTGRLDAWSASSPSPPCDAASPWPGVQCYKGVLVGLRLTHMNLSGK  93

Query  450  IDVDALSNLQGLRMIALANNSFSGPIP--DFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
             D  A++ L GL  + L +N+FSG +        R L++L++  N+FSG + AD F  + 
Sbjct  94   FDFAAVAKLPGLHSVNLKHNNFSGALAATSVGAARSLRALYLSFNQFSGPVPADVFTNLR  153

Query  624  GLRKLWLSHNGFSGNIPA-SLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQ  800
             L+KL+L+ N  +G +PA ++   PRL+ELHL+ N  + ++P     SL + ++S N+L 
Sbjct  154  WLKKLYLNGNNVTGPLPADAIAAAPRLIELHLDRNEINGSIPFKLPASLKLFNVSHNRLT  213

Query  801  GEIPSGMA-RFGAKAFEGNPELCGEP  875
            G IP  +A RF   AF GN  LCG P
Sbjct  214  GSIPPDIARRFDPSAFAGNTGLCGSP  239



>gb|AFW60340.1| putative leucine-rich repeat protein kinase family protein [Zea 
mays]
Length=667

 Score =   272 bits (696),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 195/311 (63%), Gaps = 24/311 (8%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+N+    FGL +LM ASAEVLGNG LGSAYKAA+   G+TV VKRL++ N++ ++ 
Sbjct  356   EFVLLNDHIPAFGLPDLMKASAEVLGNGTLGSAYKAAM-RNGVTVAVKRLRDMNRVGREE  414

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  ++ +G L H N+LP + YHYRK+EKL+VSE+ P+GSLLY+LHGD+      L    
Sbjct  415   FEQHVQMLGGLHHPNVLPPVGYHYRKEEKLIVSEYMPRGSLLYILHGDQSPNRLILDWQG  474

Query  1542  RIKIIKGVASGMEYLHTEFAT-----------------YKLPHGNLKSSNILLTPTYEPL  1670
             R+++  GV  G+ +LH                         PHGNLKS NILL    EP 
Sbjct  475   RLRVAVGVVRGLAFLHERLGIPAGRLVSMDGADFDAPPPPPPHGNLKSGNILLDADMEPR  534

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L DY F PLV+     Q MFA ++PEG     +S +SDVYCLG+V+LE+VTG+FPSQYL 
Sbjct  535   LVDYGFFPLVNAAQAPQAMFAFRSPEGTTRGVVSARSDVYCLGVVLLELVTGRFPSQYLL  594

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
             N +GGTDVV W   AVA+G E +++DP IA          V LL++G  C   + E+RLS
Sbjct  595   NARGGTDVVNWAATAVAEGGERDLVDPAIA---AAGRDAAVSLLRVGVRCANPEPERRLS  651

Query  2022  MKEAIKRIREI  2054
             + EA   + EI
Sbjct  652   VAEAASMVEEI  662


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 114/200 (57%), Gaps = 5/200 (3%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGK--SPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K+S  +  G  + W      +PCD    W GV C++ ++ G+RL +M L+G  D  
Sbjct  43   LLNLKKSFADPTGRLEAWSAASPFAPCDAASPWPGVQCYKGSLVGIRLTHMNLSGTFDFG  102

Query  462  ALSNLQGLRMIALANNSFSGPI-PDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
            A++ L  L  + L +N+ SGP+ P    LR L++L++  N FSG I A  FA M  L+KL
Sbjct  103  AVAKLPRLHSVNLKHNALSGPLPPSLGTLRGLRALYLSSNNFSGPIPAAVFANMRWLKKL  162

Query  639  WLSHNGFSGNIPA-SLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            +L +N  +G +PA ++   PRL+ELHL+ N     VP     SL   ++S N+L G IP 
Sbjct  163  YLDNNRITGPLPADAIASAPRLIELHLDHNQIDGPVPSKLPDSLKRFNVSHNRLSGSIPP  222

Query  816  GMA-RFGAKAFEGNPELCGE  872
             +A R+ A +F GNP LCG 
Sbjct  223  SVAVRYDASSFAGNPGLCGS  242



>gb|KHN41064.1| Putative inactive receptor kinase [Glycine soja]
Length=566

 Score =   268 bits (686),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 198/548 (36%), Positives = 291/548 (53%), Gaps = 25/548 (5%)
 Frame = +3

Query  432   MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPD-FDKLRHLKSLFIQGNRFSGEISADY  608
             MGL+G +    L NL  L+ ++L  N+ +G IPD F  L+ L++L++QGN FSG++S   
Sbjct  1     MGLSGSLP-SGLGNLTELQTLSLRFNALTGQIPDDFANLKALRNLYLQGNFFSGQVSDSV  59

Query  609   FAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSG  788
             FA +  L +L L +N FSG I      L RL  L+LE N F+ ++P L    L   ++S 
Sbjct  60    FA-LQNLVRLNLGNNNFSGEISPKFNSLTRLATLYLERNNFTGSIPDLDAPPLDQFNVSF  118

Query  789   NKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC---REDLGKDGGGGAEAQTPENAQRH  959
             N L G IP+  +R    AF GN  LCG+P+ + C    E  GK  GG             
Sbjct  119   NSLTGSIPNRFSRLDRTAFLGNSLLCGKPL-QLCPGTEEKKGKLSGGAIAGIV-------  170

Query  960   SSGMRWlllsivaglllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHss  1139
               G    +L I+  L  +    N+    E +   ++    EV+  +    A + S+  S 
Sbjct  171   -IGSVVGVLLILLLLFFLCRKNNRKNENETLPPEKRVVEGEVVSRESGGSAVAGSVEKSE  229

Query  1140  rrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVV  1319
              RS+S  G+          N  R +F L EL+ ASAEVLG G  G+ YKA +  +G +V 
Sbjct  230   IRSSSGGGAGDNKSLVFFGNVSR-VFSLDELLRASAEVLGKGTFGTTYKATME-MGASVA  287

Query  1320  VKRLKETNKMNKDAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLH  1499
             VKRLK+     K+ F  ++ ++G + HHN++ L  Y++ + EKLVV ++ P GSL  LLH
Sbjct  288   VKRLKDVTATEKE-FSEKIEQVGKMVHHNLVSLRGYYFSRDEKLVVYDYMPMGSLSALLH  346

Query  1500  GDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTD  1679
              + G     L   TR  I  G A G+ Y+H+   T    HGN+KSSNILLT T+E  ++D
Sbjct  347   ANGGVGRTPLNWETRSAIALGAARGIAYIHSHGPTSS--HGNIKSSNILLTKTFEARVSD  404

Query  1680  YAFHPLVSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQK  1850
             +    L   T T   +   +APE     +IS K+DVY  GI++LE++TGK P+ + S  +
Sbjct  405   FGLAYLALPTSTPNRVSGYRAPEVTDARKISQKADVYSFGIMLLELLTGKAPT-HSSLTE  463

Query  1851  GGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKE  2030
              G D+ +WV+  V D   +EV D E+    ++ + +MVKLLQ+   CT    +KR SM  
Sbjct  464   EGVDLPRWVQSVVQDEWNTEVFDMELLRY-QNVEEEMVKLLQLALECTAQYPDKRPSMDV  522

Query  2031  AIKRIREI  2054
                +I EI
Sbjct  523   VASKIEEI  530



>ref|XP_010048494.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g31250 [Eucalyptus grandis]
Length=631

 Score =   270 bits (690),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 195/296 (66%), Gaps = 6/296 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              V V  +RG F L +L+ ASAEVLG+G  GS+YKAAL + G  VVV+R ++ NK+ K+ F
Sbjct  314   LVFVRSDRGRFELQDLLRASAEVLGSGSFGSSYKAAL-LDGPAVVVRRFRQMNKLGKEGF  372

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H N+LPL+A+ YRK+EKL++S+F   GSL   LH +R      L   TR
Sbjct  373   YEHMRRLGSLSHPNLLPLVAFFYRKEEKLLISDFVENGSLASHLHANRSAGQPGLDWPTR  432

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G+EYL+ E     LPHG+LKSSN+LL   + PLLTDY   P+++     Q 
Sbjct  433   LKIVKGVAKGLEYLYKELPVLSLPHGHLKSSNVLLDRNFTPLLTDYGLVPVINKDHAQQF  492

Query  1725  MFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVA  1892
             M A K+PE     + + K+DV+ LGI+ILE++TGKFP+ YL   KG   D+  WV   V 
Sbjct  493   MVAFKSPEFSRSDRTTKKTDVWSLGILILEIITGKFPANYLKQGKGANADLATWVNSVVR  552

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +    EV D ++ G  +  +G+M+KLL+IG  C E DVE+R S++EA++RI E+++
Sbjct  553   EEWTGEVFDKDMRGT-KSGEGEMLKLLKIGMCCCEWDVERRWSLREAMERIEELRE  607


 Score =   160 bits (406),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 122/208 (59%), Gaps = 1/208 (0%)
 Frame = +3

Query  258  LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKT-RRWFGVLCHRKTVTGLRLYNM  434
            ++   G+   LI+F+ SL N   L +      SPC      W GV C+  +V  LRL  M
Sbjct  28   ITCDAGETQSLIKFRGSLSNATALSNWGGSADSPCTAAGSNWTGVWCNNGSVWQLRLDGM  87

Query  435  GLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFA  614
            GL G +D D+L+ L  LR++++  NSFSGP+P+  KL  LKS+ +  N FSG I  D F 
Sbjct  88   GLRGGLDFDSLAELPSLRILSIKGNSFSGPMPEVKKLLALKSVTMSSNWFSGLIPDDMFD  147

Query  615  KMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNK  794
             M  L+ ++L  N F+G +P SL +LPRLV L+L GN     +P   Q  L +++L+ N+
Sbjct  148  GMRALKMVYLDGNMFTGPMPKSLAQLPRLVNLNLAGNQIGGKIPDFPQMELQMVNLADNQ  207

Query  795  LQGEIPSGMARFGAKAFEGNPELCGEPV  878
             +G+IP G++   A  F GN +LCG+P+
Sbjct  208  FEGKIPRGLSNMNASYFAGNKDLCGKPL  235



>gb|AAN40020.1| putative receptor kinase [Zea mays]
Length=665

 Score =   270 bits (691),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 195/311 (63%), Gaps = 24/311 (8%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL+N+    FGL +LM ASAEVLGNG LGSAYKAA+   G+TV VKRL++ N++ ++ 
Sbjct  354   EFVLLNDHIPAFGLPDLMKASAEVLGNGTLGSAYKAAM-RNGVTVAVKRLRDMNRVGREE  412

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  ++ +G L H N+LP + YHYRK+EKL+VSE+ P+GSLLY+LHGD+      L    
Sbjct  413   FEQHVQMLGGLHHPNVLPPVGYHYRKEEKLIVSEYMPRGSLLYILHGDQSPNRLILDWQG  472

Query  1542  RIKIIKGVASGMEYLHTEFAT-----------------YKLPHGNLKSSNILLTPTYEPL  1670
             R+++  GV  G+ +LH                         PHGNLKS NILL    EP 
Sbjct  473   RLRVAVGVVRGLAFLHERLGIPAGRLVSMDGADFDAPPPPPPHGNLKSGNILLDADMEPR  532

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             L DY F PLV+     Q MFA ++PEG     +S +SDVYCLG+V+LE+VTG+FPSQYL 
Sbjct  533   LVDYGFFPLVNAAQAPQAMFAFRSPEGTTRGVVSARSDVYCLGVVLLELVTGRFPSQYLL  592

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
             N +GGTDVV W   AVA+G E +++DP IA          V+LL++G  C   + E+R S
Sbjct  593   NARGGTDVVNWAATAVAEGGERDLVDPAIA---AAGRDAAVRLLRVGVRCANPEPERRPS  649

Query  2022  MKEAIKRIREI  2054
             + EA   + EI
Sbjct  650   VAEAASMVEEI  660


 Score =   147 bits (370),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 115/200 (58%), Gaps = 5/200 (3%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTWVKGK--SPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K+S  +  G  + W      +PCD    W GV C++ ++ G+RL +M L+G  D  
Sbjct  43   LLNLKKSFADPTGRLEAWSAASPFAPCDAASPWPGVQCYKGSLVGIRLTHMNLSGTFDFG  102

Query  462  ALSNLQGLRMIALANNSFSGPI-PDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
            A++ L  L  + L +N+FSGP+ P    LR L++L++  N FSG I A  FA M  L+KL
Sbjct  103  AVAKLPRLHSVNLKHNAFSGPLPPSLGTLRGLRALYLSSNNFSGPIPAAVFANMRWLKKL  162

Query  639  WLSHNGFSGNIPA-SLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            +L +N  +G +PA ++   PRL+ELHL+ N     VP     SL   ++S N+L G IP 
Sbjct  163  YLDNNRITGPLPADAIASAPRLIELHLDHNQIDGPVPSKLPDSLKRFNVSHNRLSGSIPP  222

Query  816  GMA-RFGAKAFEGNPELCGE  872
             +A R+ A +F GNP LCG 
Sbjct  223  SVAVRYDASSFAGNPGLCGS  242



>ref|XP_002310125.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE90575.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=627

 Score =   269 bits (687),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 198/595 (33%), Positives = 287/595 (48%), Gaps = 76/595 (13%)
 Frame = +3

Query  375   RWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHL  554
             +W G+ C +  V  + L   GL G      LS L  LR+++L NNS  GPIPD   L +L
Sbjct  63    QWQGIKCAQGRVVRVVLQGFGLRGTFPPFTLSRLDQLRVLSLQNNSLCGPIPDLSPLFNL  122

Query  555   KSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFS  734
             KSLF+  N FS          +  L  L LS+N  +G +P +L  L RL  L LE N F+
Sbjct  123   KSLFLNHNSFSASFPPSILL-LHRLTILDLSYNNLAGQLPVNLSSLDRLNSLQLEFNQFN  181

Query  735   SAVPPLAQRSLTILDLSGNKLQGEIP--SGMARFGAKAFEGNPELCGEPVGRQCRE----  896
               +P L  R L   ++SGN L G IP    ++RF   +F  NP LCGE + + C+     
Sbjct  182   GTLPSLDLRLLVFFNVSGNNLTGPIPLTPTLSRFDTSSFSLNPFLCGEIINKACKPRSPF  241

Query  897   ------------------DLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvail  1022
                                  + GGG   + TP + Q+ S     L  ++   +L     
Sbjct  242   FDSSASPAASSPAGVPFGQSAQAGGGVVVSITPPSKQKPSRSGVVLGFTVGVSVLKQKQE  301

Query  1023  FNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNE  1202
              +  + +E V T       E LV Q+    +S S+                    V    
Sbjct  302   RHAEEEKEQVVTGTTSPAKEGLVQQVRKAEKSGSL--------------------VFCGG  341

Query  1203  ERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRL--KETNKMNKDAFDAEM  1376
             +  ++ L +LM ASAE+LG G +G+ YKA L    L V VKRL   +T   + D F+  M
Sbjct  342   KTQVYTLEQLMRASAELLGRGTIGTTYKAVLDN-QLIVTVKRLDASKTAITSSDVFERHM  400

Query  1377  RKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKII  1556
               +G LRH N++P+ AY   K E+LV+ ++ P GSL  L+HG R T    L   + +KI 
Sbjct  401   DVVGALRHPNLVPIAAYFQAKGERLVIFDYQPNGSLFNLIHGSRSTRAKPLHWTSCLKIA  460

Query  1557  KGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC-MFA  1733
             + VA G+ Y+H    T  L HGNLKS+N+LL   +E  +TDY    L   + +      A
Sbjct  461   EDVAQGLAYIH---QTSNLVHGNLKSANVLLGADFEACITDYCLAMLADTSSSENPDSAA  517

Query  1734  LKAPEGHQISH----KSDVYCLGIVILEVVTGKFPSQ--YLSNQKGGTDVVQWVRQAVAD  1895
              KAPE  + S     KSDVY  G+++LE++TGK PSQ  YL       D++ WVR    D
Sbjct  518   CKAPETRKASRRATSKSDVYAFGVLLLELLTGKHPSQHPYLV----PADMLDWVRTVRDD  573

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                         G+G+D+   M  L ++ + C+ +  E+R +M + +K I+EI+D
Sbjct  574   ------------GSGDDNQLGM--LTEVASVCSLTSPEQRPAMWQVLKMIQEIKD  614



>ref|XP_008781714.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Phoenix dactylifera]
Length=653

 Score =   268 bits (686),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 196/297 (66%), Gaps = 5/297 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              + V E    F L +L+ ASAEVLG+G  GS+YKA L   G  VVVKR  + N + ++ F
Sbjct  328   LMFVKEGAQRFELQDLLKASAEVLGSGNFGSSYKAVL-FDGPAVVVKRFNKMNGVGREDF  386

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H N+LPL+AY+YRK+EKL+V+++ P GSL ++LHG  G+    L   TR
Sbjct  387   QEHMRRLGRLSHPNLLPLVAYYYRKEEKLLVTDYIPNGSLAHMLHGRGGSNLPPLDWPTR  446

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             ++I+KGVA G+ +L+ E     LPHG+LKSSN+LL  +YEPLLTDYA  P+++ T   Q 
Sbjct  447   LRIVKGVARGLAFLYEELPMLTLPHGHLKSSNVLLNDSYEPLLTDYALVPVMNQTHASQI  506

Query  1725  MFALKAP---EGHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M A K+P   EG + S KSDV+  GI+ILE++TGKFP+ YL   + GTD+  WV   V +
Sbjct  507   MVAYKSPECAEGGRPSRKSDVWSFGILILEILTGKFPANYLRQGRAGTDLASWVNSVVRE  566

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
                 EV D E++GA E+ +G+M KLLQIG  C E D +KR  +   +++I E+++ E
Sbjct  567   EWTGEVFDNEMSGA-ENGEGEMFKLLQIGLGCCEMDAKKRWDLSMVLEKIEELREKE  622


 Score =   169 bits (428),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 127/215 (59%), Gaps = 4/215 (2%)
 Frame = +3

Query  258  LSISVGDDV-VLIEFKESLQNTKG--LDDTWVKGKSPCD-KTRRWFGVLCHRKTVTGLRL  425
            L +S   DV VL++FKE L    G  +   WV G +PC+     W GV+C    V GL+L
Sbjct  23   LRLSHSKDVDVLLKFKERLAPNGGDAVLRNWVAGSTPCEGNVSLWTGVICDSGDVYGLQL  82

Query  426  YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
             +M LAG + +D L +L  LR ++   N F GP+PD  KL  LK++++  NR SG I+  
Sbjct  83   EHMKLAGKLSIDVLVDLPVLRTLSFMGNEFEGPMPDIAKLPALKAIYLSNNRLSGGIADG  142

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
             F K   ++K+ LSHN F+G IP SL  L RL+EL L+ N F   +P L Q  L ++++S
Sbjct  143  LFKKFRSMKKVHLSHNQFTGRIPTSLVGLTRLLELRLDDNNFEGPIPDLRQPGLYLMNIS  202

Query  786  GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             N L+G IP+G+++  A  FEGN  LCG P+   C
Sbjct  203  HNNLEGPIPAGLSKMQASMFEGNKNLCGPPLDISC  237



>ref|XP_011001561.1| PREDICTED: probable inactive receptor kinase At1g48480 [Populus 
euphratica]
Length=625

 Score =   266 bits (681),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 198/582 (34%), Positives = 305/582 (52%), Gaps = 32/582 (5%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLC--HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNS  512
             W    +PC    +W GV C  +R TV  LRL  MGL+G + V AL NL  L+ +++  N+
Sbjct  50    WNLSDNPC----QWVGVFCDQNRSTVVELRLPGMGLSGRLPV-ALGNLTSLQTLSVRFNA  104

Query  513   FSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGK  689
              SGPIP D   +  L++L++QG+ FSGEI  ++  ++  L +L L++N FSG I  S   
Sbjct  105   LSGPIPADIGNIVSLRNLYLQGDFFSGEI-PEFLFRLQNLVRLNLANNNFSGVISPSFNN  163

Query  690   LPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCG  869
             L RL  L+LE N  +  +P L    L   ++S N L G +P  ++     +F+G   LCG
Sbjct  164   LTRLDTLYLEENQLTGTIPDL-NLPLDQFNVSFNNLTGPVPQKLSTKPLSSFQGT-LLCG  221

Query  870   EPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFNKNQNEEN  1049
             +P+       +  +G     +   + +    +G+    +     LL++ I   + + ++ 
Sbjct  222   KPL-------VSCNGASNGNSNDDKLSAGAIAGIAVGCVIGFLLLLMILIFLCRRKRDKT  274

Query  1050  VKTRRKDNLDEVLVVQIASMARSE----SINHssrrststegsssrggDFVLVNEERGMF  1217
             V ++  +   E+ V   +  A  E    S  H+     S   SS         N  R  F
Sbjct  275   VGSKDVELPKEIAVEIPSGKAAGEGGNVSAGHAVAVVKSEAKSSGAKNLVFFGNTARA-F  333

Query  1218  GLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLR  1397
             GL +L+ ASAEVLG G  G+AYKA L V GL V VKRLKE     K+ F  ++   G + 
Sbjct  334   GLEDLLKASAEVLGKGTFGTAYKATLDV-GLVVAVKRLKEVMVPEKE-FREKIEGAGKMN  391

Query  1398  HHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGM  1577
             H N++PL AY+Y + EK +V ++ P GSL  LLHG++G+    L   TR  I  G A G+
Sbjct  392   HENLVPLRAYYYSQDEKFLVHDYMPMGSLSALLHGNKGSGRTPLNWETRSGIALGAARGI  451

Query  1578  EYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE---  1748
              Y+H++       HGN+KSSNILLT + E  ++D+    L   TP    +   +APE   
Sbjct  452   AYIHSQGPASS--HGNIKSSNILLTTSLEARVSDFGLAHLAGLTPAPNRIDGYRAPEVTD  509

Query  1749  GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEI  1928
               ++S K+DVY  GI++LE++TGK P+    N + G D+ +WV+  V +   +EV D E+
Sbjct  510   ARKVSQKADVYSFGILLLELLTGKAPTHSQLNDE-GVDLPRWVQSVVKEEWTAEVFDLEL  568

Query  1929  AGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
                 +  +  MV+LLQ+   CT    + R SM +   +I ++
Sbjct  569   LRY-QTVEEDMVQLLQLAIDCTAQYPDNRPSMSKVRSQIEDL  609



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   267 bits (682),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 198/611 (32%), Positives = 305/611 (50%), Gaps = 43/611 (7%)
 Frame = +3

Query  276   DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR--KTVTGLRLYNMGLAGD  449
             D   L+EF  S+ + + L+  W      C     W GV C++    V  + L  +GL G 
Sbjct  40    DRQALLEFANSVPHIRKLN--WNLALPIC---YSWAGVTCNKDGTRVIAIHLPAVGLFGP  94

Query  450   IDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTG  626
             I  +++  L  L++++L  N  +G +P D   +  L+S+++Q N FSG+I      ++  
Sbjct  95    IPANSIGKLDALKVLSLRANYLNGSLPSDLLSIPSLQSVYLQHNNFSGDIPVSLSPRLGV  154

Query  627   LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
             L    LS N F+G IP ++  L RL  L+L+ N  +  +P L    L +L+LS N L G 
Sbjct  155   LD---LSFNSFTGKIPTTIKSLSRLSVLNLQFNSLTGEIPSLDTLKLNLLNLSYNMLNGS  211

Query  807   IPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlll  986
             +P+ + +F   +F GN  LCG P+   C  +             PE  +  +S       
Sbjct  212   VPNSLQKFPLSSFVGNSRLCGTPL-ISCSLNSPSPSPAADSLSPPERPKTVTSKKLSTGT  270

Query  987   sivaglllvailFN----------KNQNEENVKTRRKDNLDEVLVVQIASMARSESINHs  1136
              I   ++  +++F           K +  +N  T ++        V +A+  RSE     
Sbjct  271   IIAIAVVASSLIFLLVLVISFCCLKKKVSDNTSTIKEK-------VALANGGRSEKTEDF  323

Query  1137  srrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTV  1316
                    E +       V        F L +L+ ASAEVLG G  G+AYKA L    + V
Sbjct  324   GSGVPDAEKN-----KLVFFEGCAYSFNLEDLLRASAEVLGKGSYGTAYKAVLDEATI-V  377

Query  1317  VVKRLKETNKMNKDAFDAEMRKMGML-RHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYL  1493
             VVKRL+E     K+ F+  M  +G + RH NI+PL AY+Y K EKL+V+E+ P GSL   
Sbjct  378   VVKRLREVGAAKKE-FEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAA  436

Query  1494  LHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLL  1673
             LHG+RG     L   TR+KI  G A G+ ++HTE    K  HGN+KSSN+LLT   +  +
Sbjct  437   LHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTE-GGVKFTHGNIKSSNVLLTRDQDGCI  495

Query  1674  TDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDVYCLGIVILEVVTGKFPSQYLSN  1844
             +D+   PL++  P        +APE  +    + KSDVY  G+++LE++T K P   LS 
Sbjct  496   SDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIP-LSG  554

Query  1845  QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSM  2024
                  D+ +WVR  V +   +EV D E+    ++ + +MV++LQIG AC     + R SM
Sbjct  555   HDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQMLQIGLACVAKVPDMRPSM  613

Query  2025  KEAIKRIREIQ  2057
              + ++ I EI+
Sbjct  614   GQVVRMIEEIR  624



>ref|XP_003577341.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Brachypodium distachyon]
Length=679

 Score =   267 bits (683),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 201/312 (64%), Gaps = 20/312 (6%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDA  1361
             +FVL++   G FGL ++M ASAEVLGNG LGSAYKAA+   G+TV VKR+++ N++ ++ 
Sbjct  366   EFVLMSRASGEFGLQDMMKASAEVLGNGTLGSAYKAAM-RNGITVAVKRMRDMNRVGREE  424

Query  1362  FDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAAT  1541
             F+  +R +  LRH N+L  L YHYRK+EKL+VSEF P+GSLLY+LHGD+      L    
Sbjct  425   FENHLRMLCELRHPNVLSPLGYHYRKEEKLIVSEFMPRGSLLYVLHGDQSPNRVVLDWWA  484

Query  1542  RIKIIKGVASGMEYLHTEFATYKL-----------------PHGNLKSSNILLTPTYEPL  1670
             R++I  GVA GM YLH +     +                 PHGNLKS NILL    +P 
Sbjct  485   RLRIAVGVARGMAYLHEKLGMPAMRFVSMDGADFDAPPPPPPHGNLKSGNILLDAELQPR  544

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQ--ISHKSDVYCLGIVILEVVTGKFPSQYLSN  1844
             + DY F PLV+       MFA ++PE +   +S +SDVYCLG+V+LE+VTG+FPSQYL N
Sbjct  545   IVDYGFFPLVNAPQLAGAMFAFRSPEANTPGVSARSDVYCLGVVLLELVTGRFPSQYLVN  604

Query  1845  QKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSM  2024
              +GGTDVVQW   AV +G E E++DP +A AG  + G  V+++++   CT S  E R +M
Sbjct  605   VRGGTDVVQWAAAAVLEGCEHELVDPVVAAAGPAAVGGAVRMVRVAGECTISAPESRPNM  664

Query  2025  KEAIKRIREIQD  2060
              EA + + E+ +
Sbjct  665   AEAARMVEEVAN  676


 Score =   144 bits (364),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 105/178 (59%), Gaps = 3/178 (2%)
 Frame = +3

Query  351  KSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPI-  527
             +PC+ T  W GV C    + GLRL    L+G  D  AL+NL GL  I L +N+F+GP+ 
Sbjct  58   STPCNATHPWHGVQCDNGGLIGLRLVRHNLSGKFDFGALANLPGLHTINLRHNAFAGPLP  117

Query  528  PDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIP-ASLGKLPRLV  704
            P    +R L++L++  N FSG +  D F  M  L+KL+L +N  +G +P A++   PRL+
Sbjct  118  PSLGTVRSLRALYLSHNAFSGPVPGDVFGNMRWLKKLYLDNNELTGPLPAAAIAGAPRLL  177

Query  705  ELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMA-RFGAKAFEGNPELCGEP  875
            ELHL+ N     VP L   SL + ++S N+L G +P  +A RF   AF GNP LCG P
Sbjct  178  ELHLDHNRIDGPVPELLPASLRLFNVSHNRLTGSLPRAVATRFNESAFAGNPGLCGAP  235



>ref|XP_010548524.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g31250 [Tarenaya hassleriana]
Length=653

 Score =   266 bits (680),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/292 (48%), Positives = 191/292 (65%), Gaps = 6/292 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              V  +R  F L +++ ASAEVLG+GG GS+YKA L   G  VVVKR +  N M K+ F  
Sbjct  328   FVRNDREKFTLQDMLRASAEVLGSGGFGSSYKAVLSS-GCAVVVKRFRYMNNMGKEEFYD  386

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              ++K+G L H N+LPL+A++YR++EKL+VS+F P GSL  LLH +R      L    R+K
Sbjct  387   HLKKIGRLSHPNLLPLIAFYYRREEKLLVSDFIPNGSLANLLHANRTPGQVVLDWPIRLK  446

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             II+GVA G+ YL+  F    LPHGNLKSSN+LL   +EPLLTDYA  P+V+     Q   
Sbjct  447   IIRGVARGLAYLYRVFPDLNLPHGNLKSSNVLLDHNFEPLLTDYALVPVVNKEQAQQFTV  506

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTD-VVQWVRQAVADG  1898
             A K+PE  Q   IS KSDV+ LGI+ILEV+TGKFP+ YL   KG  D +  WV       
Sbjct  507   AYKSPEFTQQDRISRKSDVWSLGILILEVLTGKFPANYLRQGKGANDELAAWVESIARTE  566

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
               SEV D ++ G G++ +G+M+KLL+IG  C++ D+E+R+ + EA+ RI E+
Sbjct  567   WTSEVFDKDM-GVGKEHEGQMLKLLKIGLRCSDWDMERRIELNEAVDRIEEL  617


 Score =   153 bits (387),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 124/216 (57%), Gaps = 8/216 (4%)
 Frame = +3

Query  267  SVGDDV-VLIEFKESLQN--TKGLDDTWVKGKSPCD---KTRRWFGVLCHRKTVTGLRLY  428
            S G DV  L+ FK SL N  T+ L         PCD       W GV+C    V  +RL 
Sbjct  24   SSGADVEALLAFKSSLVNASTEELRSWDAAVAPPCDAGGNGSSWKGVMCSNGVVFAVRLE  83

Query  429  NMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPD-FDKLRHLKSLFIQGNRFSGEISAD  605
            NM L+G +D  AL  L+GLR ++   N+F G +P     L  L  L++  NRFSGE+  D
Sbjct  84   NMSLSGALDFHALGGLRGLRSLSFMYNAFEGTMPGGVSGLVSLVHLYLAYNRFSGEVGED  143

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
             FA +  LR++ L  N FSG IP SL +LP+LVE++LEGN FS  +P   Q+ L +++++
Sbjct  144  VFAGLRQLRRVHLEGNRFSGEIPMSLARLPKLVEMNLEGNLFSGNIPWFDQKDLVMVNVA  203

Query  786  GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
             N+L+G IP  ++   +  F GN +LCG P+G  CR
Sbjct  204  NNRLEGRIPRTLSDMNSTFFTGNKDLCGRPLG-PCR  238



>ref|XP_009418877.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Musa acuminata subsp. malaccensis]
Length=615

 Score =   265 bits (676),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 195/295 (66%), Gaps = 6/295 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
                V E R  F + +L+ ASAEVLG+G  GS+YKA L V    VVVKR KE N + ++ F
Sbjct  321   LTFVAEGRRKFDMQDLLKASAEVLGSGNFGSSYKATL-VDAPAVVVKRFKEMNGVGREDF  379

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H N+LPL+AY+YRK+EKL+++EF PKGSL ++LHG+RG+  + L   TR
Sbjct  380   QEHMRRLGRLSHSNLLPLVAYYYRKEEKLLITEFVPKGSLAHMLHGNRGSTESPLDWPTR  439

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             + I+KGVA G+ YL+ E     +PHG+LKSSN+LL  +  PLL DYA  P+++     + 
Sbjct  440   LNIVKGVARGLAYLYEELPMLTVPHGHLKSSNVLLDQSLAPLLADYALVPVMNKATASKV  499

Query  1725  MFALKAPEGH---QISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT-DVVQWVRQAVA  1892
             M A K+PE     + S KSDV+C GI+ILE++TG+FP+ +L+  K G  D+  WV +  +
Sbjct  500   MVAYKSPECARHGKPSKKSDVWCFGILILEILTGEFPANHLTQGKAGAGDLASWVSRIAS  559

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             + + S V D  + G  E+++G+M+KLLQI  AC E+D E R  +   +++I EI+
Sbjct  560   EERASPVFDKNMKGT-ENNEGEMLKLLQIAMACCETDDESRWELMTVLEKIEEIK  613


 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 5/215 (2%)
 Frame = +3

Query  261  SISVGDD-VVLIEFKESLQNTKG--LDDTWVKGKSPC--DKTRRWFGVLCHRKTVTGLRL  425
            S+++ DD  VL++F+ +L +  G     +W  GK PC       W GV C    V+ L+L
Sbjct  22   SVAMSDDGRVLLQFRATLSSGGGDAALSSWAGGKGPCMDQNVSAWTGVYCENGNVSTLQL  81

Query  426  YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
             NMGL+G +D+D L+ L GLR ++ +NNSF GP+PDF KL  LKS+++  NRFSGEI   
Sbjct  82   ENMGLSGKLDLDILTGLLGLRSLSFSNNSFEGPVPDFTKLPALKSIYLSMNRFSGEIPDG  141

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
             F+ M  L+K+WLSHN  SG IP+SL    +L+E+ L+GN F   +P L Q  L ++++S
Sbjct  142  MFSAMRALKKVWLSHNNLSGRIPSSLTVPTKLMEVGLDGNKFEGKLPDLRQPELRMVNVS  201

Query  786  GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             N L+G IP  ++   A  FEGN  LCG P+G  C
Sbjct  202  YNNLEGPIPERLSNMSASLFEGNKNLCGAPLGVSC  236



>gb|EMT28754.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=607

 Score =   264 bits (675),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 187/305 (61%), Gaps = 30/305 (10%)
 Frame = +3

Query  1218  GLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLR  1397
             G  ++M ASAEVLGNG LGSAYKAA+   G+TV VKR+++ N++ ++ F+  +R +G LR
Sbjct  300   GAMDMMKASAEVLGNGTLGSAYKAAM-RNGITVAVKRMRDMNRVGREEFENHLRVLGELR  358

Query  1398  HHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGM  1577
             H N+L  L YHYRK+EKL+V E  P+GSLLY+LHGD+      L   TR++I  GVA GM
Sbjct  359   HPNVLAPLGYHYRKEEKLIVFELMPRGSLLYVLHGDQSPNRVVLDWPTRLRIALGVARGM  418

Query  1578  EYLHTEFATYKL-----------------PHGNLKSSNILLTPTYEPLLTDYAFHPLVSG  1706
              YLH +     +                 PHGNLKS NILL    EP + DY F PLV+ 
Sbjct  419   AYLHEKLGMPTMRFVSMDGADFDAPPPPPPHGNLKSGNILLDANLEPHIVDYGFFPLVNA  478

Query  1707  TPTLQCMFALKAPEGHQ---------ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGT  1859
                 Q +FA ++PE            +S +SDVYC G+V+LE++TG+FPSQYL N +GGT
Sbjct  479   PQAPQALFAFRSPEAVAALQQQQRVPVSARSDVYCFGVVLLELITGRFPSQYLLNARGGT  538

Query  1860  DVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIK  2039
             DVV W   AV +G E EV+DP IA AG    G  V+L++I   CT+   E R +M E  +
Sbjct  539   DVVHWAAAAVTEGSEHEVVDPVIAAAG---GGSAVQLVRIAVECTDPAPESRPNMAEVAR  595

Query  2040  RIREI  2054
              + E+
Sbjct  596   MVEEV  600


 Score =   157 bits (398),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 120/201 (60%), Gaps = 5/201 (2%)
 Frame = +3

Query  288  LIEFKESLQNTKGLDDTW--VKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVD  461
            L+  K S ++     + W  +   +PC+ +R W GV C + ++ GLRL ++ L+G  D  
Sbjct  42   LLRLKASFKDPTNALEAWSPLLPPAPCNASRPWPGVQCFKGSLIGLRLVHLNLSGAFDFA  101

Query  462  ALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKL  638
            AL+NL GL  I L  N+F+GP+P     +R L++L++  N F+G I  D F  M  L+KL
Sbjct  102  ALANLPGLHSINLRRNAFAGPLPASLATVRSLRALYLSHNAFTGPIPGDVFTNMRWLKKL  161

Query  639  WLSHNGFSGNIP-ASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPS  815
            +L +N  SG +P A++   PRL+ELHL+ N    AVP L  +SL + ++S N+L G +P 
Sbjct  162  YLDNNDLSGPLPAAAIAGAPRLIELHLDHNKIEGAVPELLPKSLRLFNVSHNRLTGVLPR  221

Query  816  GMA-RFGAKAFEGNPELCGEP  875
             +A RF   AF GNP LCG P
Sbjct  222  AVATRFNESAFAGNPALCGAP  242



>ref|XP_010913795.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Elaeis guineensis]
Length=653

 Score =   265 bits (677),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 196/297 (66%), Gaps = 5/297 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              + V E    F L +L+ ASAEVLG+G  GS+YKA L   G  VVVKR  + N + ++ F
Sbjct  328   LMFVKEGAQRFELQDLLKASAEVLGSGNFGSSYKAIL-FDGPAVVVKRFNKMNGVGREDF  386

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H ++LPL+AY+YRK+EKL+V+++ P GSL ++LHG  G+    L   TR
Sbjct  387   QEHMRRLGRLSHPSLLPLVAYYYRKEEKLLVTDYIPNGSLAHMLHGRGGSNIPPLDWPTR  446

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G+ +L+ E     +PHG+LKSSN+LL  +YEP+LTDYA  P+++ T   Q 
Sbjct  447   LKIVKGVARGLAFLYEELPMLTVPHGHLKSSNVLLDDSYEPILTDYALVPVMNQTHASQI  506

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M A K+PE  +    S KSDV+  GI+ILE++TGKFP+ YL   + GTD+  WV   V +
Sbjct  507   MVAYKSPECAERGRPSRKSDVWSFGILILEILTGKFPANYLRQGRAGTDLASWVNSVVKE  566

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
                 EV D E+ G  ++ +G+M+KLLQIG  C E DVEKR  ++ A+ +I E+++ E
Sbjct  567   EWTGEVFDNEMGGT-KNGEGEMLKLLQIGLGCCEMDVEKRWDLRMAVDKIEELREKE  622


 Score =   160 bits (406),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 134/235 (57%), Gaps = 4/235 (2%)
 Frame = +3

Query  198  RIPTFPLIFFSFCLILQCLPLSISVGDDV-VLIEFKESLQNTKG--LDDTWVKGKSPCD-  365
            R   +P       L L    L +S   DV VL++FKESL    G  +   WV G +PC+ 
Sbjct  4    RASPWPPRLLMLILTLMASSLHLSHSTDVDVLLKFKESLAPNGGDAVLQNWVAGTTPCNV  63

Query  366  KTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKL  545
                W GV+C    V GL+L  M L+G + +D L +L  LR ++  NN F GP+P  +KL
Sbjct  64   NVSLWTGVICDTGDVYGLQLEKMKLSGLLSIDILVDLPFLRTLSFMNNDFEGPMPKIEKL  123

Query  546  RHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGN  725
              LKS+++  NRFSGEI+   F K   ++K+ LSHN F+G IP SL  L RL+EL L+ N
Sbjct  124  PALKSIYLSNNRFSGEIADGVFKKFRSMKKVHLSHNQFTGRIPTSLLGLTRLLELRLDDN  183

Query  726  GFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
             F   +P L Q  L ++++S N L+G IP+ +++  A  FEGN  LCG P+   C
Sbjct  184  KFEGPIPDLRQPGLYLVNMSYNNLEGPIPARLSKMKASMFEGNKNLCGPPLDISC  238



>ref|XP_004169814.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Cucumis 
sativus]
Length=782

 Score =   268 bits (685),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 187/593 (32%), Positives = 292/593 (49%), Gaps = 53/593 (9%)
 Frame = +3

Query  315   NTKGLDDTWVKGKSPCDKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMI  494
             N   L+  W       ++   W+G+ C    VT + L ++GL G ++  A +    L ++
Sbjct  204   NDTFLNRNWTGTHCHNNQPPLWYGLQCVDGRVTAISLDSLGLVGKMNFRAFNKFTELSVL  263

Query  495   ALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIP  674
             +L NNS SG                  N FS       F     ++ + LS N F G+IP
Sbjct  264   SLKNNSLSG------------------NVFS-------FTSNQKMKTIDLSFNAFDGSIP  298

Query  675   ASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSG--MARFGAKAFE  848
              SL  L  L  L L+ N F+ ++P   Q SL + ++S N L G IP    +  FGA ++ 
Sbjct  299   VSLVSLTSLESLQLQNNRFTGSIPEFNQSSLAVFNVSNNNLNGFIPRTKVLQSFGAGSYV  358

Query  849   GNPELCGEPVGRQCREDLGKDGGGGAEAQTPENAQRHSSGMRWlllsivaglllvailFN  1028
             GNP LCG P    C   +       A   T +    +SS    ++L ++           
Sbjct  359   GNPGLCGPPSDAVCNSIIKGSKATAAPPDTNKATNDNSSSKAHVILLLILV---------  409

Query  1029  KNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEER  1208
                    +K R    L + L        ++ES+   S ++     +++      L+  E 
Sbjct  410   -------IKHRELKELIKKLGSNETKEKKNESMTDISIQNQQPAEAAAADEGGKLIFTEE  462

Query  1209  G-MFGLSELMMASAEVLGNGGLGSAYKAALPVIGLT-VVVKRLKETNKMNKDAFDAEMRK  1382
             G  F L +L+ ASAE LG G  G++YKA L   G + +VVKRL++   +  D F  +++ 
Sbjct  463   GENFQLGDLLKASAEGLGKGIFGNSYKAMLE--GRSPIVVKRLRDLKPLTVDEFMKQVQL  520

Query  1383  MGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKG  1562
             +  LRH N+LPL+AY Y K+EKL++ ++  KG+L   +HG RG      + ++R+ + +G
Sbjct  521   IAKLRHPNLLPLVAYFYTKEEKLLLYKYAEKGNLFDRIHGRRGVGRVPFRWSSRLIVAQG  580

Query  1563  VASGMEYLH--TEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFAL  1736
             VA  +E+LH  ++  T  +PHGNLKSSN+LL    E L++DY F  L++     QCM + 
Sbjct  581   VARALEFLHLNSKPNTINVPHGNLKSSNVLLGENDEVLVSDYGFASLIALPIAAQCMVSY  640

Query  1737  KAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKES  1907
             ++PE  Q   +S KSDV+  G +++E++TGK  S     +  G D+  WV +AV +   +
Sbjct  641   RSPEYQQMKRVSRKSDVWSFGCLLIELLTGKISSHSAPEESHGIDLCAWVNRAVREEWTA  700

Query  1908  EVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
             E+ D EIA       G M+ LLQI   C+    +KR  M E  K I  I+ +E
Sbjct  701   EIFDSEIASQRSAIPG-MLNLLQIAIHCSNVSPDKRPEMSEVAKEIENIKLIE  752



>gb|KDO67159.1| hypothetical protein CISIN_1g008431mg [Citrus sinensis]
Length=565

 Score =   263 bits (671),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 137/294 (47%), Positives = 196/294 (67%), Gaps = 6/294 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              VN +R MF L++L+ ASAEVLG+G  GS+YKA L + G  +VVKR ++ + + K+ F  
Sbjct  240   FVNNDREMFELNDLLRASAEVLGSGSFGSSYKAVL-LTGPAMVVKRFRQMSNVGKEDFHE  298

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              M ++G L H N+LPL+A++YRK+EKL+VS+F P GSL  LLH  R      L    R+K
Sbjct  299   HMTRLGSLSHPNLLPLIAFYYRKEEKLLVSDFVPNGSLANLLHVRRAPGQPGLDWPIRLK  358

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             IIKGVA G+ YL+ EF    LPHG+LKSSN+LL   YEPLLTDYA  P+V+       M 
Sbjct  359   IIKGVAKGLAYLYKEFPGVTLPHGHLKSSNVLLDNAYEPLLTDYALVPIVNKEHAQLHMV  418

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
             A K+PE +Q   ++ K+DV+ LGI+ILE++TGKFP+ YL+  KG   D+  WV   V + 
Sbjct  419   AYKSPEFNQTDGVTRKTDVWSLGILILELLTGKFPANYLAQGKGANADLATWVNSVVREE  478

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                EV D ++ G  +  +G+M+KLL+IG  C E + E+R  ++EA+++I E+++
Sbjct  479   WTGEVFDKDMRGT-KSGEGEMLKLLKIGMCCCEWNAERRWDLREAVEKIMELKE  531


 Score =   145 bits (367),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +3

Query  432  MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
            M L G IDVD LS L GLR ++  NNSF GP+P   KL  L++L++  N+F+GEI +D F
Sbjct  1    MNLMGMIDVDTLSRLPGLRSLSFINNSFDGPMPSVGKLT-LRALYLSLNKFTGEIPSDAF  59

Query  612  AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
            A M  L+K+ L+ N FSG IP SL  L +L++L+LEGN F   +P      LT+LDLS N
Sbjct  60   AGMDQLKKVHLARNHFSGQIPKSLAGLQKLLQLNLEGNSFQGKIPDFPLAHLTLLDLSYN  119

Query  792  KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
            +L G IP  ++ F A +F+GN  LCG+P+   C+  + K
Sbjct  120  QLVGRIPDTLSNFDATSFQGNKGLCGKPL-EACKSSISK  157



>ref|XP_004503557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK-like [Cicer arietinum]
Length=631

 Score =   264 bits (675),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 198/301 (66%), Gaps = 8/301 (3%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              + ++R  F L EL+ ASAE+LG+G   S+YKA+L + G T+VVKR K+ N + K+ F  
Sbjct  328   FIRDDRERFDLQELLRASAEILGSGCYSSSYKASL-MNGPTIVVKRFKQMNNVGKEEFQE  386

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MR++G L H N++PL+AY+YRK+EKL+V++F   GSL   LHG +      L    R+K
Sbjct  387   HMRRIGKLNHPNLIPLVAYYYRKEEKLLVTDFVQNGSLAVRLHGHQALGEPSLDWPIRLK  446

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I+KG+A G+EYL+ +  +   PHGNLKS+N+LLT T+EPLLTDY   P+ +       M 
Sbjct  447   IVKGIARGLEYLYKDMPSLIAPHGNLKSANVLLTQTFEPLLTDYGLVPVTNQEMAKDIMV  506

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
               K+PE  Q   I+ KSDV+CLGI+I+E++TGKFP+ +L   KG    +  WV   V + 
Sbjct  507   IYKSPEYLQQGRITKKSDVWCLGILIIEILTGKFPATFLQQGKGSEVSLANWVDSVVPEE  566

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI--QDVEVF  2072
               S V D E+ GA  + +G+MVKLL+I  +C E DV+KR  +KEA+++I+EI  +D E F
Sbjct  567   WNSSVFDKEM-GATINGEGEMVKLLKIAVSCCEGDVDKRCDLKEAVEKIQEINERDSEEF  625

Query  2073  H  2075
             +
Sbjct  626   Y  626


 Score =   187 bits (476),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 142/225 (63%), Gaps = 3/225 (1%)
 Frame = +3

Query  216  LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTK--GLDDTWVKGKSPCDKTR-RWFG  386
            L+F +F ++   +  S +  D  +L++ KESLQ++K      +W    SPC+     WFG
Sbjct  14   LLFITFFILSCVVESSYAASDSEILLKVKESLQSSKNNAFLSSWNTSSSPCNGDHANWFG  73

Query  387  VLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
            V C++  + GL+L NMGL+G IDVD+L  L  LR I+  NN F G  P+ +KL  LKS++
Sbjct  74   VRCYQGKLWGLKLENMGLSGVIDVDSLRELPFLRTISFMNNDFDGDWPEINKLVGLKSIY  133

Query  567  IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
            +  N+FSGEI  + F  M  L+K+ LS+N F+G IP+S+  LP+LVEL L+GN F+  +P
Sbjct  134  LSNNKFSGEIPMETFEGMQWLKKIHLSNNQFTGLIPSSVVLLPKLVELRLDGNKFTGPLP  193

Query  747  PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG  881
             L Q  L    ++ N+LQG+IP+ +++  A AF GN +LCG P+ 
Sbjct  194  HLRQSKLKSFSVANNQLQGQIPTTLSKIAASAFAGNEDLCGTPLA  238



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   264 bits (675),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 207/633 (33%), Positives = 315/633 (50%), Gaps = 52/633 (8%)
 Frame = +3

Query  219   IFFSFCLI-LQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             +F   CL+ + C  LS    D   L+ F  ++ + + L+  W      C     W G+ C
Sbjct  13    LFVIVCLLPVACGDLS---SDKQALLAFSAAVPHGRKLN--WNPASPICTT---WIGINC  64

Query  396   HR--KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLF  566
                 + V GLRL  +GL G I  + L  L+ LR+++L +N  SG +P D   L  L  LF
Sbjct  65    SVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSNRLSGNLPSDILSLPSLHYLF  124

Query  567   IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
             +Q N FSG+I      +++ L    LS N  +G+IP ++  L RL  L L+ N  S  +P
Sbjct  125   LQKNNFSGDIPTSISPQLSVLD---LSFNSLTGSIPLTIRNLTRLTALSLQNNSLSGPIP  181

Query  747   PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
              L    L  L+LS N L G IPS + +F   +F GN  LCG P+   C   L       +
Sbjct  182   DLGLPRLRRLNLSYNHLNGTIPSSLQKFPNSSFVGN-SLCGLPLN-PCFHALPPSPSPSS  239

Query  927   EAQTPENAQRHSSGMRWlllsivagll------------lvailFNKNQNEENVKTRRKD  1070
                  E  +R  S  +  L +I+A  +            L    F K QN+   + +   
Sbjct  240   MFPPSEGPRRQRSSKKLPLGAIIAIAVGGAALLFLVALVLFLCCFKKKQNDAGTEPK---  296

Query  1071  NLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAE  1250
                    V+ + + R+E  +            +      V        F L +L+ ASAE
Sbjct  297   -------VKSSGIGRAEKPSEEFGSGVQEPEKN----KLVFFEGCSYNFDLEDLLRASAE  345

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGML-RHHNILPLLAY  1427
             VLG G  G+AYKA L     TVVVKRLKE     +D F+ +M  +G + +H NI+PL AY
Sbjct  346   VLGKGSFGTAYKAVLEE-STTVVVKRLKEVIVGKRD-FEQQMEIIGRVGQHPNIVPLRAY  403

Query  1428  HYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATY  1607
             +Y K EKL+V ++ P GSL  LLHG++ T    L   +R+K+  G A G+ +LH+     
Sbjct  404   YYSKDEKLLVYDYYPNGSLASLLHGNKTTGRAPLDWESRVKMSLGAARGIAHLHS-IGGA  462

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDV  1778
             K  HGN+KSSN+LL    +  ++D+   PL++   T       +APE  +    +HKSDV
Sbjct  463   KFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEVMETRKHTHKSDV  522

Query  1779  YCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             Y  G+++LE++TGK P Q  S ++   D+ +WV+  V +   +EV D E+    ++ + +
Sbjct  523   YSFGVILLEMLTGKQPIQSPS-REDIVDLPRWVQSVVREEWTAEVFDVELM-RFQNIEEE  580

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             MV++LQI  AC     + R S+ E ++ I E++
Sbjct  581   MVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVR  613



>ref|XP_007014565.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY32184.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=629

 Score =   264 bits (674),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 199/297 (67%), Gaps = 7/297 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
               +++R  F L +L+ ASAE+LG+G  GS+YKA LP  G  +VVKR K+ N + K+ F  
Sbjct  323   FTSDDRERFDLPDLLKASAEILGSGCFGSSYKAVLPN-GPEMVVKRYKQMNNVGKEEFQE  381

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MR++G LRH+N+LPL+AY+YRK+EKL++S+F   GSL   LHG +      L   TR+K
Sbjct  382   HMRRIGRLRHNNLLPLVAYYYRKEEKLLISDFVQNGSLAVHLHGHQSLGQPGLDWPTRLK  441

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I+KGVA G+ YL+ E  +   PHG+LKSSN+LL  ++EPL+TDY   P+++     + M 
Sbjct  442   IVKGVAKGLAYLYKELPSLIAPHGHLKSSNVLLNESFEPLITDYGLIPVINQESAQELMV  501

Query  1731  ALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
             A K+PE     +I+ K+DV+ LGI+ILE++TGKFP+ +L   KG   D+  WV   V + 
Sbjct  502   AYKSPEYVHHGRITKKTDVWGLGILILEILTGKFPANFLQKGKGSEEDLATWVSLVVGEE  561

Query  1899  KES-EVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
               + EV D E+ G   D DG+M+KLL+IG +C E D EKRL +K+AI+RI E+++ +
Sbjct  562   MSTEEVFDKEM-GKASDRDGEMLKLLKIGLSCCEVDAEKRLDIKDAIQRIEELKETD  617


 Score =   209 bits (533),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 151/244 (62%), Gaps = 4/244 (2%)
 Frame = +3

Query  213  PLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR-RWFGV  389
            P++   F L+      S ++ D  +L++FK SL N   L + W   K PC+ +R  W GV
Sbjct  7    PMLLIMFLLLSMIFVSSYALSDIEILLKFKSSLSNDTALGN-WENNKPPCNGSRANWLGV  65

Query  390  LCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
            LC   T+ GL+L NMGL+G IDV++L++L GLR ++  NN+F GPIP+  KL  LKS+++
Sbjct  66   LCDNGTIWGLQLENMGLSGTIDVNSLTSLSGLRTLSFMNNNFDGPIPELKKLNALKSIYL  125

Query  570  QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
              NRFSGEI  + FA M  L+KL LS N F G IP SL  LP+L+EL L+GN FS  +P 
Sbjct  126  SKNRFSGEIPGNAFAGMIWLKKLHLSQNEFMGAIPESLATLPKLLELKLDGNQFSGQIPD  185

Query  750  LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAE  929
              Q+ L I+DLS N L+G IP+ +++  A  F GN  LCG P+ + C +    D   G+ 
Sbjct  186  FKQKDLQIVDLSNNGLEGSIPASLSKMNASMFSGNKGLCGLPL-KTC-DSPAADSNSGSS  243

Query  930  AQTP  941
            ++ P
Sbjct  244  SKKP  247



>ref|XP_008783081.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Phoenix dactylifera]
Length=668

 Score =   265 bits (676),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 195/297 (66%), Gaps = 5/297 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
                V E    F L EL+ ASAEVLG+G  GS+YKA L   G TVVVKR  + N   ++ F
Sbjct  343   LTFVKEGVQRFELQELLKASAEVLGSGNFGSSYKAIL-FDGPTVVVKRFNKMNAAGREDF  401

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H N+LPL+AY+Y+K+EKL+V+ + P GSL ++LHG  G+A   L   TR
Sbjct  402   QEHMRRLGRLSHPNLLPLVAYYYKKEEKLLVTHYIPNGSLAHMLHGRGGSALRPLDWPTR  461

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G+ +L+ E     +PHG+LKSSN+LL  ++EPLLTDYA  P+++ T   Q 
Sbjct  462   LKIVKGVARGLAFLYEELPMLTVPHGHLKSSNVLLDDSFEPLLTDYALVPVMNQTHASQI  521

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M A K+PE  +    S KSD +  GI++LE++TG+FP+ YL   + GTD+  WV   V +
Sbjct  522   MVAYKSPECAERGRPSRKSDAWSFGILMLEILTGRFPANYLRQGRAGTDLASWVNSVVRE  581

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVE  2066
                 EV D EI+G  +D +G+M+KLLQI   C E+DV+KR  ++ A+++I  +++ E
Sbjct  582   EWTGEVFDKEISGT-KDGEGEMLKLLQIALGCCETDVDKRWDLRMALEKIEGLREKE  637


 Score =   177 bits (450),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 139/233 (60%), Gaps = 5/233 (2%)
 Frame = +3

Query  204  PTFPLIFFSFCLILQCLP-LSISVGDDVVLIEFKESLQNTKGLDDT--WVKGKSPCD-KT  371
            P +PL      LIL     LS+S   DV L++FKE+L    G      WV G +PC+   
Sbjct  7    PWWPLRPLMVLLILTASSHLSLSEDADV-LLKFKETLAANGGGAALGNWVAGSTPCNGNA  65

Query  372  RRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRH  551
              W GV+C+   V GL+L NM L+G++ +D L +L  LR ++L NN   GP+PD  KL  
Sbjct  66   SLWTGVICYNGDVHGLQLENMKLSGNLLIDVLVDLPALRTLSLMNNDLEGPVPDIAKLPA  125

Query  552  LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGF  731
            LK++++  NRFSG I+ D F K+  ++K+ LS N F+G IP SL  L RL+EL L+GN F
Sbjct  126  LKTIYLSNNRFSGGIADDVFKKLRAMKKVHLSRNQFTGPIPTSLVGLTRLLELRLDGNKF  185

Query  732  SSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQC  890
              ++P L Q  L + ++S N L+G IP G+++  A  FEGN  LCG P+   C
Sbjct  186  EGSIPDLRQPELYLANMSYNNLEGPIPVGLSKMKASMFEGNKNLCGPPLDVPC  238



>gb|KHM99860.1| Putative LRR receptor-like serine/threonine-protein kinase RLK 
[Glycine soja]
Length=550

 Score =   261 bits (668),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 200/311 (64%), Gaps = 6/311 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              + ++R  F L EL+ ASAE+LG+G   S+YKAAL + G T+VVKR K+ N + K+ F  
Sbjct  237   FLRDDRQRFDLHELLRASAEILGSGCFSSSYKAAL-LNGPTIVVKRFKQMNNVGKEEFQE  295

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MR++G L H N+LP LAY+YRK+EKLVV+++   GSL   LHG +      L    R+K
Sbjct  296   HMRRLGRLSHPNLLPPLAYYYRKEEKLVVTDYVQNGSLAVRLHGHQSIGEPSLDWPIRLK  355

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I+KG+A G+EYL+ +  +   PHGNLKSSN+LLT ++EPLLTDY   P+++       M 
Sbjct  356   IVKGIAKGLEYLYKDMPSLIAPHGNLKSSNVLLTESFEPLLTDYGLVPVINQDLAQDIMV  415

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
               K+PE  Q   I+ K+DV+CLGI+ILE++TGKFP+ +L   KG    +  W+   V + 
Sbjct  416   IYKSPEYLQQGRITKKTDVWCLGILILEILTGKFPANFLQQGKGSEVSLASWIHSVVPEE  475

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
               S V D E+ GA ++S+G+M KLL+I   C E DV+KR  +KEA+++I+E++  +   E
Sbjct  476   WTSAVFDQEM-GATKNSEGEMGKLLKIALNCCEGDVDKRWDLKEAVEKIQEVKQRDHDQE  534

Query  2079  LPFPDEIREAE  2111
               F     EA+
Sbjct  535   NFFTSYASEAD  545


 Score =   132 bits (331),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 93/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  432  MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
            MGL G IDVD+L  L  LR ++  NN F G  P+ D L  LKS+++  N+FSGEI    F
Sbjct  1    MGLKGVIDVDSLKGLPYLRTLSFMNNDFEGAWPEIDHLIGLKSIYLSNNKFSGEIPFRTF  60

Query  612  AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRS-LTILDLSG  788
              +  L+K+ LS+N F+G +P SL  LPRL+EL LEGN F+  +P   + + L    ++ 
Sbjct  61   EGLKWLKKVHLSNNHFTGAVPTSLVLLPRLIELRLEGNKFNGPIPRFTRHNKLKSFSVAN  120

Query  789  NKLQGEIPSGMARFGAKAFEGNPELCGEPVG  881
            N+L GEIP+ + R    +F GN  LCG P+G
Sbjct  121  NELSGEIPASLRRMPVSSFSGNERLCGGPLG  151


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 53/101 (52%), Gaps = 3/101 (3%)
 Frame = +3

Query  396  HRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQ  572
            H   +  + L N   +G+I       L+ L+ + L+NN F+G +P     L  L  L ++
Sbjct  37   HLIGLKSIYLSNNKFSGEIPFRTFEGLKWLKKVHLSNNHFTGAVPTSLVLLPRLIELRLE  96

Query  573  GNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLP  695
            GN+F+G I    F +   L+   +++N  SG IPASL ++P
Sbjct  97   GNKFNGPIPR--FTRHNKLKSFSVANNELSGEIPASLRRMP  135



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   264 bits (674),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 207/633 (33%), Positives = 315/633 (50%), Gaps = 52/633 (8%)
 Frame = +3

Query  219   IFFSFCLI-LQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLC  395
             +F   CL+ + C  LS    D   L+ F  ++ + + L+  W      C     W G+ C
Sbjct  32    LFVIVCLLPVACGDLS---SDKQALLAFSAAVPHGRKLN--WNPASPICTT---WIGINC  83

Query  396   HR--KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLF  566
                 + V GLRL  +GL G I  + L  L+ LR+++L +N  SG +P D   L  L  LF
Sbjct  84    SVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSNRLSGNLPSDILSLPSLHYLF  143

Query  567   IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
             +Q N FSG+I      +++ L    LS N  +G+IP ++  L RL  L L+ N  S  +P
Sbjct  144   LQKNNFSGDIPTSISPQLSVLD---LSFNSLTGSIPLTIRNLTRLTALSLQNNSLSGPIP  200

Query  747   PLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGA  926
              L    L  L+LS N L G IPS + +F   +F GN  LCG P+   C   L       +
Sbjct  201   DLGLPRLRRLNLSYNHLNGTIPSSLQKFPNSSFVGN-SLCGLPLN-PCFHALPPSPSPSS  258

Query  927   EAQTPENAQRHSSGMRWlllsivagll------------lvailFNKNQNEENVKTRRKD  1070
                  E  +R  S  +  L +I+A  +            L    F K QN+   + +   
Sbjct  259   MFPPSEGPRRQRSSKKLPLGAIIAIAVGGAALLFLVALVLFLCCFKKKQNDAGTEPK---  315

Query  1071  NLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFGLSELMMASAE  1250
                    V+ + + R+E  +            +      V        F L +L+ ASAE
Sbjct  316   -------VKSSGIGRAEKPSEEFGSGVQEPEKN----KLVFFEGCSYNFDLEDLLRASAE  364

Query  1251  VLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGML-RHHNILPLLAY  1427
             VLG G  G+AYKA L     TVVVKRLKE     +D F+ +M  +G + +H NI+PL AY
Sbjct  365   VLGKGSFGTAYKAVLEE-STTVVVKRLKEVIVGKRD-FEQQMEIIGRVGQHPNIVPLRAY  422

Query  1428  HYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATY  1607
             +Y K EKL+V ++ P GSL  LLHG++ T    L   +R+K+  G A G+ +LH+     
Sbjct  423   YYSKDEKLLVYDYYPNGSLASLLHGNKTTGRAPLDWESRVKMSLGAARGIAHLHS-IGGA  481

Query  1608  KLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDV  1778
             K  HGN+KSSN+LL    +  ++D+   PL++   T       +APE  +    +HKSDV
Sbjct  482   KFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEVMETRKHTHKSDV  541

Query  1779  YCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGK  1958
             Y  G+++LE++TGK P Q  S ++   D+ +WV+  V +   +EV D E+    ++ + +
Sbjct  542   YSFGVILLEMLTGKQPIQSPS-REDIVDLPRWVQSVVREEWTAEVFDVELMRF-QNIEEE  599

Query  1959  MVKLLQIGAACTESDVEKRLSMKEAIKRIREIQ  2057
             MV++LQI  AC     + R S+ E ++ I E++
Sbjct  600   MVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVR  632



>ref|XP_006483642.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g31250-like [Citrus sinensis]
Length=655

 Score =   263 bits (673),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/294 (47%), Positives = 196/294 (67%), Gaps = 6/294 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              VN +R MF L++L+ ASAEVLG+G  GS+YKA L + G  +VVKR ++ + + K+ F  
Sbjct  330   FVNNDREMFELNDLLRASAEVLGSGSFGSSYKAVL-LTGPAMVVKRFRQMSNVGKEDFHE  388

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              M ++G L H N+LPL+A++YRK+EKL+VS+F P GSL  LLH  R      L    R+K
Sbjct  389   HMTRLGSLSHPNLLPLIAFYYRKEEKLLVSDFVPNGSLANLLHVRRAPGQPGLDWPIRLK  448

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             IIKGVA G+ YL+ EF    LPHG+LKSSN+LL   YEPLLTDYA  P+V+       M 
Sbjct  449   IIKGVAKGLAYLYKEFPGVTLPHGHLKSSNVLLDNAYEPLLTDYALVPIVNKEHAQLHMV  508

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
             A K+PE +Q   ++ K+DV+ LGI+ILE++TGKFP+ YL+  KG   D+  WV   V + 
Sbjct  509   AYKSPEFNQTDGVTRKTDVWSLGILILELLTGKFPANYLAQGKGANADLATWVNSVVREE  568

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                EV D ++ G  +  +G+M+KLL+IG  C E + E+R  ++EA+++I E+++
Sbjct  569   WTGEVFDKDMRGT-KSGEGEMLKLLKIGMCCCEWNAERRWDLREAVEKIMELKE  621


 Score =   184 bits (468),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 140/230 (61%), Gaps = 8/230 (3%)
 Frame = +3

Query  237  LILQCLPLSISVG--DDVVLIEFKESLQNTKGLDDT---WVKGKSPC-DKTRRWFGVLCH  398
            L+  C  ++   G  D   L++F+ SL  + G D     W +  +PC + T+ W GV C 
Sbjct  20   LLAACFVVATCRGETDAEKLLKFRNSLTTSNGGDSALKDWEESPTPCTNDTQNWTGVRCS  79

Query  399  RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
            R  V GLRL NM L G IDVD LS L GLR ++  NNSF GP+P   KL  L++L++  N
Sbjct  80   RGIVIGLRLENMNLMGMIDVDTLSRLPGLRSLSFINNSFDGPMPSVGKLT-LRALYLSLN  138

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
            +F+GEI +D FA M  L+K+ L+ N FSG IP SL  L +L++L+LEGN F + +P    
Sbjct  139  KFTGEIPSDAFAGMDQLKKVHLARNHFSGQIPKSLAGLQKLLQLNLEGNSFQAKIPDFPL  198

Query  759  RSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
              LT+LDLS N+L G IP  ++ F A +F+GN  LCG+P+   C+  + K
Sbjct  199  AHLTMLDLSYNQLVGRIPDTLSNFNATSFQGNKGLCGKPL-EACKSSISK  247



>ref|XP_004512689.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g68400-like isoform X1 [Cicer arietinum]
 ref|XP_004517311.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g68400-like isoform X1 [Cicer arietinum]
Length=610

 Score =   262 bits (670),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 198/642 (31%), Positives = 313/642 (49%), Gaps = 66/642 (10%)
 Frame = +3

Query  183   MAAVRRIPTFPLIFFSFCL-ILQCLPLSI-----SVGDDVVLIEFKESLQNTKGLDDTWV  344
             M  +  I  F +IFF   L I+ C+ + I        D ++LI  ++SL ++  L   W 
Sbjct  1     MNFIFFITFFHVIFFFLSLNIVFCIEIEIKDFHPQERDALLLI--RDSLNSSINLHGNWT  58

Query  345   KGKSPC-DKTRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSG  521
                 PC +   RWFG+ C    V  + ++ + L+G +  + L N+  LR I  +NN+  G
Sbjct  59    G--PPCINNLSRWFGITCSNWHVVHILMHGLNLSGYLPSNFLQNITFLRQIDFSNNALFG  116

Query  522   PIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRL  701
              +P+   L     +F++  +FS                  L+H  F+G+IP    +L  L
Sbjct  117   TLPNLKGL-----VFLEHVKFS------------------LNH--FTGSIPKEYVELHSL  151

Query  702   VELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSG--MARFGAKAFEGNPELCGEP  875
               L L+ N  +  +P   Q SL   ++S N L G+IP    + RF    F+ N ELCG+ 
Sbjct  152   KVLELQENYLNGEIPFFDQTSLISFNVSYNHLVGKIPENFVLQRFPKSCFDNNSELCGKI  211

Query  876   VGRQCREDLGKDGGGGAEAQTPENAQRHS-----SGMRWlllsivaglllvailFNKNQN  1040
             + + C  +             P  + +        G+  +  +    L++V  LF K Q 
Sbjct  212   LDKLCPYEPHSPFSAPPPFAIPPPSHKKRLQVWIIGLISIAAAFFLFLMIVGFLFCKRQG  271

Query  1041  EENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEERGMFG  1220
               N +TRR +    V       M  +E             G S R G     N++  +F 
Sbjct  272   RGN-ETRRNNTTRNVFGAWANKMVSNEG----------NSGDSQRLGQLEFSNKKFPVFD  320

Query  1221  LSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGMLRH  1400
             + +L+ +SAEVLG G  G  YKA L  IG  V VKRL   N+++K  F  +M  +G ++H
Sbjct  321   MDDLLRSSAEVLGRGNFGVTYKATLE-IGNVVAVKRLNYMNELSKKEFIQQMELLGQMKH  379

Query  1401  HNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASGME  1580
              N++ +++++Y + +KLV+ E    GSL  LLH  RG     L   TR+ IIK +A G+ 
Sbjct  380   ENVVEIISFYYSEDQKLVIYELVSDGSLFELLHEGRGIGRIPLDWTTRLSIIKDIAKGLN  439

Query  1581  YLHTEFATYKLPHGNLKSSNILL---TPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE-  1748
             +LH   ++ K+PH NLKSSN+L+     +Y   LT+Y F PL+      + +   K+PE 
Sbjct  440   FLHHFLSSQKVPHANLKSSNVLIHQENQSYHSKLTNYGFLPLLKKNS--EKLSISKSPEF  497

Query  1749  --GHQISHKSDVYCLGIVILEVVTGKFPSQYLS--NQKGGTDVVQWVRQAVADGKESEVI  1916
               G +++HK+DVYC GI++LE++TGK P   L    +   +D+  WVR  V +   ++++
Sbjct  498   VKGRKLTHKTDVYCFGIIMLEIITGKIPGHILDEVEETTNSDLSDWVRTVVNNDWSTDIL  557

Query  1917  DPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKR  2042
             D EI G  E  D  M+ L +I   CT+   E R +M   +KR
Sbjct  558   DLEILGEREGHDA-MLNLTEIALECTDMMPENRPNMNVVLKR  598



>ref|XP_003524427.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK-like [Glycine max]
Length=632

 Score =   262 bits (669),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 200/311 (64%), Gaps = 6/311 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              + ++R  F L EL+ ASAE+LG+G   S+YKAAL + G T+VVKR K+ N + K+ F  
Sbjct  319   FLRDDRQRFDLHELLRASAEILGSGCFSSSYKAAL-LNGPTIVVKRFKQMNNVGKEEFQE  377

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MR++G L H N+LP LAY+YRK+EKLVV+++   GSL   LHG +      L    R+K
Sbjct  378   HMRRLGRLSHPNLLPPLAYYYRKEEKLVVTDYVQNGSLAVRLHGHQSIGEPSLDWPIRLK  437

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             I+KG+A G+EYL+ +  +   PHGNLKSSN+LLT ++EPLLTDY   P+++       M 
Sbjct  438   IVKGIAKGLEYLYKDMPSLIAPHGNLKSSNVLLTESFEPLLTDYGLVPVINQDLAQDIMV  497

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
               K+PE  Q   I+ K+DV+CLGI+ILE++TGKFP+ +L   KG    +  W+   V + 
Sbjct  498   IYKSPEYLQQGRITKKTDVWCLGILILEILTGKFPANFLQQGKGSEVSLASWIHSVVPEE  557

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
               S V D E+ GA ++S+G+M KLL+I   C E DV+KR  +KEA+++I+E++  +   E
Sbjct  558   WTSAVFDQEM-GATKNSEGEMGKLLKIALNCCEGDVDKRWDLKEAVEKIQEVKQRDHDQE  616

Query  2079  LPFPDEIREAE  2111
               F     EA+
Sbjct  617   NFFTSYASEAD  627


 Score =   167 bits (424),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 127/226 (56%), Gaps = 3/226 (1%)
 Frame = +3

Query  210  FPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR-RWFG  386
            + ++F         +P S    D  +L++ KE+LQ       +W     PC   R  W G
Sbjct  9    WTILFIYLSSHFTVVP-SFGASDSELLLQVKENLQTHNDELSSWNASIPPCSGARSNWRG  67

Query  387  VLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLF  566
            VLCH   V G++L NMGL G IDVD+L  L  LR ++  NN F G  P+ D L  LKS++
Sbjct  68   VLCHEGKVWGVKLENMGLKGVIDVDSLKGLPYLRTLSFMNNDFEGAWPEIDHLIGLKSIY  127

Query  567  IQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVP  746
            +  N+FSGEI    F  +  L+K+ LS+N F+G +P SL  LPRL+EL LEGN F+  +P
Sbjct  128  LSNNKFSGEIPFRTFEGLKWLKKVHLSNNHFTGAVPTSLVLLPRLIELRLEGNKFNGPIP  187

Query  747  PLAQRS-LTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG  881
               + + L    ++ N+L GEIP+ + R    +F GN  LCG P+G
Sbjct  188  RFTRHNKLKSFSVANNELSGEIPASLRRMPVSSFSGNERLCGGPLG  233



>ref|XP_010929417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK [Elaeis guineensis]
Length=673

 Score =   263 bits (671),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 195/294 (66%), Gaps = 5/294 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              V V E R  F L +L+ +SAEVLG G  G  Y+A LP  G +VVVKR ++ N+  ++ F
Sbjct  345   LVFVREGRERFELQDLLKSSAEVLGTGNFGCTYRATLPN-GPSVVVKRFRDMNRSGREDF  403

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAH-NDLKAAT  1541
             +  MR++G L H N+L L+AYHYRK+EKL+V ++ P  SL ++LHG+RG  H   L    
Sbjct  404   EEHMRRLGRLSHPNLLQLVAYHYRKEEKLLVHDYVPNRSLAFILHGNRGPNHMTMLDWPA  463

Query  1542  RIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQ  1721
             R+KI+KGVAS + YL+ E     +PHG+L+SSN+LL  + EPLLTDYA  P+++ +   +
Sbjct  464   RLKIVKGVASALAYLYEELPMLGVPHGHLRSSNVLLGESLEPLLTDYALIPVMNQSHAAK  523

Query  1722  CMFALKAPEGHQI---SHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVA  1892
              M A K+PE  QI   S KSDV+ LG++ILE++TGK P       K  TD+V WV     
Sbjct  524   FMVAYKSPERKQIGRTSKKSDVWSLGMLILEILTGKVPMHDTQQGKESTDLVNWVNSVAR  583

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREI  2054
             +G+ S+V+D +++   ++++G+M+KLLQI  AC E + EKR  +KEA+++I E+
Sbjct  584   EGRASQVLDSKMSKRTKNAEGQMLKLLQIALACCEENTEKRCELKEAVEKIEEM  637


 Score =   175 bits (443),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 127/209 (61%), Gaps = 7/209 (3%)
 Frame = +3

Query  285  VLIEFKESLQNTKGLDDTWVKGKSPCDKTR-----RWFGVLCHRKTVTGLRLYNMGLAG-  446
            VL++FK  + + KG   +WV G  PC         +W GV+C    +  L+L NMGL+G 
Sbjct  33   VLLKFKTMITDPKGRLGSWVSGGDPCGDLDGKGKGKWEGVICSDGNLHALQLENMGLSGM  92

Query  447  -DIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
             ++ V AL  L  LR ++  +N FSGP+PD   L  ++ +F+  N+ SGEI  D F  M 
Sbjct  93   LNVSVGALRELPDLRTLSFQDNQFSGPMPDVKNLAGMRGIFLSNNKLSGEIPDDAFQGMG  152

Query  624  GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
             L+K+ LSHN FSG+IP SL ++P+L++L L+ N FS  +P L Q+ L +L++S N+L+G
Sbjct  153  SLKKVDLSHNDFSGSIPTSLARVPKLLQLRLDDNNFSGTIPHLRQKELQLLNVSHNELEG  212

Query  804  EIPSGMARFGAKAFEGNPELCGEPVGRQC  890
            +IP G+       F+GN  LCGE VG  C
Sbjct  213  KIPDGLKNVKEAFFDGNKNLCGEAVGNPC  241



>gb|KDO62032.1| hypothetical protein CISIN_1g044996mg, partial [Citrus sinensis]
Length=678

 Score =   263 bits (671),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 201/297 (68%), Gaps = 9/297 (3%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
             FV  + ER  F L +L+ ASAE+LG+G  GS+YKA+L   G  +VVKR K+ N + ++ F
Sbjct  356   FVRDDVER--FDLHDLLRASAEILGSGCFGSSYKASLST-GAMMVVKRFKQMNNVGREEF  412

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G LRH N+LPL+AY+YRK+EKL+V EF PK SL   LHG +      L   +R
Sbjct  413   QEHMRRLGRLRHPNLLPLVAYYYRKEEKLLVHEFVPKRSLAVNLHGHQALGQPSLDWPSR  472

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G++YL+ E  +   PHG++KSSN+LL  + EP+L DY   P+++     + 
Sbjct  473   LKIVKGVAKGLQYLYRELPSLIAPHGHIKSSNVLLNESLEPVLADYGLIPVMNQESAQEL  532

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVA  1892
             M A K+PE  Q   I+ K+DV+ LG++ILE++TGKFP+ +L   +K   D+  WV   +A
Sbjct  533   MIAYKSPEFLQLGRITKKTDVWSLGVLILEIMTGKFPANFLQQGKKADGDLASWVNSVLA  592

Query  1893  DG-KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +G   +EV D E+A    +S+G+MVKLL+IG AC E +VEKRL +KEA+++I E+++
Sbjct  593   NGDNRTEVFDKEMADE-RNSEGEMVKLLKIGLACCEEEVEKRLDLKEAVEKIEEVKE  648


 Score =   172 bits (436),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 122/205 (60%), Gaps = 4/205 (2%)
 Frame = +3

Query  276  DDVVLIEFKESLQNTKGLDDTWVKGKSPCDKT-RRWFGVLCHRKTVTGLRLYNMGLAGDI  452
            D   L+  K+SL N   L + W     PC++    W GVLCHR  + GL+L +MGL G+I
Sbjct  3    DSQTLLTLKQSLSNPTALAN-WDDRTPPCNENGANWNGVLCHRGKIWGLKLEDMGLQGNI  61

Query  453  DVDALSNLQGLRMIALANNSFSGPIPDFDKLRH--LKSLFIQGNRFSGEISADYFAKMTG  626
            D+  L  L+ +R ++L  N+  GP+PD  +L +  L+S+++  NRFSGEI  D F  MT 
Sbjct  62   DITILKELREMRTLSLMRNNLEGPMPDLRQLGNGALRSVYLSNNRFSGEIPTDAFDGMTS  121

Query  627  LRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGE  806
            LRKL L+ N F+G IP SL +L RLVEL LEGN F   +P   Q+ L   ++S N L G 
Sbjct  122  LRKLLLADNQFNGPIPESLTRLSRLVELRLEGNKFEGQIPDFQQKDLVSFNVSNNALFGS  181

Query  807  IPSGMARFGAKAFEGNPELCGEPVG  881
            I   +      +F GN +LCGEP+G
Sbjct  182  ISPALRELDPSSFSGNRDLCGEPLG  206



>ref|XP_010928783.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At1g50610 [Elaeis guineensis]
Length=648

 Score =   262 bits (669),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 192/290 (66%), Gaps = 5/290 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
              + V E    F L +L+ ASAEVLG G  GS+YKA L   G  VVVKR    N + ++ F
Sbjct  322   LMFVKEGVQSFELHDLLKASAEVLGCGNFGSSYKAVL-FDGPAVVVKRFNNMNAVEREDF  380

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G L H ++LPL+AY+YRK+EKL+V++F PKGSL ++LHG  G+    +   TR
Sbjct  381   QEHMRRLGRLSHPHLLPLMAYYYRKEEKLLVTDFIPKGSLAHMLHGRNGSNLPPVDWPTR  440

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G+ +L+ E     +PHG+LKSSN+LL  ++EPLLTDYA  P+++ T   Q 
Sbjct  441   LKIVKGVARGLAFLYEELPMLTVPHGHLKSSNVLLDDSFEPLLTDYALEPVINRTHASQI  500

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVAD  1895
             M A K+PE  +    S KSDV+  GI+ILE++TGKFP+ YL   + G D+  WV   V +
Sbjct  501   MVAYKSPECAERGRPSRKSDVWSFGILILELLTGKFPANYLRQGRAGMDLASWVNSVVRE  560

Query  1896  GKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRI  2045
                 EV D E++G  ++ +G+M+KLLQIG  C E+DV+KR  ++ A+++I
Sbjct  561   EWTGEVFDKEMSGP-KNGEGEMLKLLQIGLGCCETDVDKRWDLRMALEKI  609


 Score =   174 bits (440),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 130/214 (61%), Gaps = 3/214 (1%)
 Frame = +3

Query  258  LSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCD-KTRRWFGVLCHRK-TVTGLRLYN  431
            LS+S   DV L++FK++L         WVKG +PC+ K R W GV+C     V GL+L N
Sbjct  25   LSLSKDADV-LLKFKDALAGGDAALRDWVKGTTPCNGKVRLWTGVICDGGGNVHGLQLQN  83

Query  432  MGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISADYF  611
            M L+G++ +DAL +L  LR ++  NN   GPIPD  KL  LK++++  N FSGEI    F
Sbjct  84   MKLSGELSIDALVDLPALRTLSFTNNDLEGPIPDITKLPALKNIYLSNNNFSGEIDGGLF  143

Query  612  AKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGN  791
             K+  L+ + LS N F+G IP SL  L +L+EL L+ N F   +P L Q SL ++++S N
Sbjct  144  NKLRSLKNVSLSSNQFTGPIPTSLVGLTKLLELKLDDNKFEGPIPDLRQPSLKLVNVSYN  203

Query  792  KLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCR  893
             L+G IP+G++      FEGN  LCG P+   CR
Sbjct  204  TLEGPIPAGLSWMNPSLFEGNKNLCGPPLDVPCR  237



>ref|XP_003560964.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At5g20690 [Brachypodium distachyon]
Length=691

 Score =   263 bits (671),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 207/301 (69%), Gaps = 12/301 (4%)
 Frame = +3

Query  1182  DFVLVNEERGMFGLSELMMASAEVLGNGGLGS-AYKAALPVIGLTVVVKRLKETNKM-NK  1355
             D V++++ +G+FGL++LM A+AEV+G GG GS AYKA +   G+TVVVKR ++ N+   +
Sbjct  360   DLVMLSDCKGVFGLTDLMKAAAEVIGGGGSGSSAYKAVM-ASGVTVVVKRARDMNRAPTR  418

Query  1356  DAFDAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKA  1535
             +AF+AEM+++G +RH N+LP LAYHYRK EKL+V E+ PKGSLLY+LHGDRG  +  L  
Sbjct  419   EAFEAEMKRLGGMRHANLLPPLAYHYRKDEKLLVYEYIPKGSLLYVLHGDRGMDYAALAD  478

Query  1536  -ATRIKIIKGVASGMEYLHTEFATY-----KLPHGNLKSSNILLTPTYEPLLTDYAFHPL  1697
               TR+K+  GVA G  +LH    +      ++PHGNLKSSN+LL   +EPLL D+ F  L
Sbjct  479   WPTRLKVAAGVARGAAFLHAGAGSSSSSQDEVPHGNLKSSNVLLARDFEPLLVDFGFSGL  538

Query  1698  VSGTPTLQCMFALKAPE---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVV  1868
             VS       MF+ +APE   G Q + K+DVYCLG+V+LE++TGKFPSQYL N KGGTD+V
Sbjct  539   VSYGAQSPSMFSRRAPECSSGQQATPKADVYCLGVVLLELLTGKFPSQYLQNAKGGTDLV  598

Query  1869  QWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIR  2048
              W   A+A+G E ++ DP I    + +   M +L+++   C ESDV +R  MK+A  R+ 
Sbjct  599   MWATSALAEGYEQDLFDPAIVANWKFALPDMKRLMEVAVKCVESDVGRRPEMKDAAARVE  658

Query  2049  E  2051
             +
Sbjct  659   D  659


 Score =   144 bits (364),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 102/175 (58%), Gaps = 3/175 (2%)
 Frame = +3

Query  351  KSPCDK-TRRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPI  527
            KSPC   +  W GV+C    V GLRL  + L G IDVDALS    LR ++ A N+F+GP+
Sbjct  60   KSPCAPGSHEWHGVVCAGGKVAGLRLSGLQLGGTIDVDALSAFPDLRSVSFAGNAFAGPL  119

Query  528  PDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVE  707
            P F +L  LKS+F+  N FSG I  D+F  +  L+KLWL  N   G +P S+ +   L+E
Sbjct  120  PGFHRLTALKSMFLSDNAFSGHIPDDFFPNLGHLKKLWLDRNHLWGPVPPSVSQAAALIE  179

Query  708  LHLEGNGFSSAVPPLAQRS-LTILDLSGNKLQGEIPSGM-ARFGAKAFEGNPELC  866
            LHLE N  S A+P +A  + L   D+S N L G +P     RF A AF+ N  LC
Sbjct  180  LHLERNALSGAIPDVAPPAGLKSFDVSDNDLDGVVPERFRRRFPADAFKRNQFLC  234



>ref|XP_006450084.1| hypothetical protein CICLE_v10010710mg [Citrus clementina]
 gb|ESR63324.1| hypothetical protein CICLE_v10010710mg [Citrus clementina]
Length=655

 Score =   262 bits (669),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 196/294 (67%), Gaps = 6/294 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              VN +R +F L++L+ ASAEVLG+G  GS+YKA L + G  +VVKR ++ + + K+ F  
Sbjct  330   FVNNDREIFELNDLLRASAEVLGSGSFGSSYKAVL-LTGPAMVVKRFRQMSNVGKEDFHE  388

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              M ++G L H N+LPL+A++YRK+EKL+VS+F P GSL  LLH  R      L    R+K
Sbjct  389   HMTRLGSLSHPNLLPLIAFYYRKEEKLLVSDFVPNGSLANLLHVRRAPGQAGLDWPIRLK  448

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             IIKGVA G+ YL+ EF    LPHG+LKSSN+LL   YEPLLTDYA  P+V+       M 
Sbjct  449   IIKGVAKGLAYLYKEFPGVTLPHGHLKSSNVLLDNAYEPLLTDYALVPIVNKEHAQLHMV  508

Query  1731  ALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
             A K+PE +Q   ++ K+DV+ LGI+ILE++TGKFP+ YL+  KG   D+  WV   V + 
Sbjct  509   AYKSPEFNQTDGVTRKTDVWSLGILILELLTGKFPANYLAQGKGANADLATWVNSVVREE  568

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                EV D ++ G  +  +G+M+KLL+IG  C E + E+R  ++EA+++I E+++
Sbjct  569   WTGEVFDKDMRGT-KSGEGEMLKLLKIGMCCCEWNAERRWDLREAVEKIMELKE  621


 Score =   182 bits (462),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 140/230 (61%), Gaps = 8/230 (3%)
 Frame = +3

Query  237  LILQCLPLSISVG--DDVVLIEFKESLQNTKGLDDT---WVKGKSPC-DKTRRWFGVLCH  398
            L+  C  ++   G  D   L++F+ SL  + G D     W +  +PC + T+ W GV C 
Sbjct  20   LLAACFVVATCRGETDAEKLLKFRNSLTTSNGGDSALKDWEESPTPCTNDTQNWTGVRCS  79

Query  399  RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGN  578
            R  V GLRL NM L G IDVD LS L GLR ++  NNSF GP+P   KL  L++L++  N
Sbjct  80   RGIVIGLRLENMNLMGMIDVDTLSRLPGLRSLSFINNSFDGPMPSVGKLT-LRALYLSLN  138

Query  579  RFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQ  758
            +F+GEI +D FA M  L+K+ L+ N FSG IP SL  L +L++L+LEGN F + +P    
Sbjct  139  KFTGEIPSDAFAGMDQLKKVHLARNHFSGQIPKSLAGLQKLLQLNLEGNSFQAKIPDFPL  198

Query  759  RSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGK  908
              LT+L+LS N+L G IP  ++ F A +F+GN  LCG+P+   C+  + K
Sbjct  199  AHLTLLNLSYNQLVGRIPDTLSNFDATSFQGNKGLCGKPL-EACKSSISK  247



>ref|XP_006371830.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP49627.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=638

 Score =   261 bits (668),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 194/294 (66%), Gaps = 6/294 (2%)
 Frame = +3

Query  1191  LVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDA  1370
              V  +R  F L +L+ ASAEVLG+G  GS+YKA L + G  +VVKR +  + + K+ F  
Sbjct  312   FVRYDRNRFDLQDLLRASAEVLGSGTFGSSYKAVL-LDGPAMVVKRFRHMSNVGKEGFHE  370

Query  1371  EMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIK  1550
              MRK+G L H N+LPL+AY+YRK+EKL+VS+F   GSL   LHG R      +   TR++
Sbjct  371   HMRKLGTLSHPNLLPLVAYYYRKEEKLLVSDFVGNGSLASHLHGKRSPGKPWIDWPTRLR  430

Query  1551  IIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMF  1730
             IIKGVA G+ YL+ EF T  LPHG+LKSSN+LL  T+EPLLTDYA  P+V+   + Q M 
Sbjct  431   IIKGVAKGLAYLYKEFPTLALPHGHLKSSNVLLDDTFEPLLTDYALVPVVNKDHSQQVMV  490

Query  1731  ALKAPEGHQI---SHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAVADG  1898
             A K+PE  Q    + K+DV+ LGI+ILE++TGKFP  YL+  KGG  D+  WV   V + 
Sbjct  491   AYKSPECSQSDRPNRKTDVWSLGILILEILTGKFPENYLTQGKGGDADLATWVNSVVREE  550

Query  1899  KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
                EV D ++    ++ +G+M+KLL+IG  C E ++E+R  +K A+ +I E+++
Sbjct  551   WTGEVFDMDMMRT-KNCEGEMLKLLKIGMCCCEWNLERRWDLKVAVAKIEELKE  603


 Score =   167 bits (423),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 126/223 (57%), Gaps = 2/223 (1%)
 Frame = +3

Query  216  LIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDK-TRRWFGVL  392
            L+F+           S    D  +L+ FK SL     L D    G  PC   T  W G+ 
Sbjct  13   LLFYFLVTASHFFVTSHGATDAEILVNFKNSLSTNSLLYDWNASGIPPCTGGTDNWVGLR  72

Query  393  CHR-KTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFI  569
            C+   T+  L L NMGL G ID+D L  L  LR ++  NNSF GP+P+  KL  L++L++
Sbjct  73   CNNDSTIDKLLLENMGLKGTIDIDILMQLPTLRTLSFMNNSFEGPMPEVKKLSSLRNLYL  132

Query  570  QGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPP  749
              N FSG+I  D F  M+ L++++L+HN F+G IP SL  + +L +L LEGN F   +P 
Sbjct  133  SNNNFSGKIDKDAFDGMSSLKEVYLAHNEFTGEIPRSLVLVQKLTKLSLEGNQFDGNLPD  192

Query  750  LAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPV  878
              Q +LT+ + +GN  +G+IP+ +A F   +F GN  LCG+P+
Sbjct  193  FPQENLTVFNAAGNNFKGQIPTSLADFSPSSFAGNQGLCGKPL  235



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 199/615 (32%), Positives = 308/615 (50%), Gaps = 43/615 (7%)
 Frame = +3

Query  273   GDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTRRWFGVLCHR--KTVTGLRLYNMGLAG  446
              D   L+EF  S+ + + L+  W      C   + W G+ C++    V  + L  +GL G
Sbjct  76    SDRQALLEFANSVPHIRKLN--WNLTIPIC---KSWAGITCNKDGTRVIAIHLPAVGLFG  130

Query  447   DIDVDALSNLQGLRMIALANNSFSGPIP-DFDKLRHLKSLFIQGNRFSGEISADYFAKMT  623
              I  +++  L  L++++L  N  +G +P D   +  L+S+++Q N FSG+I      ++ 
Sbjct  131   PIPANSIGKLDALKVLSLRANYLNGSLPSDLFSIPSLQSVYLQHNNFSGDIPVSLSPRLG  190

Query  624   GLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQG  803
              L    LS N  +G IPA++  L RL  L+L+ N     +P L    L  L+LS N L G
Sbjct  191   VLD---LSFNSLTGKIPATIKSLSRLSVLNLQFNSLRGEIPSLDTLKLNHLNLSYNMLNG  247

Query  804   EIPSGMARFGAKAFEGNPELCGEPVGRQCREDLGKDGGGGAEAQTPE-----NAQRHSSG  968
              +P+ + +F   +F GN  LCG P+   C  +             PE     N+++ S+G
Sbjct  248   SVPNSLQKFPLSSFVGNSRLCGTPL-TSCSLNSPSPSPAADSLSPPERPKTVNSKKLSTG  306

Query  969   MRWlllsivag-----lllvailFNKNQNEENVKTRRKDNLDEVLVVQIASMARSESINH  1133
                 +  + +      +L ++    K +  +N  T ++        V +A+  RSE    
Sbjct  307   TIIAIAVVASSLIFLLVLAISFCCLKKKVSDNTSTIKEK-------VALANGGRSEKTED  359

Query  1134  ssrrststegsssrggDFVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLT  1313
                     E +       V        F L +L+ ASAEVLG G  G+AYKA L    + 
Sbjct  360   FGSGVPDAEKN-----KLVFFEGCTYSFNLEDLLRASAEVLGKGSYGTAYKAVLDEATI-  413

Query  1314  VVVKRLKETNKMNKDAFDAEMRKMGML-RHHNILPLLAYHYRKQEKLVVSEFGPKGSLLY  1490
             VVVKRL+E     K+ F+  M  +G + RH NI+PL AY+Y K EKL+V+E+ P GSL  
Sbjct  414   VVVKRLREVGAAKKE-FEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSA  472

Query  1491  LLHGDRGTAHNDLKAATRIKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPL  1670
              LHG+ G     L   TR+KI  G A G+ ++HTE    K  HGN+KSSNILLT   +  
Sbjct  473   ALHGNSGIGRTPLDWDTRLKISLGAAKGIAHIHTE-GGVKFTHGNIKSSNILLTRDQDGC  531

Query  1671  LTDYAFHPLVSGTPTLQCMFALKAPEGHQI---SHKSDVYCLGIVILEVVTGKFPSQYLS  1841
             ++D+   PL++  P        +APE  +    + KSDVY  G+++LE++T K P   LS
Sbjct  532   ISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIP-LS  590

Query  1842  NQKGGTDVVQWVRQAVADGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLS  2021
                   D+ +WVR  V +   +EV D E+    ++ + +MV++LQIG AC     + R S
Sbjct  591   GHDEVVDLPRWVRSVVREEWTAEVFDVELLKY-QNIEEEMVQMLQIGLACVAKVPDMRPS  649

Query  2022  MKEAIKRIREIQDVE  2066
             M E ++ I +I+  E
Sbjct  650   MGEVVRMIEDIRQPE  664



>ref|XP_006453183.1| hypothetical protein CICLE_v10010420mg [Citrus clementina]
 gb|ESR66423.1| hypothetical protein CICLE_v10010420mg [Citrus clementina]
Length=698

 Score =   263 bits (671),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 201/297 (68%), Gaps = 9/297 (3%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
             FV  + ER  F L +L+ ASAE+LG+G  GS+YKA+L   G  +VVKR K+ N + ++ F
Sbjct  384   FVRDDVER--FDLHDLLRASAEILGSGCFGSSYKASLST-GAMMVVKRFKQMNNVGREEF  440

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G LRH N+LPL+AY+YRK+EKL+V EF PK SL   LHG +      L   +R
Sbjct  441   QEHMRRLGRLRHPNLLPLVAYYYRKEEKLLVHEFVPKRSLAVNLHGHQALGQPSLDWPSR  500

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G++YL+ E  +   PHG++KSSN+LL  + EP+L DY   P+++     + 
Sbjct  501   LKIVKGVAKGLQYLYRELPSLIAPHGHIKSSNVLLNESLEPVLADYGLIPVMNQESAQEL  560

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVA  1892
             M A K+PE  Q   I+ K+DV+ LG++ILE++TGKFP+ +L   +K   D+  WV   +A
Sbjct  561   MIAYKSPEFLQLGRITKKTDVWSLGVLILEIMTGKFPANFLQQGKKADGDLASWVNSVLA  620

Query  1893  DG-KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +G   +EV D E+A    +S+G+MVKLL+IG AC E +VEKRL +KEA+++I E+++
Sbjct  621   NGDNRTEVFDKEMADE-RNSEGEMVKLLKIGLACCEEEVEKRLDLKEAVEKIEEVKE  676


 Score =   186 bits (471),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 137/236 (58%), Gaps = 5/236 (2%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
            M+ + R     LIFF+  +I  C     S+ D   L+  K+SL N   L + W     PC
Sbjct  1    MSKITRHEPLLLIFFNI-VITSCFLSCSSLTDSQTLLTLKQSLSNPTALAN-WDDRTPPC  58

Query  363  DKT-RRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
            ++    W GVLCHR  + GL+L +MGL G+ID+  L  L+ +R ++L  N+  GP+PD  
Sbjct  59   NENGANWNGVLCHRGKIWGLKLEDMGLQGNIDITILKELREMRTLSLMRNNLEGPMPDLR  118

Query  540  KLRH--LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELH  713
            +L +  L+S+++  NRFSGEI  D F  MT LRKL L+ N F+G IP SL +L RLVEL 
Sbjct  119  QLGNGALRSVYLSNNRFSGEIPTDAFDGMTSLRKLLLADNQFNGPIPESLTRLSRLVELR  178

Query  714  LEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG  881
            LEGN F   +P   Q+ L   ++S N L G IP  +      +F GN +LCGEP+G
Sbjct  179  LEGNKFEGQIPDFQQKDLASFNVSNNALFGSIPPALRELDPSSFSGNRDLCGEPLG  234



>ref|XP_006474649.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RLK-like [Citrus sinensis]
Length=706

 Score =   262 bits (670),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 201/297 (68%), Gaps = 9/297 (3%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
             FV  + ER  F L +L+ ASAE+LG+G  GS+YKA+L   G  +VVKR K+ N + ++ F
Sbjct  384   FVRDDVER--FDLHDLLRASAEILGSGCFGSSYKASLST-GAMMVVKRFKQMNNVGREEF  440

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                MR++G LRH N+LPL+AY+YRK+EKL+V EF PK SL   LHG +      L   +R
Sbjct  441   QEHMRRLGRLRHPNLLPLVAYYYRKEEKLLVHEFVPKRSLAVNLHGHQALGQPSLDWPSR  500

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KI+KGVA G++YL+ E  +   PHG++KSSN+LL  + EP+L DY   P+++     + 
Sbjct  501   LKIVKGVAKGLQYLYRELPSLIAPHGHIKSSNVLLNESLEPVLADYGLIPVMNQESAQEL  560

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSN-QKGGTDVVQWVRQAVA  1892
             M A K+PE  Q   I+ K+DV+ LG++ILE++TGKFP+ +L   +K   D+  WV   +A
Sbjct  561   MIAYKSPEFLQLGRITKKTDVWSLGVLILEIMTGKFPANFLQQGKKADGDLASWVNSVLA  620

Query  1893  DG-KESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
             +G   +EV D E+A    +S+G+MVKLL+IG AC E +VEKRL +KEA+++I E+++
Sbjct  621   NGDNRTEVFDKEMADE-RNSEGEMVKLLKIGLACCEEEVEKRLDLKEAVEKIEEVKE  676


 Score =   185 bits (470),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 137/236 (58%), Gaps = 5/236 (2%)
 Frame = +3

Query  183  MAAVRRIPTFPLIFFSFCLILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC  362
            M+ + R     LIFF+  +I  C     S+ D   L+  K+SL N   L + W     PC
Sbjct  1    MSKITRHEPLLLIFFNI-VITSCFLSCSSLTDSQTLLTLKQSLSNPTALAN-WDDRTPPC  58

Query  363  DKT-RRWFGVLCHRKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFD  539
            ++    W GVLCHR  + GL+L +MGL G+ID+  L  L+ +R ++L  N+  GP+PD  
Sbjct  59   NENGANWNGVLCHRGKIWGLKLEDMGLQGNIDITILKELREMRTLSLMRNNLEGPMPDLR  118

Query  540  KLRH--LKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELH  713
            +L +  L+S+++  NRFSGEI  D F  MT LRKL L+ N F+G IP SL +L RLVEL 
Sbjct  119  QLGNGALRSVYLSNNRFSGEIPTDAFDGMTSLRKLLLADNQFNGPIPESLTRLSRLVELR  178

Query  714  LEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPVG  881
            LEGN F   +P   Q+ L   ++S N L G IP  +      +F GN +LCGEP+G
Sbjct  179  LEGNKFEGQIPDFQQKDLASFNVSNNALFGSIPPALRELDPSSFSGNRDLCGEPLG  234



>gb|KCW52164.1| hypothetical protein EUGRSUZ_J01604 [Eucalyptus grandis]
Length=629

 Score =   259 bits (663),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 190/593 (32%), Positives = 279/593 (47%), Gaps = 73/593 (12%)
 Frame = +3

Query  339   WVKGKSPCDKTRRWFGVLCH--RKTVTGLRLYNMGLAGDIDVDALSNLQGLRMIALANNS  512
             W     PCD    W GV C   R+ V  LR   MGLAG I    ++NL  L+ I+  +NS
Sbjct  74    WNLSLPPCD----WTGVFCDSARQKVIELRFPAMGLAGGIPAGTIANLTQLQTISFHSNS  129

Query  513   FSGPIPDFDKLRHLKSLFIQGNRFSGEISADYFAKMTGLRKLWLSHNGFSGNIPASLGKL  692
              SGP+PD                          A ++ LR L+L  N FSG +P SL  L
Sbjct  130   LSGPLPDL-------------------------ASLSELRNLYLQSNSFSGGLPPSLFAL  164

Query  693   PRLVELHLEGNGFSSAVPPLAQRSLTILDLSGNKLQGEIPSGMARFGAKAFEGNPELCGE  872
             P L         F+  +P L   +L   ++S N+L G IPS ++     AF GN  LCG 
Sbjct  165   PNL---------FTGPIPDL-NLTLDQFNVSSNQLTGPIPSALSTKPPSAFAGN-SLCGP  213

Query  873   PVGRQCREDLGKDGGGGAEA--------QTPENAQRHSSGMRWlllsivaglllvailFN  1028
             P+        G    GGA A                     R            +     
Sbjct  214   PLQSCNATGNGNKLSGGAIAGIVIGSVIGLFLILLVLIILCRRKSRGGGEKPKSLESQAA  273

Query  1029  KNQNEENVKTRRKDNLDEVLVVQIASMARSESINHssrrststegsssrggDFVLVNEER  1208
             +    E  +TR   ++ E      A ++  +S+N S                F    +  
Sbjct  274   RGAEAEIAQTREAKSVGEPKASSAAVISGDKSVNKSLV--------------FFGKGDAV  319

Query  1209  GMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMG  1388
               F L +L+ ASAEVLG G  G+ YKA L   G+TV VKRLK+ + + +  F   MR+ G
Sbjct  320   AAFDLEDLLRASAEVLGRGTFGTTYKATLET-GITVAVKRLKDLS-VGEAEFRERMRQTG  377

Query  1389  MLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVA  1568
              + H N++ L AY+Y K E+L+V E+ P GSL  LLHG+       L   TR  I  G A
Sbjct  378   AVEHENLVGLRAYYYNKDERLLVYEYLPIGSLSALLHGNSVVGRTPLNWDTRCDIALGAA  437

Query  1569  SGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE  1748
              G+ +LH++ A     HGN+KSSN+LLT +Y+  ++D++  P+ +       +   +APE
Sbjct  438   RGIAHLHSQDAVTS--HGNIKSSNVLLTKSYKARVSDFSLAPIANLIAAPNRIDGYRAPE  495

Query  1749  ---GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTDVVQWVRQAVADGKESEVID  1919
                 H++S K+DVY  G+++LE++TGK P+  L N++ G D+ +WV+  V +   +EV D
Sbjct  496   VTDYHKVSQKADVYSFGVLLLELLTGKAPTHSLLNEE-GVDLPRWVQSVVKEEWTAEVFD  554

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVFHE  2078
              E+    +D +  MV+LLQ+   C     +KR  M + + +I EI    + HE
Sbjct  555   DELLRY-QDVEEDMVELLQLAMHCAAQYPDKRPPMAQVVNKIEEICRSSMLHE  606



>ref|XP_010669504.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g31250 [Beta vulgaris subsp. vulgaris]
Length=659

 Score =   260 bits (664),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 197/306 (64%), Gaps = 6/306 (2%)
 Frame = +3

Query  1185  FVLVNEERGMFGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAF  1364
                +  +R  F + +L+ ASAEVLG+G  GS+YKAA+ + G T VVKR ++ N + K+ F
Sbjct  326   LCFLRNDRQKFEMQDLLKASAEVLGSGSFGSSYKAAI-MGGPTFVVKRFRQMNNVGKEEF  384

Query  1365  DAEMRKMGMLRHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATR  1544
                M+++G LRH N+LPL+A+ +++ EKL++S+F   GSL   LHG R      LK + R
Sbjct  385   QEHMKRLGRLRHTNLLPLVAFFHKRDEKLIISDFVENGSLASHLHGRRTPNQPGLKWSLR  444

Query  1545  IKIIKGVASGMEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQC  1724
             +KIIKGVA G+ YL  E     LPHG+LKSSN+LL   +EPL+ DYA  PL++     Q 
Sbjct  445   LKIIKGVARGLAYLFRELPQLSLPHGHLKSSNVLLDDNFEPLIADYALAPLINKEHGEQV  504

Query  1725  MFALKAPEGHQ---ISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGGTD-VVQWVRQAVA  1892
             M A K+PE  Q   I+ K+DV+CLGI+ILE +TGKFP+ YL + KG  D +  WV   V 
Sbjct  505   MAAYKSPEFTQSNTITKKTDVWCLGILILETLTGKFPANYLKHGKGSNDELATWVNSVVK  564

Query  1893  DGKESEVIDPEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQDVEVF  2072
             +   SE+ D E+  A     G+M+KLL+IG  C E +VEKR S+++A++RI E+++++  
Sbjct  565   EEWSSEMFDMEMR-ASRSCKGEMLKLLKIGMWCCEWNVEKRWSLRDAVQRIEELKEMDKD  623

Query  2073  HELPFP  2090
                 FP
Sbjct  624   DLADFP  629


 Score =   184 bits (467),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 132/215 (61%), Gaps = 3/215 (1%)
 Frame = +3

Query  237  LILQCLPLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPC-DKTRRWFGVLCHRKTVT  413
            +ILQ L LS S  D  +L++FK+SL N   L++ W     PC +  R W GV+CH+ T+ 
Sbjct  21   IILQMLILS-SANDAEILLKFKQSLLNADALNN-WDTTIPPCTNNIRNWVGVICHKGTLF  78

Query  414  GLRLYNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGE  593
            GL+L NM L G+ID+D+L  L  LR I++ NNSF G +P  +KL  L+S+F   N FSG 
Sbjct  79   GLQLENMNLKGNIDIDSLVQLSSLRTISVMNNSFEGELPAINKLGRLRSIFFSYNNFSGN  138

Query  594  ISADYFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTI  773
            I  D F  M  L+K+ L HN F+GN+P SL  LPRL+E+ L+ N F   +P      L +
Sbjct  139  IQDDAFEGMHVLKKVHLDHNSFTGNLPKSLAHLPRLLEVSLDNNQFYGNLPNFESTQLKL  198

Query  774  LDLSGNKLQGEIPSGMARFGAKAFEGNPELCGEPV  878
            ++LS N   G+IP  ++   + +F GNP LCG P+
Sbjct  199  VNLSNNYFDGQIPPLLSHLNSSSFLGNPGLCGRPL  233



>ref|XP_006360647.1| PREDICTED: receptor-like protein kinase [Solanum tuberosum]
Length=671

 Score =   260 bits (664),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 195/287 (68%), Gaps = 7/287 (2%)
 Frame = +3

Query  1215  FGLSELMMASAEVLGNGGLGSAYKAALPVIGLTVVVKRLKETNKMNKDAFDAEMRKMGML  1394
             F L +L+ ASAE+LG+G  GS YKAAL  +G  +VVKR ++ N + K+ F   MR++G L
Sbjct  363   FDLPDLLKASAEILGSGVFGSTYKAAL-SMGRVMVVKRFRQMNNVGKEDFHEHMRRLGRL  421

Query  1395  RHHNILPLLAYHYRKQEKLVVSEFGPKGSLLYLLHGDRGTAHNDLKAATRIKIIKGVASG  1574
              H N+LP++A++YRK+EKL+VSE+    SL   LHG++      L   TR+KI+KGVA G
Sbjct  422   SHKNLLPVVAFYYRKEEKLLVSEYVNNVSLAVHLHGNKSRGQPSLDWPTRLKIVKGVAKG  481

Query  1575  MEYLHTEFATYKLPHGNLKSSNILLTPTYEPLLTDYAFHPLVSGTPTLQCMFALKAPE--  1748
             + YL+ E  +   PHG+LKSSN+LL  +YEPLLTDYA  P+V+     + M A K+PE  
Sbjct  482   LLYLYNELPSLTAPHGHLKSSNVLLNESYEPLLTDYALLPVVNLEHAQEHMIAYKSPEFK  541

Query  1749  -GHQISHKSDVYCLGIVILEVVTGKFPSQYLSNQKGG-TDVVQWVRQAV-ADGKESEVID  1919
                +I+ K+DV+ LGI+ILE++TGKFPS +L   KG  TD+  WVR  V  D  E +V +
Sbjct  542   HSGRITRKNDVWTLGILILEIITGKFPSNFLQQGKGSDTDLATWVRSVVNEDMMEVDVFE  601

Query  1920  PEIAGAGEDSDGKMVKLLQIGAACTESDVEKRLSMKEAIKRIREIQD  2060
              E+ G   +S+G+M+KLL+I   C + D+EKR  MKEA++RI+E+++
Sbjct  602   KEMRGT-TNSEGEMMKLLKIALGCCDLDMEKRFDMKEAMERIKEVKE  647


 Score =   162 bits (411),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 119/217 (55%), Gaps = 5/217 (2%)
 Frame = +3

Query  255  PLSISVGDDVVLIEFKESLQNTKGLDDTWVKGKSPCDKTR---RWFGVLCHRKTVTGLRL  425
            P+     +  +L  F +SLQ   G    W    SPCDK      W  V+C    V GL+L
Sbjct  34   PIKSDSSEAEILFRFSKSLQKN-GATANWNTKVSPCDKNTDKPNWDSVICENGFVFGLQL  92

Query  426  YNMGLAGDIDVDALSNLQGLRMIALANNSFSGPIPDFDKLRHLKSLFIQGNRFSGEISAD  605
               GL+G IDVDAL +L   R I++ NN+F GP+P+  KL  LK+ +   N+FSG+I   
Sbjct  93   EGKGLSGTIDVDALKDLPNFRTISVMNNNFEGPLPNLSKLAGLKTAYFTNNKFSGQIDNT  152

Query  606  YFAKMTGLRKLWLSHNGFSGNIPASLGKLPRLVELHLEGNGFSSAVPPLAQRSLTILDLS  785
             F  M  L+KL L++N  SG IP+ LG+LP+L EL +E N F   +P   Q  L  ++ +
Sbjct  153  LFEGMHWLKKLHLANNQLSGKIPSVLGQLPKLTELRVENNKFEGQIPDFVQERLMDMNFA  212

Query  786  GNKLQGEIPSGMARFGAKAFEGNPELCGEPVGRQCRE  896
             N L+G IP G+      AFEGN +LC  P+ +   E
Sbjct  213  NNSLEGPIPHGLTSLKPSAFEGN-DLCDGPLSKCTSE  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7621001947248