BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20678_g4_i1 len=959 path=[2847:0-958]

Length=959
                                                                      Score     E

ref|XP_011083233.1|  PREDICTED: probable aquaporin NIP5-1               337   4e-111   
ref|XP_011038068.1|  PREDICTED: probable aquaporin NIP5-1               332   2e-109   
ref|NP_001274996.1|  probable aquaporin NIP5-1-like                     331   4e-109   
ref|XP_002518973.1|  Nodulin-26, putative                               330   1e-108   Ricinus communis
ref|NP_001274288.1|  probable aquaporin NIP5-1-like                     330   1e-108   
ref|XP_010529699.1|  PREDICTED: probable aquaporin NIP5-1               329   3e-108   
ref|XP_002298990.1|  hypothetical protein POPTR_0001s45920g             329   4e-108   Populus trichocarpa [western balsam poplar]
ref|XP_009590733.1|  PREDICTED: probable aquaporin NIP5-1               328   1e-107   
ref|XP_008437497.1|  PREDICTED: probable aquaporin NIP5-1               327   1e-107   
ref|XP_002276319.1|  PREDICTED: probable aquaporin NIP5-1               327   2e-107   Vitis vinifera
ref|XP_010555246.1|  PREDICTED: probable aquaporin NIP5-1               328   2e-107   
ref|XP_011004393.1|  PREDICTED: probable aquaporin NIP5-1               327   3e-107   
ref|XP_002317642.1|  hypothetical protein POPTR_0011s14990g             327   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009803208.1|  PREDICTED: probable aquaporin NIP5-1               327   4e-107   
gb|AGE09576.1|  NOD-like protein                                        323   8e-107   
ref|XP_004145889.1|  PREDICTED: probable aquaporin NIP5-1-like          325   8e-107   
ref|XP_006434369.1|  hypothetical protein CICLE_v10001994mg             325   9e-107   
ref|XP_006472916.1|  PREDICTED: probable aquaporin NIP5-1-like          325   1e-106   
gb|AFN37617.1|  boron transporter                                       325   2e-106   
ref|XP_010054000.1|  PREDICTED: probable aquaporin NIP5-1               324   2e-106   
ref|XP_010455435.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    325   2e-106   
ref|XP_010455436.1|  PREDICTED: probable aquaporin NIP5-1 isoform X2    324   3e-106   
ref|XP_010251728.1|  PREDICTED: probable aquaporin NIP5-1               324   4e-106   
gb|KHG22884.1|  putative aquaporin NIP5-1 -like protein                 323   5e-106   
ref|XP_009360260.1|  PREDICTED: probable aquaporin NIP5-1               322   2e-105   
ref|XP_008356814.1|  PREDICTED: probable aquaporin NIP5-1               322   2e-105   
ref|NP_192776.1|  putative aquaporin NIP5-1                             322   2e-105   Arabidopsis thaliana [mouse-ear cress]
emb|CDP12262.1|  unnamed protein product                                321   4e-105   
ref|XP_002874623.1|  hypothetical protein ARALYDRAFT_911337             321   4e-105   
ref|XP_010437147.1|  PREDICTED: probable aquaporin NIP5-1               321   5e-105   
ref|XP_007209472.1|  hypothetical protein PRUPE_ppa010013mg             320   6e-105   
ref|XP_010421957.1|  PREDICTED: probable aquaporin NIP5-1               320   1e-104   
gb|KFK31988.1|  hypothetical protein AALP_AA6G185600                    320   1e-104   
gb|KDP25192.1|  hypothetical protein JCGZ_20348                         320   1e-104   
ref|XP_008239293.1|  PREDICTED: probable aquaporin NIP5-1               320   2e-104   
ref|XP_006288313.1|  hypothetical protein CARUB_v10001558mg             319   3e-104   
ref|XP_009360304.1|  PREDICTED: probable aquaporin NIP5-1               318   7e-104   
ref|XP_009128716.1|  PREDICTED: probable aquaporin NIP5-1               318   7e-104   
ref|XP_006397069.1|  hypothetical protein EUTSA_v10028842mg             317   1e-103   
emb|CDX94261.1|  BnaC02g29210D                                          317   1e-103   
ref|XP_007039259.1|  NOD26-like intrinsic protein 5,1                   316   6e-103   
gb|AAQ11827.1|  nodulin-like intrinsic protein NIP1-2                   315   8e-103   Atriplex nummularia
ref|XP_010680950.1|  PREDICTED: probable aquaporin NIP5-1               315   1e-102   
gb|AEY75255.1|  nodulin-like intrinsic protein                          313   6e-102   
emb|CDX67591.1|  BnaA07g16310D                                          313   6e-102   
ref|XP_009389176.1|  PREDICTED: probable aquaporin NIP5-1               313   6e-102   
ref|XP_004309493.1|  PREDICTED: probable aquaporin NIP5-1-like          313   6e-102   
gb|AAQ11826.1|  nodulin-like intrinsic protein NIP1-1                   313   8e-102   Atriplex nummularia
ref|XP_009373676.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    312   2e-101   
emb|CDY05100.1|  BnaC03g28980D                                          312   2e-101   
ref|XP_010110421.1|  putative aquaporin NIP5-1                          311   3e-101   
ref|XP_009134192.1|  PREDICTED: probable aquaporin NIP5-1               311   4e-101   
ref|XP_007143584.1|  hypothetical protein PHAVU_007G084000g             309   2e-100   
ref|XP_010094419.1|  putative aquaporin NIP5-1                          309   2e-100   
gb|KHN17043.1|  Putative aquaporin NIP5-1                               307   3e-100   
ref|XP_006828763.1|  hypothetical protein AMTR_s00001p00081940          308   3e-100   
ref|XP_003535560.1|  PREDICTED: probable aquaporin NIP5-1-like          307   1e-99    
ref|XP_008360732.1|  PREDICTED: probable aquaporin NIP5-1               307   1e-99    
gb|KHN46385.1|  Putative aquaporin NIP5-1                               306   2e-99    
gb|EYU31217.1|  hypothetical protein MIMGU_mgv1a010890mg                306   3e-99    
ref|XP_010680949.1|  PREDICTED: probable aquaporin NIP5-1               302   3e-98    
ref|XP_006662508.1|  PREDICTED: aquaporin NIP3-1-like                   301   3e-98    
ref|XP_004496427.1|  PREDICTED: probable aquaporin NIP5-1-like          303   5e-98    
emb|CDP14867.1|  unnamed protein product                                303   6e-98    
ref|XP_009388143.1|  PREDICTED: probable aquaporin NIP5-1               301   7e-98    
ref|XP_003592016.1|  Aquaporin NIP3-1                                   303   8e-98    
ref|XP_008796885.1|  PREDICTED: probable aquaporin NIP5-1               301   2e-97    
ref|XP_010919364.1|  PREDICTED: probable aquaporin NIP5-1               300   1e-96    
ref|XP_010933763.1|  PREDICTED: probable aquaporin NIP5-1               298   6e-96    
gb|ABY19373.1|  major intrinsic protein NIP5;1                          298   7e-96    Lotus japonicus
ref|XP_004145968.1|  PREDICTED: probable aquaporin NIP5-1-like          295   1e-95    
gb|EYU42698.1|  hypothetical protein MIMGU_mgv1a019443mg                295   1e-95    
ref|XP_008803617.1|  PREDICTED: probable aquaporin NIP5-1               296   3e-95    
gb|AAG13499.1|AC068924_4  putative nodulin-26                           293   8e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008437496.1|  PREDICTED: probable aquaporin NIP5-1               292   3e-94    
sp|Q0IWF3.2|NIP31_ORYSJ  RecName: Full=Aquaporin NIP3-1; AltName:...    293   6e-94    Oryza sativa Japonica Group [Japonica rice]
dbj|BAO01152.1|  nodulin-26 like Intrinsic Protein 3;1                  293   7e-94    
gb|EAZ16668.1|  hypothetical protein OsJ_32143                          293   9e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EAY79189.1|  hypothetical protein OsI_34300                          291   4e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_002464380.1|  hypothetical protein SORBIDRAFT_01g017230          290   5e-93    Sorghum bicolor [broomcorn]
ref|XP_004982621.1|  PREDICTED: aquaporin NIP3-1-like                   290   6e-93    
gb|AES86406.2|  major intrinsic protein (MIP) family transporter        284   1e-91    
gb|ACN36318.1|  unknown                                                 287   1e-91    Zea mays [maize]
ref|XP_003604209.1|  Aquaporin NIP6-1                                   284   3e-91    
ref|XP_008348330.1|  PREDICTED: probable aquaporin NIP5-1               284   4e-91    
ref|XP_008380091.1|  PREDICTED: probable aquaporin NIP5-1               284   4e-91    
ref|NP_001105021.1|  aquaporin NIP3-1                                   285   4e-91    Zea mays [maize]
gb|KEH28543.1|  major intrinsic protein (MIP) family transporter        282   6e-91    
ref|XP_007216752.1|  hypothetical protein PRUPE_ppa024808mg             282   8e-91    
gb|EYU31219.1|  hypothetical protein MIMGU_mgv1a018295mg                281   3e-90    
gb|KDO83593.1|  hypothetical protein CISIN_1g0465112mg                  280   3e-90    
ref|XP_003574178.1|  PREDICTED: aquaporin NIP3-1                        281   1e-89    
ref|XP_010691608.1|  PREDICTED: aquaporin NIP6-1                        281   3e-89    
ref|XP_003604218.1|  Nodulin-like intrinsic protein NIP1-1              281   4e-89    
ref|XP_010537884.1|  PREDICTED: aquaporin NIP6-1                        280   9e-89    
ref|XP_004486614.1|  PREDICTED: aquaporin NIP6-1-like                   278   6e-88    
ref|XP_003547292.1|  PREDICTED: aquaporin NIP6-1-like                   277   7e-88    
gb|ADE76805.1|  unknown                                                 276   9e-88    
gb|KHN22407.1|  Aquaporin NIP6-1                                        276   1e-87    
ref|XP_007150811.1|  hypothetical protein PHAVU_005G182400g             276   1e-87    
ref|XP_002887811.1|  hypothetical protein ARALYDRAFT_477170             276   2e-87    
emb|CDY66949.1|  BnaA02g36290D                                          276   2e-87    
ref|XP_006301084.1|  hypothetical protein CARUB_v10021476mg             275   4e-87    
emb|CDY53224.1|  BnaA02g19440D                                          274   1e-86    
ref|XP_002527308.1|  Aquaporin NIP1.1, putative                         274   1e-86    Ricinus communis
ref|XP_006389830.1|  hypothetical protein EUTSA_v10018924mg             274   1e-86    
emb|CDY39946.1|  BnaC06g40240D                                          274   1e-86    
gb|KFK42456.1|  hypothetical protein AALP_AA2G259100                    274   2e-86    
ref|XP_009128393.1|  PREDICTED: aquaporin NIP6-1-like                   274   2e-86    
emb|CDX87340.1|  BnaA07g35330D                                          274   2e-86    
gb|ABY19374.1|  major intrinsic protein NIP6;1                          273   4e-86    Lotus japonicus
ref|XP_007023401.1|  Aquaporin NIP6,1                                   273   4e-86    
ref|XP_009106719.1|  PREDICTED: aquaporin NIP6-1                        273   5e-86    
ref|NP_178191.1|  aquaporin NIP6-1                                      272   6e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AAT35231.1|  nodulin 26-like protein                                 271   2e-85    Medicago truncatula
ref|XP_006465199.1|  PREDICTED: aquaporin NIP6-1-like                   270   3e-85    
ref|XP_006427592.1|  hypothetical protein CICLE_v10026151mg             270   4e-85    
ref|XP_010112876.1|  putative aquaporin NIP5-1                          268   6e-85    
ref|XP_010417667.1|  PREDICTED: aquaporin NIP6-1                        270   7e-85    
gb|ACJ84850.1|  unknown                                                 269   9e-85    Medicago truncatula
ref|XP_010429912.1|  PREDICTED: aquaporin NIP6-1-like isoform X1        269   1e-84    
ref|XP_010472881.1|  PREDICTED: aquaporin NIP6-1-like                   268   2e-84    
ref|XP_006857171.1|  hypothetical protein AMTR_s00065p00173470          268   2e-84    
gb|AFN44229.1|  aquaporin                                               268   4e-84    
ref|XP_010058378.1|  PREDICTED: probable aquaporin NIP5-1               265   5e-84    
ref|XP_010056097.1|  PREDICTED: probable aquaporin NIP5-1               266   5e-84    
gb|AGD98713.1|  aquaporin protein 10                                    267   6e-84    
ref|XP_008229796.1|  PREDICTED: probable aquaporin NIP5-1               266   8e-84    
ref|XP_009804421.1|  PREDICTED: aquaporin NIP6-1 isoform X2             265   9e-84    
ref|XP_008228780.1|  PREDICTED: aquaporin NIP6-1                        266   1e-83    
ref|XP_008343681.1|  PREDICTED: aquaporin NIP6-1-like                   266   1e-83    
ref|XP_010275746.1|  PREDICTED: aquaporin NIP6-1                        267   2e-83    
ref|XP_007215732.1|  hypothetical protein PRUPE_ppa009083mg             266   2e-83    
ref|XP_010058381.1|  PREDICTED: probable aquaporin NIP5-1               263   3e-83    
ref|XP_002973832.1|  hypothetical protein SELMODRAFT_173700             264   4e-83    
ref|XP_002297797.2|  aquaporin NIP6.1 family protein                    265   4e-83    Populus trichocarpa [western balsam poplar]
dbj|BAM44346.1|  plasma membrane aluminum transporter                   265   4e-83    
ref|XP_011073345.1|  PREDICTED: aquaporin NIP6-1-like                   265   4e-83    
ref|XP_011020626.1|  PREDICTED: aquaporin NIP6-1 isoform X2             265   4e-83    
ref|XP_003531732.1|  PREDICTED: aquaporin NIP6-1-like                   264   8e-83    
gb|KHG25640.1|  Aquaporin NIP6-1 -like protein                          264   9e-83    
ref|XP_002304723.1|  aquaporin NIP6.1 family protein                    264   9e-83    Populus trichocarpa [western balsam poplar]
gb|EYU21708.1|  hypothetical protein MIMGU_mgv1a010517mg                264   1e-82    
emb|CDO98218.1|  unnamed protein product                                264   1e-82    
gb|KDP41985.1|  hypothetical protein JCGZ_27003                         264   1e-82    
ref|XP_004303250.1|  PREDICTED: aquaporin NIP6-1-like                   263   2e-82    
ref|XP_009804420.1|  PREDICTED: aquaporin NIP6-1 isoform X1             262   6e-82    
ref|XP_010092181.1|  Aquaporin NIP6-1                                   265   2e-81    
ref|XP_009623274.1|  PREDICTED: aquaporin NIP6-1 isoform X2             261   2e-81    
ref|XP_009623273.1|  PREDICTED: aquaporin NIP6-1 isoform X1             260   3e-81    
ref|XP_011082216.1|  PREDICTED: aquaporin NIP6-1-like                   258   2e-80    
ref|XP_010034003.1|  PREDICTED: aquaporin NIP6-1                        258   3e-80    
ref|XP_011020625.1|  PREDICTED: aquaporin NIP6-1 isoform X1             258   3e-80    
ref|XP_010058382.1|  PREDICTED: probable aquaporin NIP5-1               254   4e-80    
ref|XP_010246844.1|  PREDICTED: probable aquaporin NIP5-1 isoform X2    256   5e-80    
ref|XP_010246843.1|  PREDICTED: probable aquaporin NIP5-1 isoform X1    256   8e-80    
ref|XP_004305876.1|  PREDICTED: probable aquaporin NIP5-1-like          255   1e-79    
ref|XP_010058113.1|  PREDICTED: probable aquaporin NIP5-1               254   1e-79    
ref|XP_006341363.1|  PREDICTED: aquaporin NIP6-1-like                   254   7e-79    
ref|XP_008454166.1|  PREDICTED: aquaporin NIP6-1                        253   3e-78    
gb|KHN38028.1|  Aquaporin NIP6-1                                        253   3e-78    
ref|XP_007135806.1|  hypothetical protein PHAVU_010G160200g             252   4e-78    
ref|XP_001779449.1|  predicted protein                                  250   5e-78    
ref|NP_001289852.1|  aquaporin NIP6-1                                   252   5e-78    
ref|XP_004156981.1|  PREDICTED: aquaporin NIP6-1-like                   251   2e-77    
ref|XP_004152170.1|  PREDICTED: aquaporin NIP6-1-like                   250   3e-77    
ref|XP_010106789.1|  Aquaporin NIP6-1                                   249   5e-77    
ref|XP_010092185.1|  Aquaporin NIP6-1                                   247   5e-76    
tpg|DAA33875.1|  TPA: aquaporin NIP6;1                                  245   9e-76    
ref|XP_002272988.1|  PREDICTED: aquaporin NIP6-1                        247   2e-75    Vitis vinifera
ref|XP_009373677.1|  PREDICTED: probable aquaporin NIP5-1 isoform X2    243   5e-75    
ref|XP_008810761.1|  PREDICTED: aquaporin NIP6-1-like                   242   2e-74    
ref|XP_010912163.1|  PREDICTED: aquaporin NIP6-1-like                   241   4e-74    
ref|XP_009385167.1|  PREDICTED: probable aquaporin NIP5-1               238   6e-73    
ref|XP_006606911.1|  PREDICTED: probable aquaporin NIP5-1-like          237   7e-73    
ref|XP_010677474.1|  PREDICTED: probable aquaporin NIP5-1               237   8e-73    
ref|XP_008811734.1|  PREDICTED: aquaporin NIP6-1-like isoform X1        235   1e-71    
ref|XP_010927947.1|  PREDICTED: aquaporin NIP6-1-like                   233   1e-70    
ref|XP_010677699.1|  PREDICTED: probable aquaporin NIP5-1               225   2e-67    
gb|KHN04168.1|  Aquaporin NIP6-1                                        218   9e-66    
gb|KHN01295.1|  Aquaporin NIP6-1                                        216   2e-65    
ref|XP_002976312.1|  hypothetical protein SELMODRAFT_105221             216   3e-65    
ref|NP_001065048.2|  Os10g0513200                                       212   2e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004514574.1|  PREDICTED: aquaporin NIP6-1-like                   212   2e-63    
ref|XP_008381109.1|  PREDICTED: aquaporin NIP6-1-like                   209   1e-62    
emb|CCI55658.1|  EaNIP3,1                                               210   2e-62    
gb|KEH43640.1|  major intrinsic protein (MIP) family transporter        206   2e-60    
emb|CCI55660.1|  EaNIP3,3                                               205   2e-60    
ref|XP_010112877.1|  putative aquaporin NIP5-1                          202   4e-60    
ref|XP_008811735.1|  PREDICTED: aquaporin NIP6-1-like isoform X2        200   1e-58    
gb|ADE34295.1|  aquaporin NIP6;6                                        198   4e-58    
emb|CAN83047.1|  hypothetical protein VITISV_007005                     200   1e-57    Vitis vinifera
ref|XP_003604219.1|  Nodulin-like intrinsic protein NIP1-1              197   2e-57    
gb|ABK27103.1|  unknown                                                 198   2e-57    Picea sitchensis
ref|XP_002973287.1|  hypothetical protein SELMODRAFT_99369              196   5e-57    
emb|CCI55659.1|  EaNIP3,2                                               196   8e-57    
ref|XP_002976617.1|  hypothetical protein SELMODRAFT_105574             196   1e-56    
emb|CCI55666.1|  EaNIP3,9                                               195   2e-56    
emb|CCI55662.1|  EaNIP3,5                                               192   2e-55    
ref|XP_006659833.1|  PREDICTED: aquaporin NIP3-3-like                   192   3e-55    
emb|CCI55664.1|  EaNIP3,6                                               192   3e-55    
emb|CCI55663.1|  EaNIP3,6                                               192   3e-55    
emb|CCI55665.1|  EaNIP3,8                                               192   3e-55    
ref|XP_002862367.1|  predicted protein                                  191   4e-55    
ref|XP_001767204.1|  predicted protein                                  191   4e-55    
ref|XP_008648254.1|  PREDICTED: aquaporin NIP3-1 isoform X1             191   6e-55    
ref|XP_001759426.1|  predicted protein                                  189   8e-55    
ref|XP_004234073.1|  PREDICTED: aquaporin NIP1-1-like                   191   1e-54    
ref|XP_009403165.1|  PREDICTED: aquaporin NIP2-1-like                   190   4e-54    
ref|XP_002966719.1|  hypothetical protein SELMODRAFT_439677             189   4e-54    
ref|XP_001754375.1|  predicted protein                                  187   5e-54    
sp|Q7EYH7.1|NIP32_ORYSJ  RecName: Full=Aquaporin NIP3-2; AltName:...    189   6e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006356091.1|  PREDICTED: aquaporin NIP1-1-like                   189   7e-54    
ref|XP_002978023.1|  hypothetical protein SELMODRAFT_176694             188   7e-54    
ref|XP_009590978.1|  PREDICTED: aquaporin NIP1-1-like                   189   7e-54    
gb|KHG08004.1|  Aquaporin NIP2-1                                        188   8e-54    
ref|XP_009785425.1|  PREDICTED: aquaporin NIP1-1-like                   188   8e-54    
ref|XP_010939491.1|  PREDICTED: aquaporin NIP2-1-like                   189   9e-54    
ref|XP_010248404.1|  PREDICTED: aquaporin NIP1-1-like                   188   1e-53    
ref|XP_008802606.1|  PREDICTED: aquaporin NIP2-1-like                   188   1e-53    
dbj|BAK09175.1|  silicon transporter 1                                  188   2e-53    
ref|XP_009381416.1|  PREDICTED: aquaporin NIP2-1-like                   188   2e-53    
emb|CAD67694.1|  Nod26-like protein                                     187   2e-53    Cucurbita pepo
emb|CCI55661.1|  EaNIP3,4a                                              186   3e-53    
emb|CDO96878.1|  unnamed protein product                                187   4e-53    
gb|ABF66147.1|  putative NOD26-like membrane integral protein           187   5e-53    Triticum aestivum [Canadian hard winter wheat]
dbj|BAH84977.1|  silicon transporter                                    187   6e-53    Hordeum vulgare [barley]
ref|XP_011101921.1|  PREDICTED: aquaporin NIP1-1-like                   186   6e-53    
ref|XP_004974438.1|  PREDICTED: aquaporin NIP3-2-like                   186   9e-53    
ref|XP_006659832.1|  PREDICTED: aquaporin NIP3-2-like                   186   1e-52    
ref|XP_008784026.1|  PREDICTED: aquaporin NIP2-1-like                   186   1e-52    
ref|XP_010258345.1|  PREDICTED: aquaporin NIP2-1-like                   186   1e-52    
sp|Q84S07.1|NIP33_ORYSJ  RecName: Full=Aquaporin NIP3-3; AltName:...    185   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443852.1|  hypothetical protein SORBIDRAFT_07g003370          186   2e-52    Sorghum bicolor [broomcorn]
ref|XP_008443411.1|  PREDICTED: aquaporin NIP2-1-like                   185   2e-52    
ref|XP_010088003.1|  Aquaporin NIP1-2                                   185   2e-52    
gb|EAZ05605.1|  hypothetical protein OsI_27823                          185   2e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_010088157.1|  Aquaporin NIP2-2                                   185   2e-52    
ref|XP_002438105.1|  hypothetical protein SORBIDRAFT_10g008090          185   3e-52    Sorghum bicolor [broomcorn]
ref|XP_010040111.1|  PREDICTED: aquaporin NIP1-1-like                   184   3e-52    
ref|XP_007032542.1|  NOD26-like intrinsic protein 4,2                   185   3e-52    
gb|EEE68055.1|  hypothetical protein OsJ_26058                          185   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010088000.1|  Aquaporin NIP1-2                                   184   3e-52    
emb|CDO96880.1|  unnamed protein product                                184   3e-52    
gb|ACG28175.1|  aquaporin NIP4.1                                        185   4e-52    Zea mays [maize]
ref|XP_010088155.1|  Aquaporin NIP2-1                                   185   4e-52    
ref|XP_010057160.1|  PREDICTED: aquaporin NIP1-1-like                   184   4e-52    
ref|XP_002534417.1|  Silicon transporter, putative                      185   4e-52    Ricinus communis
ref|XP_002986711.1|  hypothetical protein SELMODRAFT_14944              182   4e-52    
ref|NP_001105020.1|  aquaporin NIP2-2                                   184   5e-52    Zea mays [maize]
ref|XP_009401397.1|  PREDICTED: aquaporin NIP2-1-like                   184   5e-52    
ref|XP_011020627.1|  PREDICTED: aquaporin NIP6-1 isoform X3             183   5e-52    
ref|XP_003564051.1|  PREDICTED: aquaporin NIP2-2                        184   6e-52    
ref|XP_010554965.1|  PREDICTED: aquaporin NIP2-1-like                   183   8e-52    
ref|XP_002962550.1|  hypothetical protein SELMODRAFT_165578             184   8e-52    
dbj|BAK09176.1|  silicon transporter 1                                  184   8e-52    
ref|XP_010429913.1|  PREDICTED: aquaporin NIP6-1-like isoform X2        184   9e-52    
ref|NP_001267699.1|  aquaporin NIP2-1-like                              183   9e-52    
gb|ABR17555.1|  unknown                                                 183   1e-51    Picea sitchensis
ref|XP_004304304.1|  PREDICTED: aquaporin NIP2-1-like                   183   1e-51    
ref|XP_004306143.1|  PREDICTED: aquaporin NIP2-1-like                   183   1e-51    
ref|XP_010915460.1|  PREDICTED: aquaporin NIP1-1-like                   183   1e-51    
dbj|BAB12437.1|  MIP                                                    183   1e-51    Adiantum capillus-veneris [maidenhair fern]
ref|XP_004309631.1|  PREDICTED: aquaporin NIP1-2-like                   182   1e-51    
ref|XP_007211782.1|  hypothetical protein PRUPE_ppa009698mg             183   1e-51    
ref|XP_009624262.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        182   2e-51    
gb|AHJ09606.1|  aquaporin protein 25                                    182   2e-51    
ref|XP_009624261.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        183   2e-51    
ref|XP_007025281.1|  NOD26-like intrinsic protein 1,2 isoform 2         182   2e-51    
dbj|BAJ91761.1|  predicted protein                                      183   2e-51    
ref|XP_004965042.1|  PREDICTED: aquaporin NIP2-2-like                   182   3e-51    
ref|XP_004953867.1|  PREDICTED: aquaporin NIP2-1-like                   182   3e-51    
ref|XP_004309620.1|  PREDICTED: aquaporin NIP1-2-like                   181   3e-51    
ref|XP_008790055.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        180   4e-51    
ref|NP_001105517.1|  aquaporin NIP2-3                                   182   4e-51    Zea mays [maize]
ref|XP_006357696.1|  PREDICTED: aquaporin NIP2-1-like                   182   4e-51    
ref|XP_011098628.1|  PREDICTED: aquaporin NIP2-1-like                   182   4e-51    
ref|NP_001105637.1|  aquaporin NIP2-1                                   182   5e-51    Zea mays [maize]
ref|XP_003629863.1|  Aquaporin NIP1-2                                   181   5e-51    
gb|KHN04167.1|  Aquaporin NIP6-1                                        178   6e-51    
gb|ABF67956.1|  NOD26-like major intrinsic protein                      182   6e-51    
ref|XP_002264957.2|  PREDICTED: aquaporin NIP1-1                        181   7e-51    
gb|EYU28128.1|  hypothetical protein MIMGU_mgv1a011383mg                181   8e-51    
ref|XP_010665679.1|  PREDICTED: aquaporin NIP1-1-like                   181   9e-51    
ref|XP_003629862.1|  Aquaporin NIP1-2                                   181   1e-50    
ref|NP_001274283.1|  Lsi-1                                              181   1e-50    
gb|AFW77428.1|  aquaporin NIP-type                                      181   1e-50    
ref|NP_001151947.1|  LOC100285584                                       181   1e-50    
ref|XP_008225242.1|  PREDICTED: aquaporin NIP1-1                        180   1e-50    
ref|XP_009804207.1|  PREDICTED: aquaporin NIP1-1-like                   180   1e-50    
ref|XP_002522274.1|  Aquaporin NIP1.1, putative                         180   2e-50    
gb|KCW76055.1|  hypothetical protein EUGRSUZ_D004222                    179   2e-50    
ref|XP_004960601.1|  PREDICTED: aquaporin NIP1-3-like                   180   2e-50    
ref|XP_003621222.1|  Aquaporin NIP2-1                                   179   2e-50    
ref|XP_008790053.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        180   3e-50    
ref|XP_010052151.1|  PREDICTED: nodulin-26-like                         179   3e-50    
tpg|DAA33874.1|  TPA: aquaporin NIP1;1                                  179   3e-50    
ref|XP_009139751.1|  PREDICTED: putative aquaporin NIP4-1               179   3e-50    
ref|XP_008341755.1|  PREDICTED: aquaporin NIP2-1-like                   179   3e-50    
gb|AFK43636.1|  unknown                                                 179   3e-50    
ref|XP_002440774.1|  hypothetical protein SORBIDRAFT_09g006390          179   3e-50    
ref|XP_009419139.1|  PREDICTED: aquaporin NIP2-1-like                   180   4e-50    
ref|XP_004306145.1|  PREDICTED: aquaporin NIP2-1-like                   179   4e-50    
gb|KDP27150.1|  hypothetical protein JCGZ_19849                         179   4e-50    
ref|XP_002454286.1|  hypothetical protein SORBIDRAFT_04g028020          179   4e-50    
ref|XP_006358084.1|  PREDICTED: aquaporin NIP1-1-like                   179   4e-50    
dbj|BAJ96213.1|  predicted protein                                      179   4e-50    
dbj|BAH24163.1|  silicon transporter                                    179   4e-50    
ref|XP_008341577.1|  PREDICTED: aquaporin NIP2-1-like                   179   5e-50    
ref|XP_010052152.1|  PREDICTED: nodulin-26-like                         179   5e-50    
ref|XP_006431151.1|  hypothetical protein CICLE_v10012382mg             179   6e-50    
ref|XP_002278054.2|  PREDICTED: aquaporin NIP2-1                        179   7e-50    
gb|ADM47602.1|  silicon transporter protein                             179   7e-50    
ref|XP_006482598.1|  PREDICTED: aquaporin NIP2-1-like                   179   7e-50    
ref|NP_001274704.1|  aquaporin NIP1-1-like                              178   8e-50    
ref|NP_001131324.1|  hypothetical protein                               179   9e-50    
ref|XP_004163347.1|  PREDICTED: aquaporin NIP1-2-like                   178   9e-50    
gb|EMT11650.1|  Aquaporin NIP2-2                                        179   1e-49    
ref|XP_010052153.1|  PREDICTED: nodulin-26-like                         177   1e-49    
ref|XP_002454982.1|  hypothetical protein SORBIDRAFT_03g002490          177   1e-49    
ref|XP_003570658.1|  PREDICTED: aquaporin NIP2-1                        178   1e-49    
gb|EMT30274.1|  Aquaporin NIP1-3                                        178   1e-49    
gb|KHG09072.1|  Aquaporin NIP1-2 -like protein                          177   1e-49    
gb|AAS48064.1|  NIP2                                                    177   1e-49    
ref|XP_008439707.1|  PREDICTED: aquaporin NIP1-1                        177   1e-49    
dbj|BAI66444.1|  nodulin-26 like intrinsic protein                      179   1e-49    
ref|XP_009801656.1|  PREDICTED: aquaporin NIP2-1-like                   177   2e-49    
gb|KHG20522.1|  Aquaporin NIP1-2 -like protein                          177   2e-49    
gb|EMS56871.1|  Aquaporin NIP2-1                                        179   2e-49    
ref|XP_004309621.1|  PREDICTED: aquaporin NIP1-2-like                   177   2e-49    
ref|XP_004309391.1|  PREDICTED: aquaporin NIP1-2-like                   177   2e-49    
ref|XP_006655938.1|  PREDICTED: aquaporin NIP2-2-like                   177   2e-49    
gb|KDP21151.1|  hypothetical protein JCGZ_21622                         177   3e-49    
ref|XP_008794153.1|  PREDICTED: aquaporin NIP1-1-like                   177   3e-49    
ref|XP_004302297.1|  PREDICTED: aquaporin NIP1-2-like                   176   3e-49    
gb|EYU34069.1|  hypothetical protein MIMGU_mgv1a011289mg                176   4e-49    
ref|XP_010451721.1|  PREDICTED: probable aquaporin NIP4-2               176   4e-49    
emb|CDY01700.1|  BnaC04g30520D                                          176   5e-49    
ref|XP_010436733.1|  PREDICTED: probable aquaporin NIP4-2               176   5e-49    
ref|XP_009341014.1|  PREDICTED: aquaporin NIP2-1-like                   176   6e-49    
ref|XP_003568755.1|  PREDICTED: aquaporin NIP1-3-like                   176   6e-49    
ref|XP_010236367.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin NI...    174   6e-49    
ref|XP_006647882.1|  PREDICTED: aquaporin NIP2-1-like                   176   7e-49    
emb|CAB45652.1|  nodulin26-like intrinsic protein                       176   7e-49    
ref|XP_007135807.1|  hypothetical protein PHAVU_010G160200g             176   8e-49    
ref|XP_006286127.1|  hypothetical protein CARUB_v10007677mg             175   8e-49    
ref|XP_002324057.1|  hypothetical protein POPTR_0017s11960g             176   8e-49    
ref|XP_003571857.1|  PREDICTED: aquaporin NIP1-1                        176   8e-49    
ref|NP_001048108.1|  Os02g0745100                                       176   9e-49    
ref|NP_198598.1|  putative aquaporin NIP4-2                             175   1e-48    
gb|ADK56129.1|  nodulin 26-like intrinsic protein                       175   1e-48    
gb|KHN48031.1|  Nodulin-26                                              175   1e-48    
ref|XP_008383590.1|  PREDICTED: aquaporin NIP1-1-like                   175   1e-48    
ref|XP_006414041.1|  hypothetical protein EUTSA_v10025855mg             175   2e-48    
gb|KDO77957.1|  hypothetical protein CISIN_1g023184mg                   173   2e-48    
ref|NP_001057207.1|  Os06g0228200                                       175   2e-48    
ref|XP_007216227.1|  hypothetical protein PRUPE_ppa016771mg             175   2e-48    
ref|XP_009352714.1|  PREDICTED: aquaporin NIP1-1-like                   174   2e-48    
gb|EPS64810.1|  hypothetical protein M569_09969                         174   3e-48    
ref|XP_011009650.1|  PREDICTED: aquaporin NIP1-2-like                   174   3e-48    
ref|XP_010088158.1|  Aquaporin NIP2-1                                   174   3e-48    
ref|XP_010518828.1|  PREDICTED: aquaporin NIP1-2-like                   174   3e-48    
ref|XP_002868544.1|  predicted protein                                  174   4e-48    
ref|XP_006467589.1|  PREDICTED: aquaporin NIP1-2-like                   174   4e-48    
ref|XP_002305717.2|  hypothetical protein POPTR_0004s06160g             174   4e-48    
gb|AAL05942.1|  early embryogenesis aquaglyceroporin                    173   4e-48    
pir||JQ2285  nodulin-26 - soybean                                       173   4e-48 
ref|XP_007159494.1|  hypothetical protein PHAVU_002G242300g             173   5e-48    
ref|XP_006405830.1|  hypothetical protein EUTSA_v10027876mg             174   5e-48    
ref|XP_006449563.1|  hypothetical protein CICLE_v10016171mg             174   5e-48    
gb|KDO77955.1|  hypothetical protein CISIN_1g023184mg                   174   5e-48    
gb|KFK33271.1|  hypothetical protein AALP_AA6G353400                    173   5e-48    
ref|XP_002317387.2|  hypothetical protein POPTR_0011s06770g             173   6e-48    
gb|KFK28558.1|  hypothetical protein AALP_AA7G012000                    174   6e-48    
ref|NP_001235870.1|  nodulin-26 precursor                               172   9e-48    
ref|XP_002890955.1|  predicted protein                                  172   9e-48    
ref|XP_007159493.1|  hypothetical protein PHAVU_002G242200g             172   9e-48    
emb|CAA68906.1|  NLM1 protein (NodLikeMip1)                             173   1e-47    
gb|AFK48191.1|  unknown                                                 172   1e-47    
ref|XP_010538580.1|  PREDICTED: aquaporin NIP1-2-like                   173   1e-47    
ref|XP_010088004.1|  Aquaporin NIP1-2                                   172   1e-47    
ref|XP_011039373.1|  PREDICTED: aquaporin NIP1-2-like                   172   1e-47    
ref|XP_008230983.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin NI...    172   1e-47    
ref|XP_010450542.1|  PREDICTED: putative aquaporin NIP4-1 isoform X1    171   1e-47    
ref|XP_010242173.1|  PREDICTED: aquaporin NIP1-1-like                   172   1e-47    
gb|KHN06433.1|  Nodulin-26                                              171   1e-47    
emb|CDY71538.1|  BnaA04g27980D                                          171   1e-47    
ref|XP_002867962.1|  hypothetical protein ARALYDRAFT_492953             172   1e-47    
emb|CDY41749.1|  BnaA08g07040D                                          172   2e-47    
ref|NP_567572.1|  aquaporin NIP1-1                                      172   2e-47    
gb|AEU11367.1|  Lsi-1                                                   170   2e-47    
ref|XP_004504263.1|  PREDICTED: nodulin-26-like                         171   2e-47    
ref|XP_010435691.1|  PREDICTED: putative aquaporin NIP4-1               172   2e-47    
ref|XP_009351781.1|  PREDICTED: aquaporin NIP1-1-like                   171   2e-47    
ref|XP_006405829.1|  hypothetical protein EUTSA_v10028303mg             172   2e-47    
dbj|BAI66443.1|  nodulin-26 like intrinsic protein                      172   3e-47    
ref|XP_010032492.1|  PREDICTED: aquaporin NIP2-1-like isoform X1        172   3e-47    
ref|XP_006580180.1|  PREDICTED: nodulin-26-like                         171   3e-47    
gb|KCW73998.1|  hypothetical protein EUGRSUZ_E02616                     171   3e-47    
ref|XP_010056835.1|  PREDICTED: aquaporin NIP1-1-like                   171   3e-47    
ref|XP_010925587.1|  PREDICTED: aquaporin NIP1-1-like                   171   3e-47    
ref|XP_006405831.1|  hypothetical protein EUTSA_v10028080mg             171   3e-47    
ref|XP_004504265.1|  PREDICTED: nodulin-26-like                         171   3e-47    
ref|XP_009108004.1|  PREDICTED: aquaporin NIP3-1                        172   4e-47    
ref|XP_009404528.1|  PREDICTED: aquaporin NIP1-1-like                   171   4e-47    
gb|KEH36650.1|  major intrinsic protein (MIP) family transporter        170   4e-47    
ref|XP_010937151.1|  PREDICTED: aquaporin NIP2-1-like                   171   5e-47    
gb|KCW73713.1|  hypothetical protein EUGRSUZ_E02324                     170   5e-47    
ref|XP_004485943.1|  PREDICTED: aquaporin NIP1-2-like                   171   5e-47    
ref|XP_007139574.1|  hypothetical protein PHAVU_008G041100g             172   5e-47    
ref|XP_006284229.1|  hypothetical protein CARUB_v10005388mg             171   6e-47    
emb|CDP02234.1|  unnamed protein product                                171   6e-47    
ref|XP_010450543.1|  PREDICTED: putative aquaporin NIP4-1 isoform X2    171   6e-47    
ref|XP_010058835.1|  PREDICTED: aquaporin NIP1-1-like                   170   6e-47    
ref|XP_003593788.1|  Aquaporin NIP1-2                                   170   6e-47    
ref|XP_006415281.1|  hypothetical protein EUTSA_v10008205mg             172   6e-47    
ref|XP_003593789.1|  Aquaporin NIP1-2                                   170   7e-47    
ref|XP_003593786.1|  Aquaporin NIP1-2                                   170   7e-47    
ref|XP_011035752.1|  PREDICTED: aquaporin NIP2-1-like                   171   7e-47    
ref|XP_007147986.1|  hypothetical protein PHAVU_006G171000g             170   8e-47    
emb|CDM82127.1|  unnamed protein product                                170   9e-47    
ref|XP_006303503.1|  hypothetical protein CARUB_v10010843mg             171   1e-46    
ref|XP_010440890.1|  PREDICTED: putative aquaporin NIP4-1               169   1e-46    
gb|AFK41455.1|  unknown                                                 170   1e-46    
ref|NP_198597.1|  putative aquaporin NIP4-1                             170   1e-46    
ref|XP_009774307.1|  PREDICTED: nodulin-26-like                         172   1e-46    
ref|XP_010058935.1|  PREDICTED: nodulin-26-like                         171   1e-46    
ref|XP_003546049.1|  PREDICTED: nodulin-26-like                         169   2e-46    
gb|KHN06915.1|  Nodulin-26                                              169   2e-46    
ref|XP_009140163.1|  PREDICTED: putative aquaporin NIP4-1               169   2e-46    
ref|XP_007025280.1|  NOD26-like intrinsic protein 1,2 isoform 1         170   2e-46    
emb|CDY65403.1|  BnaC06g42210D                                          169   4e-46    
ref|XP_009136970.1|  PREDICTED: aquaporin NIP1-2                        169   4e-46    
ref|XP_006643882.1|  PREDICTED: aquaporin NIP1-2-like                   167   4e-46    
emb|CDX98596.1|  BnaA03g43810D                                          169   4e-46    
gb|KDO77954.1|  hypothetical protein CISIN_1g023184mg                   169   4e-46    
ref|XP_006285157.1|  hypothetical protein CARUB_v10006501mg             169   4e-46    
emb|CDX99688.1|  BnaC04g34450D                                          168   5e-46    
gb|KHN47385.1|  Aquaporin NIP1-2                                        168   5e-46    
ref|XP_002453573.1|  hypothetical protein SORBIDRAFT_04g008360          168   5e-46    
ref|XP_011102069.1|  PREDICTED: aquaporin NIP1-1-like                   168   5e-46    
ref|XP_006361154.1|  PREDICTED: multicystatin-like                      174   6e-46    
ref|XP_010058934.1|  PREDICTED: aquaporin NIP1-1-like                   170   6e-46    
ref|NP_001242005.1|  uncharacterized protein LOC100812577               168   6e-46    
gb|KFK28559.1|  hypothetical protein AALP_AA7G012100                    168   6e-46    
ref|XP_009605352.1|  PREDICTED: nodulin-26-like                         170   7e-46    
emb|CDY01565.1|  BnaC07g35550D                                          168   8e-46    
gb|AAM61294.1|  major intrinsic protein (MIP)- like                     168   8e-46    
ref|NP_001046375.1|  Os02g0232900                                       167   9e-46    
ref|XP_011101927.1|  PREDICTED: aquaporin NIP1-1-like                   167   1e-45    
ref|XP_002868543.1|  hypothetical protein ARALYDRAFT_330314             167   1e-45    
ref|NP_001266068.1|  aquaporin NIP2-1-like                              167   1e-45    
ref|XP_010449446.1|  PREDICTED: aquaporin NIP1-2-like                   167   1e-45    
gb|EYU31218.1|  hypothetical protein MIMGU_mgv11b021390mg               164   2e-45    
ref|XP_003633704.1|  PREDICTED: probable aquaporin NIP-type             167   2e-45    
ref|XP_006842671.1|  hypothetical protein AMTR_s00147p00033730          166   2e-45    
gb|KEH36649.1|  major intrinsic protein (MIP) family transporter        164   2e-45    
ref|XP_006827236.1|  hypothetical protein AMTR_s00010p00260950          166   2e-45    
ref|XP_006847785.1|  hypothetical protein AMTR_s00162p00078280          167   2e-45    
ref|XP_007147984.1|  hypothetical protein PHAVU_006G170900g             166   2e-45    
ref|XP_009777259.1|  PREDICTED: aquaporin NIP1-1-like isoform X2        166   2e-45    
gb|EMT21244.1|  Aquaporin NIP1-2                                        166   2e-45    
ref|XP_009777199.1|  PREDICTED: aquaporin NIP1-1-like isoform X1        166   2e-45    
ref|XP_004134594.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin NI...    166   3e-45    
ref|XP_006448269.1|  hypothetical protein CICLE_v10017700mg             165   4e-45    
ref|NP_001274279.1|  nodulin-26-like                                    167   4e-45    
ref|XP_010439792.1|  PREDICTED: aquaporin NIP1-2                        166   4e-45    
ref|NP_193626.1|  NOD26-like intrinsic protein 1;2                      166   6e-45    
ref|XP_010528527.1|  PREDICTED: putative aquaporin NIP4-1               165   6e-45    
ref|XP_010434480.1|  PREDICTED: aquaporin NIP1-2-like                   166   7e-45    
ref|XP_010056836.1|  PREDICTED: aquaporin NIP1-1-like                   165   7e-45    
gb|AES64038.2|  major intrinsic protein (MIP) family transporter        165   7e-45    
ref|XP_008811736.1|  PREDICTED: aquaporin NIP6-1-like isoform X3        163   9e-45    
ref|XP_009132304.1|  PREDICTED: aquaporin NIP1-2-like                   165   9e-45    
ref|XP_002870013.1|  hypothetical protein ARALYDRAFT_492969             165   1e-44    
gb|ABS72446.1|  NIP1                                                    164   1e-44    
emb|CDX78905.1|  BnaA01g09720D                                          165   1e-44    
ref|XP_010499739.1|  PREDICTED: aquaporin NIP3-1                        166   1e-44    
ref|XP_004485942.1|  PREDICTED: aquaporin NIP1-2-like                   164   1e-44    
emb|CDO96885.1|  unnamed protein product                                163   1e-44    
ref|XP_006647103.1|  PREDICTED: aquaporin NIP1-1-like                   164   2e-44    
gb|AAG50717.1|AC079041_10  major intrinsic protein, putative            164   2e-44    
ref|XP_006469313.1|  PREDICTED: probable aquaporin NIP-type-like        164   2e-44    
emb|CDX99411.1|  BnaC01g11410D                                          164   2e-44    
ref|XP_010478611.1|  PREDICTED: aquaporin NIP3-1-like                   165   2e-44    
gb|EEC78689.1|  hypothetical protein OsI_18834                          164   2e-44    
ref|XP_003593787.1|  Aquaporin NIP1-2                                   165   3e-44    
ref|XP_010062240.1|  PREDICTED: probable aquaporin NIP-type             164   3e-44    
ref|XP_010274649.1|  PREDICTED: probable aquaporin NIP-type             164   3e-44    
ref|XP_003593792.1|  Aquaporin NIP1-2                                   164   3e-44    
gb|EMT01176.1|  Aquaporin NIP2-1                                        165   3e-44    
gb|KCW69342.1|  hypothetical protein EUGRSUZ_F02826                     164   3e-44    
ref|XP_009786583.1|  PREDICTED: probable aquaporin NIP-type             163   3e-44    
gb|KHN13616.1|  Aquaporin NIP2-1                                        164   4e-44    
ref|XP_003534451.1|  PREDICTED: aquaporin NIP2-1-like                   164   4e-44    
emb|CCI69206.1|  NIP aquaporin                                          163   4e-44    
emb|CAA16760.2|  nodulin-26-like protein                                164   4e-44    
ref|NP_174472.2|  aquaporin NIP3-1                                      164   4e-44    
ref|XP_009762968.1|  PREDICTED: probable aquaporin NIP-type isofo...    163   5e-44    
emb|CDX84114.1|  BnaC08g07910D                                          164   5e-44    



>ref|XP_011083233.1| PREDICTED: probable aquaporin NIP5-1 [Sesamum indicum]
Length=300

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 191/199 (96%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  102  GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKGVFHPFMSGGVTVPSVTTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGA+AGAAIYT+
Sbjct  222  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAVAGAAIYTL  281

Query  417  VKLREEVEPTSRP-RSFRR  364
            VKLR E E   R  RSFRR
Sbjct  282  VKLRSEDEEEPRQVRSFRR  300



>ref|XP_011038068.1| PREDICTED: probable aquaporin NIP5-1 [Populus euphratica]
Length=299

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 188/198 (95%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            AE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSAS
Sbjct  102  AETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSAS  161

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHPF+SGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI
Sbjct  162  ICASFALKGVFHPFMSGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI  221

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAG YK IWIYLVAPTLGA+AGAA YT V
Sbjct  222  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGTYKEIWIYLVAPTLGALAGAATYTAV  281

Query  414  KLRE-EVEPTSRPRSFRR  364
            KLRE E +P  + RSFRR
Sbjct  282  KLREGEADPPRQVRSFRR  299



>ref|NP_001274996.1| probable aquaporin NIP5-1-like [Solanum tuberosum]
 gb|AFD96389.1| nodulin 26-like intrinsic protein [Solanum tuberosum]
Length=296

 Score =   331 bits (849),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 191/200 (96%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAAC+GLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+AAQVSA
Sbjct  97   GAESLIGNAACSGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSA  156

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  157  SICASFALKGVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  216

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNYKS+WIYLVAPTLGAIAGAA+YT+
Sbjct  217  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYKSLWIYLVAPTLGAIAGAAVYTL  276

Query  417  VKLR--EEVEPTSRPRSFRR  364
            VKLR  +  E  S+ RSFRR
Sbjct  277  VKLRGDDTTETPSQVRSFRR  296



>ref|XP_002518973.1| Nodulin-26, putative [Ricinus communis]
 gb|EEF43506.1| Nodulin-26, putative [Ricinus communis]
Length=298

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GVETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++WIYLVAPTLGAIAGA  Y+ 
Sbjct  220  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLVAPTLGAIAGAGTYSA  279

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR EEV+P    RSFRR
Sbjct  280  VKLREEEVDPPRPVRSFRR  298



>ref|NP_001274288.1| probable aquaporin NIP5-1-like [Solanum lycopersicum]
 dbj|BAO18646.1| nodulin26-like intrinsic protein 5;1 [Solanum lycopersicum]
Length=295

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAAC+GLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+AAQVSA
Sbjct  97   GAESLIGNAACSGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSA  156

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  157  SICASFALKGVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  216

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNYKS+WIYLVAPTLGA+AGAA+YT+
Sbjct  217  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYKSLWIYLVAPTLGALAGAAVYTL  276

Query  417  VKLREEVEPTSRP-RSFRR  364
            VKLR +   T R  RSFRR
Sbjct  277  VKLRGDTTETPRQVRSFRR  295



>ref|XP_010529699.1| PREDICTED: probable aquaporin NIP5-1 [Tarenaya hassleriana]
Length=304

 Score =   329 bits (844),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV  GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVGIGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYK+IWIYLVAPTLGA+AGAA+YT 
Sbjct  226  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKAIWIYLVAPTLGAVAGAAVYTG  285

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  286  VKLSDSEADPPRQVRSFRR  304



>ref|XP_002298990.1| hypothetical protein POPTR_0001s45920g [Populus trichocarpa]
 gb|EEE83795.1| hypothetical protein POPTR_0001s45920g [Populus trichocarpa]
Length=299

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            AE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSAS
Sbjct  102  AETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSAS  161

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHPF+SGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI
Sbjct  162  ICASFALKGVFHPFMSGGVTVPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI  221

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPSSGGSMNPVR+LGPAVAAG YK IWIYLVAPTLGA+ GAA YT V
Sbjct  222  AVGATVMLNILVAGPSSGGSMNPVRSLGPAVAAGTYKDIWIYLVAPTLGALVGAATYTAV  281

Query  414  KLR-EEVEPTSRPRSFRR  364
            KLR EE +P  + RSFRR
Sbjct  282  KLREEEADPPRQVRSFRR  299



>ref|XP_009590733.1| PREDICTED: probable aquaporin NIP5-1 [Nicotiana tomentosiformis]
Length=297

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 189/200 (95%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESLIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+AAQVSA
Sbjct  98   GVESLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSA  157

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALKGVFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  158  SVCASFALKGVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  217

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNYKS+WIYLVAPTLGA+AGAA+YT+
Sbjct  218  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYKSLWIYLVAPTLGALAGAAVYTL  277

Query  417  VKLR--EEVEPTSRPRSFRR  364
            VKLR  +  E   + RSFRR
Sbjct  278  VKLRGDDSTETPRQVRSFRR  297



>ref|XP_008437497.1| PREDICTED: probable aquaporin NIP5-1 [Cucumis melo]
Length=298

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GVETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVSTGQAFALEF+ITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVSTGQAFALEFIITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++W+YLVAPTLGAI GA  YT 
Sbjct  220  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWVYLVAPTLGAIIGAGTYTA  279

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR +EVE  S+ RSFRR
Sbjct  280  VKLRDDEVEAPSQVRSFRR  298



>ref|XP_002276319.1| PREDICTED: probable aquaporin NIP5-1 [Vitis vinifera]
 emb|CBI34648.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GVETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSVS GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKAVFHPFMSGGVTVPSVSIGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY++IWIYLVAPTLGA+AGAAIYT 
Sbjct  220  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRAIWIYLVAPTLGAVAGAAIYTA  279

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR +E E   + RSFRR
Sbjct  280  VKLRADEGEQPRQVRSFRR  298



>ref|XP_010555246.1| PREDICTED: probable aquaporin NIP5-1 [Tarenaya hassleriana]
Length=331

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAY+AAQVSA
Sbjct  133  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYVAAQVSA  192

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  193  SICASFALKGVFHPFMSGGVTVPSVSIGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  252

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++WIYL+APTLGA+AGAA+YT 
Sbjct  253  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLLAPTLGAVAGAAVYTS  312

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  313  VKLEDTETDPPRQVRSFRR  331



>ref|XP_011004393.1| PREDICTED: probable aquaporin NIP5-1 [Populus euphratica]
Length=300

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            AE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTI FAALRHFPW QVPAYIAAQVSAS
Sbjct  103  AETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTITFAALRHFPWVQVPAYIAAQVSAS  162

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHPF+SGGVTVPSVS GQAFALEF ITFNLLFVVTAVATDTRAVGELAGI
Sbjct  163  ICASFALKGVFHPFMSGGVTVPSVSNGQAFALEFFITFNLLFVVTAVATDTRAVGELAGI  222

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA  YT+V
Sbjct  223  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKEIWIYLVAPTLGALAGAGTYTLV  282

Query  414  KLREEVEPTSRP-RSFRR  364
            KLR++     RP RSFRR
Sbjct  283  KLRDDEADPPRPVRSFRR  300



>ref|XP_002317642.1| hypothetical protein POPTR_0011s14990g [Populus trichocarpa]
 gb|EEE98254.1| hypothetical protein POPTR_0011s14990g [Populus trichocarpa]
Length=300

 Score =   327 bits (837),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            AE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSAS
Sbjct  103  AETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSAS  162

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHPF+SGGVTVPSVSTGQAFALEF ITFNLLFVVTAVATDTRAVGELAGI
Sbjct  163  ICASFALKGVFHPFMSGGVTVPSVSTGQAFALEFFITFNLLFVVTAVATDTRAVGELAGI  222

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPS+GGSMNPVRTLGPA+AAGNYK IWIYLVAPTLGA+ GA  YT+V
Sbjct  223  AVGATVMLNILVAGPSTGGSMNPVRTLGPAIAAGNYKKIWIYLVAPTLGAVVGAGAYTLV  282

Query  414  KLREEVEPTSRP-RSFRR  364
            KLR++     RP RSFRR
Sbjct  283  KLRDDETDPPRPVRSFRR  300



>ref|XP_009803208.1| PREDICTED: probable aquaporin NIP5-1 [Nicotiana sylvestris]
Length=297

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 190/200 (95%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAAC+GLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+AAQVSA
Sbjct  98   GAESLIGNAACSGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYVAAQVSA  157

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALKGVFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  158  SVCASFALKGVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  217

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNYKS+WIY+VAPTLGA+AGAA+YT+
Sbjct  218  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYKSLWIYIVAPTLGALAGAAVYTL  277

Query  417  VKLR--EEVEPTSRPRSFRR  364
            VKLR  +  E   + RSFRR
Sbjct  278  VKLRGDDSSETPRQVRSFRR  297



>gb|AGE09576.1| NOD-like protein [Eucalyptus cladocalyx]
Length=227

 Score =   323 bits (827),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 187/198 (94%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSAS
Sbjct  30   SETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWTQVPAYIAAQVSAS  89

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHP++SGGVT+P+V  GQAFALEFLITFNLLFVVTAVATDTRAVGELAGI
Sbjct  90   ICASFALKGVFHPYMSGGVTLPTVGHGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI  149

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+AGA  YTVV
Sbjct  150  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLVAPTLGALAGAGAYTVV  209

Query  414  KLR-EEVEPTSRPRSFRR  364
            KLR +E +P    RSFRR
Sbjct  210  KLRDDETDPPRSVRSFRR  227



>ref|XP_004145889.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 ref|XP_004166374.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 gb|KGN49946.1| hypothetical protein Csa_5G146190 [Cucumis sativus]
Length=298

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GVETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVSIGQAFALEFIITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYK++W+YLVAPTLGAI GA  YT 
Sbjct  220  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKALWVYLVAPTLGAIIGAGTYTA  279

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR +EV+  S+ RSFRR
Sbjct  280  VKLRDDEVDAPSQVRSFRR  298



>ref|XP_006434369.1| hypothetical protein CICLE_v10001994mg [Citrus clementina]
 gb|ESR47609.1| hypothetical protein CICLE_v10001994mg [Citrus clementina]
Length=300

 Score =   325 bits (834),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYI AQVSA
Sbjct  102  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+ +WI+L+APTLGA+AGA  YTV
Sbjct  222  IAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTV  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E +P    RSFRR
Sbjct  282  VKLRDNETDPPREARSFRR  300



>ref|XP_006472916.1| PREDICTED: probable aquaporin NIP5-1-like [Citrus sinensis]
Length=300

 Score =   325 bits (833),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYI AQVSA
Sbjct  102  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+ +WI+L+APTLGA+AGA  YTV
Sbjct  222  IAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTV  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E +P    RSFRR
Sbjct  282  VKLRDNETDPPREARSFRR  300



>gb|AFN37617.1| boron transporter [Citrus trifoliata]
Length=300

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYI AQVSA
Sbjct  102  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIMAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+ +WI+L+APTLGA+AGA  YTV
Sbjct  222  IAVGATVMLNILMAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTV  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E +P    RSFRR
Sbjct  282  VKLRDNETDPPREARSFRR  300



>ref|XP_010054000.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
 gb|KCW78377.1| hypothetical protein EUGRSUZ_D02548 [Eucalyptus grandis]
Length=294

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 188/198 (95%), Gaps = 1/198 (1%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSAS
Sbjct  97   SETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWTQVPAYIAAQVSAS  156

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKGVFHP++SGGVT+P+VS GQAFALEFLITFNLLFVVTAVATDTRAVGELAGI
Sbjct  157  ICASFALKGVFHPYMSGGVTLPTVSHGQAFALEFLITFNLLFVVTAVATDTRAVGELAGI  216

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+AGA  YTVV
Sbjct  217  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLVAPTLGALAGAGTYTVV  276

Query  414  KLREEVEPTSRP-RSFRR  364
            KLR++     RP RSFRR
Sbjct  277  KLRDDETDPPRPVRSFRR  294



>ref|XP_010455435.1| PREDICTED: probable aquaporin NIP5-1 isoform X1 [Camelina sativa]
Length=307

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  109  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  168

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  169  SICASFALKGVFHPFMSGGVTVPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAG  228

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+GGSMNPVRTLGPAVA+GNY+S+WIYLVAPTLGAIAGAA+YT 
Sbjct  229  IAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWIYLVAPTLGAIAGAAVYTG  288

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  289  VKLNDSETDPPRQVRSFRR  307



>ref|XP_010455436.1| PREDICTED: probable aquaporin NIP5-1 isoform X2 [Camelina sativa]
Length=304

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+GGSMNPVRTLGPAVA+GNY+S+WIYLVAPTLGAIAGAA+YT 
Sbjct  226  IAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWIYLVAPTLGAIAGAAVYTG  285

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  286  VKLNDSETDPPRQVRSFRR  304



>ref|XP_010251728.1| PREDICTED: probable aquaporin NIP5-1 [Nelumbo nucifera]
Length=300

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGL VM++ILSTGH+SGAHLNPSLTIAFA  RHFPW QVPAYI AQVSA
Sbjct  102  GAETLIGNAACAGLGVMVVILSTGHLSGAHLNPSLTIAFAVFRHFPWVQVPAYIVAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHP+LSGGVTVPSVS GQAFALEF+ITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKGVFHPYLSGGVTVPSVSHGQAFALEFIITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+++W+YLVAPTLGA+AGA +YT+
Sbjct  222  IAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYRALWVYLVAPTLGAVAGAGVYTL  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLRE EVEP+   RSFRR
Sbjct  282  VKLREDEVEPSRPVRSFRR  300



>gb|KHG22884.1| putative aquaporin NIP5-1 -like protein [Gossypium arboreum]
Length=298

 Score =   323 bits (829),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+L+GNA CAGLAVMIIILSTGHISGAHLNPSLTIAFAA RHFPW QVPAYIAAQVSA
Sbjct  100  GAETLLGNATCAGLAVMIIILSTGHISGAHLNPSLTIAFAACRHFPWTQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVSHGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+++WIYL+APTLGA+ G+A YT+
Sbjct  220  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLIAPTLGAVIGSATYTL  279

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLRE EV+   + RSFRR
Sbjct  280  VKLREDEVDAPRQVRSFRR  298



>ref|XP_009360260.1| PREDICTED: probable aquaporin NIP5-1 [Pyrus x bretschneideri]
Length=298

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHP++SGGVTVP+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFALKGIFHPYMSGGVTVPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +WIYLVAPTLGA+AGAA YT 
Sbjct  219  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYTKLWIYLVAPTLGALAGAATYTA  278

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  279  VKLREDEVDAPVREARSFRR  298



>ref|XP_008356814.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=298

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHP++SGGVTVP+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFALKGIFHPYISGGVTVPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +WIYLVAPTLGA+AGAA YT 
Sbjct  219  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYTKLWIYLVAPTLGALAGAATYTA  278

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  279  VKLREDEVDAPVREARSFRR  298



>ref|NP_192776.1| putative aquaporin NIP5-1 [Arabidopsis thaliana]
 sp|Q9SV84.1|NIP51_ARATH RecName: Full=Probable aquaporin NIP5-1; AltName: Full=NOD26-like 
intrinsic protein 5-1; Short=AtNIP5;1; AltName: Full=Nodulin-26-like 
major intrinsic protein 6; Short=NodLikeMip6; 
Short=Protein NLM6 [Arabidopsis thaliana]
 emb|CAB39791.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 emb|CAB78161.1| major intrinsic protein (MIP)-like [Arabidopsis thaliana]
 gb|AAM65102.1| major intrinsic protein (MIP)-like protein [Arabidopsis thaliana]
 gb|ABO09890.1| At4g10380 [Arabidopsis thaliana]
 gb|AEE82874.1| putative aquaporin NIP5-1 [Arabidopsis thaliana]
Length=304

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVT+PSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTIPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+GGSMNPVRTLGPAVA+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  226  IAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAISGAAVYTG  285

Query  417  VKLREEVEPTSRP-RSFRR  364
            VKL + V    RP RSFRR
Sbjct  286  VKLNDSVTDPPRPVRSFRR  304



>emb|CDP12262.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+IL+TGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVS 
Sbjct  99   GAETLIGNAACAGLAVMIVILATGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV  GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  159  SICASFALKGVFHPFMSGGVTVPSVGNGQAFALEFVITFVLLFVVTAVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPA+AAGNYKSIW+YL+APTLGA+AGAA+YT 
Sbjct  219  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAIAAGNYKSIWVYLLAPTLGALAGAAVYTF  278

Query  417  VKLREEVEPTSRP-RSFRR  364
            VKL+ +   T RP RSFRR
Sbjct  279  VKLQGDETETPRPVRSFRR  297



>ref|XP_002874623.1| hypothetical protein ARALYDRAFT_911337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50882.1| hypothetical protein ARALYDRAFT_911337 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   321 bits (823),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV  GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVGVGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+GGSMNPVRTLGPAVA+GNY+S+W+YLVAPTLGAIAGAA+YT 
Sbjct  226  IAVGATVMLNILVAGPSTGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAIAGAAVYTG  285

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL + V +P  + RSFRR
Sbjct  286  VKLNDSVTDPPRQVRSFRR  304



>ref|XP_010437147.1| PREDICTED: probable aquaporin NIP5-1 [Camelina sativa]
Length=304

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILV+GPS+G SMNPVRTLGPAVA+GNY+S+WIYLVAPTLGAIAGAA+YT 
Sbjct  226  IAVGATVMLNILVSGPSTGASMNPVRTLGPAVASGNYRSLWIYLVAPTLGAIAGAAVYTG  285

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  286  VKLNDSETDPPRQVRSFRR  304



>ref|XP_007209472.1| hypothetical protein PRUPE_ppa010013mg [Prunus persica]
 gb|EMJ10671.1| hypothetical protein PRUPE_ppa010013mg [Prunus persica]
Length=267

 Score =   320 bits (819),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVS 
Sbjct  68   GAETLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSG  127

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG FHP++SGG TVP+VSTGQAFALEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  128  SICASFALKGAFHPYMSGGTTVPTVSTGQAFALEFIITFNLLFVVTAVATDTRALGELAG  187

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +W+YLVAPTLGA+AGA  YT 
Sbjct  188  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYTKLWVYLVAPTLGALAGAGTYTA  247

Query  417  VKLREE--VEPTSRPRSFRR  364
            VKLRE+   EP    RSFRR
Sbjct  248  VKLREDEVDEPVREARSFRR  267



>ref|XP_010421957.1| PREDICTED: probable aquaporin NIP5-1 [Camelina sativa]
Length=304

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVSLGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+G SMNPVRTLGPAVA+GNY+S+WIYLVAPTLG IAGAA+YT 
Sbjct  226  IAVGATVMLNILVAGPSTGASMNPVRTLGPAVASGNYRSLWIYLVAPTLGGIAGAAVYTG  285

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  286  VKLNDSETDPPRQVRSFRR  304



>gb|KFK31988.1| hypothetical protein AALP_AA6G185600 [Arabis alpina]
Length=302

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  104  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALKGVFHPF+SGGVTVPSV+ GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  164  SLCASFALKGVFHPFMSGGVTVPSVNVGQAFALEFIITFILLFVVTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGP++G SMNPVRTLGPAVA+GNY+SIW+YLVAPTLGAIAGAA+YT 
Sbjct  224  IAVGATVMLNILVAGPATGASMNPVRTLGPAVASGNYRSIWVYLVAPTLGAIAGAAVYTG  283

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  284  VKLNDSETDPPRQVRSFRR  302



>gb|KDP25192.1| hypothetical protein JCGZ_20348 [Jatropha curcas]
Length=298

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAAC+GLAVMI+ILSTGHISGAHLNP+LTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GVETLIGNAACSGLAVMIVILSTGHISGAHLNPALTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVT+PSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTIPSVSTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV LNILVAGPSSG SMNPVRTLGPAVAAGNYK+IWIYLVAP LG +AG   YT 
Sbjct  220  IAVGATVALNILVAGPSSGASMNPVRTLGPAVAAGNYKAIWIYLVAPILGGLAGGTTYTA  279

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLRE E +P  + RSFRR
Sbjct  280  VKLREDEADPPRQVRSFRR  298



>ref|XP_008239293.1| PREDICTED: probable aquaporin NIP5-1 [Prunus mume]
Length=298

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVS 
Sbjct  99   GAETLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG FHP++SGG TVP+VSTGQAFALEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFALKGAFHPYMSGGTTVPTVSTGQAFALEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +WIYLVAPTLGA+AGA  YT 
Sbjct  219  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYTKLWIYLVAPTLGALAGAGTYTA  278

Query  417  VKLREE--VEPTSRPRSFRR  364
            VKLRE+   EP    RSFRR
Sbjct  279  VKLREDEVDEPVREARSFRR  298



>ref|XP_006288313.1| hypothetical protein CARUB_v10001558mg [Capsella rubella]
 gb|EOA21211.1| hypothetical protein CARUB_v10001558mg [Capsella rubella]
Length=304

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  106  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  166  SICASFALKGVFHPFMSGGVTVPSVSIGQAFALEFIITFILLFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGA+VMLNILVAGPS+G SMNPVRTLGPAVA+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  226  IAVGASVMLNILVAGPSTGASMNPVRTLGPAVASGNYRSLWLYLVAPTLGAISGAAVYTG  285

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E +P  + RSFRR
Sbjct  286  VKLNDTETDPPRQVRSFRR  304



>ref|XP_009360304.1| PREDICTED: probable aquaporin NIP5-1 [Pyrus x bretschneideri]
Length=298

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHP++SGGVTVP+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFALKGIFHPYMSGGVTVPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVA GNY  +WIYLVAPT GA+AGAA YT 
Sbjct  219  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVALGNYTKLWIYLVAPTRGALAGAATYTA  278

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  279  VKLREDEVDAPVREARSFRR  298



>ref|XP_009128716.1| PREDICTED: probable aquaporin NIP5-1 [Brassica rapa]
 emb|CDY25253.1| BnaA02g22030D [Brassica napus]
Length=301

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  163  SICASFALKAVFHPFMSGGVTVPSVSVGQAFALEFIITFILLFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPA+A+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNILVAGPSSGGSMNPVRTLGPALASGNYRSLWVYLVAPTLGAISGAAVYTG  282

Query  417  VKLREE-VEPTSRPRSFRR  364
            VKL +   +P  + RSFRR
Sbjct  283  VKLNDSATDPPRQVRSFRR  301



>ref|XP_006397069.1| hypothetical protein EUTSA_v10028842mg [Eutrema salsugineum]
 gb|ESQ38522.1| hypothetical protein EUTSA_v10028842mg [Eutrema salsugineum]
Length=301

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW+ VPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWSHVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPS S GQAFALEF+I+F LLFVVTAVATDTRAVGELAG
Sbjct  163  SICASFALKAVFHPFMSGGVTVPSSSIGQAFALEFIISFILLFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVA+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVASGNYRSLWVYLVAPTLGAISGAAVYTG  282

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL + E++P  + RSFRR
Sbjct  283  VKLNDSEIDPPRQVRSFRR  301



>emb|CDX94261.1| BnaC02g29210D [Brassica napus]
Length=301

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSVS GQAFALEF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  163  SICASFALKAVFHPFMSGGVTVPSVSVGQAFALEFIITFILLFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPA+A+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNILVAGPSSGGSMNPVRTLGPALASGNYRSLWVYLVAPTLGAISGAAVYTG  282

Query  417  VKLREE-VEPTSRPRSFRR  364
            VKL +   +P  + RSFRR
Sbjct  283  VKLNDSATDPPRQVRSFRR  301



>ref|XP_007039259.1| NOD26-like intrinsic protein 5,1 [Theobroma cacao]
 gb|EOY23760.1| NOD26-like intrinsic protein 5,1 [Theobroma cacao]
Length=298

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAA RHFPWA VPAY+AAQVSA
Sbjct  100  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAACRHFPWAHVPAYVAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV  GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVGYGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAG SSGGSMNPVRTLGPAVAAGNYK++WIYL+APTLGA+ G+  YT+
Sbjct  220  IAVGATVMLNILVAGSSSGGSMNPVRTLGPAVAAGNYKALWIYLIAPTLGALVGSGTYTL  279

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKL E E E   + RSFRR
Sbjct  280  VKLHEDEAEAPRQVRSFRR  298



>gb|AAQ11827.1| nodulin-like intrinsic protein NIP1-2, partial [Atriplex nummularia]
Length=294

 Score =   315 bits (808),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQV+A
Sbjct  96   GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAA  155

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI AS ALKGVFHPF++GGVTVPSV  GQAFALEFLITFNL+FVVTAVATDTRAVGELAG
Sbjct  156  SILASLALKGVFHPFMAGGVTVPSVGIGQAFALEFLITFNLMFVVTAVATDTRAVGELAG  215

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+ GAAIY +
Sbjct  216  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYRAVWIYLVAPTLGALGGAAIYKL  275

Query  417  VKLRE-EVEPTSRPRSFRR  364
            V+L+E EVEP    RSFRR
Sbjct  276  VQLQEHEVEPPRPTRSFRR  294



>ref|XP_010680950.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=298

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVP YIAAQV+A
Sbjct  100  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWVQVPGYIAAQVAA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI AS  LKGVFHPF+SGGVTVPSVS GQAFALEFLITFNL+FVVTAVATD+RAVGELAG
Sbjct  160  SILASLTLKGVFHPFMSGGVTVPSVSIGQAFALEFLITFNLMFVVTAVATDSRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNY+++WIY+VAPTLGA+ GAAIY +
Sbjct  220  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYRAVWIYMVAPTLGALGGAAIYKL  279

Query  417  VKLRE-EVEPTSRPRSFRR  364
            V+L+E E EP    RSFRR
Sbjct  280  VQLQEHEAEPPRPTRSFRR  298



>gb|AEY75255.1| nodulin-like intrinsic protein [Atriplex canescens]
Length=300

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQV+A
Sbjct  102  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI AS ALKGVFHPF++GGVTVPSV  GQAFALEFLITFNL+FVVTAVATDTRAVGELAG
Sbjct  162  SILASLALKGVFHPFMAGGVTVPSVGVGQAFALEFLITFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+ GAAIY +
Sbjct  222  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYRAVWIYLVAPTLGALGGAAIYKL  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            V+L+E EVEP    RSF R
Sbjct  282  VQLQEHEVEPPRPTRSFHR  300



>emb|CDX67591.1| BnaA07g16310D [Brassica napus]
Length=301

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPS+TIAFAALRHFPWAQVPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSMTIAFAALRHFPWAQVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSVS GQAFALEF+I+F LLFV+TAVATDTRAVGELAG
Sbjct  163  SICASFALKAVFHPFMSGGVTVPSVSVGQAFALEFIISFILLFVITAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLN LVAGPSSG SMNPVRTLGPA+A+GNY+S+W+Y+VAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNNLVAGPSSGASMNPVRTLGPALASGNYRSLWVYMVAPTLGAISGAAVYTG  282

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL + V +P  + RSFRR
Sbjct  283  VKLNDNVSDPPRQVRSFRR  301



>ref|XP_009389176.1| PREDICTED: probable aquaporin NIP5-1 [Musa acuminata subsp. malaccensis]
Length=296

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFA LRHFPWA VPAYI AQVSA
Sbjct  98   GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAMLRHFPWAHVPAYILAQVSA  157

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPFLSGGVTVPSVS+ QAF +EFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  158  SICASFALKAVFHPFLSGGVTVPSVSSPQAFFIEFLITFNLLFVVTAVATDTRAVGELAG  217

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNY+ IWIYLVAPT GA+ GAA+YT 
Sbjct  218  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYERIWIYLVAPTAGAVTGAAVYTA  277

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL+EE  E   + RSFRR
Sbjct  278  VKLKEEDGEMPRQVRSFRR  296



>ref|XP_004309493.1| PREDICTED: probable aquaporin NIP5-1-like [Fragaria vesca subsp. 
vesca]
Length=301

 Score =   313 bits (802),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 185/200 (93%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYIAAQVSA
Sbjct  102  GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFACLRHFPWTQVPAYIAAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA FALKGV+HP++SGGVTVPSVS GQAFALEF+ITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICACFALKGVYHPYMSGGVTVPSVSDGQAFALEFIITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+AGA  YT 
Sbjct  222  LAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYRALWIYLVAPTLGALAGAGTYTA  281

Query  417  VKLR-EEV-EPTSRPRSFRR  364
            VKL+ +E+  P    RSFRR
Sbjct  282  VKLQGDEIGAPAREVRSFRR  301



>gb|AAQ11826.1| nodulin-like intrinsic protein NIP1-1 [Atriplex nummularia]
Length=300

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQV+A
Sbjct  102  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVAA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI AS ALKGVFHPF++GGVTVPSV  GQAFALEFLITFNL+FVVTAVATDTRAVGELAG
Sbjct  162  SILASLALKGVFHPFMAGGVTVPSVGIGQAFALEFLITFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSG SMNPVRTLGPAVAAGNY+++WIYLVAPTLGA+ GAAIY +
Sbjct  222  IAVGATVMLNILVAGPSSGASMNPVRTLGPAVAAGNYRAVWIYLVAPTLGALGGAAIYKL  281

Query  417  VKLRE-EVEPTSRPRSFRR  364
            V+L+E EVEP    RSF R
Sbjct  282  VQLQEHEVEPPRPTRSFHR  300



>ref|XP_009373676.1| PREDICTED: probable aquaporin NIP5-1 isoform X1 [Pyrus x bretschneideri]
Length=298

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 182/200 (91%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW  VPAYIAAQVS 
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVHVPAYIAAQVSG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LKGVFHP++SGGVT+P+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFTLKGVFHPYMSGGVTLPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGA VMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +WIYLVAPTLGA+AGA  YT 
Sbjct  219  LAVGACVMLNILMAGPSSGGSMNPVRTLGPAVAAGNYTKLWIYLVAPTLGALAGAGTYTA  278

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  279  VKLREDEVDAPVRMARSFRR  298



>emb|CDY05100.1| BnaC03g28980D [Brassica napus]
Length=301

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALK VFHPF+SGGVTVPSVS GQAFALEF+I+F LLFVVTAVATDTRAVGELAG
Sbjct  163  SVCASFALKAVFHPFMSGGVTVPSVSVGQAFALEFIISFILLFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+G SMNPVRTLGPA+A+GNY+S+W+YLVAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNILVAGPSTGASMNPVRTLGPALASGNYRSLWVYLVAPTLGAISGAAVYTG  282

Query  417  VKLREE-VEPTSRPRSFRR  364
            VKL +   +P  + RSFRR
Sbjct  283  VKLNDSATDPPRQVRSFRR  301



>ref|XP_010110421.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXC26253.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=299

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            AE+LIGNAACAGLAVM++ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQV+ S
Sbjct  103  AETLIGNAACAGLAVMVVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVAGS  162

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASFALKG FHPFLSGGVTVPSV T QAFALEF+ITFNLLFVVTAVATDTRAVGELAGI
Sbjct  163  ICASFALKGAFHPFLSGGVTVPSVDTAQAFALEFIITFNLLFVVTAVATDTRAVGELAGI  222

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGPSSGGSMNPVRTLGPA+AAGNY  +WIY VAPTLGA+ GA  Y  V
Sbjct  223  AVGATVMLNILIAGPSSGGSMNPVRTLGPAIAAGNYTKLWIYFVAPTLGALVGATTYAAV  282

Query  414  KLREEVEPTSRPRSFRR  364
            KL E   PT++  SFRR
Sbjct  283  KLSEPPTPTTQVMSFRR  299



>ref|XP_009134192.1| PREDICTED: probable aquaporin NIP5-1 [Brassica rapa]
 emb|CDX90757.1| BnaA03g24370D [Brassica napus]
Length=301

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWA VPAYIAAQVSA
Sbjct  103  GAETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAHVPAYIAAQVSA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALK VFHPF+SGGVTVPSVS GQAFALEF+I+F LLFVVTAVATDTRAVGELAG
Sbjct  163  SVCASFALKAVFHPFMSGGVTVPSVSVGQAFALEFIISFILLFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+G SMNPVRTLGPA+A+GNY+ +W+YLVAPTLGAI+GAA+YT 
Sbjct  223  IAVGATVMLNILVAGPSTGASMNPVRTLGPALASGNYRLLWVYLVAPTLGAISGAAVYTG  282

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL + V +P  + RSFRR
Sbjct  283  VKLNDNVTDPPRQVRSFRR  301



>ref|XP_007143584.1| hypothetical protein PHAVU_007G084000g [Phaseolus vulgaris]
 gb|ESW15578.1| hypothetical protein PHAVU_007G084000g [Phaseolus vulgaris]
Length=299

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPW  VPAYIAAQVSA
Sbjct  101  GVETLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA FALKGV+HPFLSGGVTVPSVS GQAFA EF+ITF LLFVVTAVATDTRAVGE+AG
Sbjct  161  SICACFALKGVYHPFLSGGVTVPSVSVGQAFATEFIITFILLFVVTAVATDTRAVGEMAG  220

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  221  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  280

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E EP  + RSFRR
Sbjct  281  VKLRDNEAEPPRQVRSFRR  299



>ref|XP_010094419.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXB56000.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=298

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 183/200 (92%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPWA VP YI AQVS 
Sbjct  99   GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWAHVPGYIVAQVSG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LK VFHPF+SGGVTVP+ S GQAF LEF+I+FNLLFVVTAVATDTRAVGELAG
Sbjct  159  SICASFLLKAVFHPFMSGGVTVPTTSDGQAFVLEFVISFNLLFVVTAVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP+SGGSMNPVRTLGPAVAAGNY+++WI++VAPTLGA+AGAA YT 
Sbjct  219  IAVGATVMLNILIAGPASGGSMNPVRTLGPAVAAGNYRALWIFMVAPTLGALAGAATYTT  278

Query  417  VKLR-EEVE-PTSRPRSFRR  364
            VKLR +EVE P    RSFRR
Sbjct  279  VKLRDDEVELPVREVRSFRR  298



>gb|KHN17043.1| Putative aquaporin NIP5-1 [Glycine soja]
Length=257

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPW  VPAYIAAQVSA
Sbjct  59   GVESLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSA  118

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKGV+HPFLSGGVTVP+VS  QAFA EF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  119  SICACYALKGVYHPFLSGGVTVPTVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAG  178

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  179  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  238

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR EE EP  + RSFRR
Sbjct  239  VKLRDEEAEPPRQVRSFRR  257



>ref|XP_006828763.1| hypothetical protein AMTR_s00001p00081940 [Amborella trichopoda]
 gb|ERM96179.1| hypothetical protein AMTR_s00001p00081940 [Amborella trichopoda]
Length=282

 Score =   308 bits (789),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/198 (84%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPS+TI+FA LRHFPW+QVP YI AQVSA
Sbjct  85   GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSITISFALLRHFPWSQVPTYILAQVSA  144

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LKG FHPF+SGGVTVPS S  QAF LEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  145  SICASFVLKGAFHPFMSGGVTVPSGSDWQAFILEFVISFNLMFVVTAVATDTRAVGELAG  204

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAG  SGGSMNPVRTLGPA+AAGNYK+IWIY+VAPTLGAI GAAIYT 
Sbjct  205  IAVGATVMLNILVAGMGSGGSMNPVRTLGPAIAAGNYKAIWIYMVAPTLGAITGAAIYTF  264

Query  417  VKLREEVEPTSRPRSFRR  364
            V+LR E   T RPRSFRR
Sbjct  265  VRLRGEDGETPRPRSFRR  282



>ref|XP_003535560.1| PREDICTED: probable aquaporin NIP5-1-like [Glycine max]
Length=299

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPW  VPAYIAAQVSA
Sbjct  101  GVESLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWTHVPAYIAAQVSA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKGV+HPFLSGGVTVP+VS  QAFA EF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  161  SICACYALKGVYHPFLSGGVTVPTVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAG  220

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  221  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  280

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKLR EE EP  + RSFRR
Sbjct  281  VKLRDEEAEPPRQVRSFRR  299



>ref|XP_008360732.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
 ref|XP_008360733.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=298

 Score =   307 bits (786),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 180/200 (90%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHISGAHLNPSLTIAFAALRHFPW  VPAYIAAQV  
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHISGAHLNPSLTIAFAALRHFPWLHVPAYIAAQVLG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LKGV HP++SGGVTVP+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  159  SICASFTLKGVLHPYMSGGVTVPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGA VMLNIL+AGPSSGGSMNPVRTLGPA+AAGNY  +WIYLVAPTLGA+AGA  YT 
Sbjct  219  LAVGACVMLNILMAGPSSGGSMNPVRTLGPAIAAGNYTKLWIYLVAPTLGAVAGAGTYTA  278

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  279  VKLREDEVDAPVRMARSFRR  298



>gb|KHN46385.1| Putative aquaporin NIP5-1 [Glycine soja]
Length=299

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPWA VPAYIAAQVSA
Sbjct  101  GVETLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKGV+HPFLSGGVTVP+VS  QAFA EF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  161  SICACYALKGVYHPFLSGGVTVPTVSVAQAFATEFIITFILLFVVTAVATDTRAVGELAG  220

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  221  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  280

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E EP  + RSFRR
Sbjct  281  VKLRDNEAEPPRQVRSFRR  299



>gb|EYU31217.1| hypothetical protein MIMGU_mgv1a010890mg [Erythranthe guttata]
Length=298

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQVSA
Sbjct  100  GSETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWVQVPAYIAAQVSA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPF+SGGVTVPSV  GQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  160  SICASFALKGVFHPFMSGGVTVPSVGNGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPS+G SMNP R+LGPA+AAGNYKSIWIY+VAPTLGA++GA  Y++
Sbjct  220  IAVGATVMLNILVAGPSTGASMNPARSLGPAIAAGNYKSIWIYIVAPTLGAVSGATTYSL  279

Query  417  VKLREEVEPTSRPRSFRR  364
            ++  E        R+F R
Sbjct  280  IRQDEPPLHIQTVRTFGR  297



>ref|XP_010680949.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   302 bits (774),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESLIGNAACAGLAVMIIILS GHISGAHLNPSLTIAFAALRHFPW QVPAYIAAQV A
Sbjct  63   GVESLIGNAACAGLAVMIIILSIGHISGAHLNPSLTIAFAALRHFPWIQVPAYIAAQVLA  122

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF LK VFHPF+SGGVTVPSV+  QAF LEF ITFNL+FVVTAVATDTRAVGELAG
Sbjct  123  SILASFTLKLVFHPFMSGGVTVPSVNLKQAFTLEFFITFNLMFVVTAVATDTRAVGELAG  182

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPA+AAGNYK++W+Y+VAPTLGA+ GA IY +
Sbjct  183  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAIAAGNYKAVWLYMVAPTLGALGGAGIYKL  242

Query  417  VKLREEVEPTSRP-RSFRR  364
            V+L E  +   RP RSFRR
Sbjct  243  VQLEEREDEPPRPIRSFRR  261



>ref|XP_006662508.1| PREDICTED: aquaporin NIP3-1-like, partial [Oryza brachyantha]
Length=245

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 178/201 (89%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAVMIIILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYIA QV A
Sbjct  45   GAISPFGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAVLRHFPWLQVPAYIAVQVLA  104

Query  777  SICASFALKGVFHPFLSGGVTVPSV--STGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP V  ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  105  SICAGFALKGVFHPFLSGGVTVPDVTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  164

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGATV LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGAIAGA +Y
Sbjct  165  AGIAVGATVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAIAGAGVY  224

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  225  TAVKLRDENGDTPRPQRSFRR  245



>ref|XP_004496427.1| PREDICTED: probable aquaporin NIP5-1-like [Cicer arietinum]
Length=297

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESL+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPWA VPAYIAAQVSA
Sbjct  99   GAESLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALK V+HPFL+GGVTVP+VS GQAFA EF+ITF LLFVVTAVATDTRAVGELAG
Sbjct  159  SICACYALKVVYHPFLTGGVTVPTVSIGQAFATEFIITFILLFVVTAVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AG+ +YT+
Sbjct  219  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGSGVYTL  278

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E  P    RSFRR
Sbjct  279  VKLRDNEANPAQSVRSFRR  297



>emb|CDP14867.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   303 bits (775),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 166/202 (82%), Positives = 182/202 (90%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAV+I+IL+TGHISGAHLNP++TIAFAALRHFPWAQVPAYIAAQVS 
Sbjct  96   GAETLIGNAACAGLAVLIVILATGHISGAHLNPAVTIAFAALRHFPWAQVPAYIAAQVSG  155

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VF+PF+SGGVTVPSV   QAFALEF++TF LLFVVTAVATDTRAVGELAG
Sbjct  156  SICASFALKAVFNPFMSGGVTVPSVGNAQAFALEFIVTFILLFVVTAVATDTRAVGELAG  215

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGP+SGGSMNPVRTLGPAVAAGNY S+W+YLVAPTLGA+AGA  YT+
Sbjct  216  IAVGATVMLNILVAGPASGGSMNPVRTLGPAVAAGNYTSVWVYLVAPTLGALAGAGAYTM  275

Query  417  VKL----REEVEPTSRPRSFRR  364
            VKL    R   E   + RSFRR
Sbjct  276  VKLQGEGRNATESRQQSRSFRR  297



>ref|XP_009388143.1| PREDICTED: probable aquaporin NIP5-1 [Musa acuminata subsp. malaccensis]
Length=256

 Score =   301 bits (771),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFAALRHFPW+ VPAY+ AQVSA
Sbjct  60   GAEALIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFAALRHFPWSHVPAYVVAQVSA  119

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKGVFHPFLSGGVTVPSVST QAF +EF+ITFNLLFVVTAVATDTRAVGELAG
Sbjct  120  SICASFALKGVFHPFLSGGVTVPSVSTAQAFFIEFVITFNLLFVVTAVATDTRAVGELAG  179

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNYK IWIYLVAPT GA+AGAA+YT 
Sbjct  180  IAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYKQIWIYLVAPTAGAVAGAAVYTA  239

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL+ +     R RSFRR
Sbjct  240  VKLKGDDGELPR-RSFRR  256



>ref|XP_003592016.1| Aquaporin NIP3-1 [Medicago truncatula]
 ref|XP_003592038.1| Aquaporin NIP3-1 [Medicago truncatula]
 gb|AES62267.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=300

 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPWA VPAYIAAQVSA
Sbjct  102  GVETLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKGV+HPFLSGGVTVP+VS GQAFA EF+ITF LLFVVTAVATD+RAVGELAG
Sbjct  162  SICACYALKGVYHPFLSGGVTVPTVSVGQAFATEFIITFILLFVVTAVATDSRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK +WIYLVAPTLGA+AG+ +YT+
Sbjct  222  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHLWIYLVAPTLGALAGSGVYTL  281

Query  417  VKLREE-VEPTSRPRSFRR  364
            +KLR+   EP    RSFRR
Sbjct  282  IKLRDNGAEPPQPVRSFRR  300



>ref|XP_008796885.1| PREDICTED: probable aquaporin NIP5-1 [Phoenix dactylifera]
Length=299

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYIAAQVSA
Sbjct  101  GAETLIGNAACAGLAVMIMILSTGHISGAHLNPSLTIAFACLRHFPWVQVPAYIAAQVSA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHPFLSGGVTVPSV T QAF LEF ITFNLLFVVTAVATDTRAVGELAG
Sbjct  161  SICASFALKGIFHPFLSGGVTVPSVGTSQAFFLEFCITFNLLFVVTAVATDTRAVGELAG  220

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRT+GPA+AAGNYK IWIYLVAPT GAIAGAA YT+
Sbjct  221  IAVGATVMLNILVAGPSSGGSMNPVRTIGPALAAGNYKQIWIYLVAPTAGAIAGAATYTI  280

Query  417  VKLREEVEPTSR-PRSFRR  364
            VKL +E   T R PRSFRR
Sbjct  281  VKLTDEDGATPRTPRSFRR  299



>ref|XP_010919364.1| PREDICTED: probable aquaporin NIP5-1 [Elaeis guineensis]
Length=297

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVM++ILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYIAAQVSA
Sbjct  99   GAETLIGNAACAGLAVMVVILSTGHISGAHLNPSLTIAFACLRHFPWVQVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHPFLSGGVTVPSV+T QAF LEF ITFNLLFVVTAVATDTRAVGELAG
Sbjct  159  SICASFALKGIFHPFLSGGVTVPSVTTAQAFFLEFFITFNLLFVVTAVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYK +WIYLVAPT GAIAGAA YT+
Sbjct  219  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKQVWIYLVAPTAGAIAGAATYTL  278

Query  417  VKLREEVEPTSRP-RSFRR  364
            VKL +E   T R  RSFRR
Sbjct  279  VKLTDENGVTPRSARSFRR  297



>ref|XP_010933763.1| PREDICTED: probable aquaporin NIP5-1 [Elaeis guineensis]
Length=300

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYI AQVSA
Sbjct  102  GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFACLRHFPWVQVPAYIFAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK +FHPFLSGGVT+PSV+T QAF LEF ITFNLLFVVTAVATDTRAVGELAG
Sbjct  162  SICASFALKAIFHPFLSGGVTIPSVTTAQAFFLEFCITFNLLFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPA+AAGNYK IWIYLVAPT GAIAGAA YT+
Sbjct  222  IAVGATVMLNILVAGPSSGGSMNPVRTLGPALAAGNYKQIWIYLVAPTAGAIAGAATYTL  281

Query  417  VKLREEVEPTSR-PRSFRR  364
            VKL +E   T R PRSFRR
Sbjct  282  VKLTDEDGVTPRTPRSFRR  300



>gb|ABY19373.1| major intrinsic protein NIP5;1 [Lotus japonicus]
Length=302

 Score =   298 bits (762),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE L+GNAA AGL VM IILS GHISGAHLNPSLTIAFAA RHFPW+QVPAYIAAQVSA
Sbjct  104  GAEGLMGNAATAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWSQVPAYIAAQVSA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA FALK V+HPFLSGGVTVP+V  GQAFA EF+ITF L+FVVTAVATD+RAVGELAG
Sbjct  164  SICACFALKYVYHPFLSGGVTVPTVDIGQAFATEFIITFILMFVVTAVATDSRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  224  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  283

Query  417  VKLREE-VEPTSRPRSFRR  364
            VKLR++   P  + RSFRR
Sbjct  284  VKLRDDGAGPPQQVRSFRR  302



>ref|XP_004145968.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 ref|XP_004166376.1| PREDICTED: probable aquaporin NIP5-1-like [Cucumis sativus]
 gb|KGN49947.1| hypothetical protein Csa_5G146200 [Cucumis sativus]
Length=249

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            SLIGNAACAGLAVMI+ILS GHISGAHLNPSLTIA A LRHF WA VPAYI AQVSASIC
Sbjct  54   SLIGNAACAGLAVMIVILSIGHISGAHLNPSLTIALATLRHFAWAHVPAYITAQVSASIC  113

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF LKGVFHPF+SGGVTVPSV TGQAFALEFLITFNLLFVVTAVATDTRAV ELAGI V
Sbjct  114  ASFTLKGVFHPFMSGGVTVPSVGTGQAFALEFLITFNLLFVVTAVATDTRAVRELAGIGV  173

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            GATVMLNIL+AGPS+GGSMNPVRTLGPAVAAGNY+ +WIY+VAPTLGAI GA  YT VK 
Sbjct  174  GATVMLNILIAGPSTGGSMNPVRTLGPAVAAGNYRELWIYMVAPTLGAIVGAGTYTAVKH  233

Query  408  REE-VEPTSRPRSFRR  364
            +++ ++      SFRR
Sbjct  234  KDDGIDVLPEVSSFRR  249



>gb|EYU42698.1| hypothetical protein MIMGU_mgv1a019443mg, partial [Erythranthe 
guttata]
Length=250

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNA CAGLAVM++ILS GHISGAHLNPS+T+AFA+LRHFPWA+VPAY+ AQ+SA
Sbjct  51   GVETLIGNALCAGLAVMVVILSIGHISGAHLNPSVTVAFASLRHFPWAEVPAYVVAQISA  110

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF+LK VFHPFLSGGVTVPSV+T QAFALEFL TF LLFV+ AVATDTRAVGELAG
Sbjct  111  SICASFSLKAVFHPFLSGGVTVPSVTTAQAFALEFLTTFFLLFVIIAVATDTRAVGELAG  170

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GA VML+ILVAGPS+G SMNP RTLGPA+AAGNYKSIWIY VAPTLGAIAGAA YT+
Sbjct  171  LAIGAVVMLDILVAGPSTGASMNPARTLGPAIAAGNYKSIWIYFVAPTLGAIAGAATYTL  230

Query  417  VKLREEVE-PTSRP-RSFRR  364
            VKL  + + P   P RSFRR
Sbjct  231  VKLPAQDDLPDHLPVRSFRR  250



>ref|XP_008803617.1| PREDICTED: probable aquaporin NIP5-1 [Phoenix dactylifera]
Length=298

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 183/201 (91%), Gaps = 4/201 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAACAGLAVMI+ILSTGHISGAHLNPSLTIAFA LRHFPW QVPAYIAAQVSA
Sbjct  99   GAETLIGNAACAGLAVMIVILSTGHISGAHLNPSLTIAFACLRHFPWVQVPAYIAAQVSA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALKG+FHPFLSGGVTVPSV   QAF LEF ITFNLLFVVTAVATDTRAVGELAG
Sbjct  159  SICASFALKGIFHPFLSGGVTVPSVGIAQAFFLEFFITFNLLFVVTAVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYK +WIYLVAPT GAIAGAA YT+
Sbjct  219  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKQVWIYLVAPTAGAIAGAATYTL  278

Query  417  VKLREE---VEPTSRPRSFRR  364
            VKL EE   V P S  RSFRR
Sbjct  279  VKLTEEDDGVAPRSA-RSFRR  298



>gb|AAG13499.1|AC068924_4 putative nodulin-26 [Oryza sativa Japonica Group]
Length=241

 Score =   293 bits (749),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  IILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A QV  
Sbjct  41   GAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLG  100

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  101  SICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  160

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  161  AGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVY  220

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  221  TAVKLRDENGETPRPQRSFRR  241



>ref|XP_008437496.1| PREDICTED: probable aquaporin NIP5-1 [Cucumis melo]
Length=250

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            SLIGNAAC+G+AVMI+I S GHISGAHLNPSLTIA A LRHFP A VPAYI AQVSASIC
Sbjct  55   SLIGNAACSGIAVMIVIFSIGHISGAHLNPSLTIALATLRHFPLAHVPAYITAQVSASIC  114

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASFALKGVFHPF+SGGVTVPSV T QAFALEFLITFNLLFVVT+VATDTRAV ELAGIAV
Sbjct  115  ASFALKGVFHPFMSGGVTVPSVGTAQAFALEFLITFNLLFVVTSVATDTRAVRELAGIAV  174

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            GATVMLNIL+AGPS+GGSMNPVRTLGPAVAAGNY+ +WIYLVAPTLGAI GA  YT VK 
Sbjct  175  GATVMLNILIAGPSTGGSMNPVRTLGPAVAAGNYRELWIYLVAPTLGAIVGAGTYTAVKH  234

Query  408  REE-VEPTSRPRSFRR  364
            +++ ++     RSF +
Sbjct  235  KDDGIDVLPEERSFHQ  250



>sp|Q0IWF3.2|NIP31_ORYSJ RecName: Full=Aquaporin NIP3-1; AltName: Full=NOD26-like intrinsic 
protein 3-1; AltName: Full=OsNIP3;1 [Oryza sativa Japonica 
Group]
 gb|ABG66185.1| aquaporin NIP5.1, putative, expressed [Oryza sativa Japonica 
Group]
Length=311

 Score =   293 bits (750),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  IILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A QV  
Sbjct  111  GAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLG  170

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  171  SICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  230

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  231  AGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVY  290

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  291  TAVKLRDENGETPRPQRSFRR  311



>dbj|BAO01152.1| nodulin-26 like Intrinsic Protein 3;1 [Oryza sativa Japonica 
Group]
 dbj|BAP05658.1| NOD26-like intrinsic protein [Oryza sativa Japonica Group]
Length=309

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  IILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A QV  
Sbjct  109  GAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLG  168

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  169  SICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  228

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  229  AGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVY  288

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  289  TAVKLRDENGETPRPQRSFRR  309



>gb|EAZ16668.1| hypothetical protein OsJ_32143 [Oryza sativa Japonica Group]
Length=309

 Score =   293 bits (749),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  IILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A QV  
Sbjct  109  GAISPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLG  168

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  169  SICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  228

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  229  AGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVY  288

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  289  TAVKLRDENGETPRPQRSFRR  309



>gb|EAY79189.1| hypothetical protein OsI_34300 [Oryza sativa Indica Group]
Length=309

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 175/201 (87%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV   ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A QV  
Sbjct  109  GAISPFGNAACAGLAVTTTILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQVLG  168

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  169  SICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  228

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  229  AGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAPTLGAVAGAGVY  288

Query  423  TVVKLREEVEPTSRP-RSFRR  364
            T VKLR+E   T RP RSFRR
Sbjct  289  TAVKLRDENGETPRPQRSFRR  309



>ref|XP_002464380.1| hypothetical protein SORBIDRAFT_01g017230 [Sorghum bicolor]
 gb|EER91378.1| hypothetical protein SORBIDRAFT_01g017230 [Sorghum bicolor]
Length=301

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV IIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY++ QV  
Sbjct  101  GAISPFGNAACAGLAVTIIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVSVQVLG  160

Query  777  SICASFALKGVFHPFLSGGVTVPSV--STGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICASFALKGVFHPFLSGGVTVP V  ST QAF  EF+I+FNLLFVVTAVATDTRAVGEL
Sbjct  161  SICASFALKGVFHPFLSGGVTVPDVTISTAQAFFTEFIISFNLLFVVTAVATDTRAVGEL  220

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNILVAGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  221  AGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGAGVY  280

Query  423  TVVKLREEVEPTSR-PRSFRR  364
            T VKLR+E   T R  RSFRR
Sbjct  281  TAVKLRDENGETPRTQRSFRR  301



>ref|XP_004982621.1| PREDICTED: aquaporin NIP3-1-like [Setaria italica]
Length=299

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 164/201 (82%), Positives = 175/201 (87%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  S  GNAACAGLAV IIILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY++ QV  
Sbjct  99   GVISPFGNAACAGLAVTIIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVSVQVLG  158

Query  777  SICASFALKGVFHPFLSGGVTVPSV--STGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            SICASFALKGVFHPFLSGGVTVP V  ST QAF  EF+ITFNLLFVVTAVATDTRAVGEL
Sbjct  159  SICASFALKGVFHPFLSGGVTVPDVTISTAQAFFTEFIITFNLLFVVTAVATDTRAVGEL  218

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNILVAGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA +Y
Sbjct  219  AGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGAVAGAGVY  278

Query  423  TVVKLREEVEPTSR-PRSFRR  364
            T VKLR+E   T R  RSFRR
Sbjct  279  TAVKLRDENGETPRTQRSFRR  299



>gb|AES86406.2| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=218

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 175/202 (87%), Gaps = 5/202 (2%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV AS
Sbjct  17   SETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLAS  76

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAGI
Sbjct  77   ICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGI  136

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LGA+ GA  YTVV
Sbjct  137  AVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKGIWLYLIAPILGALGGAGAYTVV  196

Query  414  KLRE-----EVEPTSRPRSFRR  364
            KL +     EV+ +S P SFRR
Sbjct  197  KLPDEEFNSEVKASSAPGSFRR  218



>gb|ACN36318.1| unknown [Zea mays]
Length=302

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 177/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  +ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A Q  A
Sbjct  102  GAISPFGNAACAGLAVATVILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALA  161

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            S+CA+FALKGVFHPFLSGGVTVP  ++ST QAF  EF+I+FNLLFVVTAVATDTRAVGEL
Sbjct  162  SVCAAFALKGVFHPFLSGGVTVPDATISTAQAFFTEFIISFNLLFVVTAVATDTRAVGEL  221

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNILVAGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA++Y
Sbjct  222  AGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGASVY  281

Query  423  TVVKLREEVEPTSR-PRSFRR  364
            T VKLR+E   T R  RSFRR
Sbjct  282  TAVKLRDENGETPRTQRSFRR  302



>ref|XP_003604209.1| Aquaporin NIP6-1 [Medicago truncatula]
Length=244

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 175/202 (87%), Gaps = 5/202 (2%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV AS
Sbjct  43   SETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLAS  102

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAGI
Sbjct  103  ICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGI  162

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LGA+ GA  YTVV
Sbjct  163  AVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKGIWLYLIAPILGALGGAGAYTVV  222

Query  414  KLRE-----EVEPTSRPRSFRR  364
            KL +     EV+ +S P SFRR
Sbjct  223  KLPDEEFNSEVKASSAPGSFRR  244



>ref|XP_008348330.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=266

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+GNAACAGLAVM +ILSTGHISGAHLNPS+TIAFA  RHFPW QVP YI AQVSA
Sbjct  47   GSETLLGNAACAGLAVMAVILSTGHISGAHLNPSVTIAFATFRHFPWTQVPLYIIAQVSA  106

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALKGVFHPF+SGGVTVPSVS  QAFALEF++TF L+F VT+VATDTRAVGELAG
Sbjct  107  SISASFALKGVFHPFMSGGVTVPSVSHCQAFALEFIVTFILMFTVTSVATDTRAVGELAG  166

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GATV+LNILVAGP++GGSMNP+RTLGPAVAAGNYK +WIYLVAPTLGA+AGAA YT 
Sbjct  167  VAIGATVLLNILVAGPTTGGSMNPIRTLGPAVAAGNYKGLWIYLVAPTLGALAGAATYTA  226

Query  417  VKL  409
            VKL
Sbjct  227  VKL  229



>ref|XP_008380091.1| PREDICTED: probable aquaporin NIP5-1 [Malus domestica]
Length=266

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+GNAACAGLAVM +ILSTGHISGAHLNPS+TIAFA  RHFPW QVP YI AQVSA
Sbjct  47   GSETLLGNAACAGLAVMAVILSTGHISGAHLNPSVTIAFATFRHFPWTQVPLYIIAQVSA  106

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALKGVFHPF+SGGVTVPSVS  QAFALEF++TF L+F VT+VATDTRAVGELAG
Sbjct  107  SISASFALKGVFHPFMSGGVTVPSVSHCQAFALEFIVTFILMFTVTSVATDTRAVGELAG  166

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GATV+LNILVAGP++GGSMNP+RTLGPAVAAGNYK +WIYLVAPTLGA+AGAA YT 
Sbjct  167  VAIGATVLLNILVAGPTTGGSMNPIRTLGPAVAAGNYKGLWIYLVAPTLGALAGAATYTA  226

Query  417  VKL  409
            VKL
Sbjct  227  VKL  229



>ref|NP_001105021.1| aquaporin NIP3-1 [Zea mays]
 sp|Q9ATN1.1|NIP31_MAIZE RecName: Full=Aquaporin NIP3-1; AltName: Full=NOD26-like intrinsic 
protein 3-1; AltName: Full=ZmNIP3-1; AltName: Full=ZmNIP3;1 
[Zea mays]
 gb|AAK26753.1| NOD26-like membrane integral protein ZmNIP3-1 [Zea mays]
 tpg|DAA49314.1| TPA: aquaporin NIP3-1 [Zea mays]
Length=302

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  +ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A Q  A
Sbjct  102  GAISPFGNAACAGLAVATVILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALA  161

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            S+CA+FALKGVFHPFLSGGVTVP  +VST QAF  EF+I+FNLLFVVTAVATDTRAVGEL
Sbjct  162  SVCAAFALKGVFHPFLSGGVTVPDATVSTAQAFFTEFIISFNLLFVVTAVATDTRAVGEL  221

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGA V LNILVAGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+APTLGA+AGA++Y
Sbjct  222  AGIAVGAAVTLNILVAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLLAPTLGALAGASVY  281

Query  423  TVVKLREEVEPTSR-PRSFRR  364
              VKLR+E   T R  RSFRR
Sbjct  282  KAVKLRDENGETPRTQRSFRR  302



>gb|KEH28543.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=218

 Score =   282 bits (721),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 5/202 (2%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV AS
Sbjct  17   SETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLAS  76

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAGI
Sbjct  77   ICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGI  136

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LGA+ GA  YT V
Sbjct  137  AVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKGIWLYLIAPILGALGGAGAYTAV  196

Query  414  KLRE-----EVEPTSRPRSFRR  364
            KL +     EV+ +S P SFRR
Sbjct  197  KLPDEEFNSEVKASSAPGSFRR  218



>ref|XP_007216752.1| hypothetical protein PRUPE_ppa024808mg, partial [Prunus persica]
 gb|EMJ17951.1| hypothetical protein PRUPE_ppa024808mg, partial [Prunus persica]
Length=222

 Score =   282 bits (721),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAAC+GLAVM++ILSTGHISGAHLNPS+T+AFA  RHFPW+QVP YI  QVSA
Sbjct  27   GVETLLGNAACSGLAVMVVILSTGHISGAHLNPSVTLAFATFRHFPWSQVPLYIIVQVSA  86

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALKGVFHPF+SGGVTVPSV+ GQAF+LEF++TF L+F +TAVATDTRAVGE+AG
Sbjct  87   SISASFALKGVFHPFMSGGVTVPSVTHGQAFSLEFIVTFILMFTITAVATDTRAVGEMAG  146

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GATV+L+ILVAGP++GGSMNP+RTLGPA+AAGNYK +WIYLVAPT GA+AGAA YT 
Sbjct  147  VAIGATVLLDILVAGPTTGGSMNPIRTLGPAIAAGNYKGLWIYLVAPTFGALAGAAAYTT  206

Query  417  VKLREEVEPTSR  382
            VKL +   P   
Sbjct  207  VKLPDNKPPNQD  218



>gb|EYU31219.1| hypothetical protein MIMGU_mgv1a018295mg [Erythranthe guttata]
Length=252

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 174/198 (88%), Gaps = 4/198 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNA CAGLAVMI+ILS GHISGAHLNPS++IAFAALRHFPW +VPAY+AAQ+  
Sbjct  54   GVETLIGNALCAGLAVMIVILSIGHISGAHLNPSVSIAFAALRHFPWVEVPAYLAAQICG  113

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            +ICASFALKG FHPFLSGGVTVP  SV+TGQAFALEFL T+ LLFV+ A+ATDTRAVGEL
Sbjct  114  AICASFALKGCFHPFLSGGVTVPSSSVTTGQAFALEFLTTYFLLFVIIALATDTRAVGEL  173

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGI +GA VML+ILVAG S+G SMNP RTLGPA+AAGNYKSIWIY+VAPTLGA+AGAA Y
Sbjct  174  AGIGIGAIVMLDILVAGSSTGASMNPARTLGPAIAAGNYKSIWIYIVAPTLGAVAGAATY  233

Query  423  TVVKLREEVEPTSRPRSF  370
            T++KLR   +P  + RSF
Sbjct  234  TLLKLRP--QPDEQVRSF  249



>gb|KDO83593.1| hypothetical protein CISIN_1g0465112mg, partial [Citrus sinensis]
Length=207

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 169/199 (85%), Gaps = 19/199 (10%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAA                  +HLNPSLTIAFAALRHFPW QVPAYI AQVSA
Sbjct  27   GAETLIGNAA------------------SHLNPSLTIAFAALRHFPWVQVPAYIMAQVSA  68

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASFALK VFHPF+SGGVTVPSV+TGQAFALEFLITFNLLFVVTAVATDTRAVGELAG
Sbjct  69   SICASFALKAVFHPFMSGGVTVPSVNTGQAFALEFLITFNLLFVVTAVATDTRAVGELAG  128

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY+ +WI+L+APTLGA+AGA  YTV
Sbjct  129  IAVGATVMLNILIAGPSSGGSMNPVRTLGPAVAAGNYEKLWIFLLAPTLGALAGATTYTV  188

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E +P    RSFRR
Sbjct  189  VKLRDNETDPPREARSFRR  207



>ref|XP_003574178.1| PREDICTED: aquaporin NIP3-1 [Brachypodium distachyon]
Length=301

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 170/200 (85%), Gaps = 5/200 (3%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S  GNAACAGLAV  IILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A Q  AS+C
Sbjct  102  SPFGNAACAGLAVTTIILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQSLASVC  161

Query  768  ASFALKGVFHPFLSGGVTVPS--VSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            A FALKGVFHPFLSGGVTVP   VST QAF  EF+ITFNLLFVVTAVATDTRAVGELAGI
Sbjct  162  AGFALKGVFHPFLSGGVTVPDAAVSTAQAFFTEFIITFNLLFVVTAVATDTRAVGELAGI  221

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYLVAPTLGA+AGA +YT V
Sbjct  222  AVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLVAPTLGAVAGAGVYTAV  281

Query  414  KLREEV---EPTSRPRSFRR  364
            KLR+     E     RSFRR
Sbjct  282  KLRDVDGGGEAPRPQRSFRR  301



>ref|XP_010691608.1| PREDICTED: aquaporin NIP6-1 [Beta vulgaris subsp. vulgaris]
Length=306

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 173/202 (86%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMIIILSTGHISGAHLNPS+TIAFAALRHFPW QVP YI AQ+SA
Sbjct  105  GSETLIGLAASSGLAVMIIILSTGHISGAHLNPSVTIAFAALRHFPWTQVPIYIGAQISA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASF LKGVFHP +SGGVTVPSV+  QAFALEF+I FNL+FVVTAVATDTRAVGELAG
Sbjct  165  SLCASFILKGVFHPIMSGGVTVPSVNYVQAFALEFIIAFNLMFVVTAVATDTRAVGELAG  224

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++GGSMNPVRTLGPA+AA NYK IWIY  AP LGA+ GA +Y+ 
Sbjct  225  IAVGATVMLNILIAGPATGGSMNPVRTLGPAIAANNYKGIWIYFTAPFLGALCGAGVYSA  284

Query  417  VKLREEVEPT----SRPRSFRR  364
            +KL EE E      S   SFRR
Sbjct  285  IKLPEEDEDALKQPSAAASFRR  306



>ref|XP_003604218.1| Nodulin-like intrinsic protein NIP1-1 [Medicago truncatula]
 gb|AAS48063.1| NIP3 [Medicago truncatula]
 gb|AES86415.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK33950.1| unknown [Medicago truncatula]
Length=305

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 5/202 (2%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV AS
Sbjct  104  SETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLAS  163

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAGI
Sbjct  164  ICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGI  223

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LGA+ GA  YT V
Sbjct  224  AVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKGIWLYLIAPILGALGGAGAYTAV  283

Query  414  KLRE-----EVEPTSRPRSFRR  364
            KL +     EV+ +S P SFRR
Sbjct  284  KLPDEEFNSEVKASSAPGSFRR  305



>ref|XP_010537884.1| PREDICTED: aquaporin NIP6-1 [Tarenaya hassleriana]
Length=304

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIG AA AGLAVMI+ILSTGHISGAHLNP++T++FAAL+HFPW  VPAYI AQV A
Sbjct  107  GAETLIGCAASAGLAVMIVILSTGHISGAHLNPAITLSFAALKHFPWKHVPAYIGAQVMA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKGVFHP ++GGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SMCAAFALKGVFHPMMNGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT 
Sbjct  227  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALCGAGTYTA  286

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE +     RSFRR
Sbjct  287  VKLPEEDDAPQEKRSFRR  304



>ref|XP_004486614.1| PREDICTED: aquaporin NIP6-1-like [Cicer arietinum]
Length=309

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 175/203 (86%), Gaps = 5/203 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMI+ILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  107  GSETLIGCAASSGLAVMIVILSTGHISGAHLNPAVTISFAALKHFPWKHVPMYIGAQVLA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALKGVFHPF+SGGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SICAAFALKGVFHPFMSGGVTVPSGGYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +GGSMNPVR+LGPA+AA NYK+IW+YL+AP +GA+ GA  YT 
Sbjct  227  IAVGATVMLNILIAGPITGGSMNPVRSLGPAIAANNYKAIWVYLLAPIIGALGGAGTYTA  286

Query  417  VKLREEVEPT-----SRPRSFRR  364
            VKL +E +       S P SFRR
Sbjct  287  VKLPQEDDNAKANAPSNPASFRR  309



>ref|XP_003547292.1| PREDICTED: aquaporin NIP6-1-like [Glycine max]
Length=304

 Score =   277 bits (709),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 171/201 (85%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+IL+TGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  104  GSETLIGCAATTGLAVMIVILATGHISGAHLNPAVTISFAALKHFPWKHVPMYIGAQVLA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA FALKGV+HPF+SGGVTVPS   GQ+FALEF+I FNL+FVVTAVATDTRAVGELAG
Sbjct  164  SICAGFALKGVYHPFMSGGVTVPSGGYGQSFALEFIIGFNLMFVVTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP SGGSMNPVRTLGPAVAA NYK+IW+YLVAP LGA+AGA  YT 
Sbjct  224  IAVGATVMLNILIAGPVSGGSMNPVRTLGPAVAANNYKAIWVYLVAPILGALAGAGTYTA  283

Query  417  VKLREEVEPTSRP---RSFRR  364
            VKL EE +         SFRR
Sbjct  284  VKLPEEDDDAKAKTSISSFRR  304



>gb|ADE76805.1| unknown [Picea sitchensis]
Length=294

 Score =   276 bits (707),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ SL+G AA  GLA+MI+ILSTGHISGAH+NPSLT+AFAALR FPW QVPAY+ AQV  
Sbjct  97   GSVSLLGLAASGGLAIMIVILSTGHISGAHVNPSLTLAFAALRQFPWIQVPAYMGAQVLG  156

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LK +FHPF+SGGVT+PS S GQAFALEF+ITFNL+FVVTAVATDTRAVGELAG
Sbjct  157  SICASFTLKLIFHPFMSGGVTIPSGSYGQAFALEFIITFNLMFVVTAVATDTRAVGELAG  216

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG +SG SMNPVRTLGPA+AAGNYK IWIYL+AP +GA+ GAA YTV
Sbjct  217  IAVGATVMLNILIAGSNSGASMNPVRTLGPAIAAGNYKGIWIYLLAPVVGALCGAAGYTV  276

Query  417  VKLREEVEPTSRPRSFRR  364
            V+L+ E       RSFRR
Sbjct  277  VRLKGEDNQGRPTRSFRR  294



>gb|KHN22407.1| Aquaporin NIP6-1 [Glycine soja]
Length=300

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 171/201 (85%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+IL+TGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  100  GSETLIGCAATTGLAVMIVILATGHISGAHLNPAVTISFAALKHFPWKHVPMYIGAQVLA  159

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA FALKGV+HPF+SGGVTVPS   GQ+FALEF+I FNL+FVVTAVATDTRAVGELAG
Sbjct  160  SICAGFALKGVYHPFMSGGVTVPSGGYGQSFALEFIIGFNLMFVVTAVATDTRAVGELAG  219

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP SGGSMNPVRTLGPAVAA NYK+IW+YLVAP LGA+AGA  YT 
Sbjct  220  IAVGATVMLNILIAGPVSGGSMNPVRTLGPAVAANNYKAIWVYLVAPILGALAGAGTYTA  279

Query  417  VKLREEVEPTSRP---RSFRR  364
            VKL EE +         SFRR
Sbjct  280  VKLPEEDDDAKAKTSISSFRR  300



>ref|XP_007150811.1| hypothetical protein PHAVU_005G182400g [Phaseolus vulgaris]
 gb|ESW22805.1| hypothetical protein PHAVU_005G182400g [Phaseolus vulgaris]
Length=303

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+IL+TGHISGAHLNP++T++FAAL+HFPW  VP YI AQV A
Sbjct  104  GSETLIGCAATTGLAVMIVILATGHISGAHLNPAVTLSFAALKHFPWKHVPMYIGAQVLA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALKGV+HPF+SGGVTVPS    QAFALEF+I FNL+FVVTAVATDTRAVGELAG
Sbjct  164  SICAAFALKGVYHPFMSGGVTVPSGGYAQAFALEFIIAFNLMFVVTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP SGGSMNPVRTLGPA+AA NYK+IW+YLVAP LGA+AGA  YT 
Sbjct  224  IAVGATVMLNILIAGPVSGGSMNPVRTLGPAIAANNYKAIWVYLVAPVLGALAGAGTYTA  283

Query  417  VKLREEVEPTSRPR--SFRR  364
            VKL EE +        SFRR
Sbjct  284  VKLPEEDDDAKAKASISFRR  303



>ref|XP_002887811.1| hypothetical protein ARALYDRAFT_477170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64070.1| hypothetical protein ARALYDRAFT_477170 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEENEAPKERRSFRR  305



>emb|CDY66949.1| BnaA02g36290D [Brassica napus]
Length=305

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTISFAALKHFPWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+ITFNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVTLSQAFALEFIITFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YTV
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTV  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEEHKEKRSFRR  305



>ref|XP_006301084.1| hypothetical protein CARUB_v10021476mg [Capsella rubella]
 gb|EOA33982.1| hypothetical protein CARUB_v10021476mg [Capsella rubella]
Length=306

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  109  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMA  168

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  169  SVCAAFALKAVFEPTMSGGVTVPTVALSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  228

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  YT+
Sbjct  229  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYKAIWVYLTAPILGALIGAGTYTI  288

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  289  VKLPEEDEAPKERRSFRR  306



>emb|CDY53224.1| BnaA02g19440D [Brassica napus]
Length=305

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTISFAALKHFPWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVALSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YTV
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTV  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEEHKEKRSFRR  305



>ref|XP_002527308.1| Aquaporin NIP1.1, putative [Ricinus communis]
 gb|EEF35060.1| Aquaporin NIP1.1, putative [Ricinus communis]
Length=308

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG A   GLAVMI+ILSTGHISGAHLNPS+TIAFAALRHFPW  VP YI AQVSA
Sbjct  107  GTETLIGLAVSTGLAVMIVILSTGHISGAHLNPSITIAFAALRHFPWKHVPVYIGAQVSA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK +FHPF+SGGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SVCAAFALKVIFHPFMSGGVTVPSGGYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV LNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA IY+ 
Sbjct  227  IAVGATVTLNILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPILGALCGAGIYSA  286

Query  417  VKLREEV----EPTSRPRSFRR  364
            VKL EE     E  S  RSFRR
Sbjct  287  VKLPEEDGDAREKPSTARSFRR  308



>ref|XP_006389830.1| hypothetical protein EUTSA_v10018924mg [Eutrema salsugineum]
 gb|ESQ27116.1| hypothetical protein EUTSA_v10018924mg [Eutrema salsugineum]
Length=305

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+ITFNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVALSQAFALEFIITFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA +Y++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANDYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKEKRSFRR  305



>emb|CDY39946.1| BnaC06g40240D [Brassica napus]
Length=305

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAITIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SLCAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKEKRSFRR  305



>gb|KFK42456.1| hypothetical protein AALP_AA2G259100 [Arabis alpina]
Length=301

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  104  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIIA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  164  SLCAAFALKAVFEPTMSGGVTVPTVALSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IWIYL AP LGA+ GA  YT+
Sbjct  224  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWIYLTAPILGALIGAGTYTI  283

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  284  VKLPEEDEAPKEKRSFRR  301



>ref|XP_009128393.1| PREDICTED: aquaporin NIP6-1-like [Brassica rapa]
Length=305

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAVTISFAALKHFPWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V+  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVALSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YTV
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTV  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEEHKETRSFRR  305



>emb|CDX87340.1| BnaA07g35330D [Brassica napus]
Length=305

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAITIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SLCAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKEKRSFRR  305



>gb|ABY19374.1| major intrinsic protein NIP6;1 [Lotus japonicus]
Length=313

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 172/203 (85%), Gaps = 5/203 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIG AA  GLAVM++ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  111  GAETLIGCAASTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPMYIIAQVMA  170

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
             ICASF LKGVF+PF+SGGVTVPS   GQAFALEF+I+F L+FVVTAVATDTRAVGE+AG
Sbjct  171  GICASFGLKGVFNPFMSGGVTVPSGGYGQAFALEFIISFILMFVVTAVATDTRAVGEMAG  230

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+YLVAP LGA++GA IYT 
Sbjct  231  IAVGATVMLNILIAGPETGASMNPVRTLGPAIAANNYKAIWVYLVAPVLGALSGAGIYTA  290

Query  417  VKLREEVEPT-----SRPRSFRR  364
            VKL +E E +     S   SFRR
Sbjct  291  VKLPDEDEDSAKVVGSNHPSFRR  313



>ref|XP_007023401.1| Aquaporin NIP6,1 [Theobroma cacao]
 gb|EOY26023.1| Aquaporin NIP6,1 [Theobroma cacao]
Length=301

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQV A
Sbjct  103  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAITISFAALKHFPWKHVPVYIGAQVMA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKGVFHPFL GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  163  SLCAAFALKGVFHPFLGGGVTVPSGGFGQAFALEFVISFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+Y  AP LGA+ GA  YT 
Sbjct  223  IAVGATVMLNILIAGPFTGASMNPVRTLGPAIAANNYKAIWVYFTAPILGALCGAGTYTA  282

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL EE  E     RSFRR
Sbjct  283  VKLPEEDGEKPLTVRSFRR  301



>ref|XP_009106719.1| PREDICTED: aquaporin NIP6-1 [Brassica rapa]
Length=305

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAVTLIGCAASAGLAVMIVILSTGHISGAHLNPAITIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SLCAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL +P LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTSPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKEKRSFRR  305



>ref|NP_178191.1| aquaporin NIP6-1 [Arabidopsis thaliana]
 sp|Q9SAI4.1|NIP61_ARATH RecName: Full=Aquaporin NIP6-1; AltName: Full=NOD26-like intrinsic 
protein 6-1; Short=AtNIP6;1 [Arabidopsis thaliana]
 gb|AAF14664.1|AC011713_12 Similar to gb|D17443 major intrinsic protein from Oryza sativa. 
EST gb|AI998369 comes from this gene [Arabidopsis thaliana]
 gb|AAV74223.1| At1g80760 [Arabidopsis thaliana]
 gb|AAX49373.1| At1g80760 [Arabidopsis thaliana]
 gb|AEE36445.1| aquaporin NIP6-1 [Arabidopsis thaliana]
Length=305

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVSAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKERRSFRR  305



>gb|AAT35231.1| nodulin 26-like protein [Medicago truncatula]
 gb|KEH39629.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=310

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 171/203 (84%), Gaps = 5/203 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQ+ A
Sbjct  108  GSETLIGCATSTGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKHVPMYIGAQILA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+F+LK VFHPF+SGGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SICAAFSLKAVFHPFMSGGVTVPSGGYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+YL+AP LGA+ GA  YT 
Sbjct  228  IAVGATVMLNILIAGPITGASMNPVRTLGPAIAANNYKAIWVYLLAPILGALGGAGTYTA  287

Query  417  VKLREEVE-----PTSRPRSFRR  364
            VKL EE +      +S   SFRR
Sbjct  288  VKLPEEDDNAKTNASSNHPSFRR  310



>ref|XP_006465199.1| PREDICTED: aquaporin NIP6-1-like [Citrus sinensis]
Length=304

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG A   GLAVM++ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  103  GSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP + GGVTVPS   G+AFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  163  SLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPS+GGSMNPVRTLGPAVA  NYK+IWIYL AP LGA+ GA  Y+ 
Sbjct  223  IAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSA  282

Query  417  VKL-REEVEPTSRP---RSFRR  364
            VKL  E+ +  ++P    SFRR
Sbjct  283  VKLPEEDTDALAKPATASSFRR  304



>ref|XP_006427592.1| hypothetical protein CICLE_v10026151mg [Citrus clementina]
 gb|ESR40832.1| hypothetical protein CICLE_v10026151mg [Citrus clementina]
Length=304

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG A   GLAVM++ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  103  GSETLIGLAGSTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIMA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP + GGVTVPS   G+AFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  163  SLCAAFALKGIFHPIMGGGVTVPSAGYGEAFALEFIISFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPS+GGSMNPVRTLGPAVA  NYK+IWIYL AP LGA+ GA  Y+ 
Sbjct  223  IAVGATVMLNILIAGPSTGGSMNPVRTLGPAVAVNNYKAIWIYLTAPILGALCGAGTYSA  282

Query  417  VKL-REEVEPTSRP---RSFRR  364
            VKL  E+ +  ++P    SFRR
Sbjct  283  VKLPEEDTDALAKPATASSFRR  304



>ref|XP_010112876.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXC35011.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=239

 Score =   268 bits (684),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE LIGNA  A LAVM++I STGHISGAHLNP++TIAFAALRHFPW+QV  YI  QV A
Sbjct  17   GAEMLIGNATSAALAVMVVIFSTGHISGAHLNPAVTIAFAALRHFPWSQVVPYIVVQVLA  76

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALKGVFHPF+SGGVTVP+VS G AFALEF++TF L+F++TAVATDTRAVGELAG
Sbjct  77   SISASFALKGVFHPFMSGGVTVPAVSHGHAFALEFIVTFILMFIITAVATDTRAVGELAG  136

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+GATV+L+ L+AGP++G SMNPVRTLGPA+AAGNYK +WIY+VAP LGA+AGAA YT 
Sbjct  137  IAIGATVLLDNLIAGPTTGASMNPVRTLGPAIAAGNYKGVWIYMVAPPLGALAGAATYTA  196

Query  417  VKLREEVEPTS  385
            VKL ++  P  
Sbjct  197  VKLSDKKPPNQ  207



>ref|XP_010417667.1| PREDICTED: aquaporin NIP6-1 [Camelina sativa]
Length=305

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HF W  VP YI AQV A
Sbjct  108  GAVTLIGCAATAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFNWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SICAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKERRSFRR  305



>gb|ACJ84850.1| unknown [Medicago truncatula]
Length=286

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  954  AESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSAS  775
            +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV AS
Sbjct  104  SETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLAS  163

Query  774  ICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGI  595
            ICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAGI
Sbjct  164  ICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAGI  223

Query  594  AVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVV  415
            AVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LGA+ GA  YT V
Sbjct  224  AVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKGIWLYLIAPILGALGGAGAYTAV  283

Query  414  KL  409
            KL
Sbjct  284  KL  285



>ref|XP_010429912.1| PREDICTED: aquaporin NIP6-1-like isoform X1 [Camelina sativa]
Length=305

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HF W  VP YI AQV A
Sbjct  108  GAVTLIGCAATAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFNWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SICAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEGPKERRSFRR  305



>ref|XP_010472881.1| PREDICTED: aquaporin NIP6-1-like [Camelina sativa]
Length=305

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L+G AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HF W  VP YI AQV A
Sbjct  108  GAVTLLGCAATAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFNWKHVPVYIGAQVLA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SICAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++  SMNPVRTLGPA+AA NY++IW+YL AP LGA+ GA  YT+
Sbjct  228  IAVGATVMLNILIAGPATSASMNPVRTLGPAIAANNYRAIWVYLTAPILGALIGAGTYTI  287

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE E     RSFRR
Sbjct  288  VKLPEEDEAPKERRSFRR  305



>ref|XP_006857171.1| hypothetical protein AMTR_s00065p00173470 [Amborella trichopoda]
 gb|ERN18638.1| hypothetical protein AMTR_s00065p00173470 [Amborella trichopoda]
Length=302

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 172/200 (86%), Gaps = 3/200 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW QVP YI AQV A
Sbjct  104  GSETLIGCAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWTQVPMYIGAQVLA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALK +FHPF+ GGVT PS S  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  164  SISASFALKVIFHPFMGGGVTAPSGSYAQAFALEFIISFNLMFVVTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++GGSMNPVRTLGPA+AA NY++IW+Y+V P LGA+ GA  YT 
Sbjct  224  IAVGATVMLNILIAGKNTGGSMNPVRTLGPAIAANNYRAIWVYIVGPILGALCGAGAYTA  283

Query  417  VKLREEVEPTSRP--RSFRR  364
            VK+ ++ E  +RP  RSFRR
Sbjct  284  VKIPDDDE-HARPQVRSFRR  302



>gb|AFN44229.1| aquaporin [Gossypium hirsutum]
 gb|AFN44230.1| aquaporin [Gossypium hirsutum]
Length=300

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFP   VP YI AQV A
Sbjct  102  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPRKHVPVYIGAQVMA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LKGVFHP + GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFGLKGVFHPMMGGGVTVPSGGFGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+Y  AP LGA+ GA  YT 
Sbjct  222  IAVGATVMLNILIAGPITGASMNPVRTLGPAIAANNYKAIWVYFTAPILGALCGAGTYTA  281

Query  417  VKLREEV-EPTSRPRSFRR  364
            VKL EE  E  S  RSFRR
Sbjct  282  VKLPEEDGEKPSTVRSFRR  300



>ref|XP_010058378.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=228

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+L+GNAACAGLAVMII+ S GHISGAHLNPS+T+A A + HFPW QVP YIAAQV+ 
Sbjct  29   GAETLLGNAACAGLAVMIIVFSIGHISGAHLNPSVTVALAVIWHFPWIQVPGYIAAQVAG  88

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CAS+ LKGVFHPF +GGVTVPSV  GQAFALEFL TF L FV+ AV TDTRAVG+LAG
Sbjct  89   SMCASYVLKGVFHPFANGGVTVPSVDIGQAFALEFLATFILAFVIVAVVTDTRAVGDLAG  148

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+GATV+L +LV G  +GGS+NPVRTLGPAVAAGNYK +W+Y+VAP LGAIAGA  Y  
Sbjct  149  IAIGATVLLGVLVTGMPTGGSLNPVRTLGPAVAAGNYKGLWMYMVAPPLGAIAGAVTYKA  208

Query  417  VKLR-EEVEPTSRPRS  373
            VKLR  E EP  R R+
Sbjct  209  VKLRGYEAEPLRRRRT  224



>ref|XP_010056097.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=280

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 166/199 (83%), Gaps = 2/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNA CAG+AV +I+ S GHISGAHLNPS+TIAFA  RHFPW QVP Y+AAQV  
Sbjct  81   GVETLIGNAVCAGVAVTVIVFSIGHISGAHLNPSVTIAFAVTRHFPWIQVPGYVAAQVGG  140

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CAS+ LKGVFHPF +GGVTVP V+  QAFALEFL TF L+FV+ AVATD RAVG+LAG
Sbjct  141  SMCASYVLKGVFHPFANGGVTVPLVNVRQAFALEFLATFLLMFVIVAVATDARAVGDLAG  200

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+GATV++ ILVAG S+G SMNPVRTLGPAVAAGNYK +W+Y+VAP LGAIAGAA YTV
Sbjct  201  IAIGATVLVGILVAGMSTGASMNPVRTLGPAVAAGNYKGLWMYMVAPPLGAIAGAATYTV  260

Query  417  VKLR-EEVEPTSRPR-SFR  367
            +KLR  E EP  R R +FR
Sbjct  261  LKLRGYEAEPPRRRRITFR  279



>gb|AGD98713.1| aquaporin protein 10 [Camellia sinensis]
Length=302

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP Y+ AQV A
Sbjct  101  GTETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPMYMGAQVIA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKGVFHP + GGVTVPS    QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  161  SLCAAFALKGVFHPLMGGGVTVPSGDYVQAFALEFIISFNLMFVVTAVATDTRAVGELAG  220

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IWIYL AP LGA+AGA +Y+ 
Sbjct  221  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNYKAIWIYLTAPILGALAGAGVYSA  280

Query  417  VKLREEVEPT-SRP---RSFRR  364
            VKL EE   T  RP    SFRR
Sbjct  281  VKLPEEDGNTHDRPSTAHSFRR  302



>ref|XP_008229796.1| PREDICTED: probable aquaporin NIP5-1 [Prunus mume]
Length=283

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
             AE+L+GNAAC+GLAVM +ILSTGHISGAHLNPS+TIAFAA RHFPW+QVP YI AQV A
Sbjct  83   NAETLLGNAACSGLAVMGVILSTGHISGAHLNPSVTIAFAAFRHFPWSQVPLYITAQVLA  142

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALKGVFHPF+SGGVTVPSV+ GQAFALEF++TF L+F + AVATDTRAVGE+A 
Sbjct  143  SISASFALKGVFHPFMSGGVTVPSVNHGQAFALEFIVTFILMFTIIAVATDTRAVGEMAS  202

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GATV++NILVAGP++GGSMNP+RTLGPAVAAGNY+ +WIYLVAPTLGA+AGAA YT 
Sbjct  203  VAIGATVLVNILVAGPTTGGSMNPIRTLGPAVAAGNYRGLWIYLVAPTLGALAGAAAYTT  262

Query  417  VKLREEV  397
            VKL + V
Sbjct  263  VKLPDNV  269



>ref|XP_009804421.1| PREDICTED: aquaporin NIP6-1 isoform X2 [Nicotiana sylvestris]
Length=245

 Score =   265 bits (676),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  44   GSETLIGLAASSGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKNVPVYIGAQIIA  103

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVTVPS S  QAFALEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  104  SFCAAFTLKVVLHPIMGGGVTVPSGSYLQAFALEFIISFNLMFVITAVATDTRAVGELAG  163

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPAVAAGNYK+IWIYL AP LGA+AGA IY+ 
Sbjct  164  IAVGATVMLNILIAGETTGASMNPVRTLGPAVAAGNYKAIWIYLTAPILGALAGAGIYSA  223

Query  417  VKLREEVEPT----SRPRSFRR  364
            VKL  E +      S   SFRR
Sbjct  224  VKLPNEDDNNHGKPSVEHSFRR  245



>ref|XP_008228780.1| PREDICTED: aquaporin NIP6-1 [Prunus mume]
Length=307

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 170/201 (85%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HF W  VP Y+ AQV A
Sbjct  107  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPSVTIAFAALKHFSWKHVPVYVGAQVLA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALK +FHP + GGVTVPS S GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SICAAFALKVIFHPIMGGGVTVPSGSYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  YT 
Sbjct  227  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPFLGALFGAGTYTA  286

Query  417  VKLREEV-EPTSRP--RSFRR  364
            VKL EE  +   +P  RSFRR
Sbjct  287  VKLPEEDGDHIEKPSTRSFRR  307



>ref|XP_008343681.1| PREDICTED: aquaporin NIP6-1-like [Malus domestica]
Length=306

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 170/200 (85%), Gaps = 2/200 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ESL+G AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HF W  VP Y+ AQV+A
Sbjct  107  GSESLLGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFSWKHVPVYVGAQVAA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK +FHP + GGVTVPS S  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SVCAAFALKAIFHPIMGGGVTVPSGSWSQAFALEFMISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  YT 
Sbjct  227  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAAKNYKAIWVYLTAPFLGALFGAGTYTA  286

Query  417  VKLREEVEPTSR--PRSFRR  364
            VKL E+ +   +  PRSFRR
Sbjct  287  VKLPEDGDGIEKPSPRSFRR  306



>ref|XP_010275746.1| PREDICTED: aquaporin NIP6-1 [Nelumbo nucifera]
Length=338

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 169/201 (84%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMI+ILSTGHISGAHLNP++TIAFAALRHFPW  VP +IAAQV A
Sbjct  138  GSETLLGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALRHFPWKHVPMFIAAQVMA  197

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP +  GVT+PS   GQAFALE +I+FNL+FVVTAVATDTRAVGELAG
Sbjct  198  SLCAAFALKGIFHPIMGAGVTIPSGGYGQAFALELIISFNLMFVVTAVATDTRAVGELAG  257

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  Y+ 
Sbjct  258  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPILGALCGAGAYSA  317

Query  417  VKLREEVEPTSRP---RSFRR  364
            VKL E+ +   +P   RS RR
Sbjct  318  VKLPEDSDTQDKPAAARSLRR  338



>ref|XP_007215732.1| hypothetical protein PRUPE_ppa009083mg [Prunus persica]
 gb|EMJ16931.1| hypothetical protein PRUPE_ppa009083mg [Prunus persica]
Length=307

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 169/201 (84%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG AA  GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HF W  VP Y+ AQV A
Sbjct  107  GTETLIGLAASTGLAVMIVILSTGHISGAHLNPSVTIAFAALKHFSWKHVPVYVGAQVLA  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALK +FHP + GGVTVPS S GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  167  SICAAFALKVIFHPIMGGGVTVPSGSYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  YT 
Sbjct  227  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPFLGALFGAGTYTA  286

Query  417  VKLREEV-EPTSRP--RSFRR  364
            VKL EE  +   +P  RSFRR
Sbjct  287  VKLPEEDGDHIEKPSTRSFRR  307



>ref|XP_010058381.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=228

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+L+GNAACAGLAVMII+ S GHISGAHLNPS+T+A A + HFPW QVP YIAAQV+ 
Sbjct  29   GAETLLGNAACAGLAVMIIVFSIGHISGAHLNPSVTVALAVIWHFPWIQVPGYIAAQVAG  88

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CAS+ LKGVFHPF +GGVTVPSV  GQAFALEFL TF L FV+ AV TDTRAVG+LAG
Sbjct  89   SMCASYVLKGVFHPFANGGVTVPSVDIGQAFALEFLATFILAFVIVAVVTDTRAVGDLAG  148

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+GATV+L +LV G  +GGS+NPVRTLGPAVAAGNYK +W+Y+VAP LGAIAGA  Y  
Sbjct  149  IAIGATVLLGVLVTGMPTGGSLNPVRTLGPAVAAGNYKGLWMYMVAPPLGAIAGAVTYKA  208

Query  417  VKLR-EEVEPTSRPRS  373
            VKLR  EVEP    R+
Sbjct  209  VKLRGYEVEPLRWRRT  224



>ref|XP_002973832.1| hypothetical protein SELMODRAFT_173700 [Selaginella moellendorffii]
 ref|XP_002983558.1| hypothetical protein SELMODRAFT_118471 [Selaginella moellendorffii]
 gb|EFJ15459.1| hypothetical protein SELMODRAFT_118471 [Selaginella moellendorffii]
 gb|EFJ24787.1| hypothetical protein SELMODRAFT_173700 [Selaginella moellendorffii]
Length=276

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ + +G AA +GLAVMI+IL+TGHISGAHLNPSLT++FAALRHFPW +VP YI AQV+A
Sbjct  79   GSITTVGLAATSGLAVMIVILATGHISGAHLNPSLTLSFAALRHFPWVEVPLYIGAQVAA  138

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+FALKG+F+PF+ GGVT+PS S  ++F LEF+I+FNL+FVVTAVATD+RAVGELAG
Sbjct  139  SICAAFALKGIFNPFMHGGVTIPSGSYWESFVLEFIISFNLMFVVTAVATDSRAVGELAG  198

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG +SG SMNPVRTLGPA+AA NYK IW+Y+V P  GA+AGAA YT+
Sbjct  199  IAVGATVMLNILIAGSTSGASMNPVRTLGPAIAANNYKGIWLYIVGPIFGALAGAAAYTL  258

Query  417  VKLREEVEPTSRPR-SFRR  364
            V+L+ E EP  RPR S RR
Sbjct  259  VRLKGEPEP-GRPRFSMRR  276



>ref|XP_002297797.2| aquaporin NIP6.1 family protein [Populus trichocarpa]
 gb|EEE82602.2| aquaporin NIP6.1 family protein [Populus trichocarpa]
Length=303

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLA MI+ILSTGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  102  GSEALIGLAASTGLAAMIVILSTGHISGAHLNPSITIAFAALKHFPWKHVPVYIGAQVLA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK +FHP + GGVTVPS   GQAFALEF+I+F L+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFALKVIFHPMMGGGVTVPSGGHGQAFALEFIISFILMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP LGA+ GA  Y+ 
Sbjct  222  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNYKAIWVYLTAPILGALCGAGTYSA  281

Query  417  VKLREEV----EPTSRPRSFRR  364
            VKL EE     E TS  RSFRR
Sbjct  282  VKLPEEDGDTNEKTSATRSFRR  303



>dbj|BAM44346.1| plasma membrane aluminum transporter [Hydrangea macrophylla]
Length=304

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 171/203 (84%), Gaps = 5/203 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  102  GSETLLGLAASTGLAVMIVILSTGHISGAHLNPSVTIAFAALKHFPWKHVPMYIGAQVMA  161

Query  777  SICASFALKGVFHPFLSGG-VTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELA  601
            S+CA+FALKG+FHP   GG VTVPSV  GQAFALEF+ITFNL+FVVTAVATDTRAVGELA
Sbjct  162  SLCAAFALKGIFHPIRGGGEVTVPSVHYGQAFALEFIITFNLMFVVTAVATDTRAVGELA  221

Query  600  GIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYT  421
            GIAVGATVMLNIL+AG S+G SMNPVRTLGPA+AA N+K IWIY  AP LGA+AGA +Y+
Sbjct  222  GIAVGATVMLNILIAGESTGASMNPVRTLGPAIAANNFKGIWIYFTAPILGALAGAGVYS  281

Query  420  VVKLREEVEPT-SRPR---SFRR  364
             VKL EE+  T  +P    SFR+
Sbjct  282  AVKLPEEIGNTHDKPETAHSFRQ  304



>ref|XP_011073345.1| PREDICTED: aquaporin NIP6-1-like [Sesamum indicum]
Length=304

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 169/202 (84%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMI+ILSTGHISGAHLNPS+TIAFAALRHFPW  VP YI AQV A
Sbjct  103  GSETLLGLAASTGLAVMIVILSTGHISGAHLNPSVTIAFAALRHFPWKHVPVYIGAQVMA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA+F LK +FHP + GGVTVP+V   QAFALEF+ITFNL+FVVTAVATDTRAVGELAG
Sbjct  163  SICAAFMLKVIFHPVMGGGVTVPAVGHAQAFALEFIITFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+A  NY +IWIYL AP LGA+AGA +Y+ 
Sbjct  223  IAVGATVMLNILIAGGTTGASMNPVRTLGPAIAVNNYTAIWIYLTAPILGALAGAGVYSA  282

Query  417  VKL-REEVEPTSRP---RSFRR  364
            VKL  E+ +P  +P    SFRR
Sbjct  283  VKLPDEDPKPHDKPLAEHSFRR  304



>ref|XP_011020626.1| PREDICTED: aquaporin NIP6-1 isoform X2 [Populus euphratica]
Length=303

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  102  GSETLIGLAASSGLAVMIVILSTGHISGAHLNPSITIAFAALKHFPWKHVPVYIGAQVLA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP + GGVTVPS    QAFALEF+ +F L+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFALKGIFHPVMGGGVTVPSGGYSQAFALEFITSFILMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+A  NYK+IWIYL AP LGA+ GA  Y+ 
Sbjct  222  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAVKNYKAIWIYLTAPILGALCGAGTYSA  281

Query  417  VKLREEV----EPTSRPRSFRR  364
            VKL EE     E TS  RSFRR
Sbjct  282  VKLPEEDGDSNEKTSAARSFRR  303



>ref|XP_003531732.1| PREDICTED: aquaporin NIP6-1-like [Glycine max]
Length=306

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 169/202 (84%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMIII STGHISGAHLNP++TI+FAAL+HFPW  VP YI  QV A
Sbjct  105  GSETLIGCAAANGLAVMIIIFSTGHISGAHLNPAVTISFAALKHFPWKNVPVYIGTQVLA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+FALK VFHPF+SGGVTVPSV  GQAFA EF+++F L+FVVTAVATDTRAVGELAG
Sbjct  165  SVSAAFALKVVFHPFMSGGVTVPSVGYGQAFATEFIVSFILMFVVTAVATDTRAVGELAG  224

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP LG + GA  YTV
Sbjct  225  IAVGATVMLNILIAGPTTGSSMNPVRTLGPAIAANNYKGIWVYLIAPILGTLCGAGAYTV  284

Query  417  VKLREE---VEPTSRPR-SFRR  364
            VKL EE     P+S P  SFRR
Sbjct  285  VKLPEEEATKTPSSAPNGSFRR  306



>gb|KHG25640.1| Aquaporin NIP6-1 -like protein [Gossypium arboreum]
Length=300

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFP   VP YI AQV A
Sbjct  102  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPRKHVPVYIGAQVMA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LKGVFHP + GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAV ELAG
Sbjct  162  SLCAAFGLKGVFHPMMGGGVTVPSGGFGQAFALEFMISFNLMFVVTAVATDTRAVDELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+Y  AP LGA+ GA  YT 
Sbjct  222  IAVGATVMLNILIAGPITGASMNPVRTLGPAIAANNYKAIWVYFTAPILGALCGAGTYTA  281

Query  417  VKLR-EEVEPTSRPRSFRR  364
            VKL  E+ E  S  RSFRR
Sbjct  282  VKLPVEDGEKPSTVRSFRR  300



>ref|XP_002304723.1| aquaporin NIP6.1 family protein [Populus trichocarpa]
 gb|EEE79702.1| aquaporin NIP6.1 family protein [Populus trichocarpa]
Length=303

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA +GLAVMI+IL+TGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  102  GSETLVGLAASSGLAVMIVILATGHISGAHLNPSITIAFAALKHFPWKHVPVYIGAQVLA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP + GGVTVPS   GQAFALEF+ +F L+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFALKGIFHPVMGGGVTVPSGGYGQAFALEFITSFILMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNI +AG ++G SMNPVRTLGPA+A  NYK+IWIYL AP LGA+ GA  Y+ 
Sbjct  222  IAVGATVMLNIFIAGETTGASMNPVRTLGPAIAVNNYKAIWIYLTAPILGALCGAGTYSA  281

Query  417  VKLREEV----EPTSRPRSFRR  364
            VKL EE     E TS  RSFRR
Sbjct  282  VKLPEEDGDSNEKTSAARSFRR  303



>gb|EYU21708.1| hypothetical protein MIMGU_mgv1a010517mg [Erythranthe guttata]
Length=310

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 168/204 (82%), Gaps = 6/204 (3%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G A   GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  106  GSETLLGLAGSTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQIVA  165

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF L  +FHP + GGVTVPSV   Q FALEF+ITFNL+FVVTAVATDTRAVGELAG
Sbjct  166  SICASFMLNAIFHPTMGGGVTVPSVGYAQTFALEFIITFNLMFVVTAVATDTRAVGELAG  225

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGPS+G SMNPVRTLGPA+AA NYK+IWIYL AP LGA+ GA +Y+ 
Sbjct  226  IAVGATVMLNILIAGPSTGASMNPVRTLGPAIAANNYKAIWIYLTAPILGALTGAGVYSA  285

Query  417  VKLREEVE---PTSRP---RSFRR  364
            VKL +E +     ++P    SFRR
Sbjct  286  VKLPDEEDKAHDNNKPVTEHSFRR  309



>emb|CDO98218.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG +A  GLAVMI+IL+TGHISGAH+NP++TIAFAAL+HFPW  VPAYIAAQV A
Sbjct  102  GSETLIGLSASTGLAVMIVILATGHISGAHINPAVTIAFAALKHFPWKHVPAYIAAQVLA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+F LKG+FHP +SGGVT+PS   GQAFALEF+I FNL+FVVTAVATDTRAVGELAG
Sbjct  162  SLAAAFILKGIFHPIMSGGVTIPSGEYGQAFALEFIIGFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG S+G SMNPVRTLGPAVAA N+K IWIYL AP LGA+AGA  Y+ 
Sbjct  222  IAVGATVMLNILIAGESTGASMNPVRTLGPAVAANNFKGIWIYLTAPVLGALAGAGTYSA  281

Query  417  VKL-REEVEPTSRPR---SFRR  364
            VKL  ++  P ++P    SFRR
Sbjct  282  VKLPDDDANPQNKPSAAPSFRR  303



>gb|KDP41985.1| hypothetical protein JCGZ_27003 [Jatropha curcas]
Length=307

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 5/203 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+L+G AA +GLAVMI+ILSTGHISGAHLNPS+TIAFAAL HFPW  VP YI AQV A
Sbjct  105  GAETLVGLAASSGLAVMIVILSTGHISGAHLNPSVTIAFAALNHFPWKHVPVYIGAQVLA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+FALKG+ HP + GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  165  SLGAAFALKGILHPIMGGGVTVPSGGYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  224

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK+IWIYL AP LGA+ GA  Y+ 
Sbjct  225  IAVGATVMLNILIAGPATGASMNPVRTLGPAIAANNYKAIWIYLTAPILGALCGAGTYSA  284

Query  417  VKLREE-----VEPTSRPRSFRR  364
            VKL EE      +P +   SFRR
Sbjct  285  VKLPEEDGNARQKPLAATASFRR  307



>ref|XP_004303250.1| PREDICTED: aquaporin NIP6-1-like [Fragaria vesca subsp. vesca]
Length=306

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G AA  GLAVM++ILSTGHISGAHLNP++TIAFAAL+HF W  VP YI AQV A
Sbjct  109  GTESLVGLAASTGLAVMVVILSTGHISGAHLNPAVTIAFAALKHFSWKLVPVYIGAQVLA  168

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+C++FALK +FHP + GGVTVPS S GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  169  SMCSAFALKVIFHPIMGGGVTVPSGSYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  228

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA N+K+IW+YL AP LGA+ GA  YT 
Sbjct  229  IAVGATVMLNILIAGETTGASMNPVRTLGPAIAANNFKAIWVYLTAPVLGALCGAGTYTA  288

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL EE       RSFRR
Sbjct  289  VKLPEEEGEKPLTRSFRR  306



>ref|XP_009804420.1| PREDICTED: aquaporin NIP6-1 isoform X1 [Nicotiana sylvestris]
Length=303

 Score =   262 bits (669),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 168/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  102  GSETLIGLAASSGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKNVPVYIGAQIIA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVTVPS S  QAFALEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  162  SFCAAFTLKVVLHPIMGGGVTVPSGSYLQAFALEFIISFNLMFVITAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPAVAAGNYK+IWIYL AP LGA+AGA IY+ 
Sbjct  222  IAVGATVMLNILIAGETTGASMNPVRTLGPAVAAGNYKAIWIYLTAPILGALAGAGIYSA  281

Query  417  VKLREEVEPT----SRPRSFRR  364
            VKL  E +      S   SFRR
Sbjct  282  VKLPNEDDNNHGKPSVEHSFRR  303



>ref|XP_010092181.1| Aquaporin NIP6-1 [Morus notabilis]
 gb|EXB50407.1| Aquaporin NIP6-1 [Morus notabilis]
Length=430

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMI+ILSTGHISGAHLNP++TI+FAALRHFPW  VP YI AQV A
Sbjct  229  GSETLLGLAASNGLAVMIVILSTGHISGAHLNPAITISFAALRHFPWKYVPVYIGAQVLA  288

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CASFALK +FHP +SGGVTVPS S GQAFALEFLITF L+FVVT VATDTRAVGELAG
Sbjct  289  SLCASFALKWIFHPIMSGGVTVPSGSHGQAFALEFLITFFLMFVVTGVATDTRAVGELAG  348

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNILVAG ++G SMNPVRTLGPA+AA N+++IW+YL AP LGA+ GA +Y+ 
Sbjct  349  IAVGATVMLNILVAGEATGASMNPVRTLGPAIAANNFEAIWVYLTAPILGALCGAGVYSA  408

Query  417  VKLREEV-EPTSRP---RSFRR  364
            VKL EE  +   +P   RS RR
Sbjct  409  VKLPEENGDNHDKPAPTRSLRR  430



>ref|XP_009623274.1| PREDICTED: aquaporin NIP6-1 isoform X2 [Nicotiana tomentosiformis]
Length=303

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  102  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKNVPVYIGAQIIA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVTVPS S  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  162  SFCAAFTLKVVLHPIMGGGVTVPSGSYLQAFALEFIISFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPAVAAGNYK+IWIYL AP LGA+AGA +Y+ 
Sbjct  222  IAVGATVMLNILIAGETTGASMNPVRTLGPAVAAGNYKAIWIYLTAPILGALAGAGVYSA  281

Query  417  VKLREEVEPT----SRPRSFRR  364
            VKL  E +      S   SFRR
Sbjct  282  VKLPNENDNNHGKPSLEHSFRR  303



>ref|XP_009623273.1| PREDICTED: aquaporin NIP6-1 isoform X1 [Nicotiana tomentosiformis]
Length=313

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQ+ A
Sbjct  112  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKNVPVYIGAQIIA  171

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVTVPS S  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  172  SFCAAFTLKVVLHPIMGGGVTVPSGSYLQAFALEFIISFNLMFVVTAVATDTRAVGELAG  231

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPAVAAGNYK+IWIYL AP LGA+AGA +Y+ 
Sbjct  232  IAVGATVMLNILIAGETTGASMNPVRTLGPAVAAGNYKAIWIYLTAPILGALAGAGVYSA  291

Query  417  VKLREEVEPT----SRPRSFRR  364
            VKL  E +      S   SFRR
Sbjct  292  VKLPNENDNNHGKPSLEHSFRR  313



>ref|XP_011082216.1| PREDICTED: aquaporin NIP6-1-like [Sesamum indicum]
Length=304

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  103  GSETLLGLAASTGLAVMIVILSTGHISGAHLNPSVTIAFAALKHFPWKHVPVYIGAQVMA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LKG+FHP L GGVT+PS    QAF+LEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  163  SLCAAFLLKGIFHPVLGGGVTIPSGGYAQAFSLEFIISFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPA+AA NYK+IW+YL AP  GA+AGA +Y+ 
Sbjct  223  IAVGATVMLNILIAGKTTGASMNPVRTLGPAIAANNYKAIWVYLTAPIFGALAGAGVYSA  282

Query  417  VKLREE  400
            VKL +E
Sbjct  283  VKLPDE  288



>ref|XP_010034003.1| PREDICTED: aquaporin NIP6-1 [Eucalyptus grandis]
 gb|KCW53890.1| hypothetical protein EUGRSUZ_J03103 [Eucalyptus grandis]
Length=298

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA +GLAVMI+IL+ GHISGAHLNP+LTI+FAAL+HFPW  VP YI AQ  A
Sbjct  103  GSETLLGLAASSGLAVMIVILAVGHISGAHLNPALTISFAALKHFPWKHVPVYIGAQAVA  162

Query  777  SICASFALKGVFHPFLSGGVTVPS--VSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            S+CA+FALKG+F+P + GGVTVPS  VS GQAFALEF+I+FNL+ VVTAVATDTRAVGEL
Sbjct  163  SLCAAFALKGIFYPVMGGGVTVPSAGVSDGQAFALEFIISFNLMLVVTAVATDTRAVGEL  222

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVGATVMLNIL+AGP++G SMNP RTLGPA+AAGNY++IWIYL AP LGA+ GA IY
Sbjct  223  AGIAVGATVMLNILIAGPTTGASMNPARTLGPAIAAGNYRAIWIYLTAPILGALCGAGIY  282

Query  423  TVVKLREE  400
            T VKL ++
Sbjct  283  TAVKLPDD  290



>ref|XP_011020625.1| PREDICTED: aquaporin NIP6-1 isoform X1 [Populus euphratica]
Length=310

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 168/209 (80%), Gaps = 11/209 (5%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA +GLAVMI+ILSTGHISGAHLNPS+TIAFAAL+HFPW  VP YI AQV A
Sbjct  102  GSETLIGLAASSGLAVMIVILSTGHISGAHLNPSITIAFAALKHFPWKHVPVYIGAQVLA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALKG+FHP + GGVTVPS    QAFALEF+ +F L+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFALKGIFHPVMGGGVTVPSGGYSQAFALEFITSFILMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAG-------PSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIA  439
            IAVGATVMLNIL+AG        ++G SMNPVRTLGPA+A  NYK+IWIYL AP LGA+ 
Sbjct  222  IAVGATVMLNILIAGVFIFMCRETTGASMNPVRTLGPAIAVKNYKAIWIYLTAPILGALC  281

Query  438  GAAIYTVVKLREEV----EPTSRPRSFRR  364
            GA  Y+ VKL EE     E TS  RSFRR
Sbjct  282  GAGTYSAVKLPEEDGDSNEKTSAARSFRR  310



>ref|XP_010058382.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=228

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 158/195 (81%), Gaps = 1/195 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E LIGNAACAG AV +II S GHISGAHLNPS+TIAFA  RHFPW QVP YIAAQ + 
Sbjct  29   GVEPLIGNAACAGAAVTVIIFSVGHISGAHLNPSVTIAFAVTRHFPWNQVPGYIAAQAAG  88

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CAS+ LK VFHP ++  VTVPSV+ G+A ALEFL TF L+FV  AVATDTRAVG+LAG
Sbjct  89   SMCASYVLKWVFHPLVNSAVTVPSVNVGRALALEFLTTFLLMFVSVAVATDTRAVGDLAG  148

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+L+ LVAG S+G SMNP+RTLGPAVAAGNYK +W+Y+VAP LGAIAGA  YT 
Sbjct  149  IAVGATVLLDNLVAGMSTGASMNPIRTLGPAVAAGNYKGLWVYMVAPPLGAIAGAVTYTT  208

Query  417  VKLR-EEVEPTSRPR  376
            +KLR  E EP  R R
Sbjct  209  LKLRGHEAEPPRRRR  223



>ref|XP_010246844.1| PREDICTED: probable aquaporin NIP5-1 isoform X2 [Nelumbo nucifera]
Length=264

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAAC+GLAVMI++LS GHISGAHLNP++T+AFA  RHFPW  VP Y+ AQ+ A
Sbjct  66   GAETLIGNAACSGLAVMIVVLSIGHISGAHLNPAVTLAFATFRHFPWLHVPPYLIAQILA  125

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LK  FHPF+S  VT PS++   AF LEF+ITF L+FV+T+VATDTRAVGELAG
Sbjct  126  SICASFTLKAAFHPFISAAVTAPSITQTHAFLLEFIITFTLMFVITSVATDTRAVGELAG  185

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+G  V+LNILVAGPS+G SMNPVRTLGPA+AA NY+SIWIY VAP LGA+ GA +Y  
Sbjct  186  IAIGGAVLLNILVAGPSTGASMNPVRTLGPAIAAQNYRSIWIYFVAPVLGALVGAGVYGA  245

Query  417  VKLREEVEPTSR  382
            +KL E+    +R
Sbjct  246  IKLSEDEADPNR  257



>ref|XP_010246843.1| PREDICTED: probable aquaporin NIP5-1 isoform X1 [Nelumbo nucifera]
Length=297

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 158/192 (82%), Gaps = 0/192 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIGNAAC+GLAVMI++LS GHISGAHLNP++T+AFA  RHFPW  VP Y+ AQ+ A
Sbjct  99   GAETLIGNAACSGLAVMIVVLSIGHISGAHLNPAVTLAFATFRHFPWLHVPPYLIAQILA  158

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LK  FHPF+S  VT PS++   AF LEF+ITF L+FV+T+VATDTRAVGELAG
Sbjct  159  SICASFTLKAAFHPFISAAVTAPSITQTHAFLLEFIITFTLMFVITSVATDTRAVGELAG  218

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IA+G  V+LNILVAGPS+G SMNPVRTLGPA+AA NY+SIWIY VAP LGA+ GA +Y  
Sbjct  219  IAIGGAVLLNILVAGPSTGASMNPVRTLGPAIAAQNYRSIWIYFVAPVLGALVGAGVYGA  278

Query  417  VKLREEVEPTSR  382
            +KL E+    +R
Sbjct  279  IKLSEDEADPNR  290



>ref|XP_004305876.1| PREDICTED: probable aquaporin NIP5-1-like [Fragaria vesca subsp. 
vesca]
Length=280

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+L+GNAAC+GLAVM+++ STGHISGAHLNPS+T+AFAA RHFPW+QVP YI AQVSA
Sbjct  70   GAETLLGNAACSGLAVMVVVFSTGHISGAHLNPSVTVAFAAFRHFPWSQVPLYITAQVSA  129

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFALK VFHPF++GGVTVPSV  GQAFALEF++TF L+FV+ AVATDTRAVGELAG
Sbjct  130  SISASFALKSVFHPFMNGGVTVPSVGNGQAFALEFIVTFILMFVIIAVATDTRAVGELAG  189

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+G  V+L+IL+AGP++G SMNP RTLGPA+AAG+YKS+WIYLVAPTLGA+AGAA YT 
Sbjct  190  VAIGTAVLLDILIAGPTTGASMNPARTLGPAIAAGHYKSLWIYLVAPTLGALAGAAAYTA  249

Query  417  VKLREEVEPTS  385
            VKL E  + T 
Sbjct  250  VKLPEIPQKTQ  260



>ref|XP_010058113.1| PREDICTED: probable aquaporin NIP5-1 [Eucalyptus grandis]
Length=238

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 159/196 (81%), Gaps = 1/196 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIGNAACAGLAV +II S GHISGAHLNP +TIAFA  RHFPW QVP Y+A QV  
Sbjct  29   GVETLIGNAACAGLAVTVIIFSVGHISGAHLNPFVTIAFAVTRHFPWNQVPGYVAVQVLG  88

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CAS+ LK VF+P ++ GVTVPSV+ G+AFALEFL TF L+FV  AVATDTRAVG+LAG
Sbjct  89   SMCASYVLKWVFYPLVNSGVTVPSVNVGRAFALEFLATFLLMFVSVAVATDTRAVGDLAG  148

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+L+ LVAG S+G SMNP+RTLGPAVAAGNYK +W Y+VAP LGAIAGA  YT 
Sbjct  149  IAVGATVLLDNLVAGMSTGASMNPIRTLGPAVAAGNYKGLWAYMVAPPLGAIAGAVTYTA  208

Query  417  VKLR-EEVEPTSRPRS  373
            +KLR  E EP  R R 
Sbjct  209  LKLRGHEAEPLCRRRD  224



>ref|XP_006341363.1| PREDICTED: aquaporin NIP6-1-like [Solanum tuberosum]
Length=306

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 166/203 (82%), Gaps = 6/203 (3%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L G AA  GLAVMI+ILSTGHISGAHLNP++TI FAAL+HFPW  VP YI AQ+ A
Sbjct  105  GSETLFGLAASTGLAVMIVILSTGHISGAHLNPAVTIGFAALKHFPWKHVPVYIGAQIIA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVT+PS S  QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  165  SFCAAFTLKVVLHPIMGGGVTIPSGSYVQAFALEFIISFNLMFVVTAVATDTRAVGELAG  224

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AG ++G SMNPVRTLGPAVA GNYK+IWIYL AP LGA+ GA +Y+ 
Sbjct  225  IAVGATVMLNILIAGETTGASMNPVRTLGPAVAVGNYKAIWIYLTAPILGALIGAGVYSA  284

Query  417  VKLREEVEPTSRPR-----SFRR  364
            VKL +E +  + P+     SFRR
Sbjct  285  VKLPDE-DGDNHPKPSLEHSFRR  306



>ref|XP_008454166.1| PREDICTED: aquaporin NIP6-1 [Cucumis melo]
Length=304

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 163/201 (81%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+ FPW  VP YI AQ+ A
Sbjct  104  GTETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKQFPWKHVPLYIGAQMVA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+C+SFALK +F P + GG TVPS    QAFALEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  164  SLCSSFALKWIFDPIMGGGATVPSCGYAQAFALEFIISFNLMFVLTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLN+L+AG ++G SMNPVRTLGPA+AA N+K+IWIYL AP LG + GA IYT 
Sbjct  224  IAVGATVMLNVLIAGQTTGASMNPVRTLGPAIAANNFKAIWIYLTAPILGTLCGAGIYTA  283

Query  417  VKLREEVEPTSRPR---SFRR  364
            VKL ++   +  P    SFRR
Sbjct  284  VKLPDKDGDSRLPSTAASFRR  304



>gb|KHN38028.1| Aquaporin NIP6-1 [Glycine soja]
Length=323

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 168/219 (77%), Gaps = 21/219 (10%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMIII STGHISGAHLNP++TI+FAAL+HFPW  VP YI  QV A
Sbjct  105  GSETLIGCAAANGLAVMIIIFSTGHISGAHLNPAVTISFAALKHFPWKNVPVYIGTQVLA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraV-----  613
            S+ A+FALK VFHPF+SGGVTVPSV  GQAFA EF+++F L+FVVTAVATDTRA      
Sbjct  165  SVSAAFALKVVFHPFMSGGVTVPSVGYGQAFATEFIVSFILMFVVTAVATDTRAEYFEGG  224

Query  612  ------------GELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIY  469
                        GELAGIAVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+Y
Sbjct  225  GRTAVANDTRAVGELAGIAVGATVMLNILIAGPTTGSSMNPVRTLGPAIAANNYKGIWVY  284

Query  468  LVAPTLGAIAGAAIYTVVKLREE---VEPTSRPR-SFRR  364
            L+AP LG + GA  YTVVKL EE     P+S P  SFRR
Sbjct  285  LIAPILGTLCGAGAYTVVKLPEEEATKTPSSAPNGSFRR  323



>ref|XP_007135806.1| hypothetical protein PHAVU_010G160200g [Phaseolus vulgaris]
 gb|ESW07800.1| hypothetical protein PHAVU_010G160200g [Phaseolus vulgaris]
Length=301

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 166/200 (83%), Gaps = 3/200 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVMIII STGHISGAHLNP++TI+FAAL+HFPW  VP YI  Q+ A
Sbjct  103  GSETLVGCAAANGLAVMIIIFSTGHISGAHLNPAVTISFAALKHFPWKNVPVYIGTQILA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+FA+K VF+PF+SGGVTVPSV  GQAFA EF+++F L+FVVTAVATDTRAVGELAG
Sbjct  163  SVSAAFAVKAVFNPFMSGGVTVPSVGYGQAFATEFIVSFILMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+AGP++G SMNPVRTLGPA+AA NYK IW+YL+AP  G + GA  YT+
Sbjct  223  IAVGATVMLNILIAGPATGSSMNPVRTLGPAIAANNYKGIWVYLIAPIFGTLCGAGAYTM  282

Query  417  VKLREEVEPTSRP--RSFRR  364
            VKL +E E T  P   SF R
Sbjct  283  VKLPQE-EATKPPIVESFGR  301



>ref|XP_001779449.1| predicted protein [Physcomitrella patens]
 gb|EDQ55727.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ +L+GNAA AGLA+MI+I +TGHISGAH+NP++TIAFA+LRHFPW QVP YIAAQV  
Sbjct  49   GSVTLLGNAATAGLAIMIVIFATGHISGAHVNPAITIAFASLRHFPWVQVPFYIAAQVLG  108

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF LKG+FHP++ GGVT+P  +   +F LEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  109  SIAASFTLKGIFHPYMHGGVTLPQGAYWPSFLLEFIISFNLMFVITAVATDTRAVGELAG  168

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGA VM+NI++AG +SG SMNPVRTLGPA+A  NYK IW+Y++ P LG +AGA  YT 
Sbjct  169  IAVGACVMMNIMIAGSTSGASMNPVRTLGPAIAVNNYKGIWLYMLGPVLGMLAGATAYTA  228

Query  417  VKLREEVEPTSRPRSFRR  364
            V+L+EE  P    R F R
Sbjct  229  VRLKEEDPPRLPVRVFHR  246



>ref|NP_001289852.1| aquaporin NIP6-1 [Solanum lycopersicum]
 dbj|BAO18647.1| nodulin26-like intrinsic protein 6;1 [Solanum lycopersicum]
Length=306

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 165/203 (81%), Gaps = 6/203 (3%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TI FAAL HFPW  VP YI AQ+ A
Sbjct  105  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIGFAALNHFPWKHVPVYIGAQIIA  164

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S CA+F LK V HP + GGVTVPS S  QAFALEF+I+FNL+FVVTAVATDTR+VGELAG
Sbjct  165  SFCAAFTLKVVLHPIMGGGVTVPSGSYVQAFALEFIISFNLMFVVTAVATDTRSVGELAG  224

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLNIL+A  ++G SMNPVRTLGPAVA GNYK+IWIYL AP LGA+ GA +Y+ 
Sbjct  225  IAVGATVMLNILIAVETTGASMNPVRTLGPAVAVGNYKAIWIYLTAPILGALIGAGVYSA  284

Query  417  VKLREEVEPTSRPR-----SFRR  364
            VKL +E +  + P+     SFRR
Sbjct  285  VKLPDE-DRDNHPKPSLEHSFRR  306



>ref|XP_004156981.1| PREDICTED: aquaporin NIP6-1-like [Cucumis sativus]
Length=304

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 162/201 (81%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+ FPW  VP YI AQ+ A
Sbjct  104  GTETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKQFPWKHVPLYIGAQMVA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+C+SFALK +F P + GG T+PS    QAFALEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  164  SLCSSFALKWIFDPIMGGGATIPSCGYAQAFALEFIISFNLMFVLTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLN+L+AG ++G SMNPVRTLGPA+A  N+K+IWIYL AP LG + GA IYT 
Sbjct  224  IAVGATVMLNVLIAGQTTGASMNPVRTLGPAIAVNNFKAIWIYLTAPILGTLCGAGIYTA  283

Query  417  VKLREEVEPTSRPR---SFRR  364
            VKL ++   +  P    SFRR
Sbjct  284  VKLPDKDGDSRLPSTAASFRR  304



>ref|XP_004152170.1| PREDICTED: aquaporin NIP6-1-like [Cucumis sativus]
 gb|KGN52947.1| hypothetical protein Csa_4G007030 [Cucumis sativus]
Length=304

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 161/201 (80%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+ FPW  VP YI AQ+ A
Sbjct  104  GTETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKQFPWKHVPLYIGAQMVA  163

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+C+SFALK  F P + GG T+PS    QAFALEF+I+FNL+FV+TAVATDTRAVGELAG
Sbjct  164  SLCSSFALKWTFDPIMGGGATIPSCGYAQAFALEFIISFNLMFVLTAVATDTRAVGELAG  223

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATVMLN+L+AG ++G SMNPVRTLGPA+A  N+K+IWIYL AP LG + GA IYT 
Sbjct  224  IAVGATVMLNVLIAGQTTGASMNPVRTLGPAIAVNNFKAIWIYLTAPILGTLCGAGIYTA  283

Query  417  VKLREEVEPTSRPR---SFRR  364
            VKL ++   +  P    SFRR
Sbjct  284  VKLPDKDGDSRLPSTAASFRR  304



>ref|XP_010106789.1| Aquaporin NIP6-1 [Morus notabilis]
 gb|EXC11817.1| Aquaporin NIP6-1 [Morus notabilis]
Length=310

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 159/193 (82%), Gaps = 7/193 (4%)
 Frame = -3

Query  933  AACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFAL  754
            A   GL VMIII STGHISGAHLNP++TIAFAAL+HFPW  VP YI AQVSAS+CASFAL
Sbjct  120  AVATGLIVMIIIFSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVSASLCASFAL  179

Query  753  KGVFHPFL-SGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATV  577
            KGVFHP   SGGVTVPSV+ GQAFALEF++TF L+FV TAVATDTRAVGELAGIAVGATV
Sbjct  180  KGVFHPVTGSGGVTVPSVAYGQAFALEFIVTFVLMFVTTAVATDTRAVGELAGIAVGATV  239

Query  576  MLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREEV  397
            MLN  VAG  +G SMNPVRTLGPAVAA ++K+IWIYL AP LGA+ GAA YTVVKL EE 
Sbjct  240  MLNNFVAG--TGASMNPVRTLGPAVAANSFKAIWIYLTAPILGALCGAAAYTVVKLPEED  297

Query  396  ----EPTSRPRSF  370
                +  SR RSF
Sbjct  298  GDNEDKPSRTRSF  310



>ref|XP_010092185.1| Aquaporin NIP6-1 [Morus notabilis]
 gb|EXB50411.1| Aquaporin NIP6-1 [Morus notabilis]
Length=317

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 157/198 (79%), Gaps = 10/198 (5%)
 Frame = -3

Query  933  AACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFAL  754
            A   GL VMIII STGHISGAHLNP++TIAFAAL+HFPW  VP YI AQVSAS+CASFAL
Sbjct  120  AVATGLVVMIIIFSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVSASLCASFAL  179

Query  753  KGVFHPFL-SGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATV  577
            KGVFHP   SGGVTVPSV+ GQAFALEF++TF L+FV TAVATDTRAVGELAGI VGATV
Sbjct  180  KGVFHPVTGSGGVTVPSVAYGQAFALEFIVTFVLMFVTTAVATDTRAVGELAGIVVGATV  239

Query  576  MLNILVAG-----PSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK  412
            MLN  VAG       +G SMNPVRTLGPAVAA N+K+IWIYL AP LGA+ GAA YT VK
Sbjct  240  MLNNFVAGLIANEERTGASMNPVRTLGPAVAANNFKAIWIYLTAPILGALCGAAAYTAVK  299

Query  411  LREE----VEPTSRPRSF  370
            L EE     +  SR RSF
Sbjct  300  LPEEDGDNEDKPSRTRSF  317



>tpg|DAA33875.1| TPA_inf: aquaporin NIP6;1 [Gossypium hirsutum]
Length=280

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFP   VP YI AQV A
Sbjct  102  GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPRKHVPVYIGAQVMA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LKGVFHP + GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  162  SLCAAFGLKGVFHPMMGGGVTVPSGGFGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  221

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYT  421
            IAVGATVMLNIL+AGP +G SMNPVRTLGPA+AA NYK+IW+Y  AP LG+  G   YT
Sbjct  222  IAVGATVMLNILIAGPITGASMNPVRTLGPAIAANNYKAIWVYFTAPILGSPCGCRTYT  280



>ref|XP_002272988.1| PREDICTED: aquaporin NIP6-1 [Vitis vinifera]
 emb|CBI38932.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVM+IILSTGHISGAHLNP++TIAFAALRHFPW  VP YI +Q+  
Sbjct  107  GSETLLGLAASTGLAVMVIILSTGHISGAHLNPAVTIAFAALRHFPWKHVPVYIGSQLMG  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVS--TGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            S+CA+FALKG+F+P + GGVTVPS S   GQAFALEF+I+F L+FVVTAVATDTRAVG L
Sbjct  167  SLCAAFALKGIFNPVMDGGVTVPSHSGAYGQAFALEFIISFFLMFVVTAVATDTRAVGSL  226

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIAVG TVMLNIL+AG ++G SMNPVRTLGPA+A  N+K+IW+YL AP LGA+ GA +Y
Sbjct  227  AGIAVGGTVMLNILIAGETTGASMNPVRTLGPAIAVNNFKAIWVYLTAPILGALCGAGVY  286

Query  423  TVVKLREE  400
            T VKL EE
Sbjct  287  TAVKLPEE  294



>ref|XP_009373677.1| PREDICTED: probable aquaporin NIP5-1 isoform X2 [Pyrus x bretschneideri]
Length=270

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 156/200 (78%), Gaps = 30/200 (15%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESLIGNAACAGL VMI+ILSTGHIS                            AQVS 
Sbjct  99   GAESLIGNAACAGLGVMIVILSTGHIS----------------------------AQVSG  130

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LKGVFHP++SGGVT+P+VSTGQAF LEF+ITFNLLFVVTAVATDTRA+GELAG
Sbjct  131  SICASFTLKGVFHPYMSGGVTLPTVSTGQAFGLEFIITFNLLFVVTAVATDTRALGELAG  190

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGA VMLNIL+AGPSSGGSMNPVRTLGPAVAAGNY  +WIYLVAPTLGA+AGA  YT 
Sbjct  191  LAVGACVMLNILMAGPSSGGSMNPVRTLGPAVAAGNYTKLWIYLVAPTLGALAGAGTYTA  250

Query  417  VKLRE-EVE-PTSRPRSFRR  364
            VKLRE EV+ P    RSFRR
Sbjct  251  VKLREDEVDAPVRMARSFRR  270



>ref|XP_008810761.1| PREDICTED: aquaporin NIP6-1-like [Phoenix dactylifera]
Length=286

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L+G AAC+G+A MIIILSTGHISGAHLNPS+TIAFA  +HF W +V  YIAAQ+SA
Sbjct  90   GAVTLLGLAACSGIAAMIIILSTGHISGAHLNPSVTIAFATFKHFSWEKVLVYIAAQMSA  149

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LK +FHP L  GVTVPS + G AF +EF+I FNL+FV TAVATD RAVGELAG
Sbjct  150  SLCAAFTLKAIFHPGLGEGVTVPSGTAGAAFLMEFIIGFNLMFVTTAVATDVRAVGELAG  209

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV +N L+AG  SG SMNP RTLGPA+AA +YK+IW+Y  AP LG + GA  Y+ 
Sbjct  210  IAVGATVTMNSLIAGRISGASMNPARTLGPAMAANDYKAIWVYFTAPILGTLTGAGAYSA  269

Query  417  VKLREEVEPTSRPRSFRR  364
            VKLR++ + T   RSFRR
Sbjct  270  VKLRDD-DATPTMRSFRR  286



>ref|XP_010912163.1| PREDICTED: aquaporin NIP6-1-like [Elaeis guineensis]
Length=285

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L+G AAC+G+A MIIILSTGHISGAHLNPS+TIAFA  +HF W +V  YIAAQ+SA
Sbjct  89   GAVTLLGLAACSGIAAMIIILSTGHISGAHLNPSVTIAFATFKHFSWEKVLVYIAAQLSA  148

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK +F+P L  GVTVPS S G AF +EF+I FNL+FV TAVATD RAVGELAG
Sbjct  149  SLCAAFALKAIFYPILGEGVTVPSGSAGAAFVMEFIIGFNLMFVTTAVATDVRAVGELAG  208

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            I VGATV +N ++AG  SG SMNP RTLGPAVAA NYK+IW+Y  AP LG + GA  YT 
Sbjct  209  ITVGATVAMNNIIAGRISGASMNPARTLGPAVAANNYKAIWVYFTAPILGTLTGAGAYTA  268

Query  417  VKLREEVEPTSRPRSFRR  364
            VKL E+ + T   RSFRR
Sbjct  269  VKLTED-DGTPTMRSFRR  285



>ref|XP_009385167.1| PREDICTED: probable aquaporin NIP5-1 [Musa acuminata subsp. malaccensis]
Length=273

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L+G A  AGLAV ++I S GHISGAHLNPS+TIAFAA RHFPW  VP Y+ AQV  
Sbjct  81   GAATLLGAATSAGLAVCVVIFSIGHISGAHLNPSVTIAFAAARHFPWKHVPGYVLAQVLG  140

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S  ASFALK +FHPF SGGVTVP++ST QAF LEF+ITF L+FV+ AVATDTRA  ELAG
Sbjct  141  STAASFALKAIFHPFHSGGVTVPTLSTAQAFFLEFVITFTLMFVIVAVATDTRAARELAG  200

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+GATV+LNILVAGPS+GGSMNPVRTLGPA+A GNY+ IWIY++AP  GAIAGA  YT 
Sbjct  201  VAIGATVLLNILVAGPSTGGSMNPVRTLGPAIATGNYEEIWIYMIAPVAGAIAGAYAYTA  260

Query  417  VKLREEVEPTSRP  379
            VKL  E +  S+P
Sbjct  261  VKLGAEDQEESQP  273



>ref|XP_006606911.1| PREDICTED: probable aquaporin NIP5-1-like [Glycine max]
Length=263

 Score =   237 bits (605),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 146/199 (73%), Gaps = 37/199 (19%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPWA VPAYIAAQVSA
Sbjct  101  GVETLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSA  160

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKG +                  +A++                    VGELAG
Sbjct  161  SICACYALKGNW----------------WCYAVQ--------------------VGELAG  184

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV+LNIL++GP+SGGSMNPVRTLGPAVAAGNYK IWIYLVAPTLGA+AGA +YT+
Sbjct  185  IAVGATVLLNILISGPTSGGSMNPVRTLGPAVAAGNYKHIWIYLVAPTLGALAGAGVYTL  244

Query  417  VKLRE-EVEPTSRPRSFRR  364
            VKLR+ E EP  + RSFRR
Sbjct  245  VKLRDNEAEPPRQVRSFRR  263



>ref|XP_010677474.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=266

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 161/202 (80%), Gaps = 4/202 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAESL+GNAAC+GLA +I ILS GHISGAH+NP++T+AFAA +HFPW QVP YI AQV  
Sbjct  65   GAESLLGNAACSGLAAIIAILSLGHISGAHINPAVTLAFAAFKHFPWIQVPVYIFAQVCG  124

Query  777  SICASFALKGVFHPFLSGGVTVPS--VSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
             I A F LK  +HPF+SGG TVPS   S GQAF LE + TF L+FV+TAVATDTRAVGEL
Sbjct  125  GISAGFLLKLAYHPFMSGGGTVPSPTASFGQAFLLEIVATFFLMFVITAVATDTRAVGEL  184

Query  603  AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIY  424
            AGIA+G T++L+IL+ GPS+GGSMNP RTLGPA+AAG Y  IWIY++AP +GAI GA IY
Sbjct  185  AGIAIGTTILLDILLIGPSTGGSMNPARTLGPALAAGRYHGIWIYMLAPPIGAILGAGIY  244

Query  423  TVVKLREEVEPTS--RPRSFRR  364
            +V+KL+++    S  R +SF R
Sbjct  245  SVLKLKDDTTEGSPQRAKSFSR  266



>ref|XP_008811734.1| PREDICTED: aquaporin NIP6-1-like isoform X1 [Phoenix dactylifera]
Length=289

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 159/199 (80%), Gaps = 2/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L G AA +GLA MI+ILSTGHISGAHLNPS+TIAFA  +HF W QV  YIAAQ+SA
Sbjct  92   GAVTLFGIAAASGLAAMIVILSTGHISGAHLNPSVTIAFATFKHFSWEQVLVYIAAQLSA  151

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LK +F+P L  GVT+PS S G AF +EF+I FNL+FV TAVATDTRAVGELAG
Sbjct  152  SLCAAFTLKAIFYPILGEGVTMPSGSVGAAFVMEFIIGFNLMFVTTAVATDTRAVGELAG  211

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV++N L+AG  SG SMNP RTLGPAVAA NYK+IW+Y  AP LGA+ GA  Y+ 
Sbjct  212  IAVGATVIMNSLIAGRISGASMNPARTLGPAVAANNYKAIWVYFTAPILGALTGAGAYSA  271

Query  417  VKL-REEVEPTSRPRSFRR  364
            VKL +++  PT++  SFRR
Sbjct  272  VKLPKDDGTPTAQ-ISFRR  289



>ref|XP_010927947.1| PREDICTED: aquaporin NIP6-1-like [Elaeis guineensis]
Length=288

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 156/199 (78%), Gaps = 3/199 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L G AA +GLA M++ILSTGHISGAHLNPS+TIAFA  +HF W QV  YIAAQ+SA
Sbjct  92   GAVTLFGVAAASGLAAMLVILSTGHISGAHLNPSVTIAFATFKHFSWEQVLVYIAAQMSA  151

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LK +F+P L  G TVPS S   AF +EF+I FNL+FV TAVATD+RAVGELAG
Sbjct  152  SLCAAFTLKAIFYPVLGEGATVPSGSVSAAFVMEFIIGFNLMFVTTAVATDSRAVGELAG  211

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV +N L+AG  SG SMNP RTLGPAVAA NYK+IW+Y  AP LGA+ GA  Y+ 
Sbjct  212  IAVGATVAMNNLIAGRISGASMNPARTLGPAVAANNYKAIWVYFTAPILGALIGAGAYSA  271

Query  417  VKL-REEVEPTSRPRSFRR  364
            VKL +++  PT+  RSFRR
Sbjct  272  VKLPKDDGTPTA--RSFRR  288



>ref|XP_010677699.1| PREDICTED: probable aquaporin NIP5-1 [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ++L+G+AAC+G+AVMII+ S GHIS AHLNP++TIA+AAL HFPWAQVP ++ A++  
Sbjct  141  GIQTLLGSAACSGVAVMIIVYSIGHISKAHLNPAVTIAYAALGHFPWAQVPIFLVAEIVG  200

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF +K  +HPF+ GGVT+PSVS GQAF LEF+ TF L+FV+  VATD  AVG LAG
Sbjct  201  SISASFLVKAAYHPFMFGGVTIPSVSVGQAFLLEFVATFFLMFVIIPVATDATAVGNLAG  260

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +A+G  VML+IL+ GP++G SMNP RTLGPA+  G Y  IWIYL+AP +GA++G A+Y +
Sbjct  261  VAIGGVVMLDILIIGPATGASMNPARTLGPAIVTGRYTGIWIYLLAPPMGAVSGGAVYAL  320

Query  417  VKLREE  400
            +KL +E
Sbjct  321  IKLPKE  326



>gb|KHN04168.1| Aquaporin NIP6-1 [Glycine soja]
Length=217

 Score =   218 bits (554),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 145/194 (75%), Gaps = 11/194 (6%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S++G A  +G+ VMIII S GHISGAHLNP++TI+FA + H PW  VP YI AQV AS+ 
Sbjct  17   SVVGCAVISGVTVMIIICSIGHISGAHLNPAVTISFAVIEHMPWKNVPVYIGAQVLASVS  76

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGE------  607
            A+FALK +FHPF+SGGVTVPSV  GQAFA EF+++F L+FVVTAVA  TR V E      
Sbjct  77   AAFALKLIFHPFMSGGVTVPSVGYGQAFAAEFMVSFTLMFVVTAVADGTRVVREFPGIIM  136

Query  606  -----LAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAI  442
                  AGI VGATVM+NIL+AG ++G SMNP RTLGPA+AA NYK IWIYL AP LG++
Sbjct  137  VQVRLFAGIVVGATVMINILMAGAATGSSMNPARTLGPAIAAHNYKGIWIYLTAPILGSL  196

Query  441  AGAAIYTVVKLREE  400
             GA  YTV+KL + 
Sbjct  197  CGAGAYTVLKLPDR  210



>gb|KHN01295.1| Aquaporin NIP6-1 [Glycine soja]
Length=208

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+++G A   G+ +MIII S G+ISGAHLNP++TI+FAA++H PW  VP YI AQV A
Sbjct  16   GQETMMGCAEITGVVMMIIIYSIGNISGAHLNPAVTISFAAIKHIPWKNVPLYIGAQVLA  75

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ A+FALK +FHP++SGGVTVPSV  G+AFA EF ++F L+FVVTAVA  TRAV   AG
Sbjct  76   SVSAAFALKALFHPYMSGGVTVPSVGYGKAFAAEFSVSFTLMFVVTAVANGTRAVRLFAG  135

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            I VGATVM+NI +AG ++G SMNP RTLGPA+AA NYK IWIYL AP LG++ GA  YTV
Sbjct  136  IVVGATVMINIHMAGAATGSSMNPARTLGPAIAAHNYKGIWIYLTAPILGSLCGAGAYTV  195

Query  417  VKLREE  400
            +KL + 
Sbjct  196  LKLPDR  201



>ref|XP_002976312.1| hypothetical protein SELMODRAFT_105221, partial [Selaginella 
moellendorffii]
 ref|XP_002979695.1| hypothetical protein SELMODRAFT_111610, partial [Selaginella 
moellendorffii]
 gb|EFJ19097.1| hypothetical protein SELMODRAFT_111610, partial [Selaginella 
moellendorffii]
 gb|EFJ22572.1| hypothetical protein SELMODRAFT_105221, partial [Selaginella 
moellendorffii]
Length=221

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 152/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA  + G A  AG+ VM++I +TGHISGAH+NP++T+AFA  RHFPW QVP YIAAQV+A
Sbjct  28   GALGVHGLAGGAGITVMVVIFATGHISGAHINPAVTVAFATYRHFPWFQVPLYIAAQVTA  87

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF LKG++HP L+GGVTVP+ +  Q+F  E ++T  ++FVVT+VATDTRAVGELAG
Sbjct  88   SISASFLLKGIYHPDLAGGVTVPAGTHWQSFLFEIILTAIMMFVVTSVATDTRAVGELAG  147

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV LN L+AG  SG SMNP R+LGPA+AA N+K  WIY++ P +G   GAA YT 
Sbjct  148  IAVGATVFLNNLIAGLISGASMNPCRSLGPAIAANNFKGFWIYVIGPLIGTQLGAAAYTA  207

Query  417  VKLREEVEPTSRPRSFRR  364
            ++ +E      RP+SFRR
Sbjct  208  IRFKE----LERPKSFRR  221



>ref|NP_001065048.2| Os10g0513200 [Oryza sativa Japonica Group]
 dbj|BAF26962.2| Os10g0513200, partial [Oryza sativa Japonica Group]
Length=152

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 3/152 (2%)
 Frame = -3

Query  810  VPAYIAAQVSASICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvta  637
            VPAY+A QV  SICA FALKGVFHPFLSGGVTVP  ++ST QAF  EF+ITFNLLFVVTA
Sbjct  1    VPAYVAVQVLGSICAGFALKGVFHPFLSGGVTVPDPTISTAQAFFTEFIITFNLLFVVTA  60

Query  636  vatdtraVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAP  457
            VATDTRAVGELAGIAVGA V LNIL+AGP++GGSMNPVRTLGPAVAAGNY+ +WIYL+AP
Sbjct  61   VATDTRAVGELAGIAVGAAVTLNILIAGPTTGGSMNPVRTLGPAVAAGNYRQLWIYLIAP  120

Query  456  TLGAIAGAAIYTVVKLREEVEPTSRP-RSFRR  364
            TLGA+AGA +YT VKLR+E   T RP RSFRR
Sbjct  121  TLGAVAGAGVYTAVKLRDENGETPRPQRSFRR  152



>ref|XP_004514574.1| PREDICTED: aquaporin NIP6-1-like, partial [Cicer arietinum]
Length=240

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 3/189 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
             +E+LIG A  +GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YI AQ+ A
Sbjct  49   NSETLIGCAGASGLAVMIIILSTGHISGAHLNPAITISFAALKHFPWKNVPVYIGAQILA  108

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGEL--  604
            SICA+F+LK +FHPF++GGVTVPSV+ G+AFAL+F+I FNL+FVVT VATDTRA+  +  
Sbjct  109  SICAAFSLKVIFHPFMNGGVTVPSVAIGEAFALKFIIGFNLMFVVTDVATDTRAMDNVIS  168

Query  603  -AGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAI  427
             A   + A V     +  P++GGSMN VR LGP +AA N++ IW YL+AP LGA+ G   
Sbjct  169  QAQATLRAPVFQRSNIQWPATGGSMNLVRALGPTIAANNFRDIWFYLIAPILGALIGEGA  228

Query  426  YTVVKLREE  400
            YT VKL +E
Sbjct  229  YTAVKLPDE  237



>ref|XP_008381109.1| PREDICTED: aquaporin NIP6-1-like, partial [Malus domestica]
Length=226

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 149/207 (72%), Gaps = 9/207 (4%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ESL+  AA  GLAVMI+ILST HISGAHLNPS T AF AL+HF    VP Y+ AQV A
Sbjct  20   GSESLLDLAASTGLAVMIVILSTCHISGAHLNPSATTAFVALKHFSRKHVPVYVGAQVVA  79

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQ-AFALEFLITFNLLFvvtavatdtraVGELA  601
            S+CA+FALK +FHP + GGVTV S +       ++F+I FNL FVVT VATDTRAVGELA
Sbjct  80   SVCAAFALKVIFHPIMGGGVTVLSGNWCHPIIGVKFIINFNLTFVVTVVATDTRAVGELA  139

Query  600  GIAVGATVMLNILVAGPSSGGSMNPVRTLGP------AVAAGNYKSIWIYLVAPTLGAIA  439
            GIAVGATVM NIL AG + G S NPVRTLGP      A+ A NYK+IW+YL+AP L A +
Sbjct  140  GIAVGATVMHNILTAGETKGASTNPVRTLGPFGTLGLAIGANNYKAIWVYLIAPFLAAPS  199

Query  438  GAAIYTVVKLREEVE--PTSRPRSFRR  364
            GA   T VKL E+ +    S PRSFRR
Sbjct  200  GAGTSTAVKLPEDGDNIEKSSPRSFRR  226



>emb|CCI55658.1| EaNIP3,1 [Equisetum arvense]
Length=248

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 0/185 (0%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +GLAVM+IIL+TGHISGAHLNP++T+AFA    FPW QVP YI AQ+SASIC+S
Sbjct  64   FGLAAASGLAVMMIILTTGHISGAHLNPAVTLAFAITGFFPWFQVPLYIVAQLSASICSS  123

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P++SGGVTVPS S  QAF  EF++T  L FV TA+ TD RAVG+L G+AVGA
Sbjct  124  FTLKALFYPYMSGGVTVPSGSHFQAFVTEFVLTIILHFVNTAMGTDKRAVGQLGGLAVGA  183

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV GP+SG SMNP RTLGPA+AA NY  IW+Y + P  GA+ G   Y +V+L+ 
Sbjct  184  TVAMNTLVGGPTSGASMNPARTLGPAIAANNYTGIWVYFLGPIPGALLGGLAYCLVRLKL  243

Query  402  EVEPT  388
            E E T
Sbjct  244  EDEST  248



>gb|KEH43640.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=269

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G E+L+GNAACAGL VM IILS GHISGAHLNPSLTIAFAA RHFPWA VPAYIAAQVSA
Sbjct  102  GVETLMGNAACAGLTVMFIILSIGHISGAHLNPSLTIAFAAFRHFPWAHVPAYIAAQVSA  161

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICA +ALKGV+HPFLSGGVTVP+VS GQAFA EF+ITF LLFVVTAVATD+RAVGELAG
Sbjct  162  SICACYALKGVYHPFLSGGVTVPTVSVGQAFATEFIITFILLFVVTAVATDSRAVGELAG  221

Query  597  IAVGATVMLNILVAG  553
            IAVGATV+LNIL++G
Sbjct  222  IAVGATVLLNILISG  236



>emb|CCI55660.1| EaNIP3,3 [Equisetum arvense]
Length=259

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+   IG AA +G AVM+IIL+TGHISGAHLNP++T+AFA    FPW QVP YIAAQ+ A
Sbjct  56   GSLGAIGLAAASGFAVMMIILTTGHISGAHLNPAVTLAFATTGFFPWFQVPFYIAAQLIA  115

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S C+SF LK +FHP LSGGVTVPS +  QA   EF++T  L FV TA+ TD RAVG+L G
Sbjct  116  STCSSFCLKAIFHPSLSGGVTVPSGNIVQALLTEFVLTAILHFVNTAMGTDKRAVGQLGG  175

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATV +N LV GP++G SMNP R+LGPA+AA N+  IWIY V P  GA+ G   Y +
Sbjct  176  LAVGATVAMNTLVGGPTTGASMNPARSLGPAIAANNFSGIWIYFVGPIPGALLGGLAYCL  235

Query  417  VKLREEVEPTSRPRS---FRR  364
            +++REE      P S   FRR
Sbjct  236  IRIREEEVSDGPPPSTTFFRR  256



>ref|XP_010112877.1| putative aquaporin NIP5-1 [Morus notabilis]
 gb|EXC35012.1| putative aquaporin NIP5-1 [Morus notabilis]
Length=196

 Score =   202 bits (514),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -3

Query  864  NPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVFHPFLSGGVTVPSVSTGQAF  685
            NP++T+AFA +RHFPWAQV  YIA QV AS+ ASF LK VF PF+SGGVTVP+VS GQAF
Sbjct  37   NPAVTVAFATVRHFPWAQVSPYIAIQVLASVSASFILKEVFDPFMSGGVTVPTVSHGQAF  96

Query  684  ALEFLITFNLLFvvtavatdtraVGELAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPA  505
            ALEF++TF L+ V  AV TDTRAVGELAGIAVG TV+LN LVAGP++G SM PVRTLGPA
Sbjct  97   ALEFIVTFILMLVNMAVVTDTRAVGELAGIAVGGTVLLNNLVAGPATGASMTPVRTLGPA  156

Query  504  VAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREEVEPTSR  382
            VAAGNYK + IY VAP LGA+AGAA YT +KL +  +PT++
Sbjct  157  VAAGNYKGMRIYTVAPLLGALAGAATYTAMKLLD--KPTNQ  195



>ref|XP_008811735.1| PREDICTED: aquaporin NIP6-1-like isoform X2 [Phoenix dactylifera]
Length=261

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 135/199 (68%), Gaps = 30/199 (15%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA +L G AA +GLA MI+ILSTGHISGAHLNPS+TIAFA  +HF W QV  YIAAQ+SA
Sbjct  92   GAVTLFGIAAASGLAAMIVILSTGHISGAHLNPSVTIAFATFKHFSWEQVLVYIAAQLSA  151

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LK +F+P L  GVT+PS S                             GELAG
Sbjct  152  SLCAAFTLKAIFYPILGEGVTMPSGSV----------------------------GELAG  183

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            IAVGATV++N L+AG  SG SMNP RTLGPAVAA NYK+IW+Y  AP LGA+ GA  Y+ 
Sbjct  184  IAVGATVIMNSLIAGRISGASMNPARTLGPAVAANNYKAIWVYFTAPILGALTGAGAYSA  243

Query  417  VKL-REEVEPTSRPRSFRR  364
            VKL +++  PT++  SFRR
Sbjct  244  VKLPKDDGTPTAQ-ISFRR  261



>gb|ADE34295.1| aquaporin NIP6;6, partial [Gossypium hirsutum]
Length=234

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+LIG AA  GLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFP   VP YI AQV A
Sbjct  90   GSETLIGLAASTGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPRKHVPVYIGAQVMA  149

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+F LKGVFHP + GGVTVPS   GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  150  SLCAAFGLKGVFHPMMGGGVTVPSGGFGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  209

Query  597  IAVGATVMLNILVAGPSSGGSMNPV  523
            I VGATVMLNIL+AGP +G SMNPV
Sbjct  210  IVVGATVMLNILIAGPITGASMNPV  234



>emb|CAN83047.1| hypothetical protein VITISV_007005 [Vitis vinifera]
Length=329

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 151/222 (68%), Gaps = 24/222 (11%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+E+L+G AA  GLAVM+IILSTGHISGAHLNP++TIAFAALRHFPW  VP YI +Q+  
Sbjct  108  GSETLLGLAASTGLAVMVIILSTGHISGAHLNPAVTIAFAALRHFPWKHVPVYIGSQLMG  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVS--TGQAFALEFLITFNLLFvvtavatdt------  622
            S+CA+FALK +F+P + GGVTVPS S   GQAFALEF+I+F L+FVVTAVATDT      
Sbjct  168  SLCAAFALKXIFNPVMDGGVTVPSHSGAYGQAFALEFIISFFLMFVVTAVATDTRAFFIF  227

Query  621  -------raVGELAGIAVGATVMLNILV---AGPSSGGSMNPVRTLGPAVAAGNYKSIWI  472
                   +  G            L+  +    G ++G SMNPVRTLGPA+A  N+K+IW+
Sbjct  228  YLCWAKEKKKGRWDRWRASRWEALSCSIFSSPGETTGASMNPVRTLGPAIAVNNFKAIWV  287

Query  471  YLVAPTLGAIAGAAIYTVVKLREE------VEPTSRPRSFRR  364
            YL AP LGA+ GA +YT VKL EE      +  +   +SFRR
Sbjct  288  YLTAPILGALCGAGVYTAVKLPEEDGNTHSLNKSMTVQSFRR  329



>ref|XP_003604219.1| Nodulin-like intrinsic protein NIP1-1 [Medicago truncatula]
 gb|AES86416.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=263

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
             +E+LIG A   GLAVMIIILSTGHISGAHLNP++TI+FAAL+HFPW  VP YIAAQV A
Sbjct  103  NSETLIGCAGATGLAVMIIILSTGHISGAHLNPAVTISFAALKHFPWKNVPLYIAAQVLA  162

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SICASF LKGVFHPF+SGGVTVPSV  GQAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  163  SICASFTLKGVFHPFMSGGVTVPSVEYGQAFALEFIISFNLMFVVTAVATDTRAVGELAG  222

Query  597  IAVGATVMLNILVAG  553
            IAVGATVMLNIL+AG
Sbjct  223  IAVGATVMLNILIAG  237



>gb|ABK27103.1| unknown [Picea sitchensis]
Length=280

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ + +G +   GLAVMIII S GHISGAHLNP++T+AFAA+R FPW QVPAYI AQV A
Sbjct  72   GSITHLGVSIVWGLAVMIIIYSIGHISGAHLNPAVTLAFAAVRRFPWTQVPAYIGAQVFA  131

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            +ICA F L+ +F        TVPS S  Q+F LE  +TF L+FV++AVATDTRA+GELAG
Sbjct  132  AICAGFVLRLMFGDVAYIAATVPSGSDMQSFVLEIFVTFLLMFVISAVATDTRAIGELAG  191

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+ +N+ ++GP SG SMNP RT+G AVA   Y SIWIY+VAP LGAI GA  Y +
Sbjct  192  MAVGATITMNVAISGPISGASMNPARTIGSAVAGNKYTSIWIYMVAPVLGAIIGAMSYNM  251

Query  417  VKLREE-VEPTSRPRSFRR  364
            ++L ++ V   ++  SF +
Sbjct  252  IRLTDKPVRELTKSGSFLK  270



>ref|XP_002973287.1| hypothetical protein SELMODRAFT_99369 [Selaginella moellendorffii]
 gb|EFJ25661.1| hypothetical protein SELMODRAFT_99369 [Selaginella moellendorffii]
Length=260

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  S+   +A   LAV  II STGHI GAHLNPS+TI+FAAL  FPW QVP YI AQ+ A
Sbjct  62   GGLSVFALSATPALAVTTIIFSTGHICGAHLNPSVTISFAALGQFPWIQVPVYIVAQLLA  121

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ ASF LKGV++P ++ GVTVP  S  QAF LE +I+F L+FV TA+ATD  AVG++A 
Sbjct  122  SVLASFILKGVYYPDIAAGVTVPIGSDLQAFVLELVISFILMFVNTALATDRSAVGDMAA  181

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATV +N L A  ++G SMNP RT+GPA+AA  YKS+W+Y+VAPTLG + GAA YT+
Sbjct  182  VAVGATVFVNNLAASQATGASMNPARTIGPAIAANCYKSLWVYIVAPTLGCLLGAAGYTI  241

Query  417  VKLREEVEPTSRPRS  373
            V+     +P    R+
Sbjct  242  VRTTGASKPKKWGRN  256



>emb|CCI55659.1| EaNIP3,2 [Equisetum arvense]
Length=262

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 142/201 (71%), Gaps = 3/201 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+   IG A+ +G AVM+IIL+TGHISGAHLNP++T+AFA    FPW QVP YIA+Q+ A
Sbjct  59   GSLGAIGLASASGFAVMMIILTTGHISGAHLNPAVTLAFATTGFFPWFQVPFYIASQLLA  118

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S C+SF LK +F+P L GGVTVPS +  QA   E ++T  L FV TA+ TD RAVG+L  
Sbjct  119  STCSSFCLKAIFYPSLHGGVTVPSGNIVQALLTELVLTAILHFVNTAMGTDKRAVGQLGA  178

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATV +N LV GP++G SMNP R+LGPA+AA NY+ IWIY + P  GA+ G   Y +
Sbjct  179  LAVGATVAMNTLVGGPTTGASMNPARSLGPAIAANNYEGIWIYFLGPIPGALIGGLAYCL  238

Query  417  VKLREEVEPTSRPRS---FRR  364
            +++REE      P S   FRR
Sbjct  239  IRIREEEVGDGAPTSTSFFRR  259



>ref|XP_002976617.1| hypothetical protein SELMODRAFT_105574 [Selaginella moellendorffii]
 gb|EFJ22286.1| hypothetical protein SELMODRAFT_105574 [Selaginella moellendorffii]
Length=260

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  S+   +A   LAV  II STGHI GAHLNPS+TI+FAAL  FPW QVP YI AQ+ A
Sbjct  62   GGLSVFALSATPALAVTTIIFSTGHICGAHLNPSVTISFAALGQFPWIQVPVYIFAQLLA  121

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ ASF LKGV++P ++ GVTVP  S  QAF LE +I+F L+FV TA+ATD  AVG++A 
Sbjct  122  SVLASFILKGVYYPDIAAGVTVPIGSDLQAFVLELVISFILMFVNTALATDRSAVGDMAA  181

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATV +N L A  ++G SMNP RT+GPA+AA  YKS+W+Y+VAPTLG + GAA YT+
Sbjct  182  VAVGATVFVNNLAASQATGASMNPARTIGPAIAANCYKSLWVYIVAPTLGCLLGAAGYTI  241

Query  417  VKLREEVEPTSRPRS  373
            V+     +P    R+
Sbjct  242  VRTTGASKPKKWGRN  256



>emb|CCI55666.1| EaNIP3,9 [Equisetum arvense]
Length=260

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 6/199 (3%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPLYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LKG+F+P L GGVTVPS +  QAF  EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKGIFNPHLHGGVTVPSGTMLQAFVTEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y V P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFVGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEP------TSRPRSFRR  364
            E         T+ P+  RR
Sbjct  242  EEATFAPPGFTTFPKWLRR  260



>emb|CCI55662.1| EaNIP3,5 [Equisetum arvense]
Length=260

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPFYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P L GGVTVPS +  QAF  EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKAIFNPHLHGGVTVPSGTMLQAFVAEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y V P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFVGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEP------TSRPRSFRR  364
            E         T+ P+  RR
Sbjct  242  EEATFAPPGFTTFPKWLRR  260



>ref|XP_006659833.1| PREDICTED: aquaporin NIP3-3-like [Oryza brachyantha]
Length=263

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G AA AGLAV +++LS  HISG HLNP+++IA A   H P A +  YIAAQ+  
Sbjct  81   GVESLLGIAASAGLAVTVLVLSLVHISGCHLNPAISIAMAVFGHLPPAHLLPYIAAQILG  140

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+ ASFA+KG+FHP   G VTVP+V T +AF +EF+ITF LL ++TA+ATD  AV EL  
Sbjct  141  SVAASFAVKGLFHPLNPGVVTVPNVGTAEAFFIEFVITFTLLLIITALATDPNAVKELIA  200

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGATVM+NILVAGPS+G SMNP RT+G A+A G Y  IW+YLVA  LG I G   Y V
Sbjct  201  VAVGATVMMNILVAGPSTGASMNPARTIGAAIATGRYTQIWVYLVATPLGGIVGTGAYIV  260

Query  417  VKL  409
            +KL
Sbjct  261  MKL  263



>emb|CCI55664.1| EaNIP3,6 [Equisetum arvense]
Length=260

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPFYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P L GGVTVPS +  QAF  EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKAIFNPHLHGGVTVPSGTMLQAFVAEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y V P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFVGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEP------TSRPRSFRR  364
            E         T+ P+  RR
Sbjct  242  EEATFAPPGFTTFPKWLRR  260



>emb|CCI55663.1| EaNIP3,6 [Equisetum arvense]
Length=260

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPFYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P L GGVTVPS +  QAF  EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKAIFNPHLHGGVTVPSGTMLQAFVAEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y V P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFVGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEP------TSRPRSFRR  364
            E         T+ P+  RR
Sbjct  242  EEATFAPPGFTTFPKWLRR  260



>emb|CCI55665.1| EaNIP3,8 [Equisetum arvense]
Length=260

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPFYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P L GGVTVPS +  QAF  EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKAIFNPHLHGGVTVPSGTMLQAFVAEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y V P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFVGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEPTSRPRSF  370
            E E T  P  F
Sbjct  242  E-EATFAPPGF  251



>ref|XP_002862367.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38625.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=242

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GAE+LIG AA AGLAVMI+ILSTGHISGAHLNP++TIAFAAL+HFPW  VP YI AQV A
Sbjct  108  GAETLIGCAASAGLAVMIVILSTGHISGAHLNPAVTIAFAALKHFPWKHVPVYIGAQVMA  167

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            S+CA+FALK VF P +SGGVTVP+V   QAFALEF+I+FNL+FVVTAVATDTRAVGELAG
Sbjct  168  SVCAAFALKAVFEPTMSGGVTVPTVGLSQAFALEFIISFNLMFVVTAVATDTRAVGELAG  227

Query  597  IAVGATVMLNILVAG  553
            IAVGATVMLNIL+AG
Sbjct  228  IAVGATVMLNILIAG  242



>ref|XP_001767204.1| predicted protein [Physcomitrella patens]
 gb|EDQ67885.1| predicted protein [Physcomitrella patens]
Length=237

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 3/189 (2%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL V I+I + GH+SGAH+NP++T+AFA  +HF W+QVP YIAAQ S +  ASF L+ + 
Sbjct  49   GLVVTIMIYAVGHVSGAHMNPAVTLAFAVAKHFSWSQVPLYIAAQCSGAFTASFLLRWIL  108

Query  741  HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVMLNIL  562
            HP  S G T+P+ S  Q+F +E +ITF L+FV+ AVATDTRA GELAGIA+G+ V LN L
Sbjct  109  HPAASEGATLPAGSDFQSFLIEIVITFILMFVIAAVATDTRACGELAGIAIGSAVALNAL  168

Query  561  VAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL-REEVEPTS  385
            +AGP SG SMNP R+LGPA+A+GNY SIW+YLV P +G++ G   Y  ++L  ++++ T 
Sbjct  169  MAGPISGASMNPARSLGPAIASGNYSSIWVYLVGPIIGSVMGMLAYNCIRLPDKQMQCTC  228

Query  384  R--PRSFRR  364
               P+SF R
Sbjct  229  DKAPKSFHR  237



>ref|XP_008648254.1| PREDICTED: aquaporin NIP3-1 isoform X1 [Zea mays]
Length=257

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA S  GNAACAGLAV  +ILSTGHISGAHLNPSLTIAFAALRHFPW QVPAY+A Q  A
Sbjct  102  GAISPFGNAACAGLAVATVILSTGHISGAHLNPSLTIAFAALRHFPWLQVPAYVAVQALA  161

Query  777  SICASFALKGVFHPFLSGGVTVP--SVSTGQAFALEFLITFNLLFvvtavatdtraVGEL  604
            S+CA+FALKGVFHPFLSGGVTVP  +VST QAF  EF+I+FNLLFVVTAVATDTRAVGEL
Sbjct  162  SVCAAFALKGVFHPFLSGGVTVPDATVSTAQAFFTEFIISFNLLFVVTAVATDTRAVGEL  221

Query  603  AGIAVGATVMLNILVAG  553
            AGIAVGA V LNILVAG
Sbjct  222  AGIAVGAAVTLNILVAG  238



>ref|XP_001759426.1| predicted protein [Physcomitrella patens]
 gb|EDQ75728.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL + I+I + GHISGAH+NP++T+AFA  +HFPW QVP YI AQ   S+ ASF L+ + 
Sbjct  46   GLVITIMIYAVGHISGAHMNPAVTLAFAIAKHFPWTQVPMYIVAQCGGSVFASFLLRWIL  105

Query  741  HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVMLNIL  562
            HP  S G T+P+ S  Q+F LE +ITF L+FVV AVATDTRA GELAGIAVG+ V LN L
Sbjct  106  HPAASEGATIPAGSDIQSFLLEIVITFILMFVVAAVATDTRARGELAGIAVGSCVALNAL  165

Query  561  VAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREEVEPTSR  382
            +AGP SG SMNP R+LGPAVA+GNY+SIW+Y+  P +GA+ G   Y  ++L +      +
Sbjct  166  MAGPISGASMNPARSLGPAVASGNYRSIWVYIAGPIIGALVGILAYNCIRLPDTEAQCDK  225

Query  381  P  379
            P
Sbjct  226  P  226



>ref|XP_004234073.1| PREDICTED: aquaporin NIP1-1-like [Solanum lycopersicum]
Length=277

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 145/196 (74%), Gaps = 6/196 (3%)
 Frame = -3

Query  939  GNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASF  760
            G A   GL VM+++ S GHISGAH NPS+TIAFA+++ FPW QVPAY+AAQV  +  AS 
Sbjct  78   GVAITWGLVVMVMVYSVGHISGAHFNPSVTIAFASVKRFPWKQVPAYVAAQVLGATLASG  137

Query  759  ALKGVF---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
             L+ +F   H   +G  T+PS +  Q+F +EF+ITF L+FV++ VATD RA+GELAG+AV
Sbjct  138  TLRLIFNGKHDHFAG--TLPSGTDFQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAV  195

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            GAT++LN++  GP SG SMNP R+LGPA+ + +YK +WIYLV+PTLGAIAGA +Y +++ 
Sbjct  196  GATILLNVMFTGPISGASMNPARSLGPAIVSSHYKGLWIYLVSPTLGAIAGAWVYNIIRF  255

Query  408  REE-VEPTSRPRSFRR  364
             ++ +   ++  SF +
Sbjct  256  TDKPLREITKSGSFLK  271



>ref|XP_009403165.1| PREDICTED: aquaporin NIP2-1-like [Musa acuminata subsp. malaccensis]
Length=292

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  S +G +   GL V ++I + GHISGAH+NP++T AFA  RHFPW QVP Y+ AQ+S 
Sbjct  73   GVVSQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTFAFAVSRHFPWIQVPFYMCAQISG  132

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            ++ ASF L+ + HP  + G T PS +  +A  +E ++TF ++FV +AVATDT+AVGELAG
Sbjct  133  AMVASFVLRELLHPITNLGTTTPSDTAAKALVMETVVTFCMMFVTSAVATDTKAVGELAG  192

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVG++V +  ++AGP SGGSMNP RTLGPAVA+ NY+S+W+Y V P LG ++G+  Y+ 
Sbjct  193  LAVGSSVCITSILAGPVSGGSMNPARTLGPAVASRNYQSLWVYFVGPVLGTVSGSFSYSF  252

Query  417  VKLREEVEPTS  385
            +++ E+ + T+
Sbjct  253  IRMTEKQQHTT  263



>ref|XP_002966719.1| hypothetical protein SELMODRAFT_439677 [Selaginella moellendorffii]
 gb|EFJ32746.1| hypothetical protein SELMODRAFT_439677 [Selaginella moellendorffii]
Length=259

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA  + G A  + +AV I+I+STGHISGAH+NP++T+AFA  RHF W QVP YI AQ++ 
Sbjct  63   GALGIHGLAGGSAIAVAIVIMSTGHISGAHINPAVTLAFATFRHFSWIQVPLYIVAQLAG  122

Query  777  SICASFALKGVFHP-FLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELA  601
            S+  +F LKG+++P  L+ GVTVP+ ST Q+   E ++T  L+FV+T+VATDTRAVGELA
Sbjct  123  SLACAFLLKGMYNPDHLATGVTVPAGSTLQSLLFEIVLTAVLMFVITSVATDTRAVGELA  182

Query  600  GIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYT  421
            GIAVG  V L+IL+ G  SG SMNPVRTLGPAVAA +++++WIY V P +GA  G  +YT
Sbjct  183  GIAVGLAVYLDILLGGYVSGASMNPVRTLGPAVAARDFRALWIYFVGPVVGAQIGGGLYT  242

Query  420  VVKLREEVEPTSRPRSFRR  364
            +++ ++  E   R + FR+
Sbjct  243  LIRFKDHTE---RRKVFRK  258



>ref|XP_001754375.1| predicted protein [Physcomitrella patens]
 gb|EDQ80825.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 134/189 (71%), Gaps = 3/189 (2%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL V I+I + GHISGAH+NP++T+AFA  RHFPW QVP Y AAQ   SI ASF L+ + 
Sbjct  40   GLVVTIMIYAVGHISGAHMNPAVTLAFAVARHFPWTQVPLYAAAQCIGSITASFMLRWIL  99

Query  741  HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVMLNIL  562
            HP    G T+P+ S  Q+F LE +ITF L+FV+ AV+TDTRA GELAGIAVG+ V LN L
Sbjct  100  HPAAYEGATLPTGSDVQSFLLEIVITFILMFVIAAVSTDTRACGELAGIAVGSAVALNAL  159

Query  561  VAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREEVEP--T  388
            +AG  SG SMNP R+LGPA A+GNY S+W+Y+  PT+GA+ G   Y  ++L  +      
Sbjct  160  MAGSISGASMNPARSLGPATASGNYHSLWVYMAGPTIGALMGMLTYNCIRLPNQAMQCAC  219

Query  387  SRP-RSFRR  364
            ++P +SFRR
Sbjct  220  NKPAKSFRR  228



>sp|Q7EYH7.1|NIP32_ORYSJ RecName: Full=Aquaporin NIP3-2; AltName: Full=NOD26-like intrinsic 
protein 3-2; AltName: Full=OsNIP3;2 [Oryza sativa Japonica 
Group]
 dbj|BAC98554.1| putative nodulin [Oryza sativa Japonica Group]
 dbj|BAC99758.1| putative nodulin [Oryza sativa Japonica Group]
 gb|EEC82909.1| hypothetical protein OsI_27822 [Oryza sativa Indica Group]
 dbj|BAM09283.1| NOD26-like intrinsic protein [Oryza sativa Japonica Group]
Length=305

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G A  AGLAV +++LS  HISG HLNP+++IA     H P A +  YIAAQ+  
Sbjct  123  GVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPPAHLLPYIAAQILG  182

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFA+KG++HP   G VTVP V T +AF LEF+ TF LLF++TA+ATD  AV EL  
Sbjct  183  SITASFAVKGMYHPVNPGIVTVPKVGTVEAFFLEFVTTFVLLFIITALATDPNAVKELIA  242

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+M+N LVAGPS+G SMNP RTLGPA+A G Y  IW+YLVA  LGA+AG   Y  
Sbjct  243  VAVGATIMMNALVAGPSTGASMNPARTLGPAIATGRYTQIWVYLVATPLGAVAGEGFYFA  302

Query  417  VKL  409
            +KL
Sbjct  303  IKL  305



>ref|XP_006356091.1| PREDICTED: aquaporin NIP1-1-like [Solanum tuberosum]
Length=277

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 145/196 (74%), Gaps = 6/196 (3%)
 Frame = -3

Query  939  GNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASF  760
            G A   GL VM+++ S GHISGAH NP++TIAFA+++ FPW QVPAY+AAQV  +  AS 
Sbjct  78   GIAITWGLVVMVMVYSVGHISGAHFNPAVTIAFASVKRFPWKQVPAYVAAQVLGATLASG  137

Query  759  ALKGVF---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
             L+ +F   H   +G  T+PS +  Q+F +EF+ITF L+FV++ VATD RA+GELAG+AV
Sbjct  138  TLRLIFNGKHDHFAG--TLPSGTDFQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAV  195

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            GAT++LN++  GP SG SMNP R+LGPA+ + +YK +WIYLV+PTLGAIAGA +Y +++ 
Sbjct  196  GATILLNVMFTGPISGASMNPARSLGPAIVSSHYKGLWIYLVSPTLGAIAGAWVYNIIRF  255

Query  408  REE-VEPTSRPRSFRR  364
             ++ +   ++  SF +
Sbjct  256  TDKPLREITKSGSFLK  271



>ref|XP_002978023.1| hypothetical protein SELMODRAFT_176694 [Selaginella moellendorffii]
 gb|EFJ20680.1| hypothetical protein SELMODRAFT_176694 [Selaginella moellendorffii]
Length=259

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            GA  + G A  + +AV I+I+STGHISGAH+NP++T+AFA  RHF W QVP YI AQ++ 
Sbjct  63   GALGIHGLAGGSAIAVAIVIMSTGHISGAHINPAVTLAFATFRHFSWIQVPLYIVAQLAG  122

Query  777  SICASFALKGVFHP-FLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELA  601
            S+  +F LKG+++P  L+ GVTVP+ ST Q+   E ++T  L+FV+T+VATDTRAVGELA
Sbjct  123  SLACAFLLKGMYNPDHLATGVTVPAGSTLQSLLFEIVLTAVLMFVITSVATDTRAVGELA  182

Query  600  GIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYT  421
            GIAVG  V L+IL+ G  SG SMNPVRTLGPAVAA +++++WIY V P +GA  G  +YT
Sbjct  183  GIAVGLAVYLDILLGGYISGASMNPVRTLGPAVAARDFRALWIYFVGPVVGAQIGGGLYT  242

Query  420  VVKLREEVEPTSRPRSFRR  364
            +++ ++  E   R + FR+
Sbjct  243  LIRFKDHTE---RRKVFRK  258



>ref|XP_009590978.1| PREDICTED: aquaporin NIP1-1-like [Nicotiana tomentosiformis]
Length=275

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 145/196 (74%), Gaps = 6/196 (3%)
 Frame = -3

Query  939  GNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASF  760
            G A   GL VM++I S GHISGAH NPS+TIAFA ++ FPW QVPAY+AAQ+  +  AS 
Sbjct  76   GIAITWGLVVMVMIYSVGHISGAHFNPSVTIAFATVKRFPWKQVPAYVAAQILGATLASG  135

Query  759  ALKGVF---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
             L+ +F   H   +G  T+P+ +  Q+F +EF+ITF L+FV++ VATD RA+GELAG+AV
Sbjct  136  TLRLIFNGKHDHFAG--TLPTGTEFQSFVVEFIITFYLMFVISGVATDNRAIGELAGLAV  193

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            GAT++LN++ AGP SG SMNP R+LGPA+ + +Y+ +WIYLV+PTLGAIAGA +Y +++ 
Sbjct  194  GATILLNVMFAGPISGASMNPARSLGPAIVSTHYRGLWIYLVSPTLGAIAGAWVYNIIRF  253

Query  408  REE-VEPTSRPRSFRR  364
             ++ +   ++  SF +
Sbjct  254  TDKPLREITKSGSFLK  269



>gb|KHG08004.1| Aquaporin NIP2-1 [Gossypium arboreum]
Length=268

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GH+SGAH+NP++T+AFAA+RHFPW QVP Y AAQ++ +I 
Sbjct  62   SRLGASVAGGLIVTVMIYAVGHVSGAHMNPAVTLAFAAVRHFPWKQVPFYGAAQLTGAIS  121

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L+ + HP    G T PS S  QA  +E ++TF+++F+ +AVATDT+A+GELAGIAV
Sbjct  122  ASFTLRVLLHPIKHVGTTSPSGSDLQALIMEIVVTFSMMFITSAVATDTKAIGELAGIAV  181

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNP R++GPA+A+G YK IW+Y+V P  G + GA  Y ++++
Sbjct  182  GSAVCITSILAGPISGGSMNPARSIGPAIASGEYKGIWVYVVGPVTGTLMGAWSYNLIRM  241

Query  408  REE----VEPTSRPRSFRR  364
            R++    + P S     RR
Sbjct  242  RDKPHHAISPHSSSFKLRR  260



>ref|XP_009785425.1| PREDICTED: aquaporin NIP1-1-like [Nicotiana sylvestris]
Length=275

 Score =   188 bits (478),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 147/202 (73%), Gaps = 6/202 (3%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  +  G A   GL VM+++ S GHISGAH NPS+TIAFA ++ FPW QVPAY+AAQV  
Sbjct  70   GMVTFPGIAITWGLVVMVMVYSVGHISGAHFNPSVTIAFATVKRFPWKQVPAYVAAQVLG  129

Query  777  SICASFALKGVF---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGE  607
            +  AS  L+ +F   H   +G  T+P+ +  Q+F +EF+ITF L+FV++ VATD RA+GE
Sbjct  130  ATLASGTLRLIFNGKHDHFAG--TLPTGTEFQSFVVEFIITFYLMFVISGVATDNRAIGE  187

Query  606  LAGIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAI  427
            LAG+AVGAT++LN++ AGP SG SMNP R+LGPA+ + +Y+ +WIYLV+PTLGAIAGA +
Sbjct  188  LAGLAVGATILLNVMFAGPISGASMNPARSLGPAIVSTHYRGLWIYLVSPTLGAIAGAWV  247

Query  426  YTVVKLREE-VEPTSRPRSFRR  364
            Y +++  ++ +   ++  SF +
Sbjct  248  YNIIRFTDKPLREITKSGSFLK  269



>ref|XP_010939491.1| PREDICTED: aquaporin NIP2-1-like [Elaeis guineensis]
Length=291

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T++FA LRHFPW QVP Y +AQ+S ++ 
Sbjct  74   SQLGQSVAGGLIVTVMIYAVGHISGAHMNPAVTLSFAVLRHFPWIQVPFYWSAQISGAVI  133

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L+ + HP  + G T+PS +  QA  +E ++TF ++FV  AVATDT+AVGELAG+AV
Sbjct  134  ASFILRQLLHPITNLGTTIPSGTPLQALVMEIVVTFCMMFVTLAVATDTKAVGELAGLAV  193

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G++V +  ++AGP SGGSMNP RTLGPA+A+  Y S+W+Y + P +G +AG + YT ++L
Sbjct  194  GSSVCITSILAGPVSGGSMNPARTLGPAIASQRYDSLWVYFIGPVMGTLAGGSAYTFIRL  253

Query  408  REE  400
             E+
Sbjct  254  TEK  256



>ref|XP_010248404.1| PREDICTED: aquaporin NIP1-1-like [Nelumbo nucifera]
Length=287

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 139/194 (72%), Gaps = 10/194 (5%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL VM+++ S GHISGAH NP++TIAFA  R FPW QVPAYIAAQV  +  AS  L+ +F
Sbjct  92   GLVVMVMVYSVGHISGAHFNPAVTIAFATCRRFPWKQVPAYIAAQVLGATLASGTLRLLF  151

Query  741  ---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVML  571
               H   +G  T+P+ S  Q+  +EFLI+F L+FV++ VATD RAVGELAG+AVGAT++L
Sbjct  152  DGDHVHFAG--TMPTGSNFQSLVMEFLISFYLMFVISGVATDNRAVGELAGLAVGATILL  209

Query  570  NILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK-----LR  406
            N+L+AGP SG SMNP R+LGPA+    YK+IWIY+V P  GA++GA  Y +++     LR
Sbjct  210  NVLIAGPVSGASMNPARSLGPAIVTNRYKAIWIYMVGPICGAVSGAWAYNIIRFTNKPLR  269

Query  405  EEVEPTSRPRSFRR  364
            E  +  S  +SFRR
Sbjct  270  EITKSGSFLKSFRR  283



>ref|XP_008802606.1| PREDICTED: aquaporin NIP2-1-like [Phoenix dactylifera]
Length=290

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T+AFA LRHFPW QVP Y +AQ+S ++ 
Sbjct  74   SQLGQSMAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVLRHFPWIQVPFYWSAQISGALL  133

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L  + HP  + G T PS +  QA  +E ++TF ++FV  AVATDT+AVGELAG+AV
Sbjct  134  ASFILGQLLHPITNLGTTTPSGTPYQALVMEIVVTFCMMFVTLAVATDTKAVGELAGLAV  193

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G++V +  ++AGP SGGSMNP RTLGPA+A+ NY S+W+Y + P LG ++G + YT ++L
Sbjct  194  GSSVCITSILAGPVSGGSMNPARTLGPAIASKNYNSLWVYFLGPVLGTLSGGSAYTFIRL  253

Query  408  --REEVEPTSRPRSFR  367
              ++ +E + +  SF+
Sbjct  254  TDKQPLEGSQKLSSFK  269



>dbj|BAK09175.1| silicon transporter 1 [Cucurbita moschata]
Length=288

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 136/199 (68%), Gaps = 4/199 (2%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T AFAA RHFPW QVP Y AAQ+S + C
Sbjct  79   SQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTTAFAATRHFPWKQVPLYAAAQLSGATC  138

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ + HP    G T PS S  QA  +E ++TF+++FV  AVATDT+AVGELAG+AV
Sbjct  139  AAFTLRLLLHPIKHLGTTTPSGSDLQALVMEIVVTFSMMFVTCAVATDTKAVGELAGLAV  198

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNPVRTLGPA+A+ NYK +W+Y V P  G + GA  Y  ++ 
Sbjct  199  GSAVCITSILAGPVSGGSMNPVRTLGPAMASDNYKGLWVYFVGPVTGTLLGAWSYKFIRA  258

Query  408  REE----VEPTSRPRSFRR  364
             ++    + P S     RR
Sbjct  259  SDKPVHLISPHSFSLKLRR  277



>ref|XP_009381416.1| PREDICTED: aquaporin NIP2-1-like [Musa acuminata subsp. malaccensis]
Length=293

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 136/185 (74%), Gaps = 0/185 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G  S +G +   GL V ++I + GHISGAH+NP++T+AFA  RHFPW QVP Y+AAQ+S 
Sbjct  74   GLVSQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVARHFPWIQVPFYMAAQISG  133

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            ++ ASF L+ + HP    G T PS +  +A  +E ++TF ++FV +AVATDT+AVGELAG
Sbjct  134  AMIASFVLRELLHPITDLGTTAPSDTAVKALVMEIVVTFCMMFVTSAVATDTKAVGELAG  193

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVG++V +  ++AGP SGGSMNP RTLGPAVA+ NY S+W+Y + P LG ++GA  Y+ 
Sbjct  194  LAVGSSVCITSILAGPISGGSMNPARTLGPAVASSNYDSLWVYFLGPVLGTLSGACSYSF  253

Query  417  VKLRE  403
            +++ E
Sbjct  254  IRMTE  258



>emb|CAD67694.1| Nod26-like protein [Cucurbita pepo]
Length=288

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 136/199 (68%), Gaps = 4/199 (2%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T AFAA RHFPW QVP Y AAQ+S + C
Sbjct  79   SQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTTAFAATRHFPWKQVPLYAAAQLSGATC  138

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ + HP    G T PS S  QA  +E ++TF+++FV  AVATDT+AVGELAG+AV
Sbjct  139  AAFTLRLLLHPIKHLGTTTPSGSDLQALVMEIVVTFSMMFVTCAVATDTKAVGELAGLAV  198

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNPVRTLGPA+A+ NYK +W+Y V P  G + GA  Y  ++ 
Sbjct  199  GSAVCITSILAGPVSGGSMNPVRTLGPAMASDNYKGLWVYFVGPVTGTLLGAWSYKFIRA  258

Query  408  REE----VEPTSRPRSFRR  364
             ++    + P S     RR
Sbjct  259  SDKPVHLISPHSFSLKLRR  277



>emb|CCI55661.1| EaNIP3,4a [Equisetum arvense]
Length=260

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 137/199 (69%), Gaps = 6/199 (3%)
 Frame = -3

Query  942  IGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICAS  763
             G AA +G AVM+IIL+T HISGAHLNP++T AFAA   FPW QVP Y+ +QV ASI AS
Sbjct  62   FGLAAASGFAVMMIILTTSHISGAHLNPAVTFAFAATGFFPWFQVPFYMVSQVLASISAS  121

Query  762  FALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGA  583
            F LK +F+P L GGVTVPS +  QA   EF++T  L FV TA+ TDTR+  +L G+AVGA
Sbjct  122  FVLKAIFNPHLHGGVTVPSGTMLQALVAEFVLTTILHFVNTAMGTDTRSARQLGGLAVGA  181

Query  582  TVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLRE  403
            TV +N LV G +SG SMNPVR+LGPA+AA NYK +W+Y   P  GA+ G   Y +++L +
Sbjct  182  TVAMNTLVGGSTSGASMNPVRSLGPAIAANNYKGLWVYFAGPFPGALLGGVAYCLIRLTD  241

Query  402  EVEP------TSRPRSFRR  364
            +         T+ P+  RR
Sbjct  242  DEATFAPPGFTTFPKWLRR  260



>emb|CDO96878.1| unnamed protein product [Coffea canephora]
Length=284

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GLAVM+++ S GHISGAHLNP++TIAFA  + FPW QVPAYI+AQV  SI AS  L+ +F
Sbjct  89   GLAVMVVVYSVGHISGAHLNPAVTIAFATCKRFPWKQVPAYISAQVLGSILASGTLRLLF  148

Query  741  H---PFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVML  571
            +      SG  T+P+ S  Q+  LEF+ITF L+FV++ VATD RA+GELAG+AVGATV+L
Sbjct  149  NGHQDHFSG--TLPNGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATVLL  206

Query  570  NILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREE-VE  394
            N++ AGP SG SMNP R+LGPA+ +  YKS+W+Y++ PT GAI GA +Y +++  ++ + 
Sbjct  207  NVMFAGPISGASMNPARSLGPAIVSSKYKSLWVYILGPTAGAIGGAWVYNIIRFTDKPLR  266

Query  393  PTSRPRSFRR  364
              ++  SF +
Sbjct  267  EITKSGSFLK  276



>gb|ABF66147.1| putative NOD26-like membrane integral protein [Triticum aestivum]
Length=300

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 132/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I +TGHISGAH+NP++T++FA  RHFPW QVP Y AAQ + ++C
Sbjct  86   SQLGQSVVGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMC  145

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ V HP    G T P+     A  +E ++TFN++F+  AVATD+RAVGELAG+AV
Sbjct  146  AAFVLRAVLHPITVLGTTTPTGPHWHALVIEIIVTFNMMFITCAVATDSRAVGELAGLAV  205

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNP RTL PAVA+G Y  +WIY + P +G ++GA +YT ++ 
Sbjct  206  GSAVCITSIFAGPVSGGSMNPARTLAPAVASGVYTGLWIYFLGPVIGTLSGAWVYTYIRF  265

Query  408  REEVEPTSRPRS  373
             EE      P+ 
Sbjct  266  EEEPSVKDGPQK  277



>dbj|BAH84977.1| silicon transporter [Hordeum vulgare]
 dbj|BAI66442.1| nodulin-26 like intrinsic protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 132/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I +TGHISGAH+NP++T++FA  RHFPW QVP Y AAQ + ++C
Sbjct  86   SQLGQSVVGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMC  145

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ V HP    G T P+     A  +E ++TFN++F+  AVATD+RAVGELAG+AV
Sbjct  146  AAFVLRAVLHPITVLGTTTPTGPHWHALVIEIIVTFNMMFITCAVATDSRAVGELAGLAV  205

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNP RTL PAVA+G Y  +WIY + P +G ++GA +YT ++ 
Sbjct  206  GSAVCITSIFAGPVSGGSMNPARTLAPAVASGVYTGLWIYFLGPVIGTLSGAWVYTYIRF  265

Query  408  REEVEPTSRPRS  373
             EE      P+ 
Sbjct  266  EEEPSVKDGPQK  277



>ref|XP_011101921.1| PREDICTED: aquaporin NIP1-1-like [Sesamum indicum]
Length=282

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 140/190 (74%), Gaps = 6/190 (3%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL VM+++ S GHISGAH NP++TIAFA  + FPW QVPAYIAAQV A+  AS  L+ +F
Sbjct  87   GLVVMVMVYSVGHISGAHFNPAVTIAFATCKRFPWKQVPAYIAAQVLAATLASGTLRLLF  146

Query  741  ---HPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVML  571
               H   +G  T+P+ S  Q+  +EF+ITF L+FV++ VATD RA+GELAG+AVGAT++L
Sbjct  147  KGRHDHFAG--TLPTGSDVQSLVVEFIITFYLMFVISGVATDNRAIGELAGLAVGATILL  204

Query  570  NILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREE-VE  394
            N++ AGP SG SMNP R+LGPA+ + NY+ +WIY++ PT GAIAGA +Y +++  ++ + 
Sbjct  205  NVMFAGPISGASMNPARSLGPAIVSSNYRGLWIYMLGPTAGAIAGAWVYNIIRFTDKPLR  264

Query  393  PTSRPRSFRR  364
              ++  SF R
Sbjct  265  EITKSASFLR  274



>ref|XP_004974438.1| PREDICTED: aquaporin NIP3-2-like [Setaria italica]
Length=289

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G A  AGLAV +++LS  HISG HLNP+++IA     H P A +  Y+ AQ+  
Sbjct  107  GVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPLAHLLPYVTAQILG  166

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF++KG++HP   G  T+P + T +AF LEF+ TF LLF++TA+ATD  AV EL  
Sbjct  167  SIAASFSVKGIYHPVNPGIATIPKLGTTEAFFLEFITTFVLLFIITALATDPNAVKELIA  226

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+M+N LVAGPS+G SMNP RTLGPA+A G Y  IWIY+VA  LGA+AG   Y  
Sbjct  227  VAVGATIMMNALVAGPSTGASMNPARTLGPAIATGRYTQIWIYMVATPLGAVAGTGAYVA  286

Query  417  VKL  409
            +KL
Sbjct  287  IKL  289



>ref|XP_006659832.1| PREDICTED: aquaporin NIP3-2-like [Oryza brachyantha]
Length=299

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G A  AGLAV +++LS  HISG HLNP+++IA     H P A +  Y+AAQ+  
Sbjct  117  GVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPPAHLLPYMAAQILG  176

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFA+KG++HP   G VTVP V T +AF LEF+ TF LLF++TA+ATD  AV EL  
Sbjct  177  SIGASFAVKGLYHPVNPGIVTVPKVGTVEAFFLEFVTTFVLLFIITALATDPNAVKELIA  236

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+M+N LVAGPS+G SMNP RT+GPA+A G Y  IW+Y+VA  LGAIAG   Y  
Sbjct  237  VAVGATIMMNALVAGPSTGASMNPARTIGPAIATGRYTQIWVYMVATPLGAIAGEGFYFA  296

Query  417  VKL  409
            +KL
Sbjct  297  IKL  299



>ref|XP_008784026.1| PREDICTED: aquaporin NIP2-1-like [Phoenix dactylifera]
Length=290

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 136/192 (71%), Gaps = 0/192 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T+AFA LRHFPW QVP Y +AQ+S ++ 
Sbjct  74   SQLGQSVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAVLRHFPWIQVPFYWSAQISGAVI  133

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L+ + HP  + G T PS +  QA  +E ++TF ++FV  AVATDT+AVGELAG+AV
Sbjct  134  ASFILRQLLHPITNLGTTTPSGTPWQALVMEIVVTFCMMFVTLAVATDTKAVGELAGLAV  193

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G++V +  ++AGP SGGSMNP RTLGPA+A+  Y S+W+Y + P LG ++G + YT ++L
Sbjct  194  GSSVCITSILAGPVSGGSMNPARTLGPAIASKRYNSLWVYFLGPVLGTLSGGSAYTFIRL  253

Query  408  REEVEPTSRPRS  373
             +        RS
Sbjct  254  ADSKLQDGSQRS  265



>ref|XP_010258345.1| PREDICTED: aquaporin NIP2-1-like [Nelumbo nucifera]
Length=296

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 136/186 (73%), Gaps = 0/186 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I S GHISGAH+NP++T+AFAA+RHFPW QVP Y AAQ++ S+ 
Sbjct  78   SKLGASVAGGLIVTVMIYSVGHISGAHMNPAVTLAFAAVRHFPWKQVPFYAAAQLTGSLA  137

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L  + HP  + G T PS +  QA  +E ++TF+++FV +AVATDTRA+GELAGIAV
Sbjct  138  ASFTLHQLLHPMKNIGTTSPSGTDVQALVMEIVVTFSMMFVTSAVATDTRAIGELAGIAV  197

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNP RT+GPA+A+ +YK IW+Y+V P  G + GA  Y +++ 
Sbjct  198  GSAVCITSILAGPISGGSMNPARTIGPAIASDHYKGIWVYVVGPISGTLLGAWSYNLIRA  257

Query  408  REEVEP  391
             ++  P
Sbjct  258  TDDKPP  263



>sp|Q84S07.1|NIP33_ORYSJ RecName: Full=Aquaporin NIP3-3; AltName: Full=NOD26-like intrinsic 
protein 3-3; AltName: Full=OsNIP3;3 [Oryza sativa Japonica 
Group]
 dbj|BAC65382.1| putative nodulin [Oryza sativa Japonica Group]
 gb|EAZ41525.1| hypothetical protein OsJ_26049 [Oryza sativa Japonica Group]
 dbj|BAM09284.1| NOD26-like intrinsic protein [Oryza sativa Japonica Group]
Length=278

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -3

Query  951  ESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASI  772
            E+L+G A  AGLAV +++LS  HISG HLNP+++IA A   H P A +  YI++Q+  ++
Sbjct  98   ETLLGIATSAGLAVTVLVLSLIHISGCHLNPAISIAMAVFGHLPSAHLLPYISSQILGAV  157

Query  771  CASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIA  592
             ASFA+KG++HP   G VTVP+V T +AF +EF+ITF LLF++TA+ATD  AV EL  +A
Sbjct  158  AASFAVKGLYHPVNPGIVTVPNVGTVEAFFVEFIITFFLLFIITALATDPNAVKELIAVA  217

Query  591  VGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK  412
            VGATVM+NILVAGPS+G SMNP RT+G A+A G Y  IW+YLVA  LGAIAG   Y  +K
Sbjct  218  VGATVMMNILVAGPSTGASMNPARTIGAAIATGRYTQIWVYLVATPLGAIAGTGAYVAIK  277

Query  411  L  409
            L
Sbjct  278  L  278



>ref|XP_002443852.1| hypothetical protein SORBIDRAFT_07g003370 [Sorghum bicolor]
 gb|EES13347.1| hypothetical protein SORBIDRAFT_07g003370 [Sorghum bicolor]
Length=297

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 130/183 (71%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G A  AGLAV +++LS  HISG HLNP+++IA A   H P A +  Y+AAQ+  
Sbjct  115  GVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMAVFGHLPLAHILPYVAAQILG  174

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASF +KG++HP   G  T+P V T +AF LEF+ TF LLF++TA+ATD  AV EL  
Sbjct  175  SIAASFTVKGIYHPVNPGIATIPKVGTTEAFFLEFITTFVLLFIITALATDPHAVKELIA  234

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+M+N LVAGPS+  SMNP RTLGPA+A   Y  IWIY+VA  LGAIAG   Y  
Sbjct  235  VAVGATIMMNALVAGPSTEASMNPARTLGPAIATCRYTQIWIYMVATPLGAIAGTGAYVA  294

Query  417  VKL  409
            +KL
Sbjct  295  IKL  297



>ref|XP_008443411.1| PREDICTED: aquaporin NIP2-1-like [Cucumis melo]
Length=287

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 137/199 (69%), Gaps = 4/199 (2%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GH+SGAH+NP++T+AFAA RHFPW QVP Y AAQ+S + C
Sbjct  78   SQLGASVAGGLIVTVMIYAVGHVSGAHMNPAVTMAFAATRHFPWKQVPLYGAAQLSGATC  137

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ + HP    G T PS S  QA  +E ++TF+++FV  AVATDT+AVGELAG+AV
Sbjct  138  AAFTLRLLLHPIKHLGTTTPSGSDLQALVMEIVVTFSMMFVTLAVATDTKAVGELAGMAV  197

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNPVRTLGPA+A+ NYK +W+Y V P +G   GA  Y  ++ 
Sbjct  198  GSAVCITSILAGPVSGGSMNPVRTLGPALASDNYKGLWVYFVGPVVGTQLGAWSYKFIRA  257

Query  408  REE----VEPTSRPRSFRR  364
             ++    + P S     RR
Sbjct  258  SDKPVHLISPHSFSLKLRR  276



>ref|XP_010088003.1| Aquaporin NIP1-2 [Morus notabilis]
 gb|EXB31119.1| Aquaporin NIP1-2 [Morus notabilis]
Length=275

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 144/195 (74%), Gaps = 6/195 (3%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL VM++I S GHISGAH NP++TIAFA+ + FP+ QVPAYIAAQV  S  AS  L+ +F
Sbjct  82   GLVVMVMIYSVGHISGAHFNPAVTIAFASTKRFPYKQVPAYIAAQVLGSTLASGTLRLLF  141

Query  741  H---PFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVML  571
            +      +G  T+P+ S  Q+F +EF+ITF L+FVV+ VATD RA+GELAG+AVGATV+L
Sbjct  142  NGRDDHFTG--TLPAGSDIQSFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLL  199

Query  570  NILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREE-VE  394
            N++ AGP SG SMNP R+LGPAV   +YK +WIYLVAPTLGAIAGA +Y +++  ++ + 
Sbjct  200  NVMFAGPISGASMNPARSLGPAVVHSHYKGLWIYLVAPTLGAIAGAWVYNLIRFTDKPLR  259

Query  393  PTSRPRSFRR*IGAE  349
              ++  SF + IG  
Sbjct  260  EITKSGSFLKSIGVR  274



>gb|EAZ05605.1| hypothetical protein OsI_27823 [Oryza sativa Indica Group]
Length=278

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -3

Query  951  ESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASI  772
            E+L+G A  AGLAV +++LS  HISG HLNP+++IA A   H P A +  YI++Q+  ++
Sbjct  98   ETLLGIATSAGLAVTVLVLSLIHISGCHLNPAISIAMAVFGHLPPAHLLPYISSQILGAV  157

Query  771  CASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIA  592
             ASFA+KG++HP   G VTVP+V T +AF +EF+ITF LLF++TA+ATD  AV EL  +A
Sbjct  158  AASFAVKGLYHPVNPGIVTVPNVGTVEAFFVEFIITFFLLFIITALATDPNAVKELIAVA  217

Query  591  VGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK  412
            VGATVM+NILVAGPS+G SMNP RT+G A+A G Y  IW+YLVA  LGAIAG   Y  +K
Sbjct  218  VGATVMMNILVAGPSTGASMNPARTIGAAIATGRYTQIWVYLVATPLGAIAGTGAYVAIK  277

Query  411  L  409
            L
Sbjct  278  L  278



>ref|XP_010088157.1| Aquaporin NIP2-2 [Morus notabilis]
 gb|EXB31969.1| Aquaporin NIP2-2 [Morus notabilis]
Length=293

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 136/183 (74%), Gaps = 0/183 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T+AFAA+RHFPW QVP Y AAQ++ +I 
Sbjct  82   SQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFAAVRHFPWKQVPLYAAAQLTGAIS  141

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F L+ +  P    G T PS +  QA A+E ++TF ++FV +AVATDT+A+GELAGIAV
Sbjct  142  AAFTLREILDPIKRIGTTSPSGTDSQALAMEIVVTFTMMFVTSAVATDTKAIGELAGIAV  201

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G++V +  ++AGP SGGSMNP RT+GPA+A+  YK IW+Y+V P +G + G+  Y V+++
Sbjct  202  GSSVCITSILAGPVSGGSMNPARTIGPAIASKYYKGIWVYMVGPFIGTLLGSLTYKVIRV  261

Query  408  REE  400
             ++
Sbjct  262  SDK  264



>ref|XP_002438105.1| hypothetical protein SORBIDRAFT_10g008090 [Sorghum bicolor]
 gb|ABQ65687.1| NOD26-like major intrinsic protein [Sorghum bicolor]
 gb|EER89472.1| hypothetical protein SORBIDRAFT_10g008090 [Sorghum bicolor]
Length=295

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I +TGHISGAH+NP++T++FA  RHFPW QVP Y AAQ + ++C
Sbjct  82   SQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMC  141

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F LK V HP    G T PS     A  +E ++TFN++FV  AVATD+RAVGELAG+AV
Sbjct  142  AAFVLKAVLHPIAVIGTTTPSGPHWHALVIEIVVTFNMMFVTCAVATDSRAVGELAGLAV  201

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNP RTL PAVA+  +  +WIY + P +G ++GA +YT ++ 
Sbjct  202  GSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVIGTLSGAWVYTYIRF  261

Query  408  RE--EVEPTSRPRSFR  367
             E    + T R  SF+
Sbjct  262  EEAPAAKDTQRLSSFK  277



>ref|XP_010040111.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW45472.1| hypothetical protein EUGRSUZ_L00814 [Eucalyptus grandis]
Length=274

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            +L G +   GLAVM+++ S GHISGAH NP++TIAFA  + FPW QVP YI AQV  S  
Sbjct  70   TLPGISMVWGLAVMVLVYSVGHISGAHFNPAVTIAFATCKRFPWKQVPPYILAQVLGSTL  129

Query  768  ASFALKGVFHPFLSGGV-TVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIA  592
            A+  L+ +F   L+  + T P+ S GQAF  EF+ITF L+F+++ VATD RA+GELAG+A
Sbjct  130  ANGTLRLLFTGKLNHFLGTQPAGSDGQAFVFEFIITFYLMFIISGVATDNRAIGELAGLA  189

Query  591  VGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK  412
            VGATV+LN++ AGP +G SMNP R+LGPA+   +Y  +WIY+VAPT+GAIAGA IY +V+
Sbjct  190  VGATVLLNVMFAGPVTGASMNPARSLGPAIVFHHYDKLWIYIVAPTVGAIAGAWIYNLVR  249

Query  411  LREE-VEPTSRPRSFRR  364
              ++ +   ++  SF R
Sbjct  250  FTDKPIREITQSGSFLR  266



>ref|XP_007032542.1| NOD26-like intrinsic protein 4,2 [Theobroma cacao]
 gb|EOY03468.1| NOD26-like intrinsic protein 4,2 [Theobroma cacao]
Length=285

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 142/204 (70%), Gaps = 4/204 (2%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GH+SGAH+NP++T+AFAA+RHFPW QVP Y AAQ + SI 
Sbjct  70   SRLGASVAGGLIVTVMIYAVGHVSGAHMNPAVTVAFAAVRHFPWKQVPFYAAAQFTGSIS  129

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF L+ + HP    G T PS S  QA  +E ++TF+++FV +AVATDT+AVGELAG+AV
Sbjct  130  ASFTLRVLLHPIKLLGTTSPSGSDVQALVMEMVVTFSMMFVTSAVATDTKAVGELAGMAV  189

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNP RT+GPA+A+ +YK+IW+Y+V P  G + GA  Y+ ++ 
Sbjct  190  GSAVCITSILAGPISGGSMNPARTIGPALASAHYKAIWVYVVGPVTGTLMGAWSYSRIRA  249

Query  408  REE----VEPTSRPRSFRR*IGAE  349
             ++    + P S     RR  G +
Sbjct  250  TDKPGQAISPQSSSFKLRRMRGQD  273



>gb|EEE68055.1| hypothetical protein OsJ_26058 [Oryza sativa Japonica Group]
Length=305

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G ESL+G A  AGLAV +++LS  HISG HLNP+++IA     H P A +  YIAAQ+  
Sbjct  123  GVESLLGIATSAGLAVTVLVLSLIHISGCHLNPAVSIAMTVFGHLPPAHLLPYIAAQILG  182

Query  777  SICASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAG  598
            SI ASFA+KG++HP   G VTVP V T +AF LEF+ TF LLF++TA+ATD  AV EL  
Sbjct  183  SITASFAVKGMYHPVNPGIVTVPKVGTVEAFFLEFVTTFVLLFIITALATDPNAVKELIA  242

Query  597  IAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTV  418
            +AVGAT+M+N LVAG S+G SMNP RTLGPA+A G Y  IW+YLVA  LGA+AG   Y  
Sbjct  243  VAVGATIMMNALVAGLSTGASMNPARTLGPAIATGRYTQIWVYLVATPLGAVAGEGFYFA  302

Query  417  VKL  409
            +KL
Sbjct  303  IKL  305



>ref|XP_010088000.1| Aquaporin NIP1-2 [Morus notabilis]
 gb|EXB31116.1| Aquaporin NIP1-2 [Morus notabilis]
Length=275

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 143/195 (73%), Gaps = 6/195 (3%)
 Frame = -3

Query  921  GLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASFALKGVF  742
            GL VM++I S GHISGAH NP++TIAFA+ + FP+ QVPAYIAAQV  S  AS  L+ +F
Sbjct  82   GLVVMVMIYSVGHISGAHFNPAVTIAFASTKRFPYKQVPAYIAAQVLGSTLASGTLRLLF  141

Query  741  H---PFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGATVML  571
            +      +G  T+P  S  Q+F +EF+ITF L+FVV+ VATD RA+GELAG+AVGATV+L
Sbjct  142  NGRDDHFTG--TLPVGSDIQSFVIEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLL  199

Query  570  NILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREE-VE  394
            N++ AGP SG SMNP R+LGPAV   +YK +WIYLVAPTLGAIAGA +Y +++  ++ + 
Sbjct  200  NVMFAGPISGASMNPARSLGPAVVHSHYKGLWIYLVAPTLGAIAGAWVYNLIRFTDKPLR  259

Query  393  PTSRPRSFRR*IGAE  349
              ++  SF + IG  
Sbjct  260  EITKSGSFLKSIGVR  274



>emb|CDO96880.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 134/180 (74%), Gaps = 2/180 (1%)
 Frame = -3

Query  939  GNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASICASF  760
            G +   GLA M+++ S GHISGAHLNP++TIAFA  + FPW QVPAYI+AQV  S  AS 
Sbjct  83   GTSVVWGLAAMVVVYSVGHISGAHLNPAITIAFATCKRFPWKQVPAYISAQVLGSTLASG  142

Query  759  ALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAVGAT  580
             L+ +F    +G   +P  S  Q+ ALEF+ITF L+FV+  VATD RA+GELAG+AVGAT
Sbjct  143  TLRLLFQDHFAG--PLPHGSDVQSLALEFIITFYLMFVICGVATDNRAIGELAGLAVGAT  200

Query  579  VMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKLREE  400
            V++N+++AGP SGGSM+P   LGPA+ + NYKS+W+Y++ PT GAI+GA +Y +++  ++
Sbjct  201  VIVNVMIAGPISGGSMSPAGRLGPAIVSSNYKSLWVYILGPTAGAISGAWVYNIIRFTDK  260



>gb|ACG28175.1| aquaporin NIP4.1 [Zea mays]
Length=295

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I +TGHISGAH+NP++T++FA  RHFPW QVP Y AAQ + ++C
Sbjct  84   SQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMC  143

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F LK V HP    G T PS     A  +E ++TFN++FV  AVATD+RAVGELAG+AV
Sbjct  144  AAFVLKAVLHPIAVIGTTTPSGPHWHALLIEIVVTFNMMFVTCAVATDSRAVGELAGLAV  203

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNP RTL PAVA+  +  +WIY + P +G ++GA +YT ++ 
Sbjct  204  GSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVIGTLSGAWVYTYIRF  263

Query  408  RE--EVEPTSRPRSFR  367
             E    + T R  SF+
Sbjct  264  EEAPAAKDTQRLSSFK  279



>ref|XP_010088155.1| Aquaporin NIP2-1 [Morus notabilis]
 gb|EXB31967.1| Aquaporin NIP2-1 [Morus notabilis]
Length=299

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 139/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GHISGAH+NP++T+AFA +RHFPW QVP Y AAQ + +I 
Sbjct  84   SQLGASVAGGLIVTVMIYAVGHISGAHMNPAVTLAFATVRHFPWKQVPLYAAAQFTGAIM  143

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
             +F L+ V +P    G T PS +  QA  +E ++TF ++FV +AVATDT+AVGELAGIAV
Sbjct  144  GAFTLREVLYPIQHLGTTTPSGTDVQALVMEIVVTFIMMFVTSAVATDTKAVGELAGIAV  203

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNPVRTLGPA+A+G YK +W+Y+V P +G + G+  Y ++++
Sbjct  204  GSAVCITSIFAGPISGGSMNPVRTLGPAIASGCYKGLWVYIVGPVIGTLLGSLSYRIIRV  263

Query  408  REE-VEPTSRPRSFR  367
             ++ + P S   SF+
Sbjct  264  DDKAIHPISPSYSFK  278



>ref|XP_010057160.1| PREDICTED: aquaporin NIP1-1-like [Eucalyptus grandis]
 gb|KCW74187.1| hypothetical protein EUGRSUZ_E02836 [Eucalyptus grandis]
Length=274

 Score =   184 bits (467),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            +L G +   GLAVM+++ S GHISGAH NP++TIAFA  + FPW QVP YI AQ+  S  
Sbjct  70   TLPGISMVWGLAVMVLVYSVGHISGAHFNPAVTIAFATCKRFPWKQVPPYILAQILGSTL  129

Query  768  ASFALKGVFHPFLSGGV-TVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIA  592
            A+  L+ +F   L+  + T P+ S GQAF  EF+ITF L+F+++ VATD RA+GELAG+A
Sbjct  130  ANGTLRLLFTGKLNHFLGTQPAGSDGQAFVFEFIITFYLMFIISGVATDNRAIGELAGLA  189

Query  591  VGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVK  412
            VGATV+LN++ AGP +G SMNP R+LGPA+   +Y  +WIY+VAPT+GAIAGA IY +++
Sbjct  190  VGATVLLNVMFAGPVTGASMNPARSLGPAIVFHHYDKLWIYIVAPTVGAIAGAWIYNLIR  249

Query  411  LREE-VEPTSRPRSFRR  364
              ++ +   ++  SF R
Sbjct  250  FTDKPIREITKSGSFLR  266



>ref|XP_002534417.1| Silicon transporter, putative [Ricinus communis]
 gb|EEF27965.1| Silicon transporter, putative [Ricinus communis]
Length=297

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 137/193 (71%), Gaps = 0/193 (0%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I + GH+SGAH+NP++T AFAA+RHFPW +VP Y AAQ++ +I 
Sbjct  82   SKLGASLAGGLIVTVMIYAVGHVSGAHMNPAVTTAFAAVRHFPWKEVPYYAAAQLTGAIS  141

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            ASF LK + HP    G T PS S  QA  +E ++TF ++FV +AVATDT+A+GELAGIAV
Sbjct  142  ASFTLKVLLHPVKHIGTTSPSGSDFQALVMEIVVTFCMMFVTSAVATDTKAIGELAGIAV  201

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  ++AGP SGGSMNP RTLGPA+A+  YK IW+Y+V P +G + G+  Y  +++
Sbjct  202  GSAVCITSILAGPISGGSMNPARTLGPAIASAYYKGIWVYIVGPVVGTLLGSWSYNFIRV  261

Query  408  REEVEPTSRPRSF  370
             ++      PRSF
Sbjct  262  TDQPLQAISPRSF  274



>ref|XP_002986711.1| hypothetical protein SELMODRAFT_14944, partial [Selaginella moellendorffii]
 ref|XP_002990720.1| hypothetical protein SELMODRAFT_47059, partial [Selaginella moellendorffii]
 gb|EFJ08169.1| hypothetical protein SELMODRAFT_47059, partial [Selaginella moellendorffii]
 gb|EFJ12274.1| hypothetical protein SELMODRAFT_14944, partial [Selaginella moellendorffii]
Length=210

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -3

Query  957  GAESLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSA  778
            G+ +  G AA  GL VM++I +TGHISGAH+NP++T+AFA +RHFPWAQVP YI +Q++A
Sbjct  28   GSLTFFGVAAANGLVVMMMIHATGHISGAHMNPAVTVAFATVRHFPWAQVPLYIGSQIAA  87

Query  777  SICASFALKGVFHPFLSGGVTVPSV-STGQAFALEFLITFNLLFvvtavatdtraVGELA  601
            S+ A F L+ +       G TVP+  +  QA  LE ++++ L+FVV AV+TDTRAVGELA
Sbjct  88   SVSACFVLRQLLTEVNKIGATVPAAGNVVQALVLEIIVSYILMFVVAAVSTDTRAVGELA  147

Query  600  GIAVGATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYT  421
            G+AVGATV LN L+AGP SG SMNP R++GPAVA  NY  +WIY+V P LG + GA  Y 
Sbjct  148  GLAVGATVALNNLIAGPLSGASMNPARSIGPAVARNNYSDVWIYIVGPVLGTLGGAWSYN  207

Query  420  VVK  412
            +++
Sbjct  208  LIR  210



>ref|NP_001105020.1| aquaporin NIP2-2 [Zea mays]
 sp|Q9ATN2.1|NIP22_MAIZE RecName: Full=Aquaporin NIP2-2; AltName: Full=NOD26-like intrinsic 
protein 2-2; AltName: Full=ZmNIP2-2; AltName: Full=ZmNIP2;2 
[Zea mays]
 gb|AAK26752.1| NOD26-like membrane integral protein ZmNIP2-2 [Zea mays]
 gb|ACG28405.1| aquaporin NIP4.1 [Zea mays]
 gb|ACN28345.1| unknown [Zea mays]
 gb|AFW76782.1| aquaporin NIP2-2 [Zea mays]
Length=294

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 134/196 (68%), Gaps = 2/196 (1%)
 Frame = -3

Query  948  SLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYIAAQVSASIC  769
            S +G +   GL V ++I +TGHISGAH+NP++T++FA  RHFPW QVP Y AAQ + ++C
Sbjct  83   SQLGQSVAGGLIVTVMIYATGHISGAHMNPAVTLSFACFRHFPWIQVPFYWAAQFTGAMC  142

Query  768  ASFALKGVFHPFLSGGVTVPSVSTGQAFALEFLITFNLLFvvtavatdtraVGELAGIAV  589
            A+F LK V HP    G T PS     A  +E ++TFN++FV  AVATD+RAVGELAG+AV
Sbjct  143  AAFVLKAVLHPIAVIGTTTPSGPHWHALLIEIVVTFNMMFVTCAVATDSRAVGELAGLAV  202

Query  588  GATVMLNILVAGPSSGGSMNPVRTLGPAVAAGNYKSIWIYLVAPTLGAIAGAAIYTVVKL  409
            G+ V +  + AGP SGGSMNP RTL PAVA+  +  +WIY + P +G ++GA +YT ++ 
Sbjct  203  GSAVCITSIFAGPVSGGSMNPARTLAPAVASNVFTGLWIYFLGPVIGTLSGAWVYTYIRF  262

Query  408  RE--EVEPTSRPRSFR  367
             E    + T R  SF+
Sbjct  263  EEAPAAKDTQRLSSFK  278



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2060434175780