BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20668_g2_i1 len=2006 path=[1:0-336 338:337-365 367:366-517
519:518-542 7084:543-881 880:882-906 2642:907-2005]

Length=2006
                                                                      Score     E

ref|XP_009795338.1|  PREDICTED: reticuline oxidase-like protein         634   0.0      
gb|EYU19101.1|  hypothetical protein MIMGU_mgv1a004329mg                628   0.0      
ref|XP_002268606.1|  PREDICTED: reticuline oxidase-like protein         626   0.0      Vitis vinifera
ref|XP_009630062.1|  PREDICTED: reticuline oxidase-like protein         623   0.0      
emb|CAN81650.1|  hypothetical protein VITISV_003752                     620   0.0      Vitis vinifera
ref|XP_003631731.2|  PREDICTED: reticuline oxidase-like protein         617   0.0      
ref|XP_009795337.1|  PREDICTED: reticuline oxidase-like protein         617   0.0      
ref|XP_011096699.1|  PREDICTED: reticuline oxidase-like protein         614   0.0      
ref|XP_011085609.1|  PREDICTED: reticuline oxidase-like protein         612   0.0      
ref|XP_010648252.1|  PREDICTED: reticuline oxidase-like protein         609   0.0      
emb|CDP12590.1|  unnamed protein product                                607   0.0      
ref|XP_008225664.1|  PREDICTED: reticuline oxidase-like protein         607   0.0      
ref|XP_010051873.1|  PREDICTED: reticuline oxidase-like protein         603   0.0      
ref|XP_002270139.2|  PREDICTED: reticuline oxidase-like protein         603   0.0      Vitis vinifera
ref|XP_010051871.1|  PREDICTED: reticuline oxidase-like protein         602   0.0      
ref|XP_004231557.1|  PREDICTED: reticuline oxidase-like protein         602   0.0      
gb|AEK87147.1|  berberine bridge enzyme                                 602   0.0      
ref|XP_006360316.1|  PREDICTED: reticuline oxidase-like protein-like    602   0.0      
ref|XP_010051869.1|  PREDICTED: reticuline oxidase-like protein         601   0.0      
emb|CDP12591.1|  unnamed protein product                                598   0.0      
ref|XP_008439529.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    598   0.0      
ref|XP_010051872.1|  PREDICTED: reticuline oxidase-like protein         595   0.0      
gb|KGN49482.1|  hypothetical protein Csa_6G525670                       596   0.0      
ref|XP_004134553.1|  PREDICTED: reticuline oxidase-like protein-like    593   0.0      
ref|XP_006448857.1|  hypothetical protein CICLE_v10014826mg             592   0.0      
ref|XP_006448860.1|  hypothetical protein CICLE_v10014748mg             592   0.0      
ref|XP_006468346.1|  PREDICTED: reticuline oxidase-like protein-l...    591   0.0      
ref|XP_011006008.1|  PREDICTED: reticuline oxidase-like protein         590   0.0      
ref|XP_006468347.1|  PREDICTED: reticuline oxidase-like protein-l...    590   0.0      
ref|XP_002317087.1|  hypothetical protein POPTR_0011s16180g             589   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010054197.1|  PREDICTED: reticuline oxidase-like protein         589   0.0      
ref|XP_002523157.1|  Reticuline oxidase precursor, putative             586   0.0      Ricinus communis
gb|KDP36342.1|  hypothetical protein JCGZ_09762                         586   0.0      
gb|KCW75709.1|  hypothetical protein EUGRSUZ_D00086                     583   0.0      
ref|XP_010054199.1|  PREDICTED: reticuline oxidase-like protein         583   0.0      
gb|KDP36344.1|  hypothetical protein JCGZ_09764                         582   0.0      
ref|XP_008228986.1|  PREDICTED: reticuline oxidase-like protein         582   0.0      
ref|XP_009760106.1|  PREDICTED: reticuline oxidase-like protein         581   0.0      
ref|XP_002523158.1|  Reticuline oxidase precursor, putative             579   0.0      Ricinus communis
ref|XP_002299028.2|  hypothetical protein POPTR_0001s46690g             580   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008220339.1|  PREDICTED: reticuline oxidase-like protein         581   0.0      
ref|XP_009362187.1|  PREDICTED: reticuline oxidase-like protein         578   0.0      
ref|XP_002300558.2|  hypothetical protein POPTR_0001s46690g             579   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039281.1|  PREDICTED: reticuline oxidase-like protein         578   0.0      
ref|XP_003532642.1|  PREDICTED: reticuline oxidase-like protein-like    577   0.0      
gb|EYU19102.1|  hypothetical protein MIMGU_mgv1a022353mg                575   0.0      
ref|XP_007158995.1|  hypothetical protein PHAVU_002G199300g             575   0.0      
ref|XP_007023055.1|  FAD-binding Berberine family protein               577   0.0      
ref|XP_007217492.1|  hypothetical protein PRUPE_ppa026518mg             572   0.0      
ref|XP_003524102.1|  PREDICTED: reticuline oxidase-like protein-like    572   0.0      
gb|KHN39153.1|  Reticuline oxidase-like protein                         571   0.0      
ref|XP_007023056.1|  FAD-binding Berberine family protein               568   0.0      
emb|CAN80091.1|  hypothetical protein VITISV_015121                     568   0.0      Vitis vinifera
ref|XP_002270585.1|  PREDICTED: reticuline oxidase-like protein         568   0.0      Vitis vinifera
gb|EYU43212.1|  hypothetical protein MIMGU_mgv1a021309mg                566   0.0      
emb|CAN60572.1|  hypothetical protein VITISV_000229                     567   0.0      Vitis vinifera
ref|XP_010042218.1|  PREDICTED: reticuline oxidase-like protein         568   0.0      
ref|XP_004504724.1|  PREDICTED: reticuline oxidase-like protein-like    566   0.0      
ref|XP_009353860.1|  PREDICTED: reticuline oxidase-like protein i...    566   0.0      
ref|XP_009353861.1|  PREDICTED: reticuline oxidase-like protein i...    566   0.0      
ref|XP_002269462.1|  PREDICTED: reticuline oxidase-like protein         565   0.0      Vitis vinifera
emb|CDP21199.1|  unnamed protein product                                563   0.0      
gb|KCW75706.1|  hypothetical protein EUGRSUZ_D00082                     562   0.0      
ref|XP_008439528.1|  PREDICTED: reticuline oxidase-like protein         563   0.0      
ref|XP_010053029.1|  PREDICTED: reticuline oxidase-like protein i...    562   0.0      
ref|XP_007147449.1|  hypothetical protein PHAVU_006G125600g             561   0.0      
ref|XP_010053028.1|  PREDICTED: reticuline oxidase-like protein i...    563   0.0      
gb|KCW77269.1|  hypothetical protein EUGRSUZ_D01626                     562   0.0      
ref|XP_010098534.1|  Reticuline oxidase-like protein                    561   0.0      
ref|XP_010098533.1|  Reticuline oxidase-like protein                    560   0.0      
gb|KHN25855.1|  Reticuline oxidase-like protein                         558   0.0      
ref|XP_010655774.1|  PREDICTED: reticuline oxidase-like protein         558   0.0      
ref|XP_010053030.1|  PREDICTED: reticuline oxidase-like protein i...    558   0.0      
ref|XP_003594610.1|  Reticuline oxidase-like protein                    557   0.0      
ref|XP_006348174.1|  PREDICTED: reticuline oxidase-like protein-like    556   0.0      
gb|KHN14306.1|  Reticuline oxidase-like protein                         555   0.0      
ref|XP_003546282.1|  PREDICTED: reticuline oxidase-like protein-like    555   0.0      
ref|XP_003534781.1|  PREDICTED: reticuline oxidase-like protein-like    555   0.0      
ref|XP_008225674.1|  PREDICTED: reticuline oxidase-like protein         555   0.0      
ref|XP_006468466.1|  PREDICTED: reticuline oxidase-like protein-like    554   0.0      
ref|XP_006370773.1|  FAD-binding domain-containing family protein       554   0.0      
ref|XP_006448838.1|  hypothetical protein CICLE_v10014838mg             553   0.0      
ref|XP_007158993.1|  hypothetical protein PHAVU_002G199100g             553   0.0      
ref|XP_002267904.2|  PREDICTED: reticuline oxidase-like protein         553   0.0      Vitis vinifera
ref|XP_006448845.1|  hypothetical protein CICLE_v10018073mg             552   0.0      
gb|KHN44646.1|  Reticuline oxidase-like protein                         552   0.0      
gb|KHN44648.1|  Reticuline oxidase-like protein                         551   0.0      
ref|XP_010316563.1|  PREDICTED: reticuline oxidase-like protein         551   0.0      
ref|XP_007211543.1|  hypothetical protein PRUPE_ppa004021mg             551   0.0      
ref|XP_007226571.1|  hypothetical protein PRUPE_ppa024148mg             551   0.0      
ref|XP_007203267.1|  hypothetical protein PRUPE_ppa019803mg             551   0.0      
ref|XP_007147447.1|  hypothetical protein PHAVU_006G125400g             551   0.0      
ref|XP_007023039.1|  FAD-binding Berberine family protein               552   0.0      
ref|XP_002317086.1|  FAD-binding domain-containing family protein       550   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003594612.1|  Reticuline oxidase-like protein                    550   0.0      
ref|XP_006432918.1|  hypothetical protein CICLE_v10000808mg             550   0.0      
ref|XP_011039280.1|  PREDICTED: reticuline oxidase-like protein         549   0.0      
ref|XP_003531066.1|  PREDICTED: reticuline oxidase-like protein-like    549   0.0      
gb|KDO48902.1|  hypothetical protein CISIN_1g009297mg                   549   0.0      
gb|KDP36348.1|  hypothetical protein JCGZ_09768                         548   0.0      
ref|XP_003535121.1|  PREDICTED: reticuline oxidase-like protein-like    549   0.0      
gb|KEH37087.1|  FAD-binding berberine family protein                    548   0.0      
ref|XP_003546281.1|  PREDICTED: reticuline oxidase-like protein-like    548   0.0      
gb|EPS70046.1|  hypothetical protein M569_04712                         547   0.0      
ref|XP_008222794.1|  PREDICTED: reticuline oxidase-like protein         547   0.0      
ref|XP_004295437.1|  PREDICTED: reticuline oxidase-like protein-like    556   0.0      
ref|XP_004486494.1|  PREDICTED: reticuline oxidase-like protein-like    546   0.0      
emb|CDP12593.1|  unnamed protein product                                546   0.0      
ref|XP_007212419.1|  hypothetical protein PRUPE_ppa016588mg             545   0.0      
ref|XP_010537531.1|  PREDICTED: reticuline oxidase-like protein i...    547   0.0      
ref|XP_010537539.1|  PREDICTED: reticuline oxidase-like protein i...    545   0.0      
ref|XP_002523151.1|  Reticuline oxidase precursor, putative             544   0.0      Ricinus communis
gb|KCW75699.1|  hypothetical protein EUGRSUZ_D00073                     543   0.0      
ref|XP_004486488.1|  PREDICTED: reticuline oxidase-like protein-like    543   0.0      
ref|XP_011006009.1|  PREDICTED: reticuline oxidase-like protein         542   0.0      
ref|XP_004293691.1|  PREDICTED: reticuline oxidase-like protein-like    542   0.0      
ref|XP_010051867.1|  PREDICTED: reticuline oxidase-like protein         543   0.0      
ref|XP_007033584.1|  FAD-binding Berberine family protein isoform 1     542   0.0      
ref|XP_009362182.1|  PREDICTED: reticuline oxidase-like protein         541   0.0      
ref|XP_010054196.1|  PREDICTED: reticuline oxidase-like protein         541   0.0      
ref|XP_006448837.1|  hypothetical protein CICLE_v10017768mg             539   0.0      
ref|XP_007147438.1|  hypothetical protein PHAVU_006G124600g             541   0.0      
ref|XP_007158994.1|  hypothetical protein PHAVU_002G199200g             541   0.0      
ref|XP_008225669.1|  PREDICTED: reticuline oxidase-like protein         540   0.0      
ref|XP_003534766.1|  PREDICTED: reticuline oxidase-like protein-like    539   0.0      
ref|XP_004295439.1|  PREDICTED: reticuline oxidase-like protein-like    538   0.0      
ref|XP_006413851.1|  hypothetical protein EUTSA_v10027426mg             539   0.0      
ref|XP_006377911.1|  hypothetical protein POPTR_0011s16160g             538   0.0      
ref|XP_003546286.1|  PREDICTED: reticuline oxidase-like protein-like    538   0.0      
ref|XP_007147450.1|  hypothetical protein PHAVU_006G125700g             537   0.0      
ref|XP_007217510.1|  hypothetical protein PRUPE_ppa024922mg             537   0.0      
ref|XP_004504723.1|  PREDICTED: reticuline oxidase-like protein-like    536   2e-180   
ref|XP_010449155.1|  PREDICTED: reticuline oxidase-like protein i...    536   2e-180   
ref|XP_004134894.1|  PREDICTED: reticuline oxidase-like protein-like    535   2e-180   
ref|XP_011006011.1|  PREDICTED: reticuline oxidase-like protein         534   4e-180   
ref|XP_004162850.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    535   4e-180   
gb|KHN14296.1|  Reticuline oxidase-like protein                         535   4e-180   
ref|XP_002523152.1|  Reticuline oxidase precursor, putative             534   5e-180   Ricinus communis
ref|XP_010449154.1|  PREDICTED: reticuline oxidase-like protein i...    535   6e-180   
ref|XP_003547341.1|  PREDICTED: reticuline oxidase-like protein-like    535   6e-180   
ref|XP_010449153.1|  PREDICTED: reticuline oxidase-like protein i...    535   1e-179   
ref|XP_007023052.1|  FAD-binding Berberine family protein               534   1e-179   
ref|XP_010680366.1|  PREDICTED: reticuline oxidase-like protein         533   2e-179   
ref|XP_006285850.1|  hypothetical protein CARUB_v10007331mg             534   2e-179   
ref|XP_002317074.2|  FAD-binding domain-containing family protein       533   3e-179   Populus trichocarpa [western balsam poplar]
ref|XP_010434267.1|  PREDICTED: reticuline oxidase-like protein         533   4e-179   
gb|KEH31331.1|  FAD-binding berberine family protein                    553   4e-179   
ref|XP_008445642.1|  PREDICTED: reticuline oxidase-like protein         532   5e-179   
ref|XP_008360665.1|  PREDICTED: reticuline oxidase-like protein         532   8e-179   
ref|XP_006417310.1|  hypothetical protein EUTSA_v10007344mg             531   1e-178   
ref|XP_004486573.1|  PREDICTED: reticuline oxidase-like protein-like    531   2e-178   
ref|XP_011040560.1|  PREDICTED: reticuline oxidase-like protein         531   2e-178   
gb|AFK34476.1|  unknown                                                 532   2e-178   
gb|EYU43213.1|  hypothetical protein MIMGU_mgv1a021270mg                530   2e-178   
ref|XP_002529891.1|  Reticuline oxidase precursor, putative             530   4e-178   Ricinus communis
ref|XP_010674638.1|  PREDICTED: reticuline oxidase-like protein         529   1e-177   
ref|XP_011085610.1|  PREDICTED: reticuline oxidase-like protein         528   3e-177   
ref|XP_010449156.1|  PREDICTED: reticuline oxidase-like protein         529   4e-177   
ref|XP_004135723.1|  PREDICTED: reticuline oxidase-like protein-like    527   4e-177   
ref|XP_011005333.1|  PREDICTED: reticuline oxidase-like protein         527   4e-177   
ref|XP_008352411.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    526   7e-177   
ref|XP_006283416.1|  hypothetical protein CARUB_v10004466mg             528   8e-177   
ref|XP_002299026.2|  hypothetical protein POPTR_0001s46680g             526   8e-177   Populus trichocarpa [western balsam poplar]
ref|XP_010501432.1|  PREDICTED: reticuline oxidase-like protein         526   1e-176   
ref|XP_007023054.1|  FAD-binding Berberine family protein               526   1e-176   
ref|NP_193816.1|  FAD-binding and BBE domain-containing protein         526   1e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434269.1|  PREDICTED: reticuline oxidase-like protein         527   3e-176   
ref|XP_010462643.1|  PREDICTED: reticuline oxidase-like protein         525   3e-176   
ref|XP_008441073.1|  PREDICTED: reticuline oxidase-like protein         524   5e-176   
ref|XP_010476115.1|  PREDICTED: reticuline oxidase-like protein         525   5e-176   
ref|XP_009362291.1|  PREDICTED: reticuline oxidase-like protein         525   5e-176   
ref|XP_003547339.1|  PREDICTED: reticuline oxidase-like protein-like    525   6e-176   
ref|XP_004295451.1|  PREDICTED: reticuline oxidase-like protein-like    524   7e-176   
gb|KFK31563.1|  hypothetical protein AALP_AA6G128100                    524   7e-176   
ref|XP_010439562.1|  PREDICTED: reticuline oxidase-like protein         524   8e-176   
ref|XP_002869923.1|  FAD-binding domain-containing protein              524   8e-176   
emb|CDP12594.1|  unnamed protein product                                523   1e-175   
ref|XP_010439563.1|  PREDICTED: reticuline oxidase-like protein         525   2e-175   
ref|XP_010556147.1|  PREDICTED: reticuline oxidase-like protein         524   2e-175   
ref|XP_009148512.1|  PREDICTED: reticuline oxidase-like protein         523   2e-175   
ref|XP_002299008.1|  hypothetical protein POPTR_0001s46340g             523   2e-175   Populus trichocarpa [western balsam poplar]
ref|XP_003534791.1|  PREDICTED: reticuline oxidase-like protein-like    524   2e-175   
gb|KHN44657.1|  Reticuline oxidase-like protein                         524   2e-175   
emb|CDY13353.1|  BnaC06g14040D                                          523   2e-175   
emb|CDX67534.1|  BnaA07g15740D                                          523   3e-175   
emb|CDX98676.1|  BnaA03g44610D                                          523   3e-175   
ref|XP_010449152.1|  PREDICTED: reticuline oxidase-like protein         523   4e-175   
emb|CDX97984.1|  BnaA06g07350D                                          522   4e-175   
ref|XP_009137153.1|  PREDICTED: reticuline oxidase-like protein         521   8e-175   
emb|CDY49803.1|  BnaCnng18160D                                          521   1e-174   
ref|XP_007147442.1|  hypothetical protein PHAVU_006G125000g             522   1e-174   
ref|XP_009362286.1|  PREDICTED: reticuline oxidase-like protein         522   2e-174   
ref|XP_002300550.2|  hypothetical protein POPTR_0001s46390g             520   2e-174   Populus trichocarpa [western balsam poplar]
ref|XP_009362285.1|  PREDICTED: reticuline oxidase-like protein         520   2e-174   
ref|XP_009125223.1|  PREDICTED: reticuline oxidase-like protein         521   2e-174   
ref|XP_006304944.1|  hypothetical protein CARUB_v10011431mg             520   2e-174   
ref|XP_002523156.1|  Reticuline oxidase precursor, putative             519   3e-174   Ricinus communis
emb|CDX94009.1|  BnaC07g36430D                                          520   6e-174   
ref|XP_003534782.1|  PREDICTED: reticuline oxidase-like protein-like    519   7e-174   
ref|XP_008356815.1|  PREDICTED: reticuline oxidase-like protein         519   7e-174   
gb|KHN44649.1|  Reticuline oxidase-like protein                         520   1e-173   
ref|XP_008392313.1|  PREDICTED: reticuline oxidase-like protein         518   1e-173   
ref|XP_004293693.1|  PREDICTED: reticuline oxidase-like protein-like    516   4e-173   
gb|KCW76615.1|  hypothetical protein EUGRSUZ_D01003                     514   4e-173   
ref|XP_009803657.1|  PREDICTED: reticuline oxidase-like protein         517   5e-173   
ref|XP_002889895.1|  hypothetical protein ARALYDRAFT_471318             517   5e-173   
ref|XP_006418476.1|  hypothetical protein EUTSA_v10007313mg             516   7e-173   
gb|KDO77595.1|  hypothetical protein CISIN_1g040700mg                   515   9e-173   
ref|NP_193815.2|  FAD-binding Berberine family protein                  517   1e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004504726.1|  PREDICTED: reticuline oxidase-like protein-like    516   2e-172   
ref|XP_008439524.1|  PREDICTED: reticuline oxidase-like protein         514   3e-172   
ref|XP_009596049.1|  PREDICTED: reticuline oxidase-like protein         514   4e-172   
gb|KHN22988.1|  Reticuline oxidase-like protein                         514   4e-172   
ref|XP_002889343.1|  ATSEC1A                                            514   5e-172   
ref|XP_009137152.1|  PREDICTED: reticuline oxidase-like protein         514   6e-172   
ref|XP_010655770.1|  PREDICTED: reticuline oxidase-like protein         514   7e-172   
gb|KEH37085.1|  reticuline oxidase-like protein                         514   9e-172   
ref|XP_002869924.1|  FAD-binding domain-containing protein              515   1e-171   
ref|XP_004486487.1|  PREDICTED: reticuline oxidase-like protein-like    514   1e-171   
ref|XP_011096701.1|  PREDICTED: reticuline oxidase-like protein         513   1e-171   
ref|XP_004162849.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    512   4e-171   
ref|NP_974580.1|  FAD-binding Berberine family protein                  512   5e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005328.1|  PREDICTED: reticuline oxidase-like protein         511   7e-171   
gb|EYU43214.1|  hypothetical protein MIMGU_mgv1a026362mg                511   9e-171   
ref|XP_006305964.1|  hypothetical protein CARUB_v10011221mg             511   1e-170   
ref|XP_002523155.1|  Reticuline oxidase precursor, putative             510   2e-170   Ricinus communis
emb|CDX98675.1|  BnaA03g44600D                                          510   2e-170   
ref|XP_007147441.1|  hypothetical protein PHAVU_006G124800g             509   3e-170   
gb|EYU19100.1|  hypothetical protein MIMGU_mgv1a004305mg                510   3e-170   
ref|NP_171700.1|  reticuline oxidase-like family protein                510   3e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115056.1|  PREDICTED: reticuline oxidase-like protein         509   3e-170   
ref|XP_010479531.1|  PREDICTED: reticuline oxidase-like protein         510   3e-170   
emb|CDY34627.1|  BnaC08g41860D                                          509   3e-170   
ref|XP_004486493.1|  PREDICTED: reticuline oxidase-like protein-like    510   5e-170   
dbj|BAD94511.1|  hypothetical protein                                   509   7e-170   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42563.1|  hypothetical protein AALP_AA1G011500                    508   1e-169   
ref|XP_006413852.1|  hypothetical protein EUTSA_v10024789mg             509   1e-169   
ref|XP_010474828.1|  PREDICTED: reticuline oxidase-like protein         508   1e-169   
ref|XP_007211821.1|  hypothetical protein PRUPE_ppa004317mg             507   1e-169   
ref|XP_010519042.1|  PREDICTED: reticuline oxidase-like protein         508   2e-169   
ref|XP_002300580.2|  hypothetical protein POPTR_0001s47400g             508   2e-169   Populus trichocarpa [western balsam poplar]
ref|NP_172642.3|  FAD-binding and BBE domain-containing protein         508   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008225665.1|  PREDICTED: reticuline oxidase-like protein         508   2e-169   
ref|XP_011040559.1|  PREDICTED: reticuline oxidase-like protein         507   3e-169   
ref|XP_011039847.1|  PREDICTED: reticuline oxidase-like protein         507   4e-169   
emb|CDY31432.1|  BnaC03g63920D                                          506   4e-169   
ref|XP_010460877.1|  PREDICTED: reticuline oxidase-like protein         505   1e-168   
gb|KDP34868.1|  hypothetical protein JCGZ_09156                         505   1e-168   
ref|XP_002299010.2|  hypothetical protein POPTR_0001s46360g             505   1e-168   Populus trichocarpa [western balsam poplar]
emb|CDP12592.1|  unnamed protein product                                505   2e-168   
ref|XP_009108480.1|  PREDICTED: reticuline oxidase-like protein         504   3e-168   
ref|XP_006307225.1|  hypothetical protein CARUB_v10008825mg             504   3e-168   
gb|KFK31562.1|  hypothetical protein AALP_AA6G128000                    505   5e-168   
ref|XP_010499613.1|  PREDICTED: reticuline oxidase-like protein         504   5e-168   
gb|KDP34867.1|  hypothetical protein JCGZ_09155                         504   7e-168   
ref|XP_004134895.1|  PREDICTED: reticuline oxidase-like protein-like    504   7e-168   
gb|KCW76692.1|  hypothetical protein EUGRSUZ_D01053                     504   8e-168   
emb|CDX76449.1|  BnaA08g09510D                                          503   1e-167   
ref|XP_008439526.1|  PREDICTED: reticuline oxidase-like protein         504   1e-167   
ref|XP_010478503.1|  PREDICTED: reticuline oxidase-like protein         503   1e-167   
ref|XP_006303958.1|  hypothetical protein CARUB_v10008807mg             503   1e-167   
gb|KDP34866.1|  hypothetical protein JCGZ_09154                         503   1e-167   
emb|CDY34829.1|  BnaA09g47550D                                          503   2e-167   
ref|NP_174357.1|  FAD-binding Berberine family protein                  502   2e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002317686.2|  hypothetical protein POPTR_0011s15950g             503   2e-167   Populus trichocarpa [western balsam poplar]
ref|XP_007158997.1|  hypothetical protein PHAVU_002G199500g             502   2e-167   
gb|KDP36345.1|  hypothetical protein JCGZ_09765                         502   2e-167   
ref|XP_009118173.1|  PREDICTED: reticuline oxidase-like protein         503   2e-167   
ref|XP_010499620.1|  PREDICTED: reticuline oxidase-like protein         502   3e-167   
emb|CDX82782.1|  BnaC01g12320D                                          503   4e-167   
emb|CDX79008.1|  BnaA01g10750D                                          503   5e-167   
ref|XP_010478507.1|  PREDICTED: reticuline oxidase-like protein         501   5e-167   
ref|XP_003531233.1|  PREDICTED: reticuline oxidase-like protein-like    501   5e-167   
ref|XP_010460881.1|  PREDICTED: reticuline oxidase-like protein         501   5e-167   
ref|XP_002890889.1|  FAD-binding domain-containing protein              501   6e-167   
emb|CDX94008.1|  BnaC07g36420D                                          501   8e-167   
ref|XP_007147448.1|  hypothetical protein PHAVU_006G125500g             501   8e-167   
ref|XP_009134021.1|  PREDICTED: reticuline oxidase-like protein         502   1e-166   
ref|XP_002890893.1|  FAD-binding domain-containing protein              501   1e-166   
ref|XP_011005332.1|  PREDICTED: reticuline oxidase-like protein         500   1e-166   
ref|XP_007023044.1|  FAD-binding and BBE domain-containing protein      500   2e-166   
ref|XP_006352998.1|  PREDICTED: reticuline oxidase-like protein-like    500   2e-166   
ref|XP_006415434.1|  hypothetical protein EUTSA_v10007341mg             500   2e-166   
gb|KEH31324.1|  reticuline oxidase-like protein                         500   3e-166   
ref|XP_004134893.1|  PREDICTED: reticuline oxidase-like protein-like    497   4e-166   
gb|ABK28425.1|  unknown                                                 498   1e-165   
gb|AAL77103.1|AF472609_1  carbohydrate oxidase                          498   1e-165   
ref|XP_003532641.1|  PREDICTED: reticuline oxidase-like protein-like    498   2e-165   
gb|KFK44874.1|  hypothetical protein AALP_AA1G313900                    497   2e-165   
ref|NP_174361.1|  FAD-binding and BBE domain-containing protein         497   4e-165   
ref|XP_006427068.1|  hypothetical protein CICLE_v10027115mg             493   3e-164   
ref|XP_009362185.1|  PREDICTED: reticuline oxidase-like protein i...    495   4e-164   
ref|XP_009362186.1|  PREDICTED: reticuline oxidase-like protein i...    494   4e-164   
ref|XP_009115053.1|  PREDICTED: reticuline oxidase-like protein         494   5e-164   
gb|KHN39155.1|  Reticuline oxidase-like protein                         493   5e-164   
ref|XP_010667595.1|  PREDICTED: reticuline oxidase-like protein         493   6e-164   
emb|CBI31067.3|  unnamed protein product                                494   6e-164   
ref|XP_010499615.1|  PREDICTED: reticuline oxidase-like protein i...    493   1e-163   
ref|XP_004233150.1|  PREDICTED: reticuline oxidase-like protein         492   3e-163   
ref|XP_010478504.1|  PREDICTED: reticuline oxidase-like protein         493   3e-163   
emb|CDY02321.1|  BnaA09g25810D                                          492   4e-163   
ref|XP_004295450.1|  PREDICTED: reticuline oxidase-like protein-like    498   5e-163   
gb|KCW75701.1|  hypothetical protein EUGRSUZ_D00075                     491   6e-163   
ref|XP_006306380.1|  hypothetical protein CARUB_v10012287mg             491   6e-163   
ref|XP_010051868.1|  PREDICTED: reticuline oxidase-like protein         491   6e-163   
ref|XP_006427069.1|  hypothetical protein CICLE_v10027503mg             489   9e-163   
ref|XP_008358604.1|  PREDICTED: reticuline oxidase-like protein         490   1e-162   
emb|CDY09546.1|  BnaC05g23730D                                          490   2e-162   
ref|XP_010685240.1|  PREDICTED: reticuline oxidase-like protein         489   2e-162   
ref|XP_007033585.1|  FAD-binding Berberine family protein isoform 2     489   3e-162   
ref|XP_004486571.1|  PREDICTED: uncharacterized protein LOC101508264    509   3e-162   
ref|XP_008225671.1|  PREDICTED: reticuline oxidase-like protein         489   3e-162   
ref|XP_007159396.1|  hypothetical protein PHAVU_002G234800g             489   4e-162   
ref|XP_006415430.1|  hypothetical protein EUTSA_v10007308mg             489   5e-162   
ref|XP_010500000.1|  PREDICTED: reticuline oxidase-like protein         489   5e-162   
ref|XP_010463011.1|  PREDICTED: reticuline oxidase-like protein         488   5e-162   
ref|XP_009362288.1|  PREDICTED: reticuline oxidase-like protein         488   6e-162   
emb|CDY50727.1|  BnaA05g35540D                                          488   8e-162   
ref|XP_009354038.1|  PREDICTED: reticuline oxidase-like protein         487   2e-161   
ref|NP_564449.1|  FAD-binding and BBE domain-containing protein         487   2e-161   
ref|XP_006307149.1|  hypothetical protein CARUB_v10008739mg             488   2e-161   
ref|XP_009102690.1|  PREDICTED: reticuline oxidase-like protein         486   4e-161   
ref|XP_009603937.1|  PREDICTED: reticuline oxidase-like protein         487   4e-161   
ref|XP_010463136.1|  PREDICTED: reticuline oxidase-like protein         486   6e-161   
gb|AAL77102.1|AF472608_1  carbohydrate oxidase                          485   1e-160   
ref|NP_174358.1|  FAD-binding and BBE domain-containing protein         485   1e-160   
ref|XP_002275045.1|  PREDICTED: reticuline oxidase-like protein         485   2e-160   
ref|XP_006465585.1|  PREDICTED: reticuline oxidase-like protein-like    484   2e-160   
ref|XP_006465584.1|  PREDICTED: reticuline oxidase-like protein-like    488   2e-160   
emb|CAN78950.1|  hypothetical protein VITISV_014049                     484   3e-160   
ref|XP_010519046.1|  PREDICTED: reticuline oxidase-like protein         484   3e-160   
gb|KDO48833.1|  hypothetical protein CISIN_1g035812mg                   483   6e-160   
ref|XP_007212922.1|  hypothetical protein PRUPE_ppa022296mg             483   8e-160   
ref|XP_010685242.1|  PREDICTED: reticuline oxidase-like protein         483   8e-160   
ref|XP_010685265.1|  PREDICTED: reticuline oxidase-like protein         483   2e-159   
ref|XP_002523154.1|  Reticuline oxidase precursor, putative             481   2e-159   
ref|XP_007212681.1|  hypothetical protein PRUPE_ppa018446mg             481   2e-159   
ref|XP_004295442.1|  PREDICTED: reticuline oxidase-like protein-like    481   3e-159   
ref|XP_006415433.1|  hypothetical protein EUTSA_v10007337mg             481   4e-159   
emb|CDX77576.1|  BnaA07g07140D                                          481   4e-159   
gb|KDP36346.1|  hypothetical protein JCGZ_09766                         481   4e-159   
ref|XP_002890890.1|  FAD-binding domain-containing protein              481   4e-159   
gb|AAF79255.1|AC023279_4  F12K21.9                                      488   4e-159   
ref|XP_009362289.1|  PREDICTED: reticuline oxidase-like protein         480   1e-158   
ref|XP_002299022.2|  hypothetical protein POPTR_0001s46620g             479   2e-158   
ref|XP_004242239.1|  PREDICTED: cannabidiolic acid synthase-like        479   2e-158   
ref|XP_007211965.1|  hypothetical protein PRUPE_ppa006568mg             474   3e-158   
ref|XP_010672792.1|  PREDICTED: reticuline oxidase-like protein         479   3e-158   
ref|XP_002299021.2|  hypothetical protein POPTR_0001s46610g             478   3e-158   
ref|XP_009115055.1|  PREDICTED: reticuline oxidase-like protein         479   4e-158   
ref|XP_007212391.1|  hypothetical protein PRUPE_ppa016294mg             478   4e-158   
gb|KFK44883.1|  hypothetical protein AALP_AA1G315400                    478   5e-158   
ref|XP_007222484.1|  hypothetical protein PRUPE_ppa004103mg             478   6e-158   
ref|XP_006370482.1|  FAD-binding domain-containing family protein       478   8e-158   
ref|XP_008225666.1|  PREDICTED: reticuline oxidase-like protein         478   1e-157   
ref|XP_002277310.1|  PREDICTED: inactive tetrahydrocannabinolic a...    478   1e-157   
ref|XP_010053021.1|  PREDICTED: reticuline oxidase-like protein         478   1e-157   
ref|XP_010501669.1|  PREDICTED: reticuline oxidase-like protein         477   1e-157   
ref|XP_008227084.1|  PREDICTED: reticuline oxidase-like protein         477   1e-157   
ref|XP_010460878.1|  PREDICTED: reticuline oxidase-like protein         478   2e-157   
ref|XP_009362183.1|  PREDICTED: reticuline oxidase-like protein         477   2e-157   
ref|XP_010478500.1|  PREDICTED: reticuline oxidase-like protein i...    478   2e-157   
ref|XP_011039288.1|  PREDICTED: tetrahydrocannabinolic acid synth...    477   3e-157   
ref|XP_002299020.2|  hypothetical protein POPTR_0001s46600g             476   3e-157   
ref|XP_007212909.1|  hypothetical protein PRUPE_ppa022216mg             476   3e-157   
ref|XP_007213528.1|  hypothetical protein PRUPE_ppa019761mg             476   4e-157   
ref|XP_007023045.1|  FAD-binding and BBE domain-containing protei...    476   4e-157   
ref|XP_010537313.1|  PREDICTED: reticuline oxidase-like protein         476   4e-157   
ref|XP_009768974.1|  PREDICTED: reticuline oxidase-like protein         476   5e-157   
ref|XP_010685243.1|  PREDICTED: reticuline oxidase-like protein         476   6e-157   
gb|KFK44875.1|  hypothetical protein AALP_AA1G314000                    476   6e-157   
ref|XP_010275367.1|  PREDICTED: tetrahydrocannabinolic acid synth...    476   9e-157   
ref|XP_011039290.1|  PREDICTED: cannabidiolic acid synthase-like 1      475   1e-156   
ref|XP_007212998.1|  hypothetical protein PRUPE_ppa022785mg             474   1e-156   
ref|XP_010053020.1|  PREDICTED: reticuline oxidase-like protein         474   2e-156   
ref|XP_008225758.1|  PREDICTED: reticuline oxidase-like protein         474   2e-156   
gb|KDP36341.1|  hypothetical protein JCGZ_09761                         469   2e-156   
ref|XP_010450189.1|  PREDICTED: reticuline oxidase-like protein         474   2e-156   
ref|XP_011040518.1|  PREDICTED: cannabidiolic acid synthase-like 1      474   2e-156   
ref|XP_010686121.1|  PREDICTED: reticuline oxidase-like protein         473   4e-156   
ref|XP_002300557.2|  hypothetical protein POPTR_0001s46580g             473   6e-156   
ref|XP_006306030.1|  hypothetical protein CARUB_v10011326mg             473   9e-156   
ref|XP_006356501.1|  PREDICTED: cannabidiolic acid synthase-like        473   1e-155   
ref|XP_006370772.1|  hypothetical protein POPTR_0001s46640g             471   1e-155   
ref|XP_010480768.1|  PREDICTED: reticuline oxidase-like protein         469   2e-155   
gb|KDO52551.1|  hypothetical protein CISIN_1g009485mg                   471   2e-155   
ref|XP_007023049.1|  FAD-binding and BBE domain-containing protei...    473   2e-155   
ref|XP_009787052.1|  PREDICTED: cannabidiolic acid synthase-like 1      471   2e-155   
ref|XP_009362287.1|  PREDICTED: reticuline oxidase-like protein         472   3e-155   
ref|XP_002299025.2|  hypothetical protein POPTR_0001s46650g             469   3e-155   
ref|XP_006490192.1|  PREDICTED: tetrahydrocannabinolic acid synth...    471   4e-155   
ref|XP_010435245.1|  PREDICTED: reticuline oxidase-like protein         470   5e-155   
ref|XP_010519044.1|  PREDICTED: reticuline oxidase-like protein         470   6e-155   
ref|XP_009615787.1|  PREDICTED: cannabidiolic acid synthase-like        470   9e-155   
ref|XP_011078509.1|  PREDICTED: cannabidiolic acid synthase-like 1      470   1e-154   
ref|XP_006421555.1|  hypothetical protein CICLE_v10006451mg             469   1e-154   
ref|XP_002299035.1|  hypothetical protein POPTR_0001s46760g             470   1e-154   
ref|XP_007212705.1|  hypothetical protein PRUPE_ppa018650mg             469   1e-154   
gb|KCW75707.1|  hypothetical protein EUGRSUZ_D00084                     464   2e-154   
ref|XP_008225668.1|  PREDICTED: reticuline oxidase-like protein         469   3e-154   
ref|XP_010667051.1|  PREDICTED: reticuline oxidase-like protein         468   3e-154   
ref|XP_010276872.1|  PREDICTED: tetrahydrocannabinolic acid synth...    468   3e-154   
ref|XP_006377930.1|  hypothetical protein POPTR_0011s16410g             468   4e-154   
ref|XP_002299033.1|  hypothetical protein POPTR_0001s46740g             468   6e-154   
ref|XP_011005994.1|  PREDICTED: tetrahydrocannabinolic acid synth...    468   7e-154   
ref|XP_010686120.1|  PREDICTED: reticuline oxidase-like protein         468   7e-154   
ref|XP_008225667.1|  PREDICTED: reticuline oxidase-like protein         468   7e-154   
ref|XP_011006017.1|  PREDICTED: cannabidiolic acid synthase-like 1      468   8e-154   
gb|EYU43211.1|  hypothetical protein MIMGU_mgv1a004698mg                466   1e-153   
ref|XP_010501670.1|  PREDICTED: reticuline oxidase-like protein         467   1e-153   
gb|AGL44336.1|  FAD-dependent oxidoreductase                            467   1e-153   
gb|EPS73320.1|  hypothetical protein M569_01431                         466   1e-153   
ref|XP_011013628.1|  PREDICTED: tetrahydrocannabinolic acid synth...    467   2e-153   
ref|XP_006415432.1|  hypothetical protein EUTSA_v10009705mg             466   2e-153   
ref|XP_003532558.1|  PREDICTED: reticuline oxidase-like protein-like    466   3e-153   
ref|XP_010537325.1|  PREDICTED: reticuline oxidase-like protein         466   3e-153   
ref|XP_011097021.1|  PREDICTED: cannabidiolic acid synthase-like        466   4e-153   
ref|XP_008445653.1|  PREDICTED: tetrahydrocannabinolic acid synth...    466   6e-153   
ref|XP_004135724.1|  PREDICTED: reticuline oxidase-like protein-like    466   8e-153   
ref|XP_004135722.1|  PREDICTED: reticuline oxidase-like protein-like    465   8e-153   
gb|KCW44231.1|  hypothetical protein EUGRSUZ_L02344                     463   8e-153   
ref|XP_006490236.1|  PREDICTED: cannabidiolic acid synthase-like ...    465   9e-153   
ref|XP_004135725.1|  PREDICTED: reticuline oxidase-like protein-like    465   1e-152   
gb|KDP34617.1|  hypothetical protein JCGZ_11140                         464   2e-152   
ref|XP_010463012.1|  PREDICTED: reticuline oxidase-like protein         464   2e-152   
gb|KEH31333.1|  FAD-binding berberine family protein                    464   2e-152   
ref|XP_011040519.1|  PREDICTED: cannabidiolic acid synthase-like        464   3e-152   
ref|XP_007211550.1|  hypothetical protein PRUPE_ppa004087mg             463   4e-152   
gb|KHN44659.1|  Reticuline oxidase-like protein                         459   4e-152   
ref|XP_006377947.1|  hypothetical protein POPTR_0011s16580g             463   4e-152   
ref|XP_010098536.1|  Reticuline oxidase-like protein                    464   4e-152   
ref|XP_006421539.1|  hypothetical protein CICLE_v10007159mg             463   4e-152   
emb|CAN81654.1|  hypothetical protein VITISV_003756                     463   4e-152   
ref|XP_007023066.1|  FAD-binding Berberine family protein isoform 1     463   5e-152   
ref|XP_002268361.1|  PREDICTED: tetrahydrocannabinolic acid synthase    463   5e-152   
ref|XP_008445632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    464   6e-152   
ref|XP_003524780.1|  PREDICTED: tetrahydrocannabinolic acid synth...    462   6e-152   
ref|XP_006377923.1|  hypothetical protein POPTR_0011s16350g             463   7e-152   
emb|CAN80105.1|  hypothetical protein VITISV_009716                     460   7e-152   
ref|XP_010657063.1|  PREDICTED: tetrahydrocannabinolic acid synth...    463   8e-152   
ref|XP_006377914.1|  hypothetical protein POPTR_0011s16260g             462   9e-152   
ref|XP_011085179.1|  PREDICTED: reticuline oxidase-like protein         462   1e-151   
gb|EYU19096.1|  hypothetical protein MIMGU_mgv1a004131mg                462   1e-151   
ref|XP_006377921.1|  hypothetical protein POPTR_0011s16330g             462   1e-151   
ref|XP_003524781.1|  PREDICTED: reticuline oxidase-like protein-like    462   1e-151   
ref|XP_004504721.1|  PREDICTED: reticuline oxidase-like protein-like    462   1e-151   
ref|XP_010519037.1|  PREDICTED: reticuline oxidase-like protein         462   1e-151   
gb|ABK94946.1|  unknown                                                 462   1e-151   
ref|XP_008225656.1|  PREDICTED: cannabidiolic acid synthase-like 1      462   1e-151   
gb|KDO52569.1|  hypothetical protein CISIN_1g043814mg                   461   2e-151   
ref|XP_008446963.1|  PREDICTED: tetrahydrocannabinolic acid synth...    462   2e-151   
ref|XP_004242238.1|  PREDICTED: inactive tetrahydrocannabinolic a...    461   2e-151   
ref|XP_010478506.1|  PREDICTED: reticuline oxidase-like protein         461   3e-151   
ref|XP_006377926.1|  hypothetical protein POPTR_0011s16380g             461   4e-151   
ref|XP_002317090.2|  hypothetical protein POPTR_0011s16220g             461   4e-151   
ref|XP_009362290.1|  PREDICTED: reticuline oxidase-like protein         461   5e-151   
ref|XP_010098537.1|  Reticuline oxidase-like protein                    461   5e-151   
ref|XP_010261632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    460   5e-151   
ref|XP_006377916.1|  hypothetical protein POPTR_0011s16280g             461   6e-151   
ref|XP_006377933.1|  FAD-binding domain-containing family protein       459   7e-151   
ref|XP_010261633.1|  PREDICTED: tetrahydrocannabinolic acid synth...    460   8e-151   
ref|XP_003638113.1|  Reticuline oxidase                                 460   9e-151   
ref|XP_011039289.1|  PREDICTED: cannabidiolic acid synthase-like 1      458   1e-150   
ref|XP_007213356.1|  hypothetical protein PRUPE_ppa027050mg             459   1e-150   
ref|XP_007023037.1|  FAD-binding Berberine family protein               459   2e-150   
ref|XP_011039284.1|  PREDICTED: tetrahydrocannabinolic acid synth...    459   2e-150   
ref|XP_003535119.1|  PREDICTED: cannabidiolic acid synthase-like ...    459   3e-150   
ref|XP_011097020.1|  PREDICTED: cannabidiolic acid synthase-like        459   3e-150   
gb|EYU43215.1|  hypothetical protein MIMGU_mgv1a004278mg                458   3e-150   
ref|XP_011037734.1|  PREDICTED: cannabidiolic acid synthase-like 1      458   3e-150   
ref|XP_007023038.1|  FAD-binding Berberine family protein               458   3e-150   
ref|XP_011037721.1|  PREDICTED: cannabidiolic acid synthase-like 1      458   3e-150   
ref|XP_007158992.1|  hypothetical protein PHAVU_002G199000g             458   3e-150   
gb|KDO77597.1|  hypothetical protein CISIN_1g009115mg                   459   4e-150   
ref|XP_002317695.1|  hypothetical protein POPTR_0011s16120g             458   4e-150   
ref|XP_009780565.1|  PREDICTED: reticuline oxidase-like protein         459   4e-150   
ref|XP_002277294.1|  PREDICTED: inactive tetrahydrocannabinolic a...    458   4e-150   
ref|XP_011078508.1|  PREDICTED: cannabidiolic acid synthase-like        458   4e-150   
ref|XP_007023036.1|  FAD-binding Berberine family protein               457   6e-150   
ref|XP_009354035.1|  PREDICTED: inactive tetrahydrocannabinolic a...    457   6e-150   
emb|CDX77568.1|  BnaA07g07060D                                          457   6e-150   
ref|XP_006307227.1|  hypothetical protein CARUB_v10008827mg             457   7e-150   
ref|XP_007023064.1|  FAD-binding Berberine family protein               457   8e-150   
ref|XP_004158101.1|  PREDICTED: reticuline oxidase-like protein-like    456   1e-149   
ref|XP_008365994.1|  PREDICTED: inactive tetrahydrocannabinolic a...    457   1e-149   
ref|XP_006490235.1|  PREDICTED: tetrahydrocannabinolic acid synth...    457   2e-149   
ref|XP_008225673.1|  PREDICTED: reticuline oxidase-like protein         456   2e-149   
ref|XP_009133978.1|  PREDICTED: reticuline oxidase-like protein         456   2e-149   
ref|XP_006448846.1|  hypothetical protein CICLE_v10017782mg             457   2e-149   
ref|XP_006421540.1|  hypothetical protein CICLE_v10007008mg             456   2e-149   
ref|XP_009613445.1|  PREDICTED: tetrahydrocannabinolic acid synth...    457   2e-149   
emb|CAN63058.1|  hypothetical protein VITISV_004191                     456   3e-149   
ref|XP_007213892.1|  hypothetical protein PRUPE_ppa003798mg             456   4e-149   
ref|XP_008807189.1|  PREDICTED: tetrahydrocannabinolic acid synth...    456   4e-149   
ref|XP_006490234.1|  PREDICTED: reticuline oxidase-like protein-like    455   5e-149   
emb|CDY09547.1|  BnaC05g23720D                                          455   6e-149   
ref|XP_002523167.1|  Reticuline oxidase precursor, putative             455   6e-149   
ref|XP_010440562.1|  PREDICTED: reticuline oxidase-like protein         454   6e-149   
ref|XP_003524099.2|  PREDICTED: cannabidiolic acid synthase-like ...    455   8e-149   
emb|CAN63059.1|  hypothetical protein VITISV_004192                     455   8e-149   



>ref|XP_009795338.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=572

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/546 (62%), Positives = 425/546 (78%), Gaps = 19/546 (3%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSV  1675
             S   L FL L    +     +  +YDSF++CL+   A  +P+  +S IVYSP N SF+ +
Sbjct  2     SSCLLPFLVLIFWNSFSHGNSDSIYDSFVNCLT---AKSVPQQEISKIVYSPNNPSFNPI  58

Query  1674  LQAYARNRRF-NTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             LQAY RNRRF N+ ++ KPVIIVTP  ESHV   VLC K+  +++++RSGGHDYEGISY+
Sbjct  59    LQAYIRNRRFFNSSTTSKPVIIVTPTEESHVSSAVLCTKETNLQLKIRSGGHDYEGISYI  118

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             S+  FI+LDMFNLRSI +++     G TAWVQAGATLGELYY IW KS+V GFP GVCPT
Sbjct  119   SNVPFIMLDMFNLRSISINV----NGNTAWVQAGATLGELYYNIWTKSNVLGFPAGVCPT  174

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SGGGYGNM+R+FGL+VD+V+DAR+VDV GR+ DR AMGEDLFWAI GGGG SF
Sbjct  175   VGVGGHLSGGGYGNMLRKFGLSVDNVLDARLVDVNGRIWDRKAMGEDLFWAIKGGGGPSF  234

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GVILAF+I+L++VP+TVTYFR E++L   +N  D V Q+ N A KID  LFIRLLLQ + 
Sbjct  235   GVILAFQIQLVQVPQTVTYFRVERFLD--QNATDAVFQWQNVAHKIDSDLFIRLLLQPIT  292

Query  957   PPTKT------NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIES  796
                K       N    KT+R++++GLFLGDS +L+++++ +FPAL L+KQDC EMSWI+S
Sbjct  293   VKRKEKVKEKKNTQQKKTIRAAFLGLFLGDSSRLMTLVSKEFPALRLQKQDCYEMSWIDS  352

Query  795   MLRWGSFGNGTKPEALLNRTPAGDAS-FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
             +LRW SF N TKP  LLNRT  GD S  LKRKSDY+Q PIP+  L+S+++KM+ LG  G+
Sbjct  353   VLRWASFDNTTKPIVLLNRT--GDLSNLLKRKSDYVQEPIPRDGLESIFQKMISLGKAGI  410

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPF  439
               NPYGGRMAEI   +TPFPHRAG+LFKIQY+V+WKEEG AA++EH+SQIR+L+SF+ PF
Sbjct  411   VFNPYGGRMAEIREDETPFPHRAGILFKIQYSVNWKEEGTAAEKEHLSQIRDLYSFMTPF  470

Query  438   VSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRN  259
             VS+NPRQAYLNYRDLDIGT D G HS EEG+VYG KYF  N++RLVKVKS+VDP NFFRN
Sbjct  471   VSKNPRQAYLNYRDLDIGTNDQGPHSLEEGRVYGTKYFKNNFDRLVKVKSKVDPSNFFRN  530

Query  258   EQSIPS  241
             EQSIP+
Sbjct  531   EQSIPT  536



>gb|EYU19101.1| hypothetical protein MIMGU_mgv1a004329mg [Erythranthe guttata]
Length=532

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/537 (62%), Positives = 413/537 (77%), Gaps = 16/537 (3%)
 Frame = -3

Query  1845  FLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQA  1666
             F+V   L  L    F+    +YD+F+ C +      IP   +SSIVYSP NASF+ VL++
Sbjct  4     FIVLNLLYFLGVLTFASADSVYDNFVQCFAGAK---IPDAQISSIVYSPNNASFAKVLES  60

Query  1665  YARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT  1486
             Y RNRRFN  ++PKP IIVTP   SHV   VLCAKKLGV++++RSGGHDYEGISYVS AT
Sbjct  61    YIRNRRFNVSTTPKPSIIVTPTAASHVSAAVLCAKKLGVQLKIRSGGHDYEGISYVSAAT  120

Query  1485  FIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvg  1306
             F++LDMFN RSIDV++      ETAWVQ GA LGE+YYRIW+KS VHG+P GVCPTVGVG
Sbjct  121   FVVLDMFNFRSIDVNMTD----ETAWVQTGAMLGEVYYRIWQKSKVHGYPAGVCPTVGVG  176

Query  1305  ghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVIL  1126
             GH+SG GYGN++R++GLTVDHVVDA+IVD  GRVL+R  MGEDLFWAI GGGG SF VIL
Sbjct  177   GHISGAGYGNLLRKYGLTVDHVVDAQIVDANGRVLNRQTMGEDLFWAIRGGGGASFAVIL  236

Query  1125  AFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTK  946
             +++IKL+ VP TVT FR EK      N  D V QY     K+D+ LFIR+LLQ   P TK
Sbjct  237   SYQIKLVPVPPTVTVFRIEK--AYDENATDAVFQYQQIVDKMDNDLFIRVLLQ---PITK  291

Query  945   TNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNG  766
                +  ++VR++++GLFLGDS +LL I +S FP LGLKK DC EM WI S+L WG+F N 
Sbjct  292   ---NKKRSVRATFIGLFLGDSSRLLPITDSQFPILGLKKSDCQEMPWINSVLFWGNFDNK  348

Query  765   TKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAE  586
             T P+ALL+RTP    +FLKRKSDY++ PI K  L+SL+ KM+E+G  GL  N YGGRM+E
Sbjct  349   TSPKALLSRTP-DSVNFLKRKSDYVKTPISKSGLESLFAKMVEIGKVGLVFNSYGGRMSE  407

Query  585   IPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLN  406
             IP+++TPFPHRAG L+KIQY+V+W EEGEAAD+ ++ QIR+L SF+APFVS NPRQAYLN
Sbjct  408   IPASETPFPHRAGNLYKIQYSVNWSEEGEAADKNYMDQIRQLFSFMAPFVSSNPRQAYLN  467

Query  405   YRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             YRDLDIGTTD+G +SY EG+VYG KYF GN++RLVK+K+ VDPDN FRNEQSIP+L+
Sbjct  468   YRDLDIGTTDNGKNSYSEGQVYGLKYFKGNFDRLVKIKTAVDPDNVFRNEQSIPTLN  524



>ref|XP_002268606.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=532

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/516 (63%), Positives = 418/516 (81%), Gaps = 18/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+F+ CL++ S +P P    SSIVY+ +N+S+++VLQ+Y RNRRFNT S+PKP+IIVT
Sbjct  34    VYDTFIQCLASHS-DPSPP--ASSIVYNQSNSSYTTVLQSYIRNRRFNTSSTPKPLIIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   +LC+K +G+E+++RSGGHDY+G+SY+SD  F ILD+FNLR+IDV+I    
Sbjct  91    PLVESHVQAAILCSKNVGMEMKIRSGGHDYDGLSYISDIPFFILDLFNLRAIDVNI----  146

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
             G ETAWVQAGATLGELYYRIWEKS +HGFP GV  TVG GGH+SGGGYG M+R++GL++D
Sbjct  147   GDETAWVQAGATLGELYYRIWEKSKLHGFPAGVGQTVGAGGHISGGGYGTMLRKYGLSID  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
              +VDA+IVDV GR+LDR AMGEDLFWAI GGGG SFGVILA+KIKL+ VP+TVT FR ++
Sbjct  207   QLVDAKIVDVNGRILDRKAMGEDLFWAIRGGGGSSFGVILAYKIKLVAVPETVTVFRVQR  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A KID+ LFIR+LLQ    P   N   ++T+R+S+V LFLGD
Sbjct  267   --TLDQNATDLVYKWQLVADKIDNDLFIRVLLQ----PVTVN--KNRTIRASFVSLFLGD  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             + +LLS+++ DFPALGLKK+DC EMSWIES+L W +F NGT P+ALLNRT +   +FLKR
Sbjct  319   AARLLSVMDKDFPALGLKKEDCMEMSWIESVLYWANFDNGTSPDALLNRT-SDSVNFLKR  377

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ +WKKM+E+G TGL  NPYGGRM+EIPS++T FPHRAG ++KIQY
Sbjct  378   KSDYVQTPISKDGLEWMWKKMIEIGKTGLVFNPYGGRMSEIPSSETAFPHRAGNIYKIQY  437

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W EEGE AD+E+++QIR L+S++ PFVS++PR ++LNYRD+DIG T     SY+EGK
Sbjct  438   SVNWSEEGEEADKEYMTQIRRLYSYMTPFVSKSPRGSFLNYRDVDIGVTK--TWSYDEGK  495

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYFM N++RLVKVK+ VDP NFFRNEQSIP L
Sbjct  496   VYGAKYFMNNFDRLVKVKTAVDPTNFFRNEQSIPPL  531



>ref|XP_009630062.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis]
Length=559

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 416/523 (80%), Gaps = 19/523 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF-NTGSSPKPVIIV  1609
             +YDSF++CL+T S   IP+  +S IVYSP+NASF+ +LQAY RNRRF N+ ++ KPVIIV
Sbjct  38    VYDSFVNCLTTKS---IPQSEISKIVYSPSNASFNPILQAYVRNRRFFNSSTTSKPVIIV  94

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP  ESHV   VLC K+  +++ +RSGGHDYEGISY+SD  FI+LDMFNLRSI +++   
Sbjct  95    TPTEESHVSSAVLCTKETNLQLNIRSGGHDYEGISYISDVPFIMLDMFNLRSISINV---  151

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                 TAWVQAGATLGELYY IW KS+V GFP GVCPTVGVGGHVSGGGYGNM+R+FGL+V
Sbjct  152   -NDNTAWVQAGATLGELYYNIWTKSNVLGFPAGVCPTVGVGGHVSGGGYGNMLRKFGLSV  210

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             DHV+DAR+VDV GR+LDR AMGEDLFWAI GGGG SFGVILAF+I+L++VP+TVTYFR E
Sbjct  211   DHVLDARLVDVNGRILDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVQVPQTVTYFRVE  270

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP------PPTKTNDSNSKTVRSSY  907
             ++L   +N  D V Q+ N  +KID+ LFIRLL+Q +              +  K++R ++
Sbjct  271   RFLN--QNATDAVLQWQNVVNKIDNDLFIRLLVQPITVKNKEKKVKGKKKAQQKSIRVTF  328

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
             + LFLGDS +L+S+++++ PALGL KQDC EM+WI+S+L+W +F N TKP ALLNRT  G
Sbjct  329   IALFLGDSSRLISLVSNELPALGLTKQDCFEMNWIDSVLQWANFDNTTKPIALLNRT--G  386

Query  726   DA-SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
             D  +FLKRKSDY+Q PIP+  L+S+++KM+ LG  GL  NPYGGRMAEIP  +TPFPHRA
Sbjct  387   DPLNFLKRKSDYVQEPIPRGRLESIFQKMISLGKAGLVFNPYGGRMAEIPEGETPFPHRA  446

Query  549   GVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG  370
             G+LFK+QY+V+W EEG AA++E+++QIR+L+SF+ PFVS+NPRQAYLNYRDLDIGT D G
Sbjct  447   GILFKMQYSVNWNEEGAAAEKEYLTQIRDLYSFMTPFVSKNPRQAYLNYRDLDIGTNDQG  506

Query  369   LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
              HS EE +VYG  YF  N++RLVKVKS VD  NFFRNEQSIP+
Sbjct  507   PHSLEEARVYGTMYFKNNFDRLVKVKSAVDSTNFFRNEQSIPT  549



>emb|CAN81650.1| hypothetical protein VITISV_003752 [Vitis vinifera]
Length=532

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/516 (63%), Positives = 416/516 (81%), Gaps = 18/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+F+ CL++ S +P P    SSIVY+  N+S+++VLQ+Y RNRRFNT S+PKP+IIVT
Sbjct  34    VYDTFIQCLASHS-DPSPP--ASSIVYNQXNSSYTTVLQSYIRNRRFNTSSTPKPLIIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   +LC+K +G+E+++RSGGHDY+G+SY+SD  F ILD+FNLR+IDV+I    
Sbjct  91    PLVESHVQAAILCSKNVGMEMKIRSGGHDYDGLSYISDIPFFILDLFNLRAIDVNI----  146

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
             G ETAWVQAGATLGELYYRIWEKS +HGFP GVCPTVG GGH+SGGGYGNM+R++GL++D
Sbjct  147   GDETAWVQAGATLGELYYRIWEKSKLHGFPAGVCPTVGAGGHISGGGYGNMLRKYGLSID  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
              +VDA+IVDV GR+LDR AMGEDLFWAI GGG  SFGV+LA+KIKL+ VP+TVT FR E+
Sbjct  207   QLVDAKIVDVNGRILDRKAMGEDLFWAIRGGGASSFGVVLAYKIKLVAVPETVTVFRVER  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A KID+ LFIR+LLQ    P   N   ++T+R+S+V LFLGD
Sbjct  267   --TLDQNATDLVYKWQLVADKIDNDLFIRVLLQ----PVTVN--KNRTIRASFVSLFLGD  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             + +LLS+++ DFPALGLKK+DC EMSWIES+L W +F NGT  +ALLNR  +   +FLKR
Sbjct  319   AARLLSVMDKDFPALGLKKEDCMEMSWIESVLYWANFDNGTSADALLNRI-SDSVNFLKR  377

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ +WKKM+ +G TGL  NPYGGRM+EIPS++T FPHRAG ++KIQY
Sbjct  378   KSDYVQTPISKDGLEWMWKKMIAIGKTGLVFNPYGGRMSEIPSSETAFPHRAGNIYKIQY  437

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W EEGE AD+E+++QIR L+S++ PFVS++PR ++LNYRD+DIG T     SY+EGK
Sbjct  438   SVNWSEEGEEADKEYMTQIRRLYSYMTPFVSKSPRGSFLNYRDVDIGVTKT--WSYDEGK  495

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYFM N++RLVKVK+ VDP NFFRNEQSIP L
Sbjct  496   VYGAKYFMNNFDRLVKVKTAVDPTNFFRNEQSIPPL  531



>ref|XP_003631731.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/525 (62%), Positives = 417/525 (79%), Gaps = 14/525 (3%)
 Frame = -3

Query  1812  TSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGS  1633
             +S  SG+I  Y++F+ CLS  S+   P D  SSIVY+  N+SF++VLQ+Y RN+RFN  S
Sbjct  23    SSATSGSI--YENFVQCLSKHSS---PFDQASSIVYAQTNSSFTNVLQSYIRNQRFNAFS  77

Query  1632  SPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRS  1453
             +PKP+IIVTP  ES V   ++C++ +G+++R+RSGGHDY+G+SYVSD  F ILDMFNLRS
Sbjct  78    TPKPLIIVTPSDESQVQAAIICSRDIGIQLRIRSGGHDYDGLSYVSDVPFFILDMFNLRS  137

Query  1452  IDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNM  1273
             I+V+I      ETAWVQAGATLGELYY+IWEKS VHGFP GVCPTVGVGGH+SGGGYGNM
Sbjct  138   INVNITD----ETAWVQAGATLGELYYKIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNM  193

Query  1272  IRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPK  1093
             +RR+GL++DH+VDA+IV+V G +LDR +MGEDLFWAI GGGG SFGVIL++K+KL+RVP+
Sbjct  194   LRRYGLSIDHIVDAQIVNVNGYILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPE  253

Query  1092  TVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRS  913
              VT FR EK   L +N  D+V Q+ +   KID+ LF RLLLQ  P   K+++ ++KTVR 
Sbjct  254   IVTVFRVEK--TLAQNATDIVYQWQHITDKIDNDLFTRLLLQ--PITVKSDNGSAKTVRV  309

Query  912   SYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTP  733
             +++ LFLGDS +L+S++N DFP LGLKK+DC EMSWIES+L W +F NGT  + LLNRT 
Sbjct  310   TFISLFLGDSTRLISVMNKDFPELGLKKEDCMEMSWIESVLYWANFDNGTSVDVLLNRT-  368

Query  732   AGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHR  553
             +   +FLKRKSDY+Q PI +  L+ LWKK++ELG  G+  N YGGRM+EIP+++TPFPHR
Sbjct  369   SDSVNFLKRKSDYVQKPISRDDLEGLWKKIIELGKPGMVFNSYGGRMSEIPASETPFPHR  428

Query  552   AGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDH  373
             AG +FKIQY+VSW +EG  AD+EH++ IREL+S++ P VS+ PR AYLNYRD+DIG + +
Sbjct  429   AGNIFKIQYSVSWHDEGAEADKEHMNLIRELYSYMTPLVSKTPRGAYLNYRDVDIGISHN  488

Query  372   GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G  SY+EGKVYG +YFM N++RLVKVK+ VDP NFFR EQSIP L
Sbjct  489   GKDSYQEGKVYGVQYFMNNFDRLVKVKTAVDPQNFFRYEQSIPPL  533



>ref|XP_009795337.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=559

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/523 (63%), Positives = 415/523 (79%), Gaps = 19/523 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF-NTGSSPKPVIIV  1609
             +YDSF++CL+T S   IP+  +S IVYSP NASF+ +LQAY RNRRF N+ ++ KPVIIV
Sbjct  38    VYDSFVNCLTTKS---IPQSEISKIVYSPNNASFNPILQAYVRNRRFFNSSTTSKPVIIV  94

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP  ESHV   VLC K+  +++++RSGGHDYEGISY+SD  FI+LDMFNLRSI +++   
Sbjct  95    TPTEESHVSSAVLCTKETNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISINV---  151

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                 TAWVQAGATLGELYY IW KS+V GFP GVCPTVGVGGH+SGGGYGNM+R+FGL+V
Sbjct  152   -NDNTAWVQAGATLGELYYNIWTKSNVLGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSV  210

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DAR+VDV GR+ DR AMGEDLFWAI GGGG SFGVILAF+I+L++VP+TVTYFR E
Sbjct  211   DNVLDARLVDVNGRIWDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVQVPQTVTYFRVE  270

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP------PPTKTNDSNSKTVRSSY  907
             ++L   +N  D V Q+ N  +KID+ LFIRLL+Q +              +  K++R ++
Sbjct  271   RFLD--QNATDAVLQWQNVVNKIDNDLFIRLLVQPITVKNKEKKVKGKKKAQQKSIRVTF  328

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
             + LFLGDS +L+S+++++ PALGL KQDC EMSWI+S+L+W +F N TKP ALLNRT  G
Sbjct  329   IALFLGDSSRLISLVSNELPALGLTKQDCFEMSWIDSVLQWANFDNTTKPIALLNRT--G  386

Query  726   DA-SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
             D  +FLKRKSDY+Q PIP+  L+S+++KM+ LG  G+  NPYGGRMAEI   +TPFPHRA
Sbjct  387   DPLNFLKRKSDYVQEPIPRDGLESIFQKMISLGKAGIVFNPYGGRMAEIAEGETPFPHRA  446

Query  549   GVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG  370
             G+LFKIQY+V+W EEG AA++E+++QI +L+SF+ PFVS+NPRQAYLNYRDLDIGT D G
Sbjct  447   GILFKIQYSVNWNEEGAAAEKEYLTQIGDLYSFMTPFVSKNPRQAYLNYRDLDIGTNDQG  506

Query  369   LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
              HS EEG+VYG  YF  N++RLVKVKS VDP NFFRNEQSIP+
Sbjct  507   PHSLEEGRVYGTMYFKNNFDRLVKVKSAVDPTNFFRNEQSIPT  549



>ref|XP_011096699.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/515 (63%), Positives = 405/515 (79%), Gaps = 16/515 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+YDSF+ C +    N IP   +SSI+Y+P N SF++VL++Y RNRRFN  ++PKP IIV
Sbjct  23    PVYDSFVQCFT---ENKIPDSQISSILYTPENPSFTNVLESYVRNRRFNVSTTPKPNIIV  79

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP  E+HV   VLCAKKLG+++++RSGGHDYEGISYVSD TF+ILDMFN RSI+V++   
Sbjct  80    TPTSEAHVSAAVLCAKKLGIQLKIRSGGHDYEGISYVSDTTFVILDMFNFRSINVNMED-  138

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                ETAWVQ+GA LGELYYRIWEKS VHGFP GVCPTVGVGGH+SG GYGNM+R++GLTV
Sbjct  139   ---ETAWVQSGALLGELYYRIWEKSKVHGFPAGVCPTVGVGGHISGAGYGNMLRKYGLTV  195

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             DHV+DA+IVD  GRVLDR +MGEDLFWAI GGGG SFGVILA+KIKL+ VP TVT FR E
Sbjct  196   DHVIDAQIVDSNGRVLDRESMGEDLFWAIRGGGGASFGVILAYKIKLVPVPPTVTVFRLE  255

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   +  N  + V QY     K+D+ LFIR+LLQ   P T+   +  ++VR++++GLFLG
Sbjct  256   K--SVDENAIEAVFQYQQVVDKLDNDLFIRVLLQ---PITR---NKKRSVRATFIGLFLG  307

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLK  709
             DS +LLSI  S+FP L LKK DC EMSWI S+L WG+F N T P  LL+R P    +FLK
Sbjct  308   DSTRLLSITGSEFPKLELKKSDCHEMSWINSVLFWGNFDNTTSPNVLLSRNP-DSVNFLK  366

Query  708   RKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQ  529
             RKSDY++ PI    L+SL+KKM+E+G  G+  N YGGRM+EIP ++TPFPHRAG +FKIQ
Sbjct  367   RKSDYVKTPISISGLESLFKKMVEIGKVGMVFNSYGGRMSEIPESETPFPHRAGNIFKIQ  426

Query  528   YAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEG  349
             Y+V+W EE E AD +++ QIR+L+SF+ PFVS+NPR+AYLNYRDLDIGTT++G +SY EG
Sbjct  427   YSVNWNEEDEEADNKYVDQIRQLYSFMEPFVSKNPREAYLNYRDLDIGTTNNGKNSYSEG  486

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             +VYG KYF  N++RLV++K+ VDP+N FRNEQSIP
Sbjct  487   QVYGVKYFKSNFDRLVRIKTTVDPENVFRNEQSIP  521



>ref|XP_011085609.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/529 (62%), Positives = 410/529 (78%), Gaps = 25/529 (5%)
 Frame = -3

Query  1809  SCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSS  1630
             + F+   P+YDSFL C +    N IP+D +S I+YSP N SF++VL +Y RNRRFN  ++
Sbjct  17    NAFASPQPVYDSFLQCFA---QNKIPRDQISRILYSPNNPSFTTVLVSYIRNRRFNVSTT  73

Query  1629  PKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSI  1450
             PKP  I+TP  ESHV   VLC+K+LGV+I++RSGGHDYEGISYVSD  F+ILDMFN RSI
Sbjct  74    PKPSTIITPTVESHVTVSVLCSKQLGVQIKIRSGGHDYEGISYVSDKDFVILDMFNFRSI  133

Query  1449  DVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMI  1270
             +V +      +TAWVQ+GA LGELYYRIWEKS+V GFP GVCPTVGVGGH+SGGGYGNM+
Sbjct  134   NVSLED----QTAWVQSGALLGELYYRIWEKSNVLGFPAGVCPTVGVGGHISGGGYGNML  189

Query  1269  RRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKT  1090
             R++GLTVDHV+DARIVD KGRVLDR +MGEDLFWAI GGGG SFGVILA+KIKL+ VP  
Sbjct  190   RKYGLTVDHVIDARIVDAKGRVLDRKSMGEDLFWAIRGGGGASFGVILAYKIKLVPVPPI  249

Query  1089  VTYFRAEKYLGLTRNFND----VVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKT  922
             VT FR E      RN+N+     VS+Y     KID+ LFIR+LLQ    P   N  ++++
Sbjct  250   VTVFRVE------RNYNENAVEAVSKYQQVIDKIDNDLFIRVLLQ----PITVN--STRS  297

Query  921   VRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLN  742
             VR++++GLFLG++++LL I +S FP LGLKK DC+EM WI S+L W +F N T P  LLN
Sbjct  298   VRATFIGLFLGNADRLLPITDSQFPELGLKKPDCTEMPWINSVLYWANFDNTTSPSVLLN  357

Query  741   RTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPF  562
             RTP    +FLKRKSDY++ PI K  L+SL+ KM+E+G  GL  N YGG M++IP + TPF
Sbjct  358   RTP-DSVNFLKRKSDYVKTPIAKEGLESLFNKMVEIGKVGLVFNSYGGIMSQIPESATPF  416

Query  561   PHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGT  382
             PHRAG ++KIQY+V+WKEEGEAAD+ +I QIREL+SF+ PFVS+ PR+AYLNYRDLDIGT
Sbjct  417   PHRAGNIYKIQYSVNWKEEGEAADKNYIKQIRELYSFMTPFVSKQPREAYLNYRDLDIGT  476

Query  381   TDHGLHSYEEGKVYGHKYFM-GNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +D+  +SYE+GKVYG KYF   N++RLVK+K+ VDPDN FRNEQSIP L
Sbjct  477   SDNSKNSYEQGKVYGLKYFKPNNFDRLVKIKTIVDPDNVFRNEQSIPVL  525



>ref|XP_010648252.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/516 (61%), Positives = 411/516 (80%), Gaps = 12/516 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y++F+ CLS  S+   P D  SSIVY+  N+SF++ LQ+Y RN+RFN  S+PKP+IIVT
Sbjct  30    IYENFVQCLSKYSS---PFDQASSIVYAQTNSSFTNALQSYIRNQRFNAFSTPKPLIIVT  86

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ES V   ++C++++G+++R+RSGGHDY+G+SYVSD  F ILDMFNLRS++V+I    
Sbjct  87    PSDESQVQAAIICSRRIGIQLRIRSGGHDYDGLSYVSDVPFFILDMFNLRSVNVNITD--  144

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQAGATLGELYY+IWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+RR+GL++D
Sbjct  145   --ETAWVQAGATLGELYYKIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMLRRYGLSID  202

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             H+VDA+IV+V G +LDR +MGEDLFWAI GGGG SFGVIL++K+KL+RVP+ VT FR EK
Sbjct  203   HIVDAQIVNVNGYILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPEIVTVFRVEK  262

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V Q+ +   KID+ LF RLLLQ  P   K+++ ++KTVR +++ LFLGD
Sbjct  263   --TLAQNATDIVYQWQHITDKIDNDLFTRLLLQ--PITVKSDNGSAKTVRVTFISLFLGD  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             S +L+S++N DFP LGLKK+DC EMSWIES+L W +F NGT  + LLNRT +   +FLKR
Sbjct  319   STRLISVMNKDFPELGLKKEDCMEMSWIESVLYWANFDNGTSVDVLLNRT-SDSVNFLKR  377

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI +  L+ LWKK++ELG  G+  N YGGRM+EIP+++T FPHRAG +FKIQY
Sbjct  378   KSDYVQKPISRDDLEGLWKKIIELGKPGMVFNSYGGRMSEIPASETAFPHRAGNIFKIQY  437

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +VSW +EG  AD+EH++ IREL+S++ P VS++PR AYLNYRD+DIG + +G  S +EG+
Sbjct  438   SVSWHDEGAEADKEHMNLIRELYSYMTPLVSKSPRGAYLNYRDVDIGISHNGKDSCQEGR  497

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG +YFM N++RLVKVK+ VDP NFFR EQSIP L
Sbjct  498   VYGVQYFMNNFDRLVKVKTAVDPQNFFRYEQSIPPL  533



>emb|CDP12590.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/525 (61%), Positives = 406/525 (77%), Gaps = 14/525 (3%)
 Frame = -3

Query  1806  CFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSP  1627
             C + +  +YD+F  CL+    N IP   +  I+YSP N SFSSVLQAY RN RFNT S+ 
Sbjct  21    CIAASHSIYDNFAACLT---KNGIPSGQIPKILYSPTNTSFSSVLQAYVRNLRFNTSSTK  77

Query  1626  KPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSID  1447
             KP IIVTPL   HV   VLC K  G+E+++RSGGHDYEGISYVSD  FIILDMFNLRSI 
Sbjct  78    KPSIIVTPLEIPHVQAAVLCTKGTGLELKIRSGGHDYEGISYVSDVPFIILDMFNLRSIH  137

Query  1446  VDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIR  1267
             VDI      ETAWVQAGAT+GELYYRIWEKS+ +GFP G+CPT+G+GGH+SGGGYG M+R
Sbjct  138   VDIPS----ETAWVQAGATVGELYYRIWEKSNAYGFPAGLCPTLGLGGHISGGGYGAMLR  193

Query  1266  RFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTV  1087
             RFGL+VD+V+DA+IVDVKG+VLDR AMGEDLFWAI GGGG SFGV+LA+K+KL++VP+ V
Sbjct  194   RFGLSVDNVLDAQIVDVKGQVLDRKAMGEDLFWAIRGGGGASFGVVLAYKLKLVQVPEIV  253

Query  1086  TYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSN-SKTVRSS  910
             T F  ++      N  D++ ++ N A KID+ LFIR+L+Q  P  +K   S   K +R +
Sbjct  254   TVFNVQRTEA--ENATDILVKWQNVADKIDNGLFIRVLVQ--PITSKGGKSKGQKIIRLT  309

Query  909   YVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPA  730
             ++ L+LGDS+ L+S++N+ FP LGLKK DC E SWI+SML W +F  G KPE LLNRT  
Sbjct  310   FIALYLGDSKSLMSVMNAGFPELGLKKSDCKEGSWIQSMLFWSNFDIGAKPELLLNRT--  367

Query  729   GDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
              D +FLKRKSDY+Q PIPK  L S++KKM++LG  GL  NPYGGRM+EIP+ +TPFPHRA
Sbjct  368   SDVNFLKRKSDYVQTPIPKDALTSIFKKMVQLGKPGLVFNPYGGRMSEIPANETPFPHRA  427

Query  549   GVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG  370
             G+++KIQY+V+W++        +I+Q REL+SF+ P+VS NPRQA+LNYRDLDIGTTD+G
Sbjct  428   GIIYKIQYSVNWEDGSPNITNHYIAQARELYSFMTPYVSSNPRQAFLNYRDLDIGTTDNG  487

Query  369   LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
              +SY EG+VYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP++S
Sbjct  488   KNSYSEGEVYGRKYFKDNFDRLVKVKTLVDPENFFRNEQSIPTVS  532



>ref|XP_008225664.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=584

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/566 (58%), Positives = 426/566 (75%), Gaps = 15/566 (3%)
 Frame = -3

Query  1893  QKHKTRHDTMMSSSPVFL--VFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLV  1720
             Q H     TM S+ P  L    L +   +++ ++ +  +YD+F+ CL+T  AN      +
Sbjct  10    QTHNKLSITMRSAMPRILPLAVLFVVFYVSASWAASGSVYDNFVQCLNT-KANSSSSTPL  68

Query  1719  SSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIR  1540
             ++IV++  N S++SVL+AY RN RFN  S+PKPV+I+TP  ESHV   VLCAK+LG++++
Sbjct  69    ANIVFAQNNPSYTSVLRAYIRNSRFNKTSTPKPVLIITPSAESHVQASVLCAKQLGIQLK  128

Query  1539  VRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWE  1360
             +RSGGHDYEG+SY SD TFI+LDMFNLRSI VDI  G    + W QAGATLGE+YYRIWE
Sbjct  129   IRSGGHDYEGVSYWSDQTFIVLDMFNLRSIAVDIKDG----SVWAQAGATLGEMYYRIWE  184

Query  1359  KSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGE  1180
             KS VHGFP GVC TVGVGGH+SGGGYGNM+R++GL VD+V+DA+IVDV+GR+LDR +MGE
Sbjct  185   KSKVHGFPAGVCETVGVGGHISGGGYGNMLRKYGLAVDNVIDAQIVDVQGRLLDRKSMGE  244

Query  1179  DLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKI  1000
             DLFWAI GGGGGSFGVI+++K+KL+ VP+ VT FR E+   L  N   VV ++   A   
Sbjct  245   DLFWAIKGGGGGSFGVIISYKLKLVSVPEIVTVFRVER--TLEENATAVVLKWQEVAPTT  302

Query  999   DDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDC  820
             DD LF+R+LLQ   P T       KTVR S +  FLG++++L+ +L  +FP LGLKK++C
Sbjct  303   DDGLFMRMLLQ---PVTSKVKKGEKTVRISILAEFLGNADQLVLLLGKEFPELGLKKENC  359

Query  819   SEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKML  640
              EMSWI+S+L W +F NGTKPEALLNR P  DA+FLKRKSDY+Q PI K  L+ LWKKM+
Sbjct  360   MEMSWIDSVLWWANFDNGTKPEALLNRNP-NDANFLKRKSDYVQTPISKDGLEWLWKKMI  418

Query  639   ELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIREL  460
             ELG TGL  NPYGG+M++I +++TPFPHRAG LFKIQY+V+W++ GE +++ +++Q R L
Sbjct  419   ELGKTGLVFNPYGGKMSQILASETPFPHRAGNLFKIQYSVNWEDAGEDSEKNYLTQSRRL  478

Query  459   HSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVD  280
             +S++ PFVS+NPR A+LNYRDLDIG    G +SYEEGKVYG KYF  N++RL+KVK+ VD
Sbjct  479   YSYMTPFVSKNPRSAFLNYRDLDIGINTFGDNSYEEGKVYGLKYFNDNFDRLLKVKTAVD  538

Query  279   PDNFFRNEQSIPSL--SRNQTGSESC  208
             P+NFFRNEQSIP+L    +   S SC
Sbjct  539   PENFFRNEQSIPTLPNGNSDVNSGSC  564



>ref|XP_010051873.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=537

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/548 (60%), Positives = 414/548 (76%), Gaps = 17/548 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNL-LTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             + S S +F +   L +L L+  ++ +  +YD+FL CL+  S    P   +S IVYS AN+
Sbjct  4     LFSLSALFALLFILVSLHLSPSWAASNSVYDTFLQCLTHRSQ---PSHQISDIVYSQANS  60

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             SF+SVL +Y RNRRFN+ S+PKP++IVTP  ESHV   VLC+K LGV +++RSGGHDYEG
Sbjct  61    SFASVLVSYIRNRRFNSSSTPKPLVIVTPTRESHVQAAVLCSKDLGVHLKIRSGGHDYEG  120

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             ISYVSD  F ILDMFNLRSIDVDI      ETAWVQAGATLGELYYRIWEKS +HGFP G
Sbjct  121   ISYVSDDAFFILDMFNLRSIDVDIQK----ETAWVQAGATLGELYYRIWEKSKLHGFPAG  176

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             +C TVGVGGH+SGGGYGNM+R++GL+VD+V+DAR+VDV+GR+LDR AMGEDLFWAI GGG
Sbjct  177   ICRTVGVGGHLSGGGYGNMLRKYGLSVDNVLDARMVDVQGRILDRKAMGEDLFWAILGGG  236

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGVILA+++ L+ VP+ VT FR EK   L +N  D+V ++   A   D  LF+RLLL
Sbjct  237   GASFGVILAYQVNLVPVPEKVTVFRVEK--TLDQNATDLVYKWQFVAPSTDHGLFMRLLL  294

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T       KT+R+S V LFLG+S++LL+I + + P +GLKK++C+E+SWIES+L
Sbjct  295   Q---PVTSKTQKEQKTLRASVVTLFLGNSDQLLAITDKELPEMGLKKENCTELSWIESVL  351

Query  789   RWGSFGNGTKP--EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLA  616
              W  F  G  P  E +L R      +FLKRKSDY+Q PI K  LD LWKKM+ELG  GL 
Sbjct  352   WWDGFDEGNIPALETMLRRDYP--TNFLKRKSDYVQTPISKANLDQLWKKMIELGKVGLV  409

Query  615   VNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFV  436
              NPYGGRM+EIP++ TPFPHRAG LFKIQY+++W E+    ++ +++QIR L+++  PFV
Sbjct  410   FNPYGGRMSEIPASATPFPHRAGNLFKIQYSINWSEDDPELEKNYLAQIRSLYNYTTPFV  469

Query  435   SRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             S+NPR AYLNYRDLDIGT+ +G +SYEEG+VYG KYF  N+ERLVKVK+ VDP+NFFRNE
Sbjct  470   SKNPRSAYLNYRDLDIGTSTNGKNSYEEGQVYGVKYFNDNFERLVKVKTAVDPNNFFRNE  529

Query  255   QSIPSLSR  232
             QSIP L +
Sbjct  530   QSIPPLPK  537



>ref|XP_002270139.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=539

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/522 (60%), Positives = 408/522 (78%), Gaps = 12/522 (2%)
 Frame = -3

Query  1803  FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPK  1624
             ++ +  +YD+F+ CLS  SA   P    SSIVY+  N+SF++VL++Y RN RFNT S+PK
Sbjct  23    YAASDSVYDTFVQCLSNHSA---PSHQASSIVYAQTNSSFTNVLRSYIRNERFNTSSTPK  79

Query  1623  PVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDV  1444
             P+IIVTP  ES V   ++C++ +G+ +++RSGGHDY+G+S VSD  F ILDMFNLRSI+V
Sbjct  80    PLIIVTPSDESQVQAAIICSRDIGILLKIRSGGHDYDGLSSVSDVPFFILDMFNLRSINV  139

Query  1443  DIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRR  1264
             +I      ETAWVQAGATLGELYYRIWEKS VHGFP GVCPT+GVGGH+SGGGYGNM+R+
Sbjct  140   NITD----ETAWVQAGATLGELYYRIWEKSRVHGFPAGVCPTLGVGGHLSGGGYGNMLRK  195

Query  1263  FGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVT  1084
             +GL++DH+VDA+I++V G +LDR +MGEDLFWAI GGGG SFGVIL++K+KL+RVP+ VT
Sbjct  196   YGLSIDHIVDAQIINVNGSILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPEIVT  255

Query  1083  YFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYV  904
              FR EK   L +N  D+V Q+ +   KID+ LF+RLLLQ  P   K+++ +SKTVR +++
Sbjct  256   VFRVEK--TLAQNATDLVYQWQHITDKIDNDLFMRLLLQ--PITVKSDNGSSKTVRVTFI  311

Query  903   GLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGD  724
              LFLGD+ +L+S++N DFP LGLKK+DC EMSWIES+L W +F N T    LLNRT    
Sbjct  312   SLFLGDATRLISVMNKDFPELGLKKEDCKEMSWIESVLYWANFDNRTSVNVLLNRTLES-  370

Query  723   ASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGV  544
               F K KSDY+Q P+ K  L+ LWKKM+ELG  G+  N YGGRM+EIP+++TPFPHRAG 
Sbjct  371   VKFFKAKSDYMQKPMSKDGLEGLWKKMIELGKPGMVFNSYGGRMSEIPASETPFPHRAGN  430

Query  543   LFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLH  364
             +FKIQY+V+W EEG  AD+++++ IRELHS++ P VS++PR +YLNYRD+DIG + +G  
Sbjct  431   IFKIQYSVNWHEEGTEADKKYVNLIRELHSYMTPLVSKSPRGSYLNYRDIDIGISHNGKD  490

Query  363   SYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             SY+EGKVYG KYFM N++RLVKVK+ VDP NFFR EQSIP L
Sbjct  491   SYQEGKVYGVKYFMNNFDRLVKVKTAVDPQNFFRYEQSIPPL  532



>ref|XP_010051871.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75704.1| hypothetical protein EUGRSUZ_D00078 [Eucalyptus grandis]
Length=538

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/548 (59%), Positives = 416/548 (76%), Gaps = 16/548 (3%)
 Frame = -3

Query  1869  TMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             T +S+    L+F+ +   L+  ++ +  +YD+FL CL+  +    P D +S IVYS AN+
Sbjct  5     TSLSALSAVLLFIVVSLHLSPSWAASDSVYDTFLQCLTHRTQ---PSDHISDIVYSRANS  61

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             SF++VL +Y RNRRFN+ S+PKP++IVTP  ESHV   VLC+K LG+ +++RSGGHDYEG
Sbjct  62    SFANVLVSYVRNRRFNSSSTPKPLVIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEG  121

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             ISYVSD  F ILDMFNLRSI+V+I      ETAWVQAGATLGELYYRIWEKS +HGFP G
Sbjct  122   ISYVSDDAFFILDMFNLRSINVNIQK----ETAWVQAGATLGELYYRIWEKSKLHGFPAG  177

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             VCPTVGVGGH SG GYGNM+R++GL+VD+V+DAR+VDV+GR+LDR AMGEDLFWAI GGG
Sbjct  178   VCPTVGVGGHFSGAGYGNMLRKYGLSVDNVLDARMVDVRGRILDRKAMGEDLFWAIIGGG  237

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGVIL ++IKL+ VP+ VT FR EK   L +N  D+V ++   A + D  LF+RLLL
Sbjct  238   GASFGVILGYQIKLVPVPEKVTVFRVEK--TLDQNATDLVYKWQFVAPRTDHGLFMRLLL  295

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T       KT+R++ V LFLG+S++LL+I + + P +GLKK++C+E+SWIES+L
Sbjct  296   Q---PVTSQTQKGQKTLRATVVTLFLGNSDQLLAITDKELPEMGLKKENCTELSWIESVL  352

Query  789   RWGSFGNGTKP--EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLA  616
              W  F  GT P  E LL+R  +   +FLKRKSDY+Q PI K  LD LWKKM+ELG  GL 
Sbjct  353   WWDGFDEGTIPALETLLSRDDS--TNFLKRKSDYVQTPISKANLDWLWKKMIELGKVGLV  410

Query  615   VNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFV  436
              NPYGGRM+EIPS+ TPFPHRAG LFKIQY+V+W E+    ++ +++QIR L+++  PFV
Sbjct  411   FNPYGGRMSEIPSSATPFPHRAGNLFKIQYSVNWSEDDPELEKNYLAQIRSLYNYTTPFV  470

Query  435   SRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             S+NPR  YLNYRDLDIGT+  G +SYEEG+VYG KYF  N+ERLVKVK+ VDP+NFFRNE
Sbjct  471   SKNPRSTYLNYRDLDIGTSTDGKNSYEEGQVYGVKYFNDNFERLVKVKTAVDPNNFFRNE  530

Query  255   QSIPSLSR  232
             QSIP L +
Sbjct  531   QSIPPLPK  538



>ref|XP_004231557.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=541

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 412/524 (79%), Gaps = 14/524 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF-NTGSSPKPVIIV  1609
             ++D+F+ CL+    N IP+  +S IVY+P N SF+S+LQAY RN RF N+ ++ KPVIIV
Sbjct  25    VFDTFVDCLT---KNSIPQSEISKIVYTPNNLSFNSILQAYIRNGRFFNSSTTSKPVIIV  81

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP  ES V  VV+C K+L +++++RSGGHDYEGISY+SD  FI+LDMFNLRSI +D    
Sbjct  82    TPTVESQVAGVVVCTKQLNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISIDT---  138

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
               G+TAWVQAGA LGE+YY IW KS V G+P GVCPTVGVGGHVSGGGYGNM+R+FGLTV
Sbjct  139   -NGKTAWVQAGAILGEVYYNIWRKSPVLGYPAGVCPTVGVGGHVSGGGYGNMLRKFGLTV  197

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+++DAR+VDV GR+LDR AMGEDLFWAI GGGG SFGVILAF+I+L+ +P+TVTYFR E
Sbjct  198   DNLLDARLVDVNGRILDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVTLPQTVTYFRVE  257

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ-IVPPPTKTNDSNSKTVRSSYVGLFL  892
             +++  T    D V Q+ N ASKID+ L+IRLL+Q I          +SK++R+++V LFL
Sbjct  258   RFIQDTTT-TDAVVQWQNVASKIDNDLYIRLLIQPITVKSKSKGAKSSKSIRATFVALFL  316

Query  891   GDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA-SF  715
             GDS +L+S+++  FP LGLKKQDC EMSWI+S+L+W +F N TKPEALLNR   GD  + 
Sbjct  317   GDSTRLMSLISKQFPLLGLKKQDCVEMSWIDSVLQWANFDNTTKPEALLNR--KGDPLTH  374

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY+Q PIPK  L+S++ KM+ LG  G+  NPYGGRM EI   +TPFPHRAG+LFK
Sbjct  375   LKRKSDYVQTPIPKKELESIFAKMISLGKAGMVFNPYGGRMGEIAEGETPFPHRAGILFK  434

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDH-GLHSY  358
             IQY+++W EEG  A++E++SQIR+L+SF+ P+VS+NPRQAYLNYRDLDIG  D    HS 
Sbjct  435   IQYSMNWHEEGLTAEKEYLSQIRDLYSFMTPYVSKNPRQAYLNYRDLDIGINDQVSQHSL  494

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQ  226
             E+G+VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP+ ++ +
Sbjct  495   EKGRVYGTKYFNKNFDRLVKVKTMVDPQNFFRNEQSIPTQTKQR  538



>gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis]
Length=539

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/530 (59%), Positives = 409/530 (77%), Gaps = 19/530 (4%)
 Frame = -3

Query  1809  SCFSGTI------PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRR  1648
             SCFS          +Y+SFL CL     N  P+D +S++VYS  NAS++SVL+AY RN R
Sbjct  19    SCFSSLTCAATDDSVYESFLQCLEN---NTNPQDQISTLVYSQTNASYTSVLRAYIRNAR  75

Query  1647  FNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDM  1468
              NT ++PKPVII+TP   SHV   V+C K +G ++++RSGGHDYEGISY+SD  F +LDM
Sbjct  76    MNTSTTPKPVIILTPKQISHVQAAVICTKSVGYQLKIRSGGHDYEGISYISDVPFFVLDM  135

Query  1467  FNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgg  1288
             FNLRSID+D+      E+AW+Q+GATLGE+YYRIWEKS  HGFP G+CPTVGVGGH SGG
Sbjct  136   FNLRSIDIDVKN----ESAWIQSGATLGEVYYRIWEKSKAHGFPAGICPTVGVGGHFSGG  191

Query  1287  gyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKL  1108
             GYGNM+R++GL VD+V+DA+IVDV G++LDR AMGEDLFWAI GGGGGSFGVI+++KI L
Sbjct  192   GYGNMLRKYGLAVDNVLDAQIVDVNGKLLDRKAMGEDLFWAIRGGGGGSFGVIISYKISL  251

Query  1107  LRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNS  928
             + VP+TVT FR E+   L  N  D+V ++   A K D+ LF+R+LLQ   P T   +   
Sbjct  252   VPVPETVTVFRVER--TLDENATDIVFKWQFVAPKTDNGLFMRMLLQ---PVTSKKNKTE  306

Query  927   KTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEAL  748
             KT+R+S V L+LG+++ L+S+L  +FP LGLKK++C+E SWI+S++ W ++  GT PE L
Sbjct  307   KTIRASIVALYLGNADTLVSLLGKEFPELGLKKENCNETSWIQSVIWWANYDIGTSPEVL  366

Query  747   LNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQT  568
             L+R P   A+FLKRKSDY+Q PI K  L+ +W++M+ELG TGL  NPYGGRM+EIP+T  
Sbjct  367   LDRDP-DSANFLKRKSDYVQTPISKDKLNLIWQRMIELGKTGLVFNPYGGRMSEIPATDA  425

Query  567   PFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDI  388
             PFPHRAG LFK+QY+V+W++ G  A+ E+++Q R+L+S++ PFVS+NPR A+LNYRDLDI
Sbjct  426   PFPHRAGNLFKVQYSVNWEDAGSTAEIEYLTQARKLYSYMTPFVSKNPRSAFLNYRDLDI  485

Query  387   GTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G  + G +SYEEG VYG+KYF GN++RLVKVK+ VDP+NFFRNEQSIP+L
Sbjct  486   GVMEAGKNSYEEGSVYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPTL  535



>ref|XP_006360316.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=544

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/523 (60%), Positives = 411/523 (79%), Gaps = 13/523 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF-NTGSSPKPVIIV  1609
             +YD+F++CL+    N +P+  +S IVYSP + SF+S+LQAY RN RF N+ ++ KPVIIV
Sbjct  29    VYDTFVNCLTI---NSVPQSEISKIVYSPNDPSFNSILQAYIRNGRFFNSSTTSKPVIIV  85

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP  ES V  VV+C K+  +++++RSGGHDYEGISY+SD  FI+LDMFNLRSI +D    
Sbjct  86    TPTVESQVAGVVICTKQTNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISIDT---  142

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                +TAWVQ GA LGELYY IW+KS V GFP GVCPTVGVGGHVSGGGYGNM+R+FGLTV
Sbjct  143   -NDKTAWVQTGAILGELYYNIWKKSEVLGFPAGVCPTVGVGGHVSGGGYGNMLRKFGLTV  201

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DAR+VDV GR+LDR +MGEDLFWAI GGGG SFGVILAF+I+L+ VP+ VTYFR E
Sbjct  202   DNVLDARLVDVNGRILDRKSMGEDLFWAIKGGGGASFGVILAFQIQLVTVPQIVTYFRVE  261

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNS-KTVRSSYVGLFL  892
             +++       D V Q+ N ASKID+ L++RLL+Q +    K   + S K++R++++ LFL
Sbjct  262   RFIE-DNTTTDAVVQWQNVASKIDNDLYMRLLIQPITVKAKAKGAKSTKSIRATFIALFL  320

Query  891   GDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA-SF  715
             GDS +L+S+++ +FP LGL KQDC EMSWI+S+L W +F + TKPEALLNR   GD  ++
Sbjct  321   GDSSRLMSLISKEFPLLGLTKQDCLEMSWIDSVLHWANFDSTTKPEALLNR--KGDPLNY  378

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY+Q  IPK+ L+S+++KM+ LG  G+  NPYGGRM EI   +TPFPHR+G+LFK
Sbjct  379   LKRKSDYVQTSIPKNGLESIFEKMISLGKAGMVFNPYGGRMGEIAEGETPFPHRSGILFK  438

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+V+W EEG  A+++++SQIR+L+SF+ P+VS+NPRQAYLNYRDLDIG  D G  S E
Sbjct  439   IQYSVNWHEEGLTAEKDYLSQIRDLYSFMTPYVSKNPRQAYLNYRDLDIGINDQGPQSLE  498

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQ  226
             +G+VYG KYF  N++RLVKVKS VDP NFFRNEQSIP+L + +
Sbjct  499   KGRVYGTKYFKNNFDRLVKVKSMVDPQNFFRNEQSIPTLRKQR  541



>ref|XP_010051869.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75703.1| hypothetical protein EUGRSUZ_D00077 [Eucalyptus grandis]
Length=537

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/537 (61%), Positives = 410/537 (76%), Gaps = 16/537 (3%)
 Frame = -3

Query  1836  FLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYAR  1657
             F+ +   L+  ++ +  +YD+FL CL+  S    P D +S IVYS AN+SF+SVL +Y R
Sbjct  15    FILVSLHLSPSWAASNSVYDTFLQCLTHRSQ---PSDQISDIVYSQANSSFASVLVSYIR  71

Query  1656  NRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFII  1477
             N RFN+ S+PKP++IVTP  ESHV   VLC+K LGV +++RSGGHDYEGISYVSD  F I
Sbjct  72    NLRFNSSSTPKPLVIVTPTRESHVQAAVLCSKDLGVHLKIRSGGHDYEGISYVSDDAFFI  131

Query  1476  LDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghv  1297
             LDMFNLRSIDVDI      ETAWVQAGATLGELYYRIWEKS VHGFP GVC TVGVGGH+
Sbjct  132   LDMFNLRSIDVDIQK----ETAWVQAGATLGELYYRIWEKSKVHGFPAGVCRTVGVGGHL  187

Query  1296  sgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFK  1117
             SGGGYGNM+R++GL+VD+V+DAR+VDV+GR+LDR AMGEDLFWAI GGGG SFGVILA++
Sbjct  188   SGGGYGNMLRKYGLSVDNVLDARMVDVQGRILDRKAMGEDLFWAILGGGGASFGVILAYQ  247

Query  1116  IKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTND  937
             +KL+ VP+ VT FR EK   L +N  D+V ++   A   D  LF+RLLLQ   P T    
Sbjct  248   VKLVPVPEKVTVFRVEK--TLDQNATDLVYKWQFVAPSTDHGLFMRLLLQ---PVTSKTQ  302

Query  936   SNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKP  757
                KT+R+S V LFLG+S++LL+I + + P +GLKK++C+E+SWIES+L W  F  GT P
Sbjct  303   KGQKTLRASVVTLFLGNSDQLLAITDKELPEMGLKKENCTELSWIESVLWWDGFDEGTIP  362

Query  756   --EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEI  583
               E +L R      +FLKRKSDY+Q PI K  LD LWKKM+ELG  GL  NPYGGRM+EI
Sbjct  363   ALETMLRRDYP--TNFLKRKSDYVQTPISKANLDQLWKKMIELGKVGLVFNPYGGRMSEI  420

Query  582   PSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNY  403
             P++ TPFPHRAG LFKIQY+++W E+    ++ +++QIR L+++  PFVS+NPR AYLNY
Sbjct  421   PASATPFPHRAGNLFKIQYSINWSEDDPELEKNYLAQIRSLYNYTTPFVSKNPRSAYLNY  480

Query  402   RDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             RDLDIGT+ +G +SYEEG+VYG K+F  N++RLVKVK+ VDP+NFFRNEQSIP L +
Sbjct  481   RDLDIGTSTNGKNSYEEGQVYGVKFFNDNFDRLVKVKTAVDPNNFFRNEQSIPPLPK  537



>emb|CDP12591.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/523 (60%), Positives = 402/523 (77%), Gaps = 17/523 (3%)
 Frame = -3

Query  1806  CFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSP  1627
             C + +  +YD+F  CL+    N IP   +S+I+YSP N SF+SVLQA+ RN RFNT S+ 
Sbjct  27    CVAASDSIYDNFASCLT---KNGIPSGQISNILYSPTNTSFNSVLQAHVRNLRFNTSSTR  83

Query  1626  KPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSID  1447
             KP IIV PL   HV   VLC K  G+E+++RSGGHDYEGISYVSD  FIILDMFNL SI 
Sbjct  84    KPSIIVAPLEIPHVQAAVLCTKGAGLELKIRSGGHDYEGISYVSDVPFIILDMFNLSSIT  143

Query  1446  VDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIR  1267
             VDI      E+AWVQAGAT+GELYYRIWEKS+ +GFP G+CPT+GVGGH+SGGGYG M+R
Sbjct  144   VDIPS----ESAWVQAGATVGELYYRIWEKSNAYGFPAGLCPTLGVGGHISGGGYGAMLR  199

Query  1266  RFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTV  1087
             RFGL+VD+V+DA+IVDVKG+VLDR AMGEDLFWAI GGGG SFGV+LA+K+KL++VP+ V
Sbjct  200   RFGLSVDNVLDAQIVDVKGQVLDRKAMGEDLFWAIRGGGGASFGVVLAYKLKLVQVPEIV  259

Query  1086  TYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSY  907
             T F  ++      N  D++ Q+ N A KID+ LFIR+L+Q   P T     + K +R ++
Sbjct  260   TVFNVQRTEA--ENATDILVQWQNVADKIDNGLFIRVLVQ---PSTS---ESQKIIRLTF  311

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
             + L+LGDS+ L+S++N+ FPALGL+K DC E SWI+SML W +F  G KPE LLNRT   
Sbjct  312   IALYLGDSDSLMSVMNAGFPALGLQKSDCKEGSWIQSMLFWSNFDIGAKPELLLNRT--S  369

Query  726   DASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAG  547
             D +FLKRKSDY+Q PIPK  L S++ KM++LG  GL  NPYGGRM+EIP+ +TPFPHRAG
Sbjct  370   DVNFLKRKSDYVQTPIPKDALTSIFNKMVQLGKPGLVFNPYGGRMSEIPANETPFPHRAG  429

Query  546   VLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGL  367
             +++KIQY+V+W +       +++ Q REL+SF  P+VS NPRQA+LNYRDLDIGTTD+G 
Sbjct  430   IIYKIQYSVNWDDASPNITNQYLEQARELYSFTTPYVSSNPRQAFLNYRDLDIGTTDNGK  489

Query  366   HSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +SY EG+VYG KYF  N++RLVKVK+ VDP+NFF+NEQSIP+L
Sbjct  490   NSYSEGEVYGRKYFKDNFDRLVKVKTVVDPENFFKNEQSIPTL  532



>ref|XP_008439529.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein 
[Cucumis melo]
Length=546

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/517 (61%), Positives = 410/517 (79%), Gaps = 13/517 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FLHC  +   N  P   VS+IV++  NAS++SVL+AY RN RFNT S+PKPVIIVT
Sbjct  40    VYTTFLHCFES---NSNPSAGVSAIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVT  96

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   V+C+KKLG+++++RSGGHDYEG+SY+SD  FI+LDM NLR++ VD+A   
Sbjct  97    PLTESHVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIVLDMSNLRAVTVDVAD--  154

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AWV+AGA LGE+YYRIWEKS V G+P GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  155   --QSAWVEAGAILGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLSVD  212

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HV+DARIVDVKGR+LD  +MGEDLFWAI GGGG SFGV+LA+KI+L+ VP+TVT FR E+
Sbjct  213   HVLDARIVDVKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVER  272

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                + +N  D+V ++   A   D++LF+RLLLQ V    K     ++T+R++ + LFLG 
Sbjct  273   --TIEQNAADLVVRWQEVAPTTDENLFMRLLLQPVSSKIK---KGTRTIRATVIALFLGK  327

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+L+S+L  +FP LGL+K++C+EMSWI+S+L WG+F  GT PEALL+R     A FL+R
Sbjct  328   SEELVSLLKKEFPELGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRN-VDSAGFLRR  386

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI +  LD L+KKM+E+G TGL  NPYGG+M+EI ST TPFPHRAG L+KIQY
Sbjct  387   KSDYVQKPISRDGLDWLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQY  446

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W E G  AD++ + QIR L+SF+ PFV++NPRQ++LNYRDLDIG  ++  +S+E+GK
Sbjct  447   SVNWDEPGPEADQQFVKQIRRLYSFMTPFVTKNPRQSFLNYRDLDIGINNNDKNSFEDGK  506

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             VYG KYF  N+ERLVKVK+ VDP+NFF NEQSIP+LS
Sbjct  507   VYGFKYFGENFERLVKVKTAVDPENFFWNEQSIPTLS  543



>ref|XP_010051872.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=538

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/548 (59%), Positives = 414/548 (76%), Gaps = 16/548 (3%)
 Frame = -3

Query  1869  TMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             T +S+    L+F+ +   L+  ++ +  +YD+FL CL+  +    P D +S IVYS AN+
Sbjct  5     TSLSALSAVLLFIVVSLHLSPSWAASDSVYDTFLQCLTHRTR---PSDHISDIVYSRANS  61

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             SF++VL +Y RNR FN+ S+PKP++IVTP  ESHV   VLC+K LG+ +++RSGGHDYEG
Sbjct  62    SFANVLVSYIRNRHFNSSSTPKPLVIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEG  121

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             ISYVSD  F ILDMFNLRSIDV+I      ETAWVQAGATLGELYYRIWEKS +HGFP G
Sbjct  122   ISYVSDDAFFILDMFNLRSIDVNIQK----ETAWVQAGATLGELYYRIWEKSKLHGFPAG  177

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             V PT+GVGGH SG GYGNM+R++GL+VD+V+DAR+VDV+GR+LDR AMGEDLFWAI GGG
Sbjct  178   VGPTIGVGGHFSGAGYGNMLRKYGLSVDNVLDARMVDVRGRILDRKAMGEDLFWAIIGGG  237

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGVILA++IKL+ VP+ VT F  EK   L +N  D+V ++   A + D  LF+RLLL
Sbjct  238   GASFGVILAYQIKLVPVPEKVTVFPVEK--TLDQNATDLVYKWQFVAPRTDHGLFMRLLL  295

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T       KT+R++ V LFLG+S++LL+I + + P +GLKK++C+E+SWIES+L
Sbjct  296   Q---PVTSQTQKGQKTLRATVVTLFLGNSDQLLAITDKELPEMGLKKENCTELSWIESVL  352

Query  789   RWGSFGNGTKP--EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLA  616
              W  F  GT P  E LL+R  +   +FLKRKSDY+Q PI K  LD LWKKM+ELG  GL 
Sbjct  353   WWDGFDEGTIPALETLLSRDDS--TNFLKRKSDYVQTPISKANLDWLWKKMIELGKVGLV  410

Query  615   VNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFV  436
              NPYGGRM+EI ++ TPFPHRAG LFKIQY+V+W E+    ++ +++Q+R L+++  PFV
Sbjct  411   FNPYGGRMSEILASATPFPHRAGNLFKIQYSVNWNEDDPELEKNYLAQVRSLYNYTTPFV  470

Query  435   SRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             S+NPR AYLNYRDLDIGT+  G +SYEEG+VYG KYF  N+ERLVKVK+ VDP+NFFRNE
Sbjct  471   SKNPRSAYLNYRDLDIGTSTDGKNSYEEGQVYGVKYFNDNFERLVKVKTAVDPNNFFRNE  530

Query  255   QSIPSLSR  232
             QSIP L +
Sbjct  531   QSIPPLPK  538



>gb|KGN49482.1| hypothetical protein Csa_6G525670 [Cucumis sativus]
Length=578

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/518 (61%), Positives = 408/518 (79%), Gaps = 13/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FLHC  + S +      VSSIV++  NAS++SVL+AY RN RFNT S+PKPVIIVT
Sbjct  25    VYSTFLHCFQSNSNSSAG---VSSIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVT  81

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   V+C+KKLG+++++RSGGHDYEG+SY+SD  FIILDM NLR++ VD+A   
Sbjct  82    PLTESHVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIILDMSNLRTVTVDVAD--  139

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AWV AGATLGE+YYRIWEKS V G+P GVCPTVGVGGH+SGGGYGNM+R++GL VD
Sbjct  140   --QSAWVGAGATLGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLAVD  197

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HV+DARIVDVKGR+LD  +MGEDLFWAI GGGG SFGV+LA+KI+L+ VP+TVT FR E+
Sbjct  198   HVLDARIVDVKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVER  257

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                + +N  D+V ++   A   D++LF+RLLLQ V    K     ++T+R+S V LFLG 
Sbjct  258   --TIEQNAADLVVRWQEVAPTTDENLFMRLLLQPVSSKIK---KGTRTIRASVVALFLGK  312

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+L+S+L  + P LGL+K++C+EMSWI+S+L WG+F  GT PEALL+R     A FL+R
Sbjct  313   SEELVSLLKKELPELGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRN-VDSAGFLRR  371

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI +  L+ L+KKM+E+G TGL  NPYGG+M+EI ST TPFPHRAG L+KIQY
Sbjct  372   KSDYVQKPISRDGLNWLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQY  431

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W E G  AD+E + QIR L+SF+ PFVS+NPRQ++LNYRDLDIG  ++  +S+E+GK
Sbjct  432   SVNWNEPGPEADQEFVKQIRRLYSFMTPFVSKNPRQSFLNYRDLDIGINNNDKNSFEDGK  491

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             VYG KYF  N+ERLVKVK+ VDP+NFF NEQSIP+ SR
Sbjct  492   VYGFKYFGENFERLVKVKTAVDPENFFWNEQSIPTHSR  529



>ref|XP_004134553.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004162840.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=531

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 407/517 (79%), Gaps = 13/517 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FLHC  + S +      VSSIV++  NAS++SVL+AY RN RFNT S+PKPVIIVT
Sbjct  25    VYSTFLHCFQSNSNSSAG---VSSIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVT  81

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   V+C+KKLG+++++RSGGHDYEG+SY+SD  FIILDM NLR++ VD+A   
Sbjct  82    PLTESHVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIILDMSNLRTVTVDVAD--  139

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AWV AGATLGE+YYRIWEKS V G+P GVCPTVGVGGH+SGGGYGNM+R++GL VD
Sbjct  140   --QSAWVGAGATLGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLAVD  197

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HV+DARIVDVKGR+LD  +MGEDLFWAI GGGG SFGV+LA+KI+L+ VP+TVT FR E+
Sbjct  198   HVLDARIVDVKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVER  257

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                + +N  D+V ++   A   D++LF+RLLLQ V    K     ++T+R+S V LFLG 
Sbjct  258   --TIEQNAADLVVRWQEVAPTTDENLFMRLLLQPVSSKIK---KGTRTIRASVVALFLGK  312

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+L+S+L  + P LGL+K++C+EMSWI+S+L WG+F  GT PEALL+R     A FL+R
Sbjct  313   SEELVSLLKKELPELGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRN-VDSAGFLRR  371

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI +  L+ L+KKM+E+G TGL  NPYGG+M+EI ST TPFPHRAG L+KIQY
Sbjct  372   KSDYVQKPISRDGLNWLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQY  431

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W E G  AD+E + QIR L+SF+ PFVS+NPRQ++LNYRDLDIG  ++  +S+E+GK
Sbjct  432   SVNWNEPGPEADQEFVKQIRRLYSFMTPFVSKNPRQSFLNYRDLDIGINNNDKNSFEDGK  491

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             VYG KYF  N+ERLVKVK+ VDP+NFF NEQSIP+ S
Sbjct  492   VYGFKYFGENFERLVKVKTAVDPENFFWNEQSIPTHS  528



>ref|XP_006448857.1| hypothetical protein CICLE_v10014826mg [Citrus clementina]
 gb|ESR62097.1| hypothetical protein CICLE_v10014826mg [Citrus clementina]
Length=542

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/536 (59%), Positives = 409/536 (76%), Gaps = 20/536 (4%)
 Frame = -3

Query  1839  VFLALCNL---LTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             + LALC     +T   SG+   Y+SFL CL+  + +   +  +S+IV +  N+S++SVL+
Sbjct  19    ILLALCFFNFPITRAASGS--AYESFLQCLTQQTNSS--EQQISNIVVTQTNSSYASVLR  74

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFN  S+ KP +I+TPL ESHV   V+C+K++G ++++RSGGHDYEG+SY+SD 
Sbjct  75    AYIRNARFNLSSTLKPTVIITPLQESHVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDR  134

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ILDMFNLRSIDVD+      E+AWV+AGATLGELYYRIW+KS +HG+P GVCPTVGV
Sbjct  135   PFFILDMFNLRSIDVDVKD----ESAWVEAGATLGELYYRIWQKSELHGYPAGVCPTVGV  190

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SGGGYGNM+R+FGL+ D+VVDA+IVD +GR+LDR AMGEDLFWAI GGGG SFGV+
Sbjct  191   GGHLSGGGYGNMLRKFGLSTDNVVDAKIVDARGRILDRKAMGEDLFWAIRGGGGASFGVV  250

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             LA+KIKL+ VP+TVT FRAE+ L    N +DVV ++   A   DD+LF+R+LLQ   P T
Sbjct  251   LAYKIKLVPVPETVTVFRAERLLA--ENASDVVYKWQLVAPATDDNLFMRMLLQ---PVT  305

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             +   +   TVR+S V L+LG ++ L+++L  DFP LGLKK++  EMSWI+S+L W +F N
Sbjct  306   R---NKKPTVRASIVALYLGGADSLVTLLAKDFPELGLKKENVMEMSWIQSVLWWANFDN  362

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             GT P  LL+R     A FLKRKSDY+Q PIPK+ L+ LWK+M+ELG  GL  NPYGG+MA
Sbjct  363   GTSPNVLLDRD-LNSADFLKRKSDYVQKPIPKYSLNLLWKQMMELGKIGLVFNPYGGKMA  421

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EIP+++T FPHRAG LFKIQY++SW + G   + + +SQ   L+SF+ PFVS++PR AYL
Sbjct  422   EIPASETAFPHRAGNLFKIQYSISWGDPGTEIEEDRLSQATSLYSFMTPFVSKSPRSAYL  481

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             NYRD+DIG   HG  SY EGKVYG KYF GN++RLVKVKS VDP+NFFRNEQSIP+
Sbjct  482   NYRDVDIGINHHGEDSYAEGKVYGEKYFNGNFDRLVKVKSMVDPENFFRNEQSIPT  537



>ref|XP_006448860.1| hypothetical protein CICLE_v10014748mg [Citrus clementina]
 gb|ESR62100.1| hypothetical protein CICLE_v10014748mg [Citrus clementina]
Length=570

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/540 (59%), Positives = 408/540 (76%), Gaps = 22/540 (4%)
 Frame = -3

Query  1818  LLTSCF-------SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYA  1660
             LL  CF       + +   Y+SFL CL+  + +   +  +S+IV +  N+S++SVL+AY 
Sbjct  20    LLVLCFFNFPITRAASDSAYESFLQCLTQQTNSS--EQQISNIVVTQTNSSYASVLRAYI  77

Query  1659  RNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFI  1480
             RN RFN  S+ KP +I+TPL ESHV   V+C+K++G ++++RSGGHDYEG+SY+SD  F 
Sbjct  78    RNARFNLSSTLKPTVIITPLQESHVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFF  137

Query  1479  ILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvggh  1300
             ILDMFNLRSIDVD+      E+AWV+AGATLGELYYRIW+KS +HG+P GVCPTVGVGGH
Sbjct  138   ILDMFNLRSIDVDVKD----ESAWVEAGATLGELYYRIWQKSKLHGYPAGVCPTVGVGGH  193

Query  1299  vsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAF  1120
             +SGGGYGNM+R+FGL+ D+VVDA+IVDV+GR+LDR AMGEDLFWAI GGGG SFGV+LA+
Sbjct  194   LSGGGYGNMLRKFGLSTDNVVDAKIVDVRGRILDRKAMGEDLFWAIRGGGGASFGVVLAY  253

Query  1119  KIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTN  940
             KIKL+ VP+TVT FRAE+ L    N  DVV ++   A   DD+LF+R+LLQ   P T+  
Sbjct  254   KIKLVPVPETVTVFRAERLLA--ENATDVVYKWQLVAPATDDNLFMRMLLQ---PVTR--  306

Query  939   DSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK  760
              +   TVR+S V L+LG ++ L+++L  DFP LGLKK++  EMSWI+S+L W +F NGT 
Sbjct  307   -NKKPTVRASIVALYLGGADSLVTLLAKDFPELGLKKENVMEMSWIQSVLWWANFDNGTS  365

Query  759   PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIP  580
             P  LL+R     A FLKRKSDY+Q PIPK+ L+ LWK+M+ELG  GL  NPYGG+MAEIP
Sbjct  366   PNVLLDRD-LNSADFLKRKSDYVQKPIPKYSLNLLWKQMMELGKIGLVFNPYGGKMAEIP  424

Query  579   STQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYR  400
             +++T FPHRAG LFKIQY++SW + G   + + +SQ   L+SF+ PFVS +PR AYLNYR
Sbjct  425   ASETAFPHRAGNLFKIQYSISWSDPGTEIEEDRLSQATSLYSFMTPFVSTSPRSAYLNYR  484

Query  399   DLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             D+DIG   HG  SY EGKVYG KYF GN++RLVKVK+ VDP+NFFRNEQSIP+  R+ +G
Sbjct  485   DVDIGINHHGEDSYAEGKVYGEKYFNGNFDRLVKVKTMVDPENFFRNEQSIPTQPRSDSG  544



>ref|XP_006468346.1| PREDICTED: reticuline oxidase-like protein-like isoform X1 [Citrus 
sinensis]
 gb|KDO75192.1| hypothetical protein CISIN_1g043104mg [Citrus sinensis]
Length=570

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 409/540 (76%), Gaps = 22/540 (4%)
 Frame = -3

Query  1818  LLTSCF-------SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYA  1660
             LL  CF       + +   Y+SFL CL+  + +   +  +S+IV +  N+S++SVL+AY 
Sbjct  20    LLVLCFFNFPITRAASDSAYESFLQCLTQQTNSSDQQ--ISNIVVTQTNSSYASVLRAYI  77

Query  1659  RNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFI  1480
             RN RFN  S+ KP +I+TPL E+HV   V+C+K++G ++++RSGGHDYEG+SY+SD  F 
Sbjct  78    RNARFNLSSTLKPTVIITPLQEAHVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFF  137

Query  1479  ILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvggh  1300
             ILDMFNLRSIDVD+      E+AWV+AGATLGELYYRIW+KS +HG+P GVCPTVGVGGH
Sbjct  138   ILDMFNLRSIDVDVKD----ESAWVEAGATLGELYYRIWQKSKLHGYPAGVCPTVGVGGH  193

Query  1299  vsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAF  1120
             +SGGGYGNM+R+FGL+ D+VVDA+IVDV+GR+LDR AMGEDLFWAI GGGG SFGV+LA+
Sbjct  194   LSGGGYGNMLRKFGLSTDNVVDAKIVDVRGRILDRKAMGEDLFWAIRGGGGASFGVVLAY  253

Query  1119  KIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTN  940
             KIKL+ VP+TVT FRAE+ L    N  DVV ++   A   DD+LF+R+LLQ   P T+  
Sbjct  254   KIKLVPVPETVTVFRAERLLA--ENATDVVYKWQLVAPATDDNLFMRMLLQ---PVTR--  306

Query  939   DSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK  760
              +   TVR+S V L+LG ++ L+++L  DFP LGLKK++  EMSWI+S+L W +F NGT 
Sbjct  307   -NKKPTVRASIVALYLGGADSLVTLLAKDFPELGLKKENVMEMSWIQSVLWWANFDNGTS  365

Query  759   PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIP  580
             P  LL+R     A FLKRKSDY+Q PIPK+ L+ LWK+M+ELG  GL  NPYGG+MAEIP
Sbjct  366   PNVLLDRD-LNSADFLKRKSDYVQKPIPKYSLNLLWKQMMELGKIGLVFNPYGGKMAEIP  424

Query  579   STQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYR  400
             +++T FPHRAG LFKIQY++SW + G   + + +SQ   L+SF+ PFVS++PR AYLNYR
Sbjct  425   ASETAFPHRAGNLFKIQYSISWSDPGTEIEEDRLSQATSLYSFMTPFVSKSPRSAYLNYR  484

Query  399   DLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             D+DIG   HG  SY EGKVYG KYF GN++RLVKVK+ VDP+NFFRNEQSIP+  R+ +G
Sbjct  485   DVDIGINHHGEDSYAEGKVYGEKYFNGNFDRLVKVKTMVDPENFFRNEQSIPTQPRSDSG  544



>ref|XP_011006008.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=535

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 406/518 (78%), Gaps = 16/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL CL     N  P+D +S++VYS +N +++SVL+AY RN R+NT ++PKP++IVT
Sbjct  32    VYESFLQCLE---KNTNPQDKISNLVYSQSNTAYTSVLRAYIRNARYNTSATPKPLVIVT  88

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+C KK+G ++++RSGGHDY+GISY+SD  F ILDMFNLR I+VDI    
Sbjct  89    PTQISHVEATVICTKKVGYQLKIRSGGHDYDGISYISDTPFFILDMFNLRFIEVDIKD--  146

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+A VQAGATLGELYY+IWE S VHGFP GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  147   --ESASVQAGATLGELYYKIWESSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKYGLSVD  204

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVDV G++LDR AMGEDLFWAI GGGGGSFGVI+++KIKL+ VP+TVT FR E+
Sbjct  205   NVLDAQIVDVNGKLLDRKAMGEDLFWAIRGGGGGSFGVIISYKIKLVSVPETVTVFRVER  264

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  DVV ++   A  I   LF+R+LLQ V    K      +T+R+S V L+LGD
Sbjct  265   --TLDQNATDVVYKWQLVAPTISKDLFMRMLLQSVTRKGK------QTIRASIVTLYLGD  316

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             S+ L+++L  +FP LGLKK++C+E SWI+S+L W +F  GT P+ LL+R P  DA+FLKR
Sbjct  317   SDSLVALLGKEFPELGLKKENCNETSWIQSVLWWANFDLGTSPDVLLDRNP-NDANFLKR  375

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PIPK  L+ LWKKM+++G TGL  NPYGGRM+EIP++ TPFPHRAG L+KIQY
Sbjct  376   KSDYVQKPIPKDGLEWLWKKMIDIGKTGLVFNPYGGRMSEIPASATPFPHRAGNLYKIQY  435

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+WKE G+ AD++ ++QIR LHS++  FVS+NPR A+LNYRDLDIG       S+E+G 
Sbjct  436   SVNWKEAGKEADKKFMTQIRRLHSYMTSFVSKNPRSAFLNYRDLDIGVMVPDKDSFEQGS  495

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             VYG+KYF  N++RLVKVK+ VDP+NFFRNEQSIP+L R
Sbjct  496   VYGYKYFNDNFDRLVKVKTAVDPENFFRNEQSIPTLPR  533



>ref|XP_006468347.1| PREDICTED: reticuline oxidase-like protein-like isoform X2 [Citrus 
sinensis]
Length=554

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/542 (58%), Positives = 408/542 (75%), Gaps = 22/542 (4%)
 Frame = -3

Query  1818  LLTSCF-------SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYA  1660
             LL  CF       + +   Y+SFL CL+  + +   +  +S+IV +  N+S++SVL+AY 
Sbjct  20    LLVLCFFNFPITRAASDSAYESFLQCLTQQTNSSDQQ--ISNIVVTQTNSSYASVLRAYI  77

Query  1659  RNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFI  1480
             RN RFN  S+ KP +I+TPL E+HV   V+C+K++G ++++RSGGHDYEG+SY+SD  F 
Sbjct  78    RNARFNLSSTLKPTVIITPLQEAHVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFF  137

Query  1479  ILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvggh  1300
             ILDMFNLRSIDVD+      E+AWV+AGATLGELYYRIW+KS +HG+P GVCPTVGVGGH
Sbjct  138   ILDMFNLRSIDVDVKD----ESAWVEAGATLGELYYRIWQKSKLHGYPAGVCPTVGVGGH  193

Query  1299  vsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAF  1120
             +SGGGYGNM+R+FGL+ D+VVDA+IVDV+GR+LDR AMGEDLFWAI GGGG SFGV+LA+
Sbjct  194   LSGGGYGNMLRKFGLSTDNVVDAKIVDVRGRILDRKAMGEDLFWAIRGGGGASFGVVLAY  253

Query  1119  KIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTN  940
             KIKL+ VP+TVT FRAE+ L    N  DVV ++   A   DD+LF+R+LLQ   P T+  
Sbjct  254   KIKLVPVPETVTVFRAERLLA--ENATDVVYKWQLVAPATDDNLFMRMLLQ---PVTR--  306

Query  939   DSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK  760
              +   TVR+S V L+LG ++ L+++L  DFP LGLKK++  EMSWI+S+L W +F NGT 
Sbjct  307   -NKKPTVRASIVALYLGGADSLVTLLAKDFPELGLKKENVMEMSWIQSVLWWANFDNGTS  365

Query  759   PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIP  580
             P  LL+R     A FLKRKSDY+Q PIPK+ L+ LWK+M+ELG  GL  NPYGG+MAEIP
Sbjct  366   PNVLLDRD-LNSADFLKRKSDYVQKPIPKYSLNLLWKQMMELGKIGLVFNPYGGKMAEIP  424

Query  579   STQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYR  400
             +++T FPHRAG LFKIQY++SW + G   + + +SQ   L+SF+ PFVS++PR AYLNYR
Sbjct  425   ASETAFPHRAGNLFKIQYSISWSDPGTEIEEDRLSQATSLYSFMTPFVSKSPRSAYLNYR  484

Query  399   DLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             D+DIG   HG  SY EGKVYG KYF GN++RLVKVK+ VDP+NFFRNEQSIP+  R +  
Sbjct  485   DVDIGINHHGEDSYAEGKVYGEKYFNGNFDRLVKVKTMVDPENFFRNEQSIPTQPRQRVA  544

Query  219   SE  214
              +
Sbjct  545   EK  546



>ref|XP_002317087.1| hypothetical protein POPTR_0011s16180g [Populus trichocarpa]
 gb|EEE97699.1| hypothetical protein POPTR_0011s16180g [Populus trichocarpa]
Length=535

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/533 (59%), Positives = 416/533 (78%), Gaps = 19/533 (4%)
 Frame = -3

Query  1821  NLLTSCFSGTI---PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNR  1651
             N+ +  FS T     +Y+SFL CL     N  P+D +S++VYS +NA+++SVL+AY RN 
Sbjct  17    NVPSGSFSATTNDESVYESFLQCLE---KNTNPQDKISNLVYSQSNAAYTSVLRAYIRNA  73

Query  1650  RFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILD  1471
             R+NT ++PKP++IVTP   SHV   V+C KK+G ++++RSGGHDY+GISY+SD  F ILD
Sbjct  74    RYNTSATPKPLVIVTPTEISHVQATVICTKKVGYQLKIRSGGHDYDGISYISDTPFFILD  133

Query  1470  MFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsg  1291
             MFNLRSI+VDI      E+A VQAGATLGELYY+IWE S  +GFP GVCPTVGVGGH+SG
Sbjct  134   MFNLRSIEVDIKD----ESACVQAGATLGELYYKIWESSKGYGFPAGVCPTVGVGGHLSG  189

Query  1290  ggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIK  1111
             GGYGNM+R++GL+VD+V+DA+IVDV G++LDR AMGEDLFWAI GGGGGSFGVI+++KIK
Sbjct  190   GGYGNMLRKYGLSVDNVLDAQIVDVNGKLLDRKAMGEDLFWAICGGGGGSFGVIISYKIK  249

Query  1110  LLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSN  931
             L+ VPKTVT FR E+   L +N  DVV ++   A  I + LF+R+LLQ   P T+     
Sbjct  250   LVPVPKTVTVFRVER--TLDQNATDVVYKWQFVAPTISNDLFMRMLLQ---PVTR---KG  301

Query  930   SKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEA  751
              +T+R+S V L+LGDS+ L+++L  +FP LGLKK++C+E SWI+S+L W ++  GT P+ 
Sbjct  302   KQTIRASIVTLYLGDSDSLVALLGKEFPELGLKKENCNETSWIQSVLWWANYDLGTSPDV  361

Query  750   LLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQ  571
             LL+R P  DA+FLKRKSDY+Q PIPK  L+ LWKKM+++G TGL  NPYGGRM+EIP++ 
Sbjct  362   LLDRNP-NDANFLKRKSDYVQKPIPKDGLEWLWKKMIDVGKTGLVFNPYGGRMSEIPASA  420

Query  570   TPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLD  391
             TPFPHRAG L+KIQY+++W+E G+ AD++ ++QIR LHS++  FVS+NPR A+LNYRDLD
Sbjct  421   TPFPHRAGNLYKIQYSMNWQEAGKEADKKFMTQIRRLHSYMTSFVSKNPRSAFLNYRDLD  480

Query  390   IGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             IG T     S+E+G VYG+KYF  N++RLVKVK+ VDP+NFFRNEQSIP+L R
Sbjct  481   IGVTVPNKDSFEQGSVYGYKYFNDNFDRLVKVKTAVDPENFFRNEQSIPTLPR  533



>ref|XP_010054197.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75702.1| hypothetical protein EUGRSUZ_D00076 [Eucalyptus grandis]
Length=537

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/539 (58%), Positives = 410/539 (76%), Gaps = 16/539 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
             L+F+ +   L+  ++ +  +YD+FL CLS  S    P D +S I+YSPAN+SF++VL +Y
Sbjct  13    LLFILVSLHLSPSWAASDSVYDTFLQCLSRRSQ---PSDHISDIIYSPANSSFANVLTSY  69

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RNRRFN+ S+PKP++IVTP  ESHV   +LC+K LGV +++RSGGHDYEG+SYVS   F
Sbjct  70    LRNRRFNSSSTPKPLVIVTPKQESHVQAAILCSKDLGVHLKIRSGGHDYEGMSYVSVDAF  129

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
              ILDMFNLRSIDVDI      ETAWVQAGATLGELYY IW+KS VHGFP GVC  +G+GG
Sbjct  130   FILDMFNLRSIDVDIQK----ETAWVQAGATLGELYYGIWKKSKVHGFPAGVCTVLGIGG  185

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H+SGGGYGNM+R++GL+ D+V+DA+IVDV+GR+LDR AMGEDLFWAI GGGG SFGVILA
Sbjct  186   HLSGGGYGNMLRKYGLSADNVLDAKIVDVQGRILDRKAMGEDLFWAILGGGGASFGVILA  245

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             ++IKL+ VP+ VT FR E+   L +N  D+V ++ + A   D  LF+RL L    P +  
Sbjct  246   YQIKLVPVPEKVTVFRVER--TLDQNATDLVYKWQSVAPSTDSGLFMRLSLL---PTSSQ  300

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT  763
                   T+ +S V L+LG+S++LL+I + +FP +GL+K++C+E+SWIES+L W  F NGT
Sbjct  301   TQKGQLTIGASLVALYLGNSDQLLAITDKEFPEIGLRKENCTEISWIESVLWWIGFDNGT  360

Query  762   --KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
                PE LL+R     A F KRKSDY+Q PI K  L+ LWKKM+E+   GL++NPYGGRM+
Sbjct  361   FPAPETLLSRDYP--AIFFKRKSDYVQTPIAKANLEWLWKKMIEVEKVGLSLNPYGGRMS  418

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EIP++ TPFPHRAG LFKIQY + WKEE   A +++++QI  L+S++ PFVS+NPR A+L
Sbjct  419   EIPASATPFPHRAGNLFKIQYFIDWKEEDPEAGKKYLAQISRLYSYMTPFVSKNPRSAFL  478

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             NYRDLDIG T +G +SYEEG+VYG KYF  N+ERLVKVK+ VDP+NFFRNEQSIP+L +
Sbjct  479   NYRDLDIGATTNGNNSYEEGRVYGVKYFNDNFERLVKVKTAVDPNNFFRNEQSIPTLPK  537



>ref|XP_002523157.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39188.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=539

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/517 (59%), Positives = 402/517 (78%), Gaps = 16/517 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL     N  P+D +SS+VY+ ANAS++SVL+AY RN R NT ++PKP IIVT
Sbjct  36    VYTSFLQCLQN---NTTPQDQISSLVYTKANASYTSVLRAYIRNARMNTTATPKPTIIVT  92

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+CAKK+G +++VRSGGHDYEGISYVSD  F +LDMFNLRS+ VD+    
Sbjct  93    PKQISHVQAAVICAKKVGYQLKVRSGGHDYEGISYVSDVPFFVLDMFNLRSVQVDMKN--  150

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AW+QAGATLGE+Y+ IWE S VHGFP G+CPTVGVGGH+SGGGYGNM+R++GL VD
Sbjct  151   --ESAWIQAGATLGEVYHGIWENSKVHGFPAGICPTVGVGGHISGGGYGNMLRKYGLAVD  208

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +++DA+IVDV G+++DR AMGEDLFWAI GGGGGSFGV++++KIKL+ VP+TVT FRAE+
Sbjct  209   NILDAQIVDVNGKLMDRKAMGEDLFWAIRGGGGGSFGVVISYKIKLVPVPETVTIFRAER  268

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              +    N  D+  ++   A K D+ LF+R+L+Q   P T+   +  +T+R S V L+LG+
Sbjct  269   VI--EENATDIAYKWQLVAPKTDNGLFMRMLMQ---PVTR---NKQQTLRVSIVSLYLGN  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++ L+++L  +FP LGLKK++C+EM+WI+S+L W +F NGT P+ LL+R     A+FLKR
Sbjct  321   ADSLVALLGKEFPELGLKKENCTEMNWIQSVLWWANFDNGTSPDVLLDRN-VDSANFLKR  379

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PIPK+ L  ++K+M+ELG  GL  NPYGGRM EIPST+ PFPHRAG LFK+QY
Sbjct  380   KSDYVQKPIPKNALTLIFKRMMELGKIGLVFNPYGGRMDEIPSTEVPFPHRAGNLFKMQY  439

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +++W E G      ++SQ R L+S++ PFVS+NPR A+LNYRDLDIG    G +SYEEG 
Sbjct  440   SINWNEPGSDLQSNYLSQARNLYSYMTPFVSKNPRSAFLNYRDLDIGVMTPGKNSYEEGS  499

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             +YG+KYF GN++RLVKVK+ VDP+NFFRNEQSIP+LS
Sbjct  500   IYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPTLS  536



>gb|KDP36342.1| hypothetical protein JCGZ_09762 [Jatropha curcas]
Length=541

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/548 (57%), Positives = 416/548 (76%), Gaps = 16/548 (3%)
 Frame = -3

Query  1866  MMSSSPVFL--VFLALCNLLT-SCFSGTI--PMYDSFLHCLSTVSANPIPKDLVSSIVYS  1702
             M  S+  FL  +F+ +CNL +   F+ T+   +++SFL CL     N  PKD V+ +VY+
Sbjct  1     MSKSTKYFLPFLFVLICNLSSLFTFAATVDDTVFESFLQCLQN---NTDPKDQVTDLVYT  57

Query  1701  PANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGH  1522
               N +++SVLQ+Y RN R N  ++PKP II+TP   SHV   V+C KK+G ++++RSGGH
Sbjct  58    KTNEAYTSVLQSYIRNARLNKSTTPKPSIILTPKQVSHVQSFVICTKKVGYQLKIRSGGH  117

Query  1521  DYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHg  1342
             DYEGISY+SD+ + ILDMFNLRSI+VDI       +AWV++GATLGELYYRIWE S VHG
Sbjct  118   DYEGISYISDSPYFILDMFNLRSINVDIKNN----SAWVESGATLGELYYRIWETSKVHG  173

Query  1341  fpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAI  1162
             FP G+CPTVGVGGH+SGGGYGNM+R +GL VD+VVDA +VDV G+VLDR  MGEDLFWAI
Sbjct  174   FPAGICPTVGVGGHISGGGYGNMLRTYGLAVDNVVDAVMVDVNGKVLDRKQMGEDLFWAI  233

Query  1161  NggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFI  982
              GGGGGSFGVI+++K++L+ VP+ V+ FR +KY+   +   D+V +Y + A  ID+ LF+
Sbjct  234   RGGGGGSFGVIISYKVQLVSVPEIVSVFRVQKYIDEDKTTVDLVYKYQSVAPTIDNGLFM  293

Query  981   RLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWI  802
             R+L+Q  P  +K N    KT+  +   L+LG+++ ++S+L+ + P LGL K++CSEMSWI
Sbjct  294   RMLVQ--PSSSKIN-KGQKTISITVNALYLGNADSVVSLLSKELPELGLMKENCSEMSWI  350

Query  801   ESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTG  622
             +S+L W +F N T P ALL+R     A+FLKRKSDY+QNPI    L+S++ KM+ELG TG
Sbjct  351   DSVLWWANFDNATSPNALLDRK-LNSANFLKRKSDYVQNPISIDGLNSIFTKMIELGKTG  409

Query  621   LAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAP  442
             L  NPYGG+MAEIP+T  PFPHRAG L+K+QY+V+W+E G+AA+ E++ QIREL+SF+ P
Sbjct  410   LVFNPYGGKMAEIPATDAPFPHRAGNLYKVQYSVNWEEAGDAAESEYLGQIRELYSFMTP  469

Query  441   FVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFR  262
             FVS NPR A+LNYRDLDIG  + G +S+EEG VYG KYF GN++RLVKVK+ VDP+NFFR
Sbjct  470   FVSNNPRSAFLNYRDLDIGIMEPGKNSFEEGSVYGFKYFNGNFDRLVKVKTAVDPENFFR  529

Query  261   NEQSIPSL  238
             NEQSIP+L
Sbjct  530   NEQSIPTL  537



>gb|KCW75709.1| hypothetical protein EUGRSUZ_D00086, partial [Eucalyptus grandis]
Length=514

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/518 (61%), Positives = 398/518 (77%), Gaps = 16/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+F+ CL+  +    P D +S IVYS AN+SF +VL +Y RN  FN  S+PKP++IVT
Sbjct  10    VYDTFIQCLAHRTQ---PSDHISDIVYSQANSSFVNVLVSYIRNGHFNLLSTPKPLVIVT  66

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   VLC+K LG+ +++RSGGHD+EGISYVS+  F ILDMFNLRSIDVDI    
Sbjct  67    PTRESHVQAAVLCSKDLGMHLKIRSGGHDFEGISYVSNDAFFILDMFNLRSIDVDIKE--  124

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQAGATLGELYYRIWEKS VHGFP GVC TVGVGGH+SG GYGNM+R++GL+VD
Sbjct  125   --ETAWVQAGATLGELYYRIWEKSKVHGFPAGVCATVGVGGHLSGAGYGNMLRKYGLSVD  182

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA++VDV+GR+LDR AMGEDLFWAI GGGG SFGVILA++IKL+ VP+ VT FR EK
Sbjct  183   NVLDAKMVDVQGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFRVEK  242

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A   D  LF+RL+LQ   P T       KT+R+S VGLFLG+
Sbjct  243   --TLDQNATDLVYKWQFVAPTTDHGLFMRLVLQ---PVTSKTQKGHKTLRASVVGLFLGN  297

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKP--EALLNRTPAGDASFL  712
             S++LL++   + P +GLKK +C+EMSWIES+L W  F  GT P  E LL+R  +   +F 
Sbjct  298   SDQLLALTEEELPEMGLKKGNCTEMSWIESVLWWDGFDEGTIPALETLLSRDHS--TNFR  355

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+Q PI +  LD LWKKM+ELG  GL  NPYGGRM+EIP++ TPFPHRAG LFKI
Sbjct  356   KRKSDYVQTPISRANLDCLWKKMIELGKVGLMFNPYGGRMSEIPASATPFPHRAGNLFKI  415

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY ++W ++    ++ +++QIR L+SF+ PFVS+NPR AYLNYRDLDIGT+ +G +SYEE
Sbjct  416   QYFINWSKDDPELEKNYLAQIRRLYSFMTPFVSKNPRGAYLNYRDLDIGTSTNGNNSYEE  475

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N+ERLVKVK+ VDP++FFRNEQSIP+L
Sbjct  476   GRVYGVKYFNDNFERLVKVKTAVDPNDFFRNEQSIPTL  513



>ref|XP_010054199.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=530

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/518 (61%), Positives = 398/518 (77%), Gaps = 16/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+F+ CL+  +    P D +S IVYS AN+SF +VL +Y RN  FN  S+PKP++IVT
Sbjct  26    VYDTFIQCLAHRTQ---PSDHISDIVYSQANSSFVNVLVSYIRNGHFNLLSTPKPLVIVT  82

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   VLC+K LG+ +++RSGGHD+EGISYVS+  F ILDMFNLRSIDVDI    
Sbjct  83    PTRESHVQAAVLCSKDLGMHLKIRSGGHDFEGISYVSNDAFFILDMFNLRSIDVDIKE--  140

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQAGATLGELYYRIWEKS VHGFP GVC TVGVGGH+SG GYGNM+R++GL+VD
Sbjct  141   --ETAWVQAGATLGELYYRIWEKSKVHGFPAGVCATVGVGGHLSGAGYGNMLRKYGLSVD  198

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA++VDV+GR+LDR AMGEDLFWAI GGGG SFGVILA++IKL+ VP+ VT FR EK
Sbjct  199   NVLDAKMVDVQGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFRVEK  258

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A   D  LF+RL+LQ   P T       KT+R+S VGLFLG+
Sbjct  259   --TLDQNATDLVYKWQFVAPTTDHGLFMRLVLQ---PVTSKTQKGHKTLRASVVGLFLGN  313

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKP--EALLNRTPAGDASFL  712
             S++LL++   + P +GLKK +C+EMSWIES+L W  F  GT P  E LL+R  +   +F 
Sbjct  314   SDQLLALTEEELPEMGLKKGNCTEMSWIESVLWWDGFDEGTIPALETLLSRDHS--TNFR  371

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+Q PI +  LD LWKKM+ELG  GL  NPYGGRM+EIP++ TPFPHRAG LFKI
Sbjct  372   KRKSDYVQTPISRANLDCLWKKMIELGKVGLMFNPYGGRMSEIPASATPFPHRAGNLFKI  431

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY ++W ++    ++ +++QIR L+SF+ PFVS+NPR AYLNYRDLDIGT+ +G +SYEE
Sbjct  432   QYFINWSKDDPELEKNYLAQIRRLYSFMTPFVSKNPRGAYLNYRDLDIGTSTNGNNSYEE  491

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N+ERLVKVK+ VDP++FFRNEQSIP+L
Sbjct  492   GRVYGVKYFNDNFERLVKVKTAVDPNDFFRNEQSIPTL  529



>gb|KDP36344.1| hypothetical protein JCGZ_09764 [Jatropha curcas]
Length=540

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/539 (58%), Positives = 406/539 (75%), Gaps = 12/539 (2%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             VF++   L +  T   +    +Y SFL CL     N  P D ++++VY+ +N  ++SVL+
Sbjct  12    VFILVFNLSSSFTVAAATDDAVYASFLQCLKN---NTNPNDQIANLVYTKSNKGYTSVLR  68

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             +Y RN R N  ++PKP II+TP   SHV   V+C KK+G ++++RSGGHDYEGISY SD 
Sbjct  69    SYIRNARLNKSTTPKPSIILTPKQVSHVQSFVICTKKVGYQLKIRSGGHDYEGISYYSDE  128

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ILDMFNLRSI+VD+       +AWV++GATLGELYY IWEKS VHGFP GVCPTVGV
Sbjct  129   PFFILDMFNLRSINVDVTNN----SAWVESGATLGELYYSIWEKSKVHGFPAGVCPTVGV  184

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SGGGYGNM+R++GL VD+V+DA IVDV G+VLDR  MGEDLFWAI GGGGGSFGVI
Sbjct  185   GGHISGGGYGNMLRKYGLAVDNVIDAVIVDVNGKVLDRKQMGEDLFWAIRGGGGGSFGVI  244

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             +++KI+L+ VP+TVT FR EKY+    +  D+V +Y + A  ID+ LF+R+L+Q  P  +
Sbjct  245   VSYKIQLVSVPETVTVFRVEKYIDEDNSTIDLVYKYQSVAPTIDNGLFMRMLVQ--PVSS  302

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             K N    KT+R + V L+LG+++ ++S L+ + P LGLKK+ CSEMSWI+S++ W +  N
Sbjct  303   KIN-KGQKTIRITIVALYLGNADSVVSSLSKELPELGLKKEKCSEMSWIDSVV-WWAIDN  360

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
              T P ALL+R     A FLKRKSDY+QNPI K  L S++ KM+ELG TGL  NPYGG+MA
Sbjct  361   ATSPNALLDRD-LNSAEFLKRKSDYVQNPISKTGLSSIFTKMIELGKTGLVFNPYGGKMA  419

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EIP++  PFPHRAG L+KIQY++SW++EG AA+ E++ QIREL++F  PFVS+NPR A+L
Sbjct  420   EIPASDAPFPHRAGNLYKIQYSMSWQDEGNAAESEYLGQIRELYNFTTPFVSKNPRSAFL  479

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             NYRDLDIG  + G +SY+ G VYG KYF GNY+RLVKVK+ VDP+NFFRNEQSIP+LSR
Sbjct  480   NYRDLDIGIMEPGKNSYQAGSVYGFKYFNGNYDRLVKVKTAVDPENFFRNEQSIPTLSR  538



>ref|XP_008228986.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=570

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 391/516 (76%), Gaps = 19/516 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+FL CL+T + NP    L S+I+Y+  N S+SSVL+AY RN RFNT S+PKPV+IVT
Sbjct  31    VYDNFLQCLNT-NTNPSSTQL-SNIIYAENNPSYSSVLRAYIRNSRFNTTSTPKPVLIVT  88

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+CAK+L +++R+RSGGHDYEG+SY SD TFI+LDMFNLR++ VDI    
Sbjct  89    PSASSHVQASVVCAKQLAIQLRIRSGGHDYEGLSYWSDQTFIVLDMFNLRTVTVDIEDS-  147

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                + WVQAGATLGELYYRI EKS VHGFP GVCPTVG+GGH+SGGGYGNM+R+FGL VD
Sbjct  148   ---SVWVQAGATLGELYYRISEKSKVHGFPAGVCPTVGIGGHISGGGYGNMLRKFGLAVD  204

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVD KGR+LDR AMGEDLFWAI GGGGGSFGVI+A+K+KL+ VPKTVT F+A +
Sbjct  205   NVLDAQIVDAKGRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLISVPKTVTVFQAAR  264

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  DVVS++   A   DD LF+RLLLQ            S TV+++ +  FLG+
Sbjct  265   --TLEENATDVVSRWQEVAPTTDDGLFMRLLLQ----------PGSNTVKATIMAEFLGN  312

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+S+L   FP LGLKK DC EMSWIES+L W ++ NGT P+ LL+R P   A+FLKR
Sbjct  313   ADQLVSLLGKQFPELGLKKDDCKEMSWIESVLWWANYDNGTSPDVLLDRNP-DHANFLKR  371

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K+ L+ +WKKM+E+G  GL  NPYGG M+ IP++ TPFPHRAG LFK+QY
Sbjct  372   KSDYVQTPISKNRLELVWKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGSLFKVQY  431

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +VSW E G  A++ +    R L  F+ PFVS+NPR A+LNYRDLDIG    G  SYE+GK
Sbjct  432   SVSWGEAGAEAEKNYTRDTRRLFRFMTPFVSKNPRSAFLNYRDLDIGVNKFGNRSYEQGK  491

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ERLVKVK+ VDP NFFRNEQSIP L
Sbjct  492   VYGLKYFNDNFERLVKVKTAVDPANFFRNEQSIPPL  527



>ref|XP_009760106.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=532

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/544 (58%), Positives = 404/544 (74%), Gaps = 19/544 (3%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLTSCF----SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             + ++L F A  +LL + +    + + P Y SFL CLS  S    P D + S VY+P N+S
Sbjct  3     TSLYLTFFAFLSLLFAIYYIPLAASDPSYQSFLQCLSKHSD---PSDHILSRVYTPNNSS  59

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             + SVLQ Y RN+RFN  ++ KP II TPL ESH+   V+C+KK    +++RSGGHDYEGI
Sbjct  60    YKSVLQHYIRNKRFNRSTTLKPDIIFTPLQESHIQVAVICSKKTDKHLKIRSGGHDYEGI  119

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggv  1327
             SYVS+ +F++LDM NLRS+DVDI      ETAWVQAGATLGELYYRIWEKS +H FP G+
Sbjct  120   SYVSNISFVLLDMSNLRSVDVDIHN----ETAWVQAGATLGELYYRIWEKSKIHAFPAGI  175

Query  1326  cptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgggg  1147
             CPTVGVGGH++GGGYGN++R++GL+VD+++DA IVDV G++L+R +MGEDLFWAI+GGGG
Sbjct  176   CPTVGVGGHITGGGYGNLLRKYGLSVDNLIDAHIVDVHGQILNRESMGEDLFWAISGGGG  235

Query  1146  GSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ  967
              SFGVI A+KIKL++VP  VT FR  +   L +N  D+V ++   A  ID++LFIRL ++
Sbjct  236   ASFGVITAYKIKLVKVPDIVTVFRVVR--TLKQNAIDIVYRWQFIADNIDNNLFIRLTVK  293

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
                 PT      +KT+ +++V LFLGDS KLLS+++ DFP LGL   DC EMSWIES L 
Sbjct  294   ----PTNDKQKGTKTIAATFVALFLGDSRKLLSVMDRDFPQLGLHIGDCKEMSWIESELF  349

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W SF NGT P+ALLNR P   A FLKRKSDYLQ PIPK  L S++ KM+ELG+T L  NP
Sbjct  350   WSSFPNGTPPDALLNRMPG--AKFLKRKSDYLQKPIPKDKLKSIFDKMIELGDTELVFNP  407

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGGRM EIP  +TPFPHRAG +FKIQYA +W+EEG+ A+  H++Q R L++++ PFVS++
Sbjct  408   YGGRMNEIPEWETPFPHRAGNIFKIQYAANWEEEGKEAENFHLNQTRVLYNYMTPFVSKS  467

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR A+LNYRDLDIG   +G H Y EG+VYG KYF GN+ +LVKVK+ VD DNFF NEQS 
Sbjct  468   PRCAFLNYRDLDIGVNHNGNHRYIEGRVYGLKYFKGNFNKLVKVKTLVDHDNFFWNEQST  527

Query  246   PSLS  235
             P L+
Sbjct  528   PPLA  531



>ref|XP_002523158.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39189.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=539

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/517 (59%), Positives = 398/517 (77%), Gaps = 16/517 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL     N  P+D +SS+VY+  NAS++SVL+AY RN R NT ++PKP IIVT
Sbjct  36    VYSSFLECLQN---NTTPQDQISSLVYTKTNASYTSVLRAYIRNARMNTTATPKPTIIVT  92

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+CAKK+G +++VRSGGHDYEGISYVSD  F +LDMFNLRS+ VD+    
Sbjct  93    PKQISHVQAAVICAKKVGYQLKVRSGGHDYEGISYVSDVPFFVLDMFNLRSVQVDMKN--  150

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AW+QAGATLGE+Y+ IWE S VHGFP GVCPTVGVGGH SGGGYGNM+R++GL VD
Sbjct  151   --ESAWIQAGATLGEVYHGIWENSKVHGFPAGVCPTVGVGGHFSGGGYGNMLRKYGLAVD  208

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVDV G+++DR AMGEDLFWAI GGGGGSFGV++++KIKL+ VP+TVT FRAE+
Sbjct  209   NVLDAQIVDVNGKLMDRKAMGEDLFWAIRGGGGGSFGVVISYKIKLVPVPETVTVFRAER  268

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              +    N  D+  ++   A K D+ LF+RLL+Q   P T+   +  +T+R + + L+LG 
Sbjct  269   LI--EENATDIAYKWQLVAPKTDNGLFMRLLIQ---PVTR---NKQQTLRVTIMSLYLGK  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++ L+++L  +FP LGLKK++C+EM+WI+S+L W +F NGT P+ LL+R     A+FLKR
Sbjct  321   ADSLVALLGKEFPELGLKKENCTEMNWIQSVLWWANFDNGTSPDVLLDRH-VDSANFLKR  379

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PIP++ L  ++K+M+ELG  GL  NPYGGRM EIPST+ PFPHRAG LFK+QY
Sbjct  380   KSDYVQKPIPRNALTLIFKRMVELGKIGLVFNPYGGRMDEIPSTEVPFPHRAGNLFKMQY  439

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +++W E G      ++SQ R L+S++ PFVS+NPR A+LNYRDLDIG      +SYEEG 
Sbjct  440   SINWNEPGSDLQSNYLSQARNLYSYMTPFVSKNPRSAFLNYRDLDIGVMTPSKNSYEEGS  499

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             +YGHKYF GN++RLVKVK+ VDP+NFFRNEQSIP+LS
Sbjct  500   IYGHKYFNGNFDRLVKVKTAVDPENFFRNEQSIPTLS  536



>ref|XP_002299028.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
 gb|EEE83833.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
Length=584

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 418/547 (76%), Gaps = 23/547 (4%)
 Frame = -3

Query  1857  SSPVFLVFLALC--NLLTSCFS----GTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPA  1696
             + P  L  L +   N+ +S FS    G   +Y+SFL CL +   N  P+D +S +VYS +
Sbjct  2     AKPTLLAVLVILIFNITSSSFSAAADGDDSVYESFLQCLES---NTNPQDEISKLVYSQS  58

Query  1695  NASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDY  1516
             + S++SVL+AY RN R+NT ++PKPV+IVTP   SHV   V+C KK+G ++++RSGGHDY
Sbjct  59    STSYTSVLRAYIRNARYNTSATPKPVVIVTPTQISHVQATVICTKKVGYQLKIRSGGHDY  118

Query  1515  EGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp  1336
             +GISYVSD  F +LDMFNLRSI+V++      E+A VQAGATLGELYY+IWE S VHGFP
Sbjct  119   DGISYVSDMPFFVLDMFNLRSIEVNV----NDESATVQAGATLGELYYKIWESSKVHGFP  174

Query  1335  ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINg  1156
              GVCPTVGVGGH+SG GYGNM+R++GL+VD+VVDA IVDV G++LDR AMGEDLFWAI G
Sbjct  175   AGVCPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNGKLLDRKAMGEDLFWAIRG  234

Query  1155  gggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRL  976
             GGGGSFGVI+++KIKL+ VP+TVT FR E+   L +N  DVV ++   A +  + LF+R+
Sbjct  235   GGGGSFGVIISYKIKLVSVPETVTVFRVER--TLEQNATDVVYKWQLVAPQTSNDLFMRM  292

Query  975   LLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIES  796
             LLQ   P T+  +   +T+R+S V L+LG+S+ L+++L  +FP LGLKK+DC+E SWI+S
Sbjct  293   LLQ---PVTRNGN---QTIRASIVTLYLGNSDSLVALLGKEFPELGLKKEDCNETSWIQS  346

Query  795   MLRWGSFGN-GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
             ++ W    N G  P+ LL+R P  DA+FLKRKSDY+QNPI K  L+ LWKKM+E+G TGL
Sbjct  347   VMWWDESQNLGKSPDVLLDRNP-NDANFLKRKSDYVQNPISKDGLEWLWKKMIEVGKTGL  405

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPF  439
               NPYGGRM EIP+++TPFPHRAG LFK+QY+V+W+E G  AD+  ++QIR LHS++ PF
Sbjct  406   VFNPYGGRMNEIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMTQIRRLHSYMTPF  465

Query  438   VSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRN  259
             VS+NPR +YLNYRDLDIG  + G  S+E+G VYG+KYF  N++RLVKVK+ VDP+NFFRN
Sbjct  466   VSKNPRSSYLNYRDLDIGVMEAGKDSFEQGSVYGYKYFNDNFDRLVKVKTAVDPENFFRN  525

Query  258   EQSIPSL  238
             EQSIP+L
Sbjct  526   EQSIPTL  532



>ref|XP_008220339.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=616

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 393/519 (76%), Gaps = 19/519 (4%)
 Frame = -3

Query  1800  SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             S +  +YD+FL CL+T + NP    L S+I+Y+  N S+SSVL+AY RN RFNT S+PKP
Sbjct  62    SSSASVYDNFLQCLNT-NTNPSSTQL-SNIIYAQNNPSYSSVLRAYIRNSRFNTTSTPKP  119

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             V+IVTP   SHV   V+CAK+LG+++R+RSGGHDYEG+SY SD TFI+LDMFNLRS+ VD
Sbjct  120   VLIVTPSAASHVQASVVCAKQLGIQLRIRSGGHDYEGLSYWSDKTFIVLDMFNLRSVTVD  179

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             I       + WVQAGATLGELYYRI EKS VHGFP GVCPTVG+GGH+SGGGYGNM+R+F
Sbjct  180   IEDS----SVWVQAGATLGELYYRISEKSKVHGFPAGVCPTVGIGGHISGGGYGNMLRKF  235

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL VD+V+DA+IVD KGR+LDR AMGEDLFWAI GGGGGSFGVI+A+K+KL+ VP+TVT 
Sbjct  236   GLAVDNVLDAQIVDAKGRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLVSVPETVTV  295

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             F+A +   L  N  D VS++   A   DD LF+R+LLQ            S TV+++ + 
Sbjct  296   FQAAR--TLEENATDFVSKWQEVAPTTDDGLFMRMLLQ----------PGSNTVKATIIA  343

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
              FLG++++L+S+L   FP LGLK++DC EMSWIES+L W ++ NGT P+ LL+R P   A
Sbjct  344   EFLGNADQLVSLLGKQFPELGLKEEDCKEMSWIESVLWWDNYDNGTSPDVLLDRNP-DHA  402

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q PI K  L+ LWKKM+E+G  GL  NPYGG M+ IP++ TPFPHRAG L
Sbjct  403   NFLKRKSDYVQTPISKSRLELLWKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGNL  462

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FK+QY+VSW E G  A+  + +  R L  FL PFVS+NPR A+LNYRDLDIG    G  S
Sbjct  463   FKVQYSVSWGEAGAEAENNYTTDTRRLFRFLTPFVSKNPRSAFLNYRDLDIGVNKFGNRS  522

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YE+GKVYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP
Sbjct  523   YEQGKVYGLKYFNDNFDRLVKVKTAVDPENFFRNEQSIP  561



>ref|XP_009362187.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=538

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/520 (59%), Positives = 391/520 (75%), Gaps = 11/520 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YDSFL CL T   N      +S IVY+  N S++ VLQAY RN RFN  S+PKP++IVT
Sbjct  30    VYDSFLQCLKT-KTNSSNTSQLSDIVYAQNNPSYTPVLQAYIRNSRFNKTSTPKPLLIVT  88

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   VLCAK  G+++++RSGGHDYEGISY S  TFI+LDMFNLRSI VDI    
Sbjct  89    PLTESHVQASVLCAKLAGLQLKIRSGGHDYEGISYWSSQTFIVLDMFNLRSIKVDIKDN-  147

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                + W QAGATLGELYYRIWE S VH FP G+C  VGVGGH+SGGGYGN++R++GL VD
Sbjct  148   ---SVWAQAGATLGELYYRIWENSKVHAFPAGICQLVGVGGHLSGGGYGNLLRKYGLAVD  204

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IV+VKG +LDR +MGEDLFWAI GGGGGSFGVI+++K+KL+ VP+ VT FR EK
Sbjct  205   NVLDAQIVNVKGELLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEVVTIFRVEK  264

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N   ++S++   A   DD LF+RLLLQ V    K  +   KT+R+S +  FLG+
Sbjct  265   --TLEQNATALISRWQEVAPTTDDGLFLRLLLQPVSSKVKKGE---KTIRASVLAEFLGN  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+ +L  +FP LGL+K++C+EMSWIES+L W +F  GT P+ALL+R P  DA+FLKR
Sbjct  320   ADQLVKLLGKEFPELGLQKENCTEMSWIESVLWWANFDIGTSPKALLDRMP-NDANFLKR  378

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI    L+ LWKKM+ELG TGL  NPYGG M+ I  ++TPFPHRAG L+KIQY
Sbjct  379   KSDYVQTPISIDGLEWLWKKMIELGKTGLVFNPYGGEMSRISPSETPFPHRAGNLYKIQY  438

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W+  GE  ++ + +Q + L S++ PFVS+NPR A+LNYRDLDIG +  G  SYEEGK
Sbjct  439   SVNWEAAGEDLEKNYTTQSKRLFSYMTPFVSKNPRSAFLNYRDLDIGASSTGAPSYEEGK  498

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQ  226
             VYG KYF  N++RLVKVK+ VDP+NFF NEQSIP L RN+
Sbjct  499   VYGVKYFNDNFDRLVKVKTAVDPENFFYNEQSIPILPRNE  538



>ref|XP_002300558.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
 gb|EEE85363.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
Length=566

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/547 (58%), Positives = 418/547 (76%), Gaps = 23/547 (4%)
 Frame = -3

Query  1857  SSPVFLVFLALC--NLLTSCFS----GTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPA  1696
             + P  L  L +   N+ +S FS    G   +Y+SFL CL +   N  P+D +S +VYS +
Sbjct  2     AKPTLLAVLVILIFNITSSSFSAAADGDDSVYESFLQCLES---NTNPQDEISKLVYSQS  58

Query  1695  NASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDY  1516
             + S++SVL+AY RN R+NT ++PKPV+IVTP   SHV   V+C KK+G ++++RSGGHDY
Sbjct  59    STSYTSVLRAYIRNARYNTSATPKPVVIVTPTQISHVQATVICTKKVGYQLKIRSGGHDY  118

Query  1515  EGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp  1336
             +GISYVSD  F +LDMFNLRSI+V++      E+A VQAGATLGELYY+IWE S VHGFP
Sbjct  119   DGISYVSDMPFFVLDMFNLRSIEVNV----NDESATVQAGATLGELYYKIWESSKVHGFP  174

Query  1335  ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINg  1156
              GVCPTVGVGGH+SG GYGNM+R++GL+VD+VVDA IVDV G++LDR AMGEDLFWAI G
Sbjct  175   AGVCPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNGKLLDRKAMGEDLFWAIRG  234

Query  1155  gggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRL  976
             GGGGSFGVI+++KIKL+ VP+TVT FR E+   L +N  DVV ++   A +  + LF+R+
Sbjct  235   GGGGSFGVIISYKIKLVSVPETVTVFRVER--TLEQNATDVVYKWQLVAPQTSNDLFMRM  292

Query  975   LLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIES  796
             LLQ   P T+  +   +T+R+S V L+LG+S+ L+++L  +FP LGLKK+DC+E SWI+S
Sbjct  293   LLQ---PVTRNGN---QTIRASIVTLYLGNSDSLVALLGKEFPELGLKKEDCNETSWIQS  346

Query  795   MLRWGSFGN-GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
             ++ W    N G  P+ LL+R P  DA+FLKRKSDY+QNPI K  L+ LWKKM+E+G TGL
Sbjct  347   VMWWDESQNLGKSPDVLLDRNP-NDANFLKRKSDYVQNPISKDGLEWLWKKMIEVGKTGL  405

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPF  439
               NPYGGRM EIP+++TPFPHRAG LFK+QY+V+W+E G  AD+  ++QIR LHS++ PF
Sbjct  406   VFNPYGGRMNEIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMTQIRRLHSYMTPF  465

Query  438   VSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRN  259
             VS+NPR +YLNYRDLDIG  + G  S+E+G VYG+KYF  N++RLVKVK+ VDP+NFFRN
Sbjct  466   VSKNPRSSYLNYRDLDIGVMEAGKDSFEQGSVYGYKYFNDNFDRLVKVKTAVDPENFFRN  525

Query  258   EQSIPSL  238
             EQSIP+L
Sbjct  526   EQSIPTL  532



>ref|XP_011039281.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=566

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/549 (58%), Positives = 418/549 (76%), Gaps = 23/549 (4%)
 Frame = -3

Query  1851  PVFLVFLALC--NLLTSCFSGTI----PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             P  L FL +   N+ +S FS T      +Y+SFL CL +   N  P+D +S +VYS ++ 
Sbjct  4     PTLLAFLVILIFNITSSAFSATADGDDSVYESFLQCLQS---NTNPQDEISKLVYSQSST  60

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             S++SVL+AY RN R+NT ++PKP++IVTP   SHV   V+C KK+G ++++RSGGHDY+G
Sbjct  61    SYTSVLRAYIRNARYNTSATPKPLVIVTPTQISHVQATVICTKKVGYQLKIRSGGHDYDG  120

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             ISYVSD  F +LDMFNLRSI+V++      E+A VQAGATLGELYY+IWE S VHGFP G
Sbjct  121   ISYVSDMPFFVLDMFNLRSIEVNV----NDESATVQAGATLGELYYKIWESSKVHGFPAG  176

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             +CPTVGVGGH+SG GYGNM+R++GL+VD+VVDA IVDV G++LDR AMGEDLFWAI GGG
Sbjct  177   ICPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNGKLLDRKAMGEDLFWAIRGGG  236

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             GGSFGVI+++KIKL+ VP+TVT FR E+   L +N  DVV ++   A +  + LF+R+LL
Sbjct  237   GGSFGVIISYKIKLVSVPETVTVFRVER--TLDQNATDVVYKWQLVAPQTSNDLFMRMLL  294

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T+  +   +T+R+S V L+LG+S+ L+++L  +FP LGLKK+DC E SWI+S++
Sbjct  295   Q---PVTRNGN---QTIRASIVTLYLGNSDSLVALLGKEFPELGLKKEDCIETSWIQSVM  348

Query  789   RWGSFGN-GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
              W    N G  P+ LL+R P  DA+FLKRKSDY+QNPI K  L+ LWKKM+E+G TGL  
Sbjct  349   WWDESQNLGKSPDVLLDRNP-NDANFLKRKSDYVQNPISKDGLEWLWKKMIEVGKTGLVF  407

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGGRM +IP+++TPFPHRAG LFK+QY+V+W+E G  AD+  ++QIR L+S++ PFVS
Sbjct  408   NPYGGRMNQIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMTQIRRLYSYMTPFVS  467

Query  432   RNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQ  253
             +NPR AYLNYRDLDIG  + G  S+E+G VYG+KYF  N++RLVKVK+ VDP+NFFRNEQ
Sbjct  468   KNPRSAYLNYRDLDIGVMEAGKDSFEQGSVYGYKYFNDNFDRLVKVKTAVDPENFFRNEQ  527

Query  252   SIPSLSRNQ  226
             SIP+L   Q
Sbjct  528   SIPTLPNVQ  536



>ref|XP_003532642.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=577

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/514 (60%), Positives = 390/514 (76%), Gaps = 11/514 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL+  + +P   D VS+IV++  NASFSSVLQAY RN RFNT S+PKP+++VT
Sbjct  35    VYTSFLQCLTNYTKSP---DQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  E HV   V+CAK + +++++RSGGHDYEGISYVSD  FIILDMF+ R+I VDI    
Sbjct  92    PSEEPHVQGAVICAKSIAIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDIEN--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQAGATLGELYYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+ GL+VD
Sbjct  150   --EVAVVQAGATLGELYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HVVDA+IVD KGR+LD+ +MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ V+ FR  K
Sbjct  208   HVVDAKIVDAKGRILDKESMGEDLFWAIRGGGGASFGVILSYNVKLVPVPEVVSVFRIAK  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              L    +  ++V Q+   A   DD LF+RLLLQ   P +       +T+R++ + LFLG 
Sbjct  268   SLDQNESATELVLQWQQVAPHTDDRLFMRLLLQ---PVSSKVVKGQRTIRATVMALFLGG  324

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++++ +++  +FPALGL K++C+E+SWI+S+L WG+F N TKP+ALL+R     ASFLKR
Sbjct  325   ADEVATLMGKEFPALGLSKENCTELSWIDSVLWWGNFDNTTKPDALLDRD-LNSASFLKR  383

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PIPK  L+ +W+KM+ELG TG   NPYGG+M+E+ S  TPFPHRAG LFKIQY
Sbjct  384   KSDYVQKPIPKKGLEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQY  443

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W + G   +    SQ R L+S++ PFVS +PR A+LNYRDLDIGT   G +SY EG 
Sbjct  444   SVNWDDPGVELENNFTSQARMLYSYMTPFVSSSPRSAFLNYRDLDIGTNSFGKNSYAEGA  503

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             VYG KYF  N+ERLVK+K+ VDP+NFFRNEQSIP
Sbjct  504   VYGVKYFNDNFERLVKIKTEVDPENFFRNEQSIP  537



>gb|EYU19102.1| hypothetical protein MIMGU_mgv1a022353mg [Erythranthe guttata]
Length=549

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/540 (57%), Positives = 397/540 (74%), Gaps = 24/540 (4%)
 Frame = -3

Query  1815  LTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTG  1636
               S +S     YD+F+ CLS   +N   K+ + +IVY P N+SF+SVLQ Y RN RFNT 
Sbjct  18    FNSYYSFASSDYDTFVQCLS---SNHNTKNQIPNIVYGPNNSSFTSVLQDYIRNPRFNTP  74

Query  1635  SSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLR  1456
             ++ KP +IVTPL ESHV   +LC+KK+G+E+++RSGGHDYEGISYVS+  FIILDMFNLR
Sbjct  75    ATRKPSLIVTPLQESHVQAAILCSKKIGIELKIRSGGHDYEGISYVSEVPFIILDMFNLR  134

Query  1455  SIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGN  1276
             S+ VDI      ETAWVQ+GATLGELYY IW+ S VHGFP GV PTVGVGGH+SGGGYGN
Sbjct  135   SVSVDIKS----ETAWVQSGATLGELYYNIWQNSKVHGFPAGVGPTVGVGGHISGGGYGN  190

Query  1275  MIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVP  1096
             M+R+FGL+VDHV+DARIVD  GR+LDR +MGEDLFWAI GGGG SFGV+LA+KI+L+ VP
Sbjct  191   MLRKFGLSVDHVIDARIVDANGRMLDRKSMGEDLFWAIKGGGGASFGVVLAYKIQLVPVP  250

Query  1095  KTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ--------------IVP  958
               VT FR  K   L  N  D+  ++   A+KIDD+LFIRLL+Q                 
Sbjct  251   PVVTVFRVAK--TLEENVTDIFYRWQFVANKIDDNLFIRLLVQPTSLTKKKPNLDMKKKK  308

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
              P        KTVR +++  +LG++ +LLS++ S FP LGL +QDC E SWI+S+L W +
Sbjct  309   KPNSGKAPGQKTVRVTFIAQYLGNANELLSVMKSQFPELGLTQQDCIETSWIQSVLYWAN  368

Query  777   FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
             + NGT  + LL+R  +   +F KRKSDYL+ PIPK  L+ LWK ++ELG  G+  N YGG
Sbjct  369   YNNGTSEKVLLDRK-SDSENFFKRKSDYLKTPIPKDGLEGLWKNIIELGKAGMVFNAYGG  427

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
             +M+ I  ++TPFPHR G +FKIQY  +WKE+G  A++++I Q R L+S++ P+VS+NPR+
Sbjct  428   QMSRIGESETPFPHRNGNIFKIQYFANWKEQGAEAEKKYIEQTRTLYSYMTPYVSKNPRE  487

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +YLNYRDLDIGTT +G ++Y+EGKVYG KYF GN++RLVKVK+ VDPDNFFRNEQSIP L
Sbjct  488   SYLNYRDLDIGTTSNGKNTYDEGKVYGEKYFKGNFDRLVKVKTAVDPDNFFRNEQSIPPL  547



>ref|XP_007158995.1| hypothetical protein PHAVU_002G199300g [Phaseolus vulgaris]
 gb|ESW30989.1| hypothetical protein PHAVU_002G199300g [Phaseolus vulgaris]
Length=573

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/534 (58%), Positives = 392/534 (73%), Gaps = 11/534 (2%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
             L+FL L    +        +Y SFL CL+  + +   +D VS IV++  N+SFSSVLQAY
Sbjct  12    LLFLLLSVTASVAAPTAESVYTSFLQCLTNYTKS---QDHVSDIVFAQTNSSFSSVLQAY  68

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RN RFNT S+PKP+++VTPL E HV   V+C+K +G+++++RSGGHD+EGISYVSD  F
Sbjct  69    IRNARFNTTSTPKPLLVVTPLEEPHVQGAVICSKNIGIQLKIRSGGHDFEGISYVSDQPF  128

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
             IILDMF  R+I VD+      E A VQAGATLGE+YYRIWEKS VHGFP GVCPTVGVGG
Sbjct  129   IILDMFQFRNITVDVQN----EIAVVQAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGG  184

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H+SGGGYGNM+R+ GL VDHV+DA+IVDVKGR+LD+  MGEDLFWAI GGGG SFGVIL+
Sbjct  185   HLSGGGYGNMLRKHGLAVDHVIDAKIVDVKGRILDKKGMGEDLFWAIRGGGGASFGVILS  244

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             + IKL+ VP+ VT +R  K L    +  + V Q+   A   DD LF+RLLLQ   P +  
Sbjct  245   YTIKLVPVPEVVTVYRVAKSLDKNESATEFVLQWQQVAPHTDDRLFMRLLLQ---PVSSK  301

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT  763
                  KT+R++ V LFLG +++++ ++  +FP LGL KQ+C+EM+WI+S+L W +F N T
Sbjct  302   VVKGQKTIRATVVALFLGGADEVVKLMGKEFPTLGLSKQNCTEMNWIDSVLWWANFDNIT  361

Query  762   KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEI  583
             KP+ALL+R     ASFLKRKSDY+Q PI K  L+ +WKKM+ELG TG   NPYGG+M+E+
Sbjct  362   KPDALLDRN-VNSASFLKRKSDYVQKPISKEGLEGIWKKMVELGKTGFVFNPYGGKMSEV  420

Query  582   PSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNY  403
              S  TPFPHRAG LFKIQY+V+W E G   +     Q R L+S++ PFVS NPR A+LNY
Sbjct  421   SSDATPFPHRAGNLFKIQYSVNWDEPGVELENNFTRQARMLYSYMTPFVSSNPRSAFLNY  480

Query  402   RDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             RDLDIGT   G +SY+EG VYG KYF  N++RLVK+KS VDP+NFFRNEQSIP+
Sbjct  481   RDLDIGTNSFGNNSYKEGAVYGVKYFNDNFDRLVKIKSAVDPENFFRNEQSIPT  534



>ref|XP_007023055.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25677.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=651

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/547 (59%), Positives = 411/547 (75%), Gaps = 22/547 (4%)
 Frame = -3

Query  1881  TRHDTMMSSSPVFLVFLALCNL-LTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVY  1705
             T    M  S P+ L  LA+ ++ + S    +  +Y+SF+ CL++ S    P D VS+IVY
Sbjct  120   TDKKAMTMSLPLLL--LAVVSITICSSVGASDSVYESFIQCLTSHSN---PSDHVSNIVY  174

Query  1704  SPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGG  1525
             S +++S++SVLQAY RN RFNT ++PKPVII+TPL ESHV   V+C+KK+G ++++RSGG
Sbjct  175   SQSSSSYNSVLQAYIRNARFNTSATPKPVIIITPLQESHVSAAVICSKKIGFQLKIRSGG  234

Query  1524  HDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVH  1345
             HD+EGISYVSD  F ILDMFNLRSI V++A     E+AWV+AGATLGELYYRIWEKS VH
Sbjct  235   HDFEGISYVSDKPFFILDMFNLRSISVNMAD----ESAWVEAGATLGELYYRIWEKSKVH  290

Query  1344  gfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWA  1165
             GFP GVCPTVGVGGH+SG GYGNM+R++GL+VDHVVDA+IVDV G++LDR  MGEDLFWA
Sbjct  291   GFPAGVCPTVGVGGHISGAGYGNMVRKYGLSVDHVVDAKIVDVNGKILDRKGMGEDLFWA  350

Query  1164  INggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLF  985
             I GGGGGSFGVILA+KIKL+ VP+TVT F+ E+   L +N  DVV ++ + A   D++LF
Sbjct  351   IRGGGGGSFGVILAYKIKLVPVPETVTVFKVER--TLEQNATDVVYKWQSVAPTTDNNLF  408

Query  984   IRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSW  805
             +R+L+Q    P   N    KT+R S   L+LG ++ L+S+L  D P LGLKK++C EMSW
Sbjct  409   MRMLVQ----PVTLN--KQKTIRISIYALYLGRADNLVSLLAKDLPELGLKKENCLEMSW  462

Query  804   IESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNT  625
             I+S L WGS   GT P ALL+R       F+KRKSDY+Q PIPK  L+ LWK+M+EL   
Sbjct  463   IDSALWWGSLNYGTSPNALLSRN--YHVKFMKRKSDYVQTPIPKDGLEWLWKRMIELAEP  520

Query  624   GLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLA  445
             GL  NPYGG M EI +T TPFPHRAG LFKIQY++SWKE G  ADR++ + ++ LHS++ 
Sbjct  521   GLVFNPYGGIMNEIKATDTPFPHRAGNLFKIQYSISWKETGMDADRKYRTLVKRLHSYMT  580

Query  444   PFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFF  265
              FVS+NPR AYLNYRDLDIG ++    +Y+EGKVYG  YF GN+ERLV VKS VDP+NFF
Sbjct  581   GFVSKNPRSAYLNYRDLDIGISE--TWTYQEGKVYGQSYFNGNFERLVDVKSAVDPENFF  638

Query  264   RNEQSIP  244
             RNEQSIP
Sbjct  639   RNEQSIP  645



>ref|XP_007217492.1| hypothetical protein PRUPE_ppa026518mg [Prunus persica]
 gb|EMJ18691.1| hypothetical protein PRUPE_ppa026518mg [Prunus persica]
Length=567

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/514 (60%), Positives = 389/514 (76%), Gaps = 18/514 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+FL CL+T + NP    L S+I+Y+  N S+SSVL+AY RN RFNT S+PKPV+IVT
Sbjct  27    VYDNFLQCLNT-NTNPSSTQL-SNIIYAENNPSYSSVLRAYIRNSRFNTTSTPKPVLIVT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+CAK+LG+++R+RSGGHDYEG+SY SD TFI+LDMFNLR++ VD     
Sbjct  85    PSASSHVQASVVCAKQLGIQLRIRSGGHDYEGLSYWSDQTFIVLDMFNLRTVTVD---DI  141

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                + WVQAGATLGELYYRI EKS VHGFP G+CPTVG+GGH+SGGGYGNM+R+FGL VD
Sbjct  142   EDSSVWVQAGATLGELYYRISEKSKVHGFPAGICPTVGIGGHISGGGYGNMLRKFGLAVD  201

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVD KGR+LDR AMGEDLFWAI GGGGGSFGVI+A+K+KL+ VP+TVT F+A +
Sbjct  202   NVLDAQIVDAKGRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLVPVPETVTVFQAAR  261

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N   +VS++   A   DD LF+RLLLQ            S TV+++ +  FLG+
Sbjct  262   --TLEENATAIVSRWQEVAPTTDDGLFMRLLLQ----------PGSNTVKATIMAEFLGN  309

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+S+L   FP LGLKK DC EMSWIES+L W ++ NGT P+ LL+R P   A+FLKR
Sbjct  310   ADQLVSLLGKQFPELGLKKDDCKEMSWIESVLWWANYDNGTSPDVLLDRNP-DHANFLKR  368

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ +WKKM+E+G  GL  NPYGG M+ IP++ TPFPHRAG LFK+QY
Sbjct  369   KSDYVQTPISKSRLELVWKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGNLFKVQY  428

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +VSW E G  A++ + +  R L  F+ PFVS+NPR A+LNYRDLDIG    G  SYE+GK
Sbjct  429   SVSWGEAGAEAEKNYTTDTRRLFRFMTPFVSKNPRSAFLNYRDLDIGVNKFGNRSYEQGK  488

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP
Sbjct  489   VYGLKYFNENFDRLVKVKTAVDPANFFRNEQSIP  522



>ref|XP_003524102.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=582

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/523 (58%), Positives = 395/523 (76%), Gaps = 11/523 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL+  +     +D VS+IV++  NASFSSVLQAY RN RFNT S+PKP+++VT
Sbjct  40    VYTSFLECLTNYTK---AQDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVT  96

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  + HV   V+CAK +G+++++RSGGHDYEGISYVSD  FIILDMF+ R+I VD+    
Sbjct  97    PSEDPHVQGAVICAKSIGIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDVEN--  154

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQAGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+ GL+VD
Sbjct  155   --EVAVVQAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVD  212

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HVVDA+IVDVKGR+LD+ +MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ VT FR  K
Sbjct  213   HVVDAKIVDVKGRILDKESMGEDLFWAIRGGGGASFGVILSYTVKLIPVPEVVTVFRIAK  272

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              L    +  ++V Q+   A   D  LF+RLLLQ   P +       +T+R++ + LFLG 
Sbjct  273   SLDQNESATELVLQWQQVAPHTDHRLFMRLLLQ---PVSSKVVKGQRTIRATVMALFLGG  329

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++++++++  +FPALGL K++C+E+SWI+S+L W +F N TKP+ALL+R     ASFLKR
Sbjct  330   ADEVVTLMGKEFPALGLSKENCTELSWIDSVLWWSNFDNTTKPDALLDRD-LNSASFLKR  388

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+QNPI K  L+ +W+KM+ELG TG   NPYGG+M+E+ S  TPFPHRAG LFKIQY
Sbjct  389   KSDYVQNPISKKGLEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQY  448

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W + G   ++   SQ + L+S++ PFVS +PR A+LNYRDLDIGT   G +SYEEG 
Sbjct  449   SVNWDDPGVELEKNFTSQAKMLYSYMTPFVSSDPRSAFLNYRDLDIGTNSFGKNSYEEGA  508

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGS  217
             VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP      TG+
Sbjct  509   VYGVKYFNDNFKRLVKIKTEVDPENFFRNEQSIPIHPGPDTGA  551



>gb|KHN39153.1| Reticuline oxidase-like protein [Glycine soja]
Length=577

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/529 (58%), Positives = 394/529 (74%), Gaps = 13/529 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL+  + +P   D VS+IV++  NASFSSVLQAY RN RFNT S+PKP+++VT
Sbjct  35    VYTSFLQCLTNYTKSP---DQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  E HV   V+CAK + +++++RSGGHDYEGISYVSD  FIILDMF+ R+I VDI    
Sbjct  92    PSEEPHVQGAVICAKSIAIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDIEN--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQAGATLGELYYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+ GL+VD
Sbjct  150   --EVAVVQAGATLGELYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HVVDA+IVD KGR+LD+ +MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ V+ FR  K
Sbjct  208   HVVDAKIVDAKGRILDKESMGEDLFWAIRGGGGASFGVILSYNVKLVPVPEVVSVFRIAK  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              L    +  ++V Q+   A   D  LF+RLLLQ   P +       +T+R++ + LFLG 
Sbjct  268   SLDQNESATELVLQWQQVAPHTDHRLFMRLLLQ---PVSSKVVKGQRTIRATVMALFLGG  324

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++++ +++  +FPALGL K++C+E+SWI+S+L WG+F N TKP+AL++R     ASFLKR
Sbjct  325   ADEVATLMGKEFPALGLSKENCTELSWIDSVLWWGNFDNTTKPDALIDRD-LNSASFLKR  383

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PIPK  L+ +W+KM+ELG TG   NPYGG+M+E+ S  TPFPHRAG LFKIQY
Sbjct  384   KSDYVQKPIPKKGLEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQY  443

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W + G   +    SQ R L+S++ PFVS +PR A+LNYRDLDIG    G +SY EG 
Sbjct  444   SVNWDDPGVELENNFTSQARMLYSYMTPFVSSSPRSAFLNYRDLDIGINSFGKNSYAEGA  503

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             VYG KYF  N+ERLVK+K+ VDP+NFFRNEQSIP   R    SE+ + G
Sbjct  504   VYGVKYFNDNFERLVKIKTEVDPENFFRNEQSIPVHPR--LDSEATKSG  550



>ref|XP_007023056.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25678.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=531

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/520 (59%), Positives = 386/520 (74%), Gaps = 19/520 (4%)
 Frame = -3

Query  1803  FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPK  1624
             ++ + P Y S   CLS      IP D VSSI++S +N S++SVLQAY RN RFNT S+PK
Sbjct  25    WAASDPAYQSLFQCLS----QSIPSDNVSSILFSNSNPSYASVLQAYIRNARFNTSSTPK  80

Query  1623  PVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDV  1444
             PVII+TPL E HV   V+C++K+G  +++RSGGHDYEG+SYV D  F +LDMFNLRSI V
Sbjct  81    PVIIITPLEEFHVSAAVICSQKVGFRLKIRSGGHDYEGLSYVFDEPFFVLDMFNLRSISV  140

Query  1443  DIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRR  1264
             D+A     E+AWV  GATLGELYY IWEKS VHGFPGGVCPTVGVGGH SG GYG ++R+
Sbjct  141   DMAD----ESAWVGTGATLGELYYNIWEKSKVHGFPGGVCPTVGVGGHFSGAGYGTLLRK  196

Query  1263  FGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVT  1084
             +GLTVDH+VDA+IVDV GR+LDR  MGEDLFWAI GGG  SFGV+LA+KIKL+ VP+TVT
Sbjct  197   YGLTVDHIVDAKIVDVNGRILDRKGMGEDLFWAIRGGGAASFGVVLAYKIKLVPVPETVT  256

Query  1083  YFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYV  904
              FR E+ L    N  DV  ++ + A   DD+LF+R+LLQ   P T+   +  +T+R + +
Sbjct  257   VFRLERLLA--DNATDVALKWQSVAPTTDDNLFMRMLLQ---PATR---NRQRTLRVTVI  308

Query  903   GLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGD  724
              L+LGD+  L+++L  +FP L LKK++C+E +WI+S+L W +F  GT P ALL+R    D
Sbjct  309   ALYLGDANSLVALLGKEFPELSLKKENCTETTWIDSVLWWANFDFGTSPTALLDRN-LND  367

Query  723   ASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGV  544
             A FLKRKSDY+Q PIP+  L+SLW+KM+ELG  GL  N YGGRM EI + +TPFPHRAG 
Sbjct  368   ADFLKRKSDYVQTPIPRDGLESLWEKMIELGKVGLVFNAYGGRMNEIKADETPFPHRAGN  427

Query  543   LFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLH  364
             L+KIQY+V+W E G  A++ + +Q R LH F+  FVS+NPR AYLNYRD+DIG  ++   
Sbjct  428   LYKIQYSVNWDEPGNEAEKNYTTQSRTLHDFMTQFVSKNPRSAYLNYRDIDIGVAEN--W  485

Query  363   SYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             + EEGKVYG  YF  NYERLV VK+ VDP NFFRNEQSIP
Sbjct  486   TVEEGKVYGESYFNDNYERLVDVKTAVDPKNFFRNEQSIP  525



>emb|CAN80091.1| hypothetical protein VITISV_015121 [Vitis vinifera]
Length=531

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/516 (58%), Positives = 394/516 (76%), Gaps = 14/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLST S +  P   +S+++Y+P N+S+SSVL++Y RN RFNT ++PKP +I+T
Sbjct  28    VHGAFLQCLSTHSQSSHP---ISAVLYTPDNSSYSSVLESYIRNLRFNTSATPKPRLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   ++C+KK G+++++RSGGHDYEG+SYVSD  F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWVQAGATLGE+YYRI EKS  HGFP GVCPTVG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI GGGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   A K+DD LFIRL + +V     ++ S  KTVR++++ LFLG 
Sbjct  261   --TLEQNATNIVYQWQQVADKVDDDLFIRLTMDVV----NSSRSGEKTVRATFLSLFLGS  314

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N+  P LGL+  DC+EMSW+ES+L W +F  GT  EALL+R P    + LKR
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQV-LTHLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ PIPK  L+ +WKKM+EL    L  NPYGG+MAEI  + TPFPHRAG L KIQY
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W EEG  A   +I+  R+L+S++ PFVS+ PR+A+LNYRDLD+G   +G +SY EG+
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNGKNSYLEGR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ RLV++K++VDP NFFRNEQSIP+L
Sbjct  494   VYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_002270585.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/516 (58%), Positives = 392/516 (76%), Gaps = 14/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLST S +  P   +S+++Y+P N+S+SSVL++Y RN RFNT ++PKP +I+T
Sbjct  28    VHGAFLQCLSTHSQSSHP---ISAVLYTPDNSSYSSVLESYIRNLRFNTSTTPKPRLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   ++C+KK G+++++RSGGHDYEG+SYVSD  F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWVQAGATLGE+YYRI EKS +HGF  GVCP VG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESAWVQAGATLGEIYYRIAEKSKIHGFSAGVCPRVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI GGGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   A K+D  LFIRL + +V      + S  KTVR+++  LFLG 
Sbjct  261   --TLEQNATNIVYQWQQVADKVDGDLFIRLTMDVV----NRSRSGEKTVRATFRSLFLGS  314

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N+  P LGL+  DC+EMSW+ES+L W +F  GT  EALL+R P    + LKR
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQ-VLTHLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ PIPK  L+ +WKKM+EL    LA NPYGG+MAEI  + TPFPHRAG L KIQY
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W EEG  A   +I+  R+L+S++ PFVS++PR+A+LNYRDLD+G   +G +SY EG+
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNGKNSYLEGR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ RLV++K++VDP NFFRNEQSIP+L
Sbjct  494   VYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>gb|EYU43212.1| hypothetical protein MIMGU_mgv1a021309mg, partial [Erythranthe 
guttata]
Length=489

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/505 (59%), Positives = 383/505 (76%), Gaps = 16/505 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             M   F+ CLS    N IP   +S I+Y+P N SF++VLQ+Y RNRRFN  ++ KP II+T
Sbjct  1     MDSCFVQCLSD---NKIPSCQISKIIYTPKNPSFTTVLQSYIRNRRFNVSTTRKPSIIIT  57

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  E HV   V+CAKKL  ++++RSGGHDYEGISYVSD  F+ILDMFNLRSI+V +    
Sbjct  58    PTSEIHVSAAVICAKKLKTQLKIRSGGHDYEGISYVSDTKFVILDMFNLRSINVSVED--  115

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                TAWV++GA LGELYYRI E + +  FP GVCPT+G+GGH+SGGGYGNMIR++GL+VD
Sbjct  116   --RTAWVESGALLGELYYRITENTKLLAFPAGVCPTMGIGGHISGGGYGNMIRKYGLSVD  173

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HVVDA+IVD  GRVLDR +MGEDLFWAI GGGG SFGV+LA+K+ L+ VP+ VT F  EK
Sbjct  174   HVVDAKIVDANGRVLDRKSMGEDLFWAIRGGGGASFGVVLAYKLNLVPVPEDVTVFTVEK  233

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                 ++N  D V QY     K+D  LFIR+LLQ    P   N   +++VR++++G+FLG+
Sbjct  234   --EASQNATDAVFQYQQIVDKMDKDLFIRVLLQ----PVTLN--KTRSVRATFIGMFLGN  285

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++LLSI  S FP LGL+K DC EM+WI S++ W +F N + PE LLNRTP    +FLKR
Sbjct  286   TDRLLSITGSLFPELGLQKSDCREMNWIYSVIYWANFVNTSAPEVLLNRTP-DSVNFLKR  344

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ L+ KM+E+G  GL  N YGG M+EI  + TPFPHRAG LFKIQY
Sbjct  345   KSDYVQTPISKPGLEKLFDKMVEIGKVGLVFNSYGGVMSEIDESATPFPHRAGNLFKIQY  404

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+WKEEGE AD+++++QIREL+SF+ P+VS+NPRQA+LNYRDLDIG  D+  +SYE+GK
Sbjct  405   SVNWKEEGEEADKDYVAQIRELYSFMEPYVSKNPRQAFLNYRDLDIGINDNSNNSYEQGK  464

Query  345   VYGHKYFMGNYERLVKVKSRVDPDN  271
             +YG KYF GN++RLVK+K+RVDPDN
Sbjct  465   IYGEKYFKGNFDRLVKIKTRVDPDN  489



>emb|CAN60572.1| hypothetical protein VITISV_000229 [Vitis vinifera]
Length=531

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/516 (58%), Positives = 393/516 (76%), Gaps = 14/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLST S +  P   +S+++Y+P N+S+SSVL++Y RN RFNT ++PKP +I+T
Sbjct  28    VHGAFLQCLSTHSQSSHP---ISAVLYTPDNSSYSSVLESYIRNLRFNTSTTPKPRLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   ++C+KK G+++++RSGGHDYEG+SYVSD  F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWVQAGATLGE+YYRI EKS +HGFP GVCP VG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESAWVQAGATLGEIYYRIAEKSKIHGFPAGVCPRVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI GGGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   A K+D  LFIRL + +V      + S  KTVR+++  LFLG 
Sbjct  261   --TLEQNATNIVYQWQQVADKVDGDLFIRLTMDVV----NRSRSGEKTVRATFRSLFLGS  314

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N+  P LGL+  DC+EMSW+ES+L W +F  GT  EALL+R P    + LKR
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQ-VLTHLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ PIPK  L+ +WKKM+EL    LA NPYGG+MAEI  + TPFPHRAG L KIQY
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W EEG  A   +I+  R+L+S++ PFVS++PR+A+LNYRDLD+G   +G +SY EG+
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNGKNSYLEGR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ RLV++K++VDP NFFRNEQSIP+L
Sbjct  494   VYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_010042218.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=552

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/521 (58%), Positives = 391/521 (75%), Gaps = 15/521 (3%)
 Frame = -3

Query  1785  MYDSFLHCLST-----VSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             +YD+FL CL              +   S I+++P N+SF ++L +  RNRRF T S+PKP
Sbjct  30    LYDTFLQCLLNHTQVLQQQQQQQQQEPSQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKP  89

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++I+TP   SHV   VLCA++ G E+R+RSGGHD+EG SYVS A F+ILDMFN RS+DVD
Sbjct  90    LLILTPSQPSHVQSAVLCARRTGTEVRIRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVD  149

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             +      ETAWV +GAT+GELYYRIWEKS ++GF  GVCPTVGVGGH+SGGGYGNM+R++
Sbjct  150   VER----ETAWVGSGATIGELYYRIWEKSGLYGFNAGVCPTVGVGGHLSGGGYGNMLRKY  205

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL  D+VVDA+IVDV+GRVLDR++MGEDLFWAI GGGG SFGVIL +++KL+ VP  VT 
Sbjct  206   GLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGGGGASFGVILGYRVKLVPVPNVVTV  265

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR  K +    N  ++V Q+ N A + D+ LF+RLLLQ   P +      +KTV +S + 
Sbjct  266   FRVAKTI--QENATELVYQWQNAAPRTDNDLFMRLLLQ---PVSSKIQKGAKTVNASVLA  320

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             LFLG++++L+S++N +FP LGLKK+DC+EMSWIES L WG F +GT  EALL+R P    
Sbjct  321   LFLGNADRLVSLVNEEFPELGLKKEDCAEMSWIESALWWGDFDSGTAVEALLDRMPK-SV  379

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q P+ +  L+ LW KM+ELG  G   NPYGG+M EIP +  PFPHRAG L
Sbjct  380   NFLKRKSDYVQQPMSREELELLWDKMIELGKVGFVFNPYGGKMGEIPMSDAPFPHRAGNL  439

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY++SW E+G  A++ ++++IREL++F+ P+VS+ PR+A+LNYRDLDIG TD+G +S
Sbjct  440   FKIQYSISWSEDGIEAEQSNLAEIRELYNFMTPYVSKKPRRAFLNYRDLDIGITDNGENS  499

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             Y EG VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP L
Sbjct  500   YREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVL  540



>ref|XP_004504724.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=539

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/547 (56%), Positives = 398/547 (73%), Gaps = 15/547 (3%)
 Frame = -3

Query  1878  RHDTMMSSSPVFLVFLALCNLLTSCFSGTIP-MYDSFLHCLSTVSANPIPKDLVSSIVYS  1702
             +    + SS VFL+ L +CN+  S  + T   +Y SF+HCL+  + +    D  S+ ++S
Sbjct  3     KSSCFVHSSIVFLLLL-VCNVSVSETTSTAESLYTSFIHCLTNQTKS---SDQFSNTLFS  58

Query  1701  PANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGH  1522
               NASFSSVLQAY RN R NT S+PKP++I+TPL ESHV   V C+K +G+++++RSGGH
Sbjct  59    QTNASFSSVLQAYIRNARLNTTSTPKPLLIITPLQESHVQSTVFCSKTIGIQLKIRSGGH  118

Query  1521  DYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHg  1342
             D+EG+SYVS+  FIILDMF  R+I VDI      E A VQ+GATLGE YYRIWEKS VHG
Sbjct  119   DFEGLSYVSNQPFIILDMFQFRNISVDIQN----EVAVVQSGATLGEFYYRIWEKSKVHG  174

Query  1341  fpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAI  1162
             FP GVCPTVGVGGH SGGGYGNM+R FGL++D+++DA+IVDV GR+LD+  MGED FWAI
Sbjct  175   FPSGVCPTVGVGGHFSGGGYGNMMREFGLSIDNIIDAKIVDVNGRILDKNTMGEDFFWAI  234

Query  1161  NggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFI  982
              GGGG SFGVIL++ +KL+ VP+ VT FR  K   L +N  ++V Q+   A   DD LF+
Sbjct  235   RGGGGSSFGVILSYTVKLVLVPEVVTVFRVAK--NLDQNATELVFQWQQVAPHTDDRLFM  292

Query  981   RLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWI  802
             RLLLQ   P +        TVR++ + LFLG +++++++L  +FP+LGL K+ CSEMSWI
Sbjct  293   RLLLQ---PVSSKVVKGEITVRATVMALFLGGADEIVTLLGKEFPSLGLNKEKCSEMSWI  349

Query  801   ESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTG  622
             +S+L W SFGN +KP+ LL+R     A F KRKSDY+Q+PIPK  L+ +WKK++ELG  G
Sbjct  350   DSVLWWASFGNDSKPDVLLDRK-IDSAKFFKRKSDYVQDPIPKDGLEGIWKKVIELGKVG  408

Query  621   LAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAP  442
             L  NPYGG+M  IPS  T FPHR G LFKIQY+V+W+E G   +    +Q R L++++ P
Sbjct  409   LVFNPYGGKMNLIPSNATAFPHREGNLFKIQYSVNWEEPGIDVENNFTNQARMLYNYMTP  468

Query  441   FVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFR  262
             FVS NPR+A+LNYRDLDIG  D G  SYE+G VYG KYF  N+ERLVK+K+ VDP+NFFR
Sbjct  469   FVSNNPRRAFLNYRDLDIGINDFGNSSYEQGVVYGAKYFNNNFERLVKIKTVVDPENFFR  528

Query  261   NEQSIPS  241
             NEQSIP+
Sbjct  529   NEQSIPT  535



>ref|XP_009353860.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/521 (58%), Positives = 388/521 (74%), Gaps = 11/521 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YDSFL CL T   N      +SSIVY+  N S++ +LQAY RN RFN  S+PKP+++VT
Sbjct  26    VYDSFLQCLDT-KTNSSNTTQLSSIVYAQNNPSYTPILQAYIRNSRFNRTSTPKPLLVVT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   VLCAK  GV++++RSGGHDYEGISY S  TFI+LDMFNLRSI V+I    
Sbjct  85    PLTESHVQASVLCAKLAGVQLKIRSGGHDYEGISYWSSQTFIVLDMFNLRSITVNIEDN-  143

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                + W Q GATLGELYYRIWEKS VH FP G+C  VGVGGH+SGGGYGN++R++GL VD
Sbjct  144   ---SVWAQTGATLGELYYRIWEKSKVHAFPAGICQLVGVGGHISGGGYGNLLRKYGLAVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IV+  G +LDR +MGEDLFWAI GGGGGSFGVI+++K+KL+ VP+ VT FR EK
Sbjct  201   NVLDAQIVNANGELLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEVVTIFRVEK  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  +   +V ++   A   DD LF+RLLLQ V    K  +   KTVR++ +  FLG+
Sbjct  261   --TLEEDATALVLRWQEVAPTTDDGLFLRLLLQPVSSKVKKGE---KTVRATVLAEFLGN  315

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
              ++L+++L  +FP LGL K++C+E SWIES+L W +F  GT PEALL+R P  DA+FLKR
Sbjct  316   GDQLVTLLGKEFPELGLTKENCTETSWIESVLWWANFDIGTSPEALLDRMP-NDANFLKR  374

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ LWKKM+ELG TGL  NPYGG M+ I  ++TPFPHRAG LFKIQY
Sbjct  375   KSDYVQTPISKDGLEWLWKKMIELGKTGLVFNPYGGEMSRIAPSETPFPHRAGNLFKIQY  434

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W++ GE  ++ + ++ + L S++ PFVS+NPR A+LNYRDLDIG + +G  +YEEGK
Sbjct  435   SVNWEDAGEDLEKNYTTESKRLFSYMTPFVSKNPRSAFLNYRDLDIGASSNGAPTYEEGK  494

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQT  223
             VYG KYF  N++RLVKVK+ VDP+NFF NEQSIP L  + T
Sbjct  495   VYGVKYFNDNFDRLVKVKTAVDPENFFYNEQSIPILPSSHT  535



>ref|XP_009353861.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=562

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/532 (58%), Positives = 392/532 (74%), Gaps = 15/532 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YDSFL CL T   N      +SSIVY+  N S++ +LQAY RN RFN  S+PKP+++VT
Sbjct  26    VYDSFLQCLDT-KTNSSNTTQLSSIVYAQNNPSYTPILQAYIRNSRFNRTSTPKPLLVVT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   VLCAK  GV++++RSGGHDYEGISY S  TFI+LDMFNLRSI V+I    
Sbjct  85    PLTESHVQASVLCAKLAGVQLKIRSGGHDYEGISYWSSQTFIVLDMFNLRSITVNIEDN-  143

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                + W Q GATLGELYYRIWEKS VH FP G+C  VGVGGH+SGGGYGN++R++GL VD
Sbjct  144   ---SVWAQTGATLGELYYRIWEKSKVHAFPAGICQLVGVGGHISGGGYGNLLRKYGLAVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IV+  G +LDR +MGEDLFWAI GGGGGSFGVI+++K+KL+ VP+ VT FR EK
Sbjct  201   NVLDAQIVNANGELLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEVVTIFRVEK  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  +   +V ++   A   DD LF+RLLLQ V    K  +   KTVR++ +  FLG+
Sbjct  261   --TLEEDATALVLRWQEVAPTTDDGLFLRLLLQPVSSKVKKGE---KTVRATVLAEFLGN  315

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
              ++L+++L  +FP LGL K++C+E SWIES+L W +F  GT PEALL+R P  DA+FLKR
Sbjct  316   GDQLVTLLGKEFPELGLTKENCTETSWIESVLWWANFDIGTSPEALLDRMP-NDANFLKR  374

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ LWKKM+ELG TGL  NPYGG M+ I  ++TPFPHRAG LFKIQY
Sbjct  375   KSDYVQTPISKDGLEWLWKKMIELGKTGLVFNPYGGEMSRIAPSETPFPHRAGNLFKIQY  434

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W++ GE  ++ + ++ + L S++ PFVS+NPR A+LNYRDLDIG + +G  +YEEGK
Sbjct  435   SVNWEDAGEDLEKNYTTESKRLFSYMTPFVSKNPRSAFLNYRDLDIGASSNGAPTYEEGK  494

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQT----GSESCEP  202
             VYG KYF  N++RLVKVK+ VDP+NFF NEQSIP L  + T    GS S  P
Sbjct  495   VYGVKYFNDNFDRLVKVKTAVDPENFFYNEQSIPILPNSHTDVNGGSNSNIP  546



>ref|XP_002269462.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/516 (58%), Positives = 393/516 (76%), Gaps = 14/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLST S +  P   +S+++Y+P N+S+SSVL++Y RN RFNT ++ KP +I+T
Sbjct  28    VHGAFLQCLSTRSQSSHP---ISAVLYTPDNSSYSSVLESYIRNLRFNTSATLKPRLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   ++C+KK G+++++RSGGHDYEG+SYVSD  F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWVQAGATLGE+YYRI EKS  HGFP GVCPTVG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI GGGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   A K+DD LFIRL + +V     ++ S  KTVR++++ LFLG 
Sbjct  261   --TLEQNTTNIVYQWQQVADKVDDDLFIRLTMDVV----NSSRSGEKTVRATFLSLFLGS  314

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N+  P LGL+  DC+EMSW+ES+L W +F  GT  EALL+R P    + LKR
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQV-LTHLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ PIPK  L+ +WKKM+EL    L  NPYGG+MAEI  + TPFPHRAG L KIQY
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W EEG  A   +I+  R+L+S++ PFVS+ PR+A+LNYRDLD+G   +G +SY EG+
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNGKNSYLEGR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ RLV++K++VDP NFFRNEQSIP+L
Sbjct  494   VYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>emb|CDP21199.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/517 (60%), Positives = 397/517 (77%), Gaps = 14/517 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+F +CL+    N IP + +S I+YSP+N+SFSSVL AY RN+R NT ++ KP IIVT
Sbjct  26    IYDNFAYCLT---RNGIPSNQISKILYSPSNSSFSSVLDAYVRNKRLNTPTTRKPSIIVT  82

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL   H+   +LC K  G+++ +RSGGHD+EG+SYVSD  FIILD+FNLRSI+VD A   
Sbjct  83    PLQVQHIQAAILCTKGTGLQLNIRSGGHDFEGLSYVSDVPFIILDLFNLRSINVDTAT--  140

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQAGATLGELYYRIWEKS++ GFP G+CPTVGVGGH+SGGGYG+++RR+GLTVD
Sbjct  141   --ETAWVQAGATLGELYYRIWEKSNILGFPAGLCPTVGVGGHISGGGYGSLLRRYGLTVD  198

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+I+DV GRVLDR AMGEDLFWAI GGGG SFGV+LA++I+L+RVP+  T F  +K
Sbjct  199   NVLDAQIIDVNGRVLDRKAMGEDLFWAIRGGGGASFGVVLAYRIRLVRVPEIHTVFNVQK  258

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                   N  DV+ ++ N A KID+ LFIR+L+Q    P        K +R +++G FLGD
Sbjct  259   TEA--ENATDVLYKWQNIADKIDNDLFIRVLVQ----PITGKVKGQKIIRLTFMGHFLGD  312

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             + +L+S++N  FP LGLK+ DC E SWI++ML W  +  GT  E LL+R       FLKR
Sbjct  313   ANRLISVMNIGFPELGLKRSDCLETSWIDTMLWWYKYKIGTAKEVLLSRA-YDQLIFLKR  371

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+QNPIPK  L SL+KKM++LG TGL  NPYGGRM+EIP  +TPFPHRAG++FKIQY
Sbjct  372   KSDYVQNPIPKDGLVSLFKKMVQLGKTGLVFNPYGGRMSEIPENETPFPHRAGIIFKIQY  431

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W++       +++ + R L+SF+ PFVS+NPRQA+LNYRDLDIGTTD+G +SY EG+
Sbjct  432   SVNWEDADPNLINQYVGEARNLYSFMTPFVSKNPRQAFLNYRDLDIGTTDNGKNSYNEGQ  491

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP+L+
Sbjct  492   VYGVKYFKNNFDRLVKVKTMVDPQNFFRNEQSIPTLN  528



>gb|KCW75706.1| hypothetical protein EUGRSUZ_D00082 [Eucalyptus grandis]
Length=520

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/548 (57%), Positives = 400/548 (73%), Gaps = 34/548 (6%)
 Frame = -3

Query  1869  TMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             T +S+    L+F+ +   L+  ++ +  +YD+FL CL+  +    P D +S IVYS AN+
Sbjct  5     TSLSALSAVLLFIVVSLHLSPSWAASDSVYDTFLQCLTHRTR---PSDHISDIVYSRANS  61

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             SF++                  P++IVTP  ESHV   VLC+K LG+ +++RSGGHDYEG
Sbjct  62    SFAN------------------PLVIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEG  103

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             ISYVSD  F ILDMFNLRSIDV+I      ETAWVQAGATLGELYYRIWEKS +HGFP G
Sbjct  104   ISYVSDDAFFILDMFNLRSIDVNIQK----ETAWVQAGATLGELYYRIWEKSKLHGFPAG  159

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             V PT+GVGGH SG GYGNM+R++GL+VD+V+DAR+VDV+GR+LDR AMGEDLFWAI GGG
Sbjct  160   VGPTIGVGGHFSGAGYGNMLRKYGLSVDNVLDARMVDVRGRILDRKAMGEDLFWAIIGGG  219

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGVILA++IKL+ VP+ VT F  EK   L +N  D+V ++   A + D  LF+RLLL
Sbjct  220   GASFGVILAYQIKLVPVPEKVTVFPVEK--TLDQNATDLVYKWQFVAPRTDHGLFMRLLL  277

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T       KT+R++ V LFLG+S++LL+I + + P +GLKK++C+E+SWIES+L
Sbjct  278   Q---PVTSQTQKGQKTLRATVVTLFLGNSDQLLAITDKELPEMGLKKENCTELSWIESVL  334

Query  789   RWGSFGNGTKP--EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLA  616
              W  F  GT P  E LL+R  +   +FLKRKSDY+Q PI K  LD LWKKM+ELG  GL 
Sbjct  335   WWDGFDEGTIPALETLLSRDDS--TNFLKRKSDYVQTPISKANLDWLWKKMIELGKVGLV  392

Query  615   VNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFV  436
              NPYGGRM+EI ++ TPFPHRAG LFKIQY+V+W E+    ++ +++Q+R L+++  PFV
Sbjct  393   FNPYGGRMSEILASATPFPHRAGNLFKIQYSVNWNEDDPELEKNYLAQVRSLYNYTTPFV  452

Query  435   SRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             S+NPR AYLNYRDLDIGT+  G +SYEEG+VYG KYF  N+ERLVKVK+ VDP+NFFRNE
Sbjct  453   SKNPRSAYLNYRDLDIGTSTDGKNSYEEGQVYGVKYFNDNFERLVKVKTAVDPNNFFRNE  512

Query  255   QSIPSLSR  232
             QSIP L +
Sbjct  513   QSIPPLPK  520



>ref|XP_008439528.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=556

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/538 (58%), Positives = 394/538 (73%), Gaps = 20/538 (4%)
 Frame = -3

Query  1800  SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             S   P+Y +FL CL   S    P  L S+IV+ P N S+SS+L+AY RN RFNT S+PKP
Sbjct  19    SAASPLYQTFLRCLQNHSD---PNQLTSNIVFDPTNISYSSLLRAYIRNARFNTSSTPKP  75

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY--VSDATFIILDMFNLRSID  1447
               I+TPLHESH+   ++CAK   + IR+RSGGHD+EG+SY  VS + FI++DMFNLRSI 
Sbjct  76    TFIITPLHESHLQFTLICAKSSALHIRIRSGGHDFEGLSYASVSPSPFILIDMFNLRSIA  135

Query  1446  VDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIR  1267
             VD+       +AWVQAGATLGELYYRIWE+S +HGFP GVCPTVGVGGH+SGGGYGNM+R
Sbjct  136   VDLQS----RSAWVQAGATLGELYYRIWEQSKLHGFPAGVCPTVGVGGHISGGGYGNMLR  191

Query  1266  RFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTV  1087
             +FGL+VDHVVDARIVD  GR++DR  MGEDLFWAI GGGG SFGVILA+KI+L+ VP+TV
Sbjct  192   KFGLSVDHVVDARIVDANGRIVDRKMMGEDLFWAIRGGGGASFGVILAYKIQLVPVPETV  251

Query  1086  TYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSY  907
             T FR ++   L  N  D+V ++ + A   D  LF+RLLLQ +    K      KTVR+S 
Sbjct  252   TVFRLQR--TLEDNGTDMVYRWQHIAPNTDSDLFMRLLLQPIYSKPK------KTVRASV  303

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
               LFLG +++LLSIL  DFP LGLKK+DC EM WIES++ W ++ +GT    LL R+P G
Sbjct  304   YTLFLGRADRLLSILKRDFPELGLKKEDCIEMGWIESVIWWANYEHGTSLRVLLGRSP-G  362

Query  726   DASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAG  547
              A F KRKSDY+Q PI K  L+ LWKK++EL  T L  NPYGG+M EI +  T FP RAG
Sbjct  363   LAHFQKRKSDYVQTPISKDGLELLWKKLMELDKTELVFNPYGGKMNEISALDTAFPRRAG  422

Query  546   VLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDH--  373
              LFKIQY+VSWKE+G  A++ H++Q++ L++FL P+VS+NPR AY NYRDLDIGT  +  
Sbjct  423   NLFKIQYSVSWKEQGIEAEKSHVNQLQLLYNFLTPYVSKNPRTAYFNYRDLDIGTNHNYD  482

Query  372   GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
               +S+EEGKVYG KYF  N+ERLV+VK+ VDP NFFR+EQSIP+  + Q+   S   G
Sbjct  483   AANSFEEGKVYGIKYFKENFERLVRVKTAVDPQNFFRDEQSIPAFPKLQSSGLSWSGG  540



>ref|XP_010053029.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Eucalyptus 
grandis]
Length=559

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/527 (56%), Positives = 392/527 (74%), Gaps = 15/527 (3%)
 Frame = -3

Query  1785  MYDSFLHCL-----STVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             +YD+FL CL              +   S I+++P N+SF ++L +  RNRRF T S+PKP
Sbjct  30    LYDTFLQCLLNHTQVLQQQQQQRQQEPSQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKP  89

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++I+TP   SHV   VLCA++ G E+R+RSGGHD+EG SYVS A F+ILDMFN RS+DVD
Sbjct  90    LLILTPSQPSHVQSAVLCARRTGTEVRIRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVD  149

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             +      ETAWV +GAT+GELYYRIWEKS ++GF  GVCPTVGVGGH+SGGGYGNM+R++
Sbjct  150   VER----ETAWVGSGATVGELYYRIWEKSGLYGFNAGVCPTVGVGGHLSGGGYGNMLRKY  205

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL  D+VVDA+IVDV+GRVLDR++MGEDLFWAI GGGG SFGVIL +++KL+ VP  VT 
Sbjct  206   GLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGGGGASFGVILGYRVKLVPVPNVVTV  265

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR  K   +  N  ++V Q+ N A + D+ LF+RLLLQ   P +      +KTV +S + 
Sbjct  266   FRVAK--TIEENATELVYQWQNIAPRTDNDLFMRLLLQ---PVSSKIQKGAKTVNASVLA  320

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             LFLG++++L+S+++ +FP LGLKK+DC+EMSWIES L WG F +G   +ALL+R P    
Sbjct  321   LFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALWWGDFDSGVAVKALLDRMPK-SV  379

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q P+ +  L+ LW +M+ELG  G   NPYGG+M EIP +  PFPHRAG L
Sbjct  380   NFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPYGGKMGEIPVSDAPFPHRAGNL  439

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY++SW E+G  A++ ++++IREL++F+ P+VS+ PR+A+LNYRD DIG TD+G +S
Sbjct  440   FKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKPRRAFLNYRDFDIGITDNGENS  499

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             Y EG VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP L R+ + 
Sbjct  500   YREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVLPRSSSA  546



>ref|XP_007147449.1| hypothetical protein PHAVU_006G125600g [Phaseolus vulgaris]
 gb|ESW19443.1| hypothetical protein PHAVU_006G125600g [Phaseolus vulgaris]
Length=538

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/540 (57%), Positives = 396/540 (73%), Gaps = 16/540 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             M+S   F++ L L +  TSC S T  +Y +F+ CL     N I    +S+IV++  NAS+
Sbjct  12    MASMLPFVIVLLLSH--TSCASPTDSVYGAFVDCLR----NNIHSPNISNIVFAQTNASY  65

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
             +S+L+AY RN R NT S+PKP+IIVTPL E HV   V+CAK + +++++RSGGHD+EG+S
Sbjct  66    TSILRAYIRNARLNTTSAPKPLIIVTPLQEYHVQTAVICAKGIDIQLKIRSGGHDFEGLS  125

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             Y+SD  FI+LDMFNLR+I VD+  G     A VQAGATLGE+YYRIWE+S VHGFP GVC
Sbjct  126   YISDEPFIMLDMFNLRNITVDVQKG----VAVVQAGATLGEVYYRIWEESDVHGFPAGVC  181

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH SGGGYGNM+R++GL++DH++DA+IVDVKGR+L++  MGEDLFWAI GGGG 
Sbjct  182   PTVGVGGHFSGGGYGNMMRKYGLSIDHIIDAQIVDVKGRILNKETMGEDLFWAIRGGGGA  241

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL++ IKL+ VP+ VT FR EK   L +N  D+V Q+   A   D+ LF+RL L+ 
Sbjct  242   SFGVILSYTIKLVPVPEVVTVFRVEK--TLDQNATDLVVQWQQVAPHTDERLFMRLQLR-  298

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
               P         KT+R+  V LFLG ++ L+S+L+ +F  LGL K++C EMSWIES L W
Sbjct  299   --PVNSNVGGRHKTIRAEVVTLFLGGADDLVSLLDKEFSILGLNKENCIEMSWIESALWW  356

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              SF NGT P ALLNR     A FLKRKSDY++ PI +  L+ +W++M+ELG T +  NPY
Sbjct  357   ASFRNGTHPNALLNRK-LNSAKFLKRKSDYVKTPISRDGLEWIWRRMIELGETSIVFNPY  415

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM EI +  T FPHRAG LFKI+Y+V+W E G AAD+   +QIR LHS++ PFVS+NP
Sbjct  416   GGRMNEISTNATAFPHRAGNLFKIEYSVNWDEPGYAADKNFTTQIRRLHSYMTPFVSKNP  475

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R+A+LNYRDLDIG   H  +SY EG+VYG KYF  N+  LVK+K+ VDP+N+FRNEQSIP
Sbjct  476   RRAFLNYRDLDIGINHHDNNSYHEGEVYGIKYFHNNFYTLVKIKTEVDPENYFRNEQSIP  535



>ref|XP_010053028.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Eucalyptus 
grandis]
Length=578

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/527 (56%), Positives = 392/527 (74%), Gaps = 15/527 (3%)
 Frame = -3

Query  1785  MYDSFLHCL-----STVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             +YD+FL CL              +   S I+++P N+SF ++L +  RNRRF T S+PKP
Sbjct  30    LYDTFLQCLLNHTQVLQQQQQQRQQEPSQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKP  89

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++I+TP   SHV   VLCA++ G E+R+RSGGHD+EG SYVS A F+ILDMFN RS+DVD
Sbjct  90    LLILTPSQPSHVQSAVLCARRTGTEVRIRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVD  149

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             +      ETAWV +GAT+GELYYRIWEKS ++GF  GVCPTVGVGGH+SGGGYGNM+R++
Sbjct  150   VER----ETAWVGSGATVGELYYRIWEKSGLYGFNAGVCPTVGVGGHLSGGGYGNMLRKY  205

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL  D+VVDA+IVDV+GRVLDR++MGEDLFWAI GGGG SFGVIL +++KL+ VP  VT 
Sbjct  206   GLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGGGGASFGVILGYRVKLVPVPNVVTV  265

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR  K   +  N  ++V Q+ N A + D+ LF+RLLLQ   P +      +KTV +S + 
Sbjct  266   FRVAK--TIEENATELVYQWQNIAPRTDNDLFMRLLLQ---PVSSKIQKGAKTVNASVLA  320

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             LFLG++++L+S+++ +FP LGLKK+DC+EMSWIES L WG F +G   +ALL+R P    
Sbjct  321   LFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALWWGDFDSGVAVKALLDRMPK-SV  379

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q P+ +  L+ LW +M+ELG  G   NPYGG+M EIP +  PFPHRAG L
Sbjct  380   NFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPYGGKMGEIPVSDAPFPHRAGNL  439

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY++SW E+G  A++ ++++IREL++F+ P+VS+ PR+A+LNYRD DIG TD+G +S
Sbjct  440   FKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKPRRAFLNYRDFDIGITDNGENS  499

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             Y EG VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP L R+ + 
Sbjct  500   YREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVLPRSSSA  546



>gb|KCW77269.1| hypothetical protein EUGRSUZ_D01626, partial [Eucalyptus grandis]
Length=562

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/527 (56%), Positives = 392/527 (74%), Gaps = 15/527 (3%)
 Frame = -3

Query  1785  MYDSFLHCL-----STVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             +YD+FL CL              +   S I+++P N+SF ++L +  RNRRF T S+PKP
Sbjct  29    LYDTFLQCLLNHTQVLQQQQQQRQQEPSQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKP  88

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++I+TP   SHV   VLCA++ G E+R+RSGGHD+EG SYVS A F+ILDMFN RS+DVD
Sbjct  89    LLILTPSQPSHVQSAVLCARRTGTEVRIRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVD  148

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             +      ETAWV +GAT+GELYYRIWEKS ++GF  GVCPTVGVGGH+SGGGYGNM+R++
Sbjct  149   VER----ETAWVGSGATVGELYYRIWEKSGLYGFNAGVCPTVGVGGHLSGGGYGNMLRKY  204

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL  D+VVDA+IVDV+GRVLDR++MGEDLFWAI GGGG SFGVIL +++KL+ VP  VT 
Sbjct  205   GLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGGGGASFGVILGYRVKLVPVPNVVTV  264

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR  K   +  N  ++V Q+ N A + D+ LF+RLLLQ   P +      +KTV +S + 
Sbjct  265   FRVAK--TIEENATELVYQWQNIAPRTDNDLFMRLLLQ---PVSSKIQKGAKTVNASVLA  319

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             LFLG++++L+S+++ +FP LGLKK+DC+EMSWIES L WG F +G   +ALL+R P    
Sbjct  320   LFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALWWGDFDSGVAVKALLDRMPK-SV  378

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q P+ +  L+ LW +M+ELG  G   NPYGG+M EIP +  PFPHRAG L
Sbjct  379   NFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPYGGKMGEIPVSDAPFPHRAGNL  438

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY++SW E+G  A++ ++++IREL++F+ P+VS+ PR+A+LNYRD DIG TD+G +S
Sbjct  439   FKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKPRRAFLNYRDFDIGITDNGENS  498

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
             Y EG VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP L R+ + 
Sbjct  499   YREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVLPRSSSA  545



>ref|XP_010098534.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75194.1| Reticuline oxidase-like protein [Morus notabilis]
Length=547

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 386/517 (75%), Gaps = 11/517 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y  FL CL   +    P   VS+ VYS +N S++SVL+AY RN RFN+ S+ KP++IVT
Sbjct  39    LYTRFLQCLENHTN---PSSQVSNQVYSQSNTSYTSVLRAYIRNARFNSSSTNKPLLIVT  95

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESHV   V+CAK +G+++++RSGGHDY GISYVSD+ F ILDMF LRSI VD+A   
Sbjct  96    ASHESHVQAAVICAKSIGLQLKIRSGGHDYAGISYVSDSPFAILDMFQLRSISVDVAD--  153

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+ WV++GATLGELYYRIWEKS V GFPGGVCPTV +GGHVSGGGYG MIR++GL VD
Sbjct  154   --ESVWVESGATLGELYYRIWEKSKVLGFPGGVCPTVAIGGHVSGGGYGQMIRKYGLAVD  211

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
              V+DA+IVDV G +LDR AMGEDLFWAI GGGG SFGVIL++K+KL+ VP+TVT FR E+
Sbjct  212   QVLDAKIVDVNGNILDRKAMGEDLFWAIRGGGGASFGVILSYKLKLVPVPETVTVFRMER  271

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                  ++  D V ++   A   DD LF+R+L+Q   P T       KT+R++ V +FLG+
Sbjct  272   IYDQNQSVTDFVYEWQKVAPATDDGLFMRMLIQ---PITSRVRRPEKTIRATIVTMFLGN  328

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+S+L+ +FP L LKK++C EMSWI+S+L W +F NGT PE LL+R     A+FL R
Sbjct  329   ADQLVSLLDKEFPLLELKKENCMEMSWIDSVLWWANFDNGTSPEVLLDRD-LDSANFLIR  387

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ LWK++ ELG TG   NPYGG+M EI     PFPHRAG L+KIQY
Sbjct  388   KSDYVQTPISKDGLEWLWKRVTELGKTGFVFNPYGGKMNEISPADAPFPHRAGNLYKIQY  447

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W+E     ++ + +QIR L S++ PFVS+NPR+A+LNYRDLDIG    G +SYEEGK
Sbjct  448   SVNWEESSPELEKNYTTQIRRLFSYMTPFVSKNPRRAFLNYRDLDIGVNSFGENSYEEGK  507

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             VYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP+LS
Sbjct  508   VYGVKYFSDNFDRLVKVKTAVDPENFFRNEQSIPTLS  544



>ref|XP_010098533.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75193.1| Reticuline oxidase-like protein [Morus notabilis]
Length=537

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 383/517 (74%), Gaps = 12/517 (2%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             Y++FL C+   +   +P  L SSI+YS  N S++SVL+AY RN RFNT S+ KP++I+TP
Sbjct  27    YNTFLQCMQR-NTKALPSQL-SSIIYSQTNPSYTSVLRAYIRNARFNTTSTNKPLLIITP  84

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
               ESH+   VLCAK LG+ I+ RSGGHDY G+SY S   F+I+DMFNLRS+ VD+A    
Sbjct  85    TTESHISATVLCAKTLGLRIKTRSGGHDYAGLSYTSGVPFVIIDMFNLRSVTVDLAD---  141

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ++AW+Q GATLGELY+ IW+KS   GFP GVCPTVG GGH+SGGGYGNMIR++GL VDH
Sbjct  142   -QSAWIQTGATLGELYHNIWKKSKALGFPAGVCPTVGAGGHLSGGGYGNMIRKYGLAVDH  200

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             VVDA+IVD KG VLDR AMGEDLFWAI GGGG SFGVILA+K+KL+ VP  VT F+A++ 
Sbjct  201   VVDAKIVDAKGNVLDRKAMGEDLFWAIRGGGGASFGVILAYKLKLVPVPDIVTVFKAQRT  260

Query  1062  L-GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             L  +     D V Q+   A   +D LF+R+L+Q   P T       KTVR +   L+LG 
Sbjct  261   LDNVNDKMTDFVYQWQQAAPTTNDGLFMRMLIQ---PVTSKASKGQKTVRVTINALYLGK  317

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+S L  DFP LGLKK++C+E+SWI+S+L W ++ NGT P+ALL+R P   A F  R
Sbjct  318   ADELVSFLAKDFPLLGLKKENCTELSWIDSVLWWANYDNGTSPDALLDRDP-NSAIFGTR  376

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+QNPI K  L+ +WKKM+ELG  GL  NPYGGRM ++P + TPFPHRAG LFKIQY
Sbjct  377   KSDYVQNPISKDGLEWIWKKMMELGKVGLVFNPYGGRMNQVPESATPFPHRAGNLFKIQY  436

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             ++SWKE G  AD    +QIR L S++ PFVS+NPR A+LNYRD+DIG    G +SYEEGK
Sbjct  437   SISWKEPGPEADNNFTTQIRRLFSYMTPFVSKNPRSAFLNYRDIDIGVNHFGPNSYEEGK  496

Query  345   VYGHKYF-MGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG +YF   N++RLVKVK+ VDP+NFF++EQSIP+L
Sbjct  497   VYGVRYFGAANFDRLVKVKTAVDPENFFKSEQSIPTL  533



>gb|KHN25855.1| Reticuline oxidase-like protein [Glycine soja]
Length=541

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 389/514 (76%), Gaps = 11/514 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL+  +     +D VS+IV++  NASFSSVLQAY RN RFNT S+PKP+++VT
Sbjct  34    VYTSFLECLTNYTK---AQDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  + HV   V+CAK +G+++++RSGGHDYEGISYVSD  FIILDMF+ R    +I    
Sbjct  91    PSEDPHVQGAVICAKSIGIQLKIRSGGHDYEGISYVSDQPFIILDMFHFR----NITVAV  146

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQAGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+ GL+VD
Sbjct  147   ENEVAVVQAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVD  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HVVDA+IVDVKGR+LD+ +MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ VT FR  K
Sbjct  207   HVVDAKIVDVKGRILDKESMGEDLFWAIRGGGGASFGVILSYTVKLIPVPEVVTVFRIAK  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              L    +  ++V Q+   A   D  LF+RLLLQ   P +       +T+R++ + LFLG 
Sbjct  267   SLDQNESATELVLQWQQVAPHTDHRLFMRLLLQ---PVSSKVVKGQRTIRATVMALFLGG  323

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             ++++++++  +FPALGL K++C+E+SWI+S+L W +F N TKP+ALL+R     ASFLKR
Sbjct  324   ADEVVTLMGKEFPALGLSKENCTELSWIDSVLWWSNFDNTTKPDALLDRD-LNSASFLKR  382

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+QNPI K  L+ +W+KM+ELG TG   NPYGG+M+E+ S  TPFPHRAG LFKIQY
Sbjct  383   KSDYVQNPISKKGLEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQY  442

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+W + G   ++   SQ + L+S++ PFVS +PR A+LNYRDLDIGT   G +SYEEG 
Sbjct  443   SVNWDDPGVELEKNFTSQAKMLYSYMTPFVSSDPRSAFLNYRDLDIGTNSFGKNSYEEGA  502

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  503   VYGVKYFNDNFKRLVKIKTEVDPENFFRNEQSIP  536



>ref|XP_010655774.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/516 (57%), Positives = 390/516 (76%), Gaps = 14/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLST S +  P   +S+ +Y+P N+S+SSVL++Y RN RFNT ++PKP +I+T
Sbjct  28    VHGAFLQCLSTHSQSSHP---ISAALYTPDNSSYSSVLESYIRNLRFNTSTTPKPRLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   ++C+KK G+++++RSGGHD+EG+SYVSD  F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIQAAIICSKKHGLQMKIRSGGHDFEGVSYVSDVPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWVQAGATLGE+YYRI EKS  HGFP GVCPTVG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESAWVQAGATLGEMYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI  GGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIIAGGGASYGVIVSYKIKLVQVPATVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   A K+D  LFIRL + +V     ++ S  KTVR++++ LFLG 
Sbjct  261   --TLEQNATNIVYQWQQVADKVDGDLFIRLTMDVV----NSSRSGEKTVRATFLSLFLGS  314

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N+  P LGL+  DC+EMSW+ES+L W  F  GT  EALL+R P    + LKR
Sbjct  315   SERLLSIMNTRLPELGLQSSDCTEMSWVESVLFWTEFATGTPVEALLDRNPQ-VLTHLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ PIPK  L+ +WKKM+EL    L  NPYGG+MAEI  + TPFPHRAG L KI Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPYLVFNPYGGKMAEISPSATPFPHRAGNLCKIMY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W EEG  A   +I+  ++L+S++ PFVS++PR+A+LNYRDLD+G   +G +SY EG+
Sbjct  434   ATNWDEEGSEAAERYINLTQKLYSYMTPFVSKSPREAFLNYRDLDLGVNHNGKNSYLEGR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +YG KYF  N+ RLV++K++VDP NFFRNEQSIP+L
Sbjct  494   IYGIKYFKENFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_010053030.1| PREDICTED: reticuline oxidase-like protein isoform X3 [Eucalyptus 
grandis]
Length=548

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/521 (57%), Positives = 389/521 (75%), Gaps = 15/521 (3%)
 Frame = -3

Query  1785  MYDSFLHCL-----STVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             +YD+FL CL              +   S I+++P N+SF ++L +  RNRRF T S+PKP
Sbjct  30    LYDTFLQCLLNHTQVLQQQQQQRQQEPSQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKP  89

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++I+TP   SHV   VLCA++ G E+R+RSGGHD+EG SYVS A F+ILDMFN RS+DVD
Sbjct  90    LLILTPSQPSHVQSAVLCARRTGTEVRIRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVD  149

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             +      ETAWV +GAT+GELYYRIWEKS ++GF  GVCPTVGVGGH+SGGGYGNM+R++
Sbjct  150   VER----ETAWVGSGATVGELYYRIWEKSGLYGFNAGVCPTVGVGGHLSGGGYGNMLRKY  205

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL  D+VVDA+IVDV+GRVLDR++MGEDLFWAI GGGG SFGVIL +++KL+ VP  VT 
Sbjct  206   GLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGGGGASFGVILGYRVKLVPVPNVVTV  265

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR  K   +  N  ++V Q+ N A + D+ LF+RLLLQ   P +      +KTV +S + 
Sbjct  266   FRVAK--TIEENATELVYQWQNIAPRTDNDLFMRLLLQ---PVSSKIQKGAKTVNASVLA  320

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             LFLG++++L+S+++ +FP LGLKK+DC+EMSWIES L WG F +G   +ALL+R P    
Sbjct  321   LFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALWWGDFDSGVAVKALLDRMPK-SV  379

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             +FLKRKSDY+Q P+ +  L+ LW +M+ELG  G   NPYGG+M EIP +  PFPHRAG L
Sbjct  380   NFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPYGGKMGEIPVSDAPFPHRAGNL  439

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY++SW E+G  A++ ++++IREL++F+ P+VS+ PR+A+LNYRD DIG TD+G +S
Sbjct  440   FKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKPRRAFLNYRDFDIGITDNGENS  499

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             Y EG VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP L
Sbjct  500   YREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQSIPVL  540



>ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago truncatula]
 gb|AES64861.1| FAD-binding berberine family protein [Medicago truncatula]
Length=542

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/552 (55%), Positives = 399/552 (72%), Gaps = 23/552 (4%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCF------SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVY  1705
             M  S+P+ L + ++   + S F      + T  +Y +FLHCL+  + +P     +S+IV+
Sbjct  1     MAKSNPISLCYFSIPFFVLSVFFSASLAAPTESLYTTFLHCLTQNNTDPT----ISNIVF  56

Query  1704  SPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGG  1525
             S  N SFS VL+ Y RN RFNT S+ KP++IVTP   SHV   V+CAK++ ++I++RSGG
Sbjct  57    SQTNTSFSIVLKNYIRNARFNTTSTTKPLLIVTPKQPSHVQSTVICAKQVNIQIKIRSGG  116

Query  1524  HDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVH  1345
             HDYEGISYV+ + FIILDMFNLR+I+VDI      E A+VQ GATLGE+YYRI+EKS VH
Sbjct  117   HDYEGISYVNQSPFIILDMFNLRTINVDIKN----EVAYVQGGATLGEVYYRIYEKSKVH  172

Query  1344  gfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWA  1165
             GFP GVCPTVGVGGH SGGGYG M+R++GL+VD+++DA IVDVKGR+L+R +MGEDLFWA
Sbjct  173   GFPAGVCPTVGVGGHFSGGGYGTMLRKYGLSVDNIIDAEIVDVKGRLLNRKSMGEDLFWA  232

Query  1164  INggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLF  985
             I GGGG SFGV+L++ +KL+ VP+TVT FR EK   L +N  D+V Q+   A   D+ LF
Sbjct  233   ILGGGGASFGVVLSYTVKLVAVPETVTVFRIEK--TLEQNATDLVVQWQQVAPTTDNRLF  290

Query  984   IRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSW  805
             +RLLLQ   P T      +KT+R+S V +FLG +E+L+ IL   FP LGLKK DC E+SW
Sbjct  291   MRLLLQ---PITSKVVKGTKTIRASVVAMFLGRAEELVGILGKQFPLLGLKKTDCIELSW  347

Query  804   IESMLRWGS---FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLEL  634
             I S++ +     F  G KPE+LL+R     A+F KRKSDY+Q  I K  L+ +WKKM+EL
Sbjct  348   INSVIWYNDADDFNKGAKPESLLDRN-LNSAAFGKRKSDYVQKAISKDDLEGIWKKMIEL  406

Query  633   GNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHS  454
             G  G   NPYGG+MAEIP+  TPFPHRAG LFKIQ++V+W +    A    ++Q + L+S
Sbjct  407   GKVGFVFNPYGGKMAEIPADATPFPHRAGNLFKIQFSVNWNDPAPNATVGFLNQAKVLYS  466

Query  453   FLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPD  274
             ++ P+VS+NPR AY+NYRDLDIG    G +SYEEG+VYG KYF  N++RLVK+K+ VDPD
Sbjct  467   YMTPYVSKNPRSAYINYRDLDIGINSFGKNSYEEGEVYGTKYFNNNFDRLVKIKTAVDPD  526

Query  273   NFFRNEQSIPSL  238
             NFFRNEQSIP L
Sbjct  527   NFFRNEQSIPVL  538



>ref|XP_006348174.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=529

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/523 (59%), Positives = 387/523 (74%), Gaps = 15/523 (3%)
 Frame = -3

Query  1803  FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPK  1624
              + + P Y SFL CLS  S    P D + S VY+P N+S+ SVLQ Y RN+RFN  ++PK
Sbjct  21    LAASTPSYLSFLQCLSKHSH---PSDHILSRVYTPNNSSYKSVLQHYIRNQRFNRSTTPK  77

Query  1623  PVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDV  1444
             P II TPL ESHV   V C +K    +++RSGGHDYEGISYVS+ +F++LDM NLRSIDV
Sbjct  78    PDIIFTPLQESHVQVAVTCCRKTDKYLKIRSGGHDYEGISYVSNISFVLLDMSNLRSIDV  137

Query  1443  DIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRR  1264
             DI      ETAWVQAGA LGELYYRIWEKS VH FP GVCPTVGVGGH++GGGYGN++R+
Sbjct  138   DIQN----ETAWVQAGALLGELYYRIWEKSKVHAFPAGVCPTVGVGGHITGGGYGNLLRK  193

Query  1263  FGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVT  1084
             +GL+VD+++DA IVDV GR+L+R +MGEDLFWAI GG G SFGVI A+K++L++VP  VT
Sbjct  194   YGLSVDNLIDAHIVDVHGRILNRGSMGEDLFWAIRGGCGASFGVISAYKLRLVKVPDVVT  253

Query  1083  YFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYV  904
              FR  + L  T    D+V  +   A KID +LFIRL L+    P       +KT+ +++V
Sbjct  254   VFRVVRTLEETAI--DIVYWWQFIAEKIDSNLFIRLALK----PIDEKQKGTKTITATFV  307

Query  903   GLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGD  724
              LFLGDS +LLSI++ DFP LGL  +DC EMSWIES L W SF NGT P+ALLNR P   
Sbjct  308   ALFLGDSRELLSIMDRDFPQLGLHIEDCKEMSWIESELFWASFPNGTLPDALLNRKPG--  365

Query  723   ASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGV  544
             A FLKRKSDYLQ PIPK  L S++ KM+ELG+T L  N YGGRM+EIP  +TPFPHRAG 
Sbjct  366   AKFLKRKSDYLQKPIPKDKLKSIFDKMIELGDTELVFNQYGGRMSEIPEWETPFPHRAGN  425

Query  543   LFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLH  364
             +FKIQYA +W +EG+ A+  +I+Q R L++++ PFVS++PR AYLNYRDLDIG   +G +
Sbjct  426   IFKIQYAANWGKEGKEAENFYINQTRVLYNYMTPFVSKSPRCAYLNYRDLDIGVNHNGNN  485

Query  363   SYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
              Y EG+VYG KYF  N+ +LVKVK+ VDPDNFF NEQSIP L+
Sbjct  486   RYIEGRVYGLKYFKDNFNKLVKVKTLVDPDNFFWNEQSIPPLA  528



>gb|KHN14306.1| Reticuline oxidase-like protein [Glycine soja]
Length=527

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 395/538 (73%), Gaps = 15/538 (3%)
 Frame = -3

Query  1851  PVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
             P+ +V L L    +     T  +Y++F+ CL     N I    +S+IV++  N+S+SS+L
Sbjct  3     PIVIVLL-LSPHASYAAQATESVYETFVDCLR----NYINSPNISNIVFAQTNSSYSSIL  57

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
             +AY RN RFNT SSPKP+IIV P+ ESHV   V+CA+ + ++I+ RSGGHD+EG+SY+SD
Sbjct  58    RAYIRNARFNTTSSPKPLIIVAPVQESHVQTAVICAESIDMQIKTRSGGHDFEGLSYISD  117

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               FI+LDMFNLR+I VD       + A VQAGATLGELYYRIWEKS V GFP GVC TVG
Sbjct  118   EPFIMLDMFNLRNITVDAQN----KVAVVQAGATLGELYYRIWEKSDVLGFPAGVCHTVG  173

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             VGGH SGGGYGNM+R++GL++DH+ DA+IVDVKGR+L++ +MGEDLFWAI GGGG SFGV
Sbjct  174   VGGHFSGGGYGNMMRKYGLSIDHISDAQIVDVKGRILNKESMGEDLFWAIRGGGGASFGV  233

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             IL++ IKL+ VP+ VT F+ EK   L +N  D+V Q+   A   D+ LF+RL L    P 
Sbjct  234   ILSYTIKLVPVPEVVTVFQVEK--TLEQNATDLVVQWQQVAPYTDERLFMRLQLH---PM  288

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
                     KTVR++ + +FLG +E+L+S+L+  FP LGLKK++C EMSWIES++ W SF 
Sbjct  289   ISNVGERHKTVRAAVMTMFLGGAEELVSLLDKKFPTLGLKKENCIEMSWIESVVWWDSFP  348

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
             NG  PEALL R     A FLKRKSDY+++PI K  L+ +WK+M+ELG TG+A NPYGGRM
Sbjct  349   NGAHPEALLGRN-LNSAKFLKRKSDYVKDPISKDGLEWIWKRMIELGQTGMAFNPYGGRM  407

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
              EI +  T FPHRAG LFKI+Y+ +W+E G +A++   +QIR LHS++ PFVS+NPR+A+
Sbjct  408   NEISANATAFPHRAGNLFKIEYSANWEEPGGSAEKNFTTQIRRLHSYMTPFVSKNPRRAF  467

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             LNYRDLDIG   H  +SY+EG+VYG KYF  N+ RL K+K+ VDP N+FRNEQSIP+L
Sbjct  468   LNYRDLDIGINHHDNNSYQEGEVYGFKYFDDNFYRLAKIKTEVDPGNYFRNEQSIPTL  525



>ref|XP_003546282.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=537

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 395/538 (73%), Gaps = 15/538 (3%)
 Frame = -3

Query  1851  PVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
             P+ +V L L    +     T  +Y++F+ CL     N I    +S+IV++  N+S+SS+L
Sbjct  13    PIVIVLL-LSPHASYAAQATESVYETFVDCLR----NYINSPNISNIVFAQTNSSYSSIL  67

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
             +AY RN RFNT SSPKP+IIV P+ ESHV   V+CA+ + ++I+ RSGGHD+EG+SY+SD
Sbjct  68    RAYIRNARFNTTSSPKPLIIVAPVQESHVQTAVICAESIDMQIKTRSGGHDFEGLSYISD  127

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               FI+LDMFNLR+I VD       + A VQAGATLGELYYRIWEKS V GFP GVC TVG
Sbjct  128   EPFIMLDMFNLRNITVDAQN----KVAVVQAGATLGELYYRIWEKSDVLGFPAGVCHTVG  183

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             VGGH SGGGYGNM+R++GL++DH+ DA+IVDVKGR+L++ +MGEDLFWAI GGGG SFGV
Sbjct  184   VGGHFSGGGYGNMMRKYGLSIDHISDAQIVDVKGRILNKESMGEDLFWAIRGGGGASFGV  243

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             IL++ IKL+ VP+ VT F+ EK   L +N  D+V Q+   A   D+ LF+RL L    P 
Sbjct  244   ILSYTIKLVPVPEVVTVFQVEK--TLEQNATDLVVQWQQVAPYTDERLFMRLQLH---PM  298

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
                     KTVR++ + +FLG +E+L+S+L+  FP LGLKK++C EMSWIES++ W SF 
Sbjct  299   ISNVGERHKTVRAAVMTMFLGGAEELVSLLDKKFPTLGLKKENCIEMSWIESVVWWDSFP  358

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
             NG  PEALL R     A FLKRKSDY+++PI K  L+ +WK+M+ELG TG+A NPYGGRM
Sbjct  359   NGAHPEALLGRN-LNSAKFLKRKSDYVKDPISKDGLEWIWKRMIELGQTGMAFNPYGGRM  417

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
              EI +  T FPHRAG LFKI+Y+ +W+E G +A++   +QIR LHS++ PFVS+NPR+A+
Sbjct  418   NEISANATAFPHRAGNLFKIEYSANWEEPGGSAEKNFTTQIRRLHSYMTPFVSKNPRRAF  477

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             LNYRDLDIG   H  +SY+EG+VYG KYF  N+ RL K+K+ VDP N+FRNEQSIP+L
Sbjct  478   LNYRDLDIGINHHDNNSYQEGEVYGFKYFDDNFYRLAKIKTEVDPGNYFRNEQSIPTL  535



>ref|XP_003534781.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=533

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/536 (57%), Positives = 396/536 (74%), Gaps = 24/536 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
              VFL++ + L S  S    +YD+FLHCL+  +    P   +S+IV++  ++ F +VL+ Y
Sbjct  13    FVFLSVFSSL-SARSPNPSLYDTFLHCLTQHTN---PSTQLSNIVFANTDSKFPTVLENY  68

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RN RFNT S+PKP++IVTPL ESHV   V+CAK + +++++RSGGHDYEGISY+S   F
Sbjct  69    IRNARFNTSSTPKPLLIVTPLVESHVQAAVICAKSVNIQLKIRSGGHDYEGISYISQKPF  128

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
             I+LDM NLR I VD+      E A VQAGA LGELY+RIWEKS +HGFP  VCPTVGVGG
Sbjct  129   ILLDMSNLRKITVDVKN----ELAVVQAGAILGELYFRIWEKSKLHGFPAAVCPTVGVGG  184

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H+SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFGVI++
Sbjct  185   HISGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFGVIVS  244

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             F IKL+ VP+TVT+FR +K   L +N  D+V Q+   A   DD LF+RLLL         
Sbjct  245   FTIKLVPVPETVTFFRIDK--TLEQNATDLVLQWQQVAPTTDDRLFMRLLLA--------  294

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFG  772
                + KT R+S V LFLG + +++SIL  +FP LGLKK +C+E+SWI+S++ W    +F 
Sbjct  295   --PSGKTARASVVALFLGGANEVVSILEKEFPLLGLKKDNCTEVSWIDSVIWWNDDEAFK  352

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
             NG KPE LL+R     A FLKRKSDY+QN IP+  L+ +WKKM+ELG TGL  NPYGG+M
Sbjct  353   NGAKPETLLDRH-LNSAPFLKRKSDYVQNAIPREGLELIWKKMIELGKTGLVFNPYGGKM  411

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
             A+IPS  TPFPHR G LFK+QY+V+W +   AA +  ++Q R L+S + P+VS++PR A+
Sbjct  412   AQIPSDATPFPHRKGNLFKVQYSVTWSDSSPAAAQNFLNQTRILYSEMTPYVSKSPRSAF  471

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             LNYRD+DIGT   G +S++EGKVYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP
Sbjct  472   LNYRDIDIGTNSFGKNSFQEGKVYGAKYFNDNFQRLVKVKTAVDPENFFRNEQSIP  527



>ref|XP_008225674.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=535

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/516 (59%), Positives = 386/516 (75%), Gaps = 15/516 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             + F+ CL   S    P   +   +Y+P NAS+SSVL++Y RN RFNT S+ KP +IVT L
Sbjct  31    EKFVQCLLNHSQ---PSHPIGPAIYTPNNASYSSVLESYIRNLRFNTSSTRKPFLIVTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV++  F ILDMFNLRSI+VDI      
Sbjct  88    HESHVQLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSINVDIKS----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YYRI EKS +HGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD+V
Sbjct  144   ETAWVQAGATLGEVYYRIAEKSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNV  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV GR+LDR AMGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT FR  +  
Sbjct  204   VDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVPR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +N  ++V ++   A K+DD LFIRL + IV     +   N+KT+R+S++G+FLGDSE
Sbjct  262   TLEQNATEIVYRWQYVADKLDDDLFIRLTMDIV---NGSGGENNKTLRASFIGMFLGDSE  318

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LLS++N  FP LGLK+ DC EMSW+ES L W SF NGT PEALL+R P    + LKRKS
Sbjct  319   RLLSVMNKSFPELGLKQSDCMEMSWVESTLFWTSFPNGTAPEALLSRIPQV-LTHLKRKS  377

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIPK  L  +++KM+EL    L  NPYGGRM EI ++ TPFPHRAG L+K+QYA 
Sbjct  378   DYVKKPIPKAGLKWIFQKMIELEAPMLTFNPYGGRMGEISASATPFPHRAGNLWKVQYAT  437

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEEGK  346
             +W  EG  A   +I   R+LH ++ PFVS+NPR+A+ NY+DLDIG     +G  SY EG+
Sbjct  438   NWDTEGSEASEYYIDLTRKLHMYMTPFVSKNPREAFFNYKDLDIGINHDANGKASYLEGR  497

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  498   VYGIKYFKDNFDRLVHVKTKVDPKNFFRNEQSIPTL  533



>ref|XP_006468466.1| PREDICTED: reticuline oxidase-like protein-like [Citrus sinensis]
Length=538

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/520 (57%), Positives = 389/520 (75%), Gaps = 15/520 (3%)
 Frame = -3

Query  1794  TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVI  1615
             ++ ++++F+ CL + S    P   +S  +++P N+SFSSVLQA  RN RFN+ S+PKP +
Sbjct  31    SVSVHENFIQCLLSHSQ---PSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFL  87

Query  1614  IVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIA  1435
             I+T LHESH+   ++CA+K G+++++RSGGHDYEG+SYVS   F +LDMFNL S+DVDI 
Sbjct  88    IITALHESHIQAAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDIE  147

Query  1434  GGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGL  1255
                  ETAWVQ GATLGE+YYRI EKS  HGFP GVCPTVGVGGH+ GGGYGNM+R++GL
Sbjct  148   T----ETAWVQTGATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGL  203

Query  1254  TVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFR  1075
             TVD++VDA++VDV GR+LDR +MGEDLFWAI GGGG SFGV+LA++IKL+RVP+TVT F+
Sbjct  204   TVDNIVDAKLVDVSGRLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQ  263

Query  1074  AEKYLGLTRNFNDVVSQYFNTASK-IDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGL  898
               K   L +N  ++V ++   ASK + D LF+RL+L +V        S +KTVR+S++ L
Sbjct  264   VRK--TLEQNATEIVYRWQQVASKQLPDDLFVRLILDVV----NGTKSGTKTVRASFLSL  317

Query  897   FLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDAS  718
             FLGDS +LLSI+N  FP LGL + DC E SWI S+L W +F        LLNRTP    +
Sbjct  318   FLGDSNRLLSIMNESFPELGLAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPP-TLT  376

Query  717   FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLF  538
             FLKRKSDY++ PIPK+ L+ +WK+M+EL    +  NPYGG+MAEIPST TPFPHRAG L+
Sbjct  377   FLKRKSDYVKQPIPKNGLEFIWKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLW  436

Query  537   KIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSY  358
             KIQY  +W E G  A   +++  R+L+ ++ PFVS+NPRQA+ NYRD+D+G   +G  S+
Sbjct  437   KIQYVTNWNEPGTDAANRYLNLTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNGKASF  496

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EE K YG KYF+GN+ RLVK+K++VDP NFFRNEQSIP L
Sbjct  497   EEAKAYGIKYFLGNFNRLVKIKTKVDPGNFFRNEQSIPVL  536



>ref|XP_006370773.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP67342.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=535

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/541 (56%), Positives = 397/541 (73%), Gaps = 18/541 (3%)
 Frame = -3

Query  1845  FLVFLALCN----LLTSCFSGTIPM-YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             F  F+++      LL+  +  T  + +++FLHCL   S    P   +S+ +Y+P N S+S
Sbjct  3     FFCFISIAACALFLLSISWEATSDLDHENFLHCLLNHSQPSYP---ISTAIYTPNNESYS  59

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
             SVLQ+Y RN RFN  ++PKP++I+T LHESHV   + CA++  +++++RSGGHDYEG+SY
Sbjct  60    SVLQSYIRNLRFNMSTTPKPLLILTALHESHVQAAISCAREHNLQMKIRSGGHDYEGVSY  119

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VSD  F +LDMFNLRSIDVD+A     ETAW+Q GATLGE+YYR+ EKS  HGFP GVCP
Sbjct  120   VSDVPFFVLDMFNLRSIDVDVAS----ETAWIQVGATLGEVYYRVSEKSKAHGFPAGVCP  175

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVGVGGH  GGGYGNM+R++GL+VD+++DA++VDV GR+LDR +MGEDLFWAI GGGG S
Sbjct  176   TVGVGGHFGGGGYGNMMRKYGLSVDNIIDAKMVDVNGRLLDRKSMGEDLFWAITGGGGSS  235

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGV+LA+KI ++RVP+ VT FR  +   + +N  D+V Q+   A  IDD LFIRL + +V
Sbjct  236   FGVVLAYKINIVRVPEVVTVFRVRR--TVDQNATDIVEQWQQVAYNIDDDLFIRLTMDVV  293

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
                T+  +   KTVR+++  LFLGDSE+LLSI N+ FP LGL + DC EMSW+ES+L W 
Sbjct  294   NSTTRIGE---KTVRTTFRALFLGDSERLLSITNASFPKLGLLRSDCIEMSWLESVLFWT  350

Query  780   SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYG  601
              F  GT  +ALL+RTP      LKRKSDY+Q PIP+  L+ +WKKM+EL    L  NPYG
Sbjct  351   DFPLGTPTDALLSRTPQS-LVHLKRKSDYVQKPIPRDGLEGIWKKMIELQVPQLTFNPYG  409

Query  600   GRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPR  421
             G+M EIP+T+ PFPHRAG L+KIQYA +W E G+     +I   R+L+S++ PFVS+NPR
Sbjct  410   GKMWEIPATERPFPHRAGNLWKIQYATNWNEGGQEEANYYIDLTRQLYSYMTPFVSKNPR  469

Query  420   QAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             QA+LNYRDLD+G   +G  SY EG+VYG KYF  N+ RLVK+K++VDP NFFRNEQSIP+
Sbjct  470   QAFLNYRDLDLGINHNGKESYLEGRVYGIKYFQVNFNRLVKIKTKVDPGNFFRNEQSIPT  529

Query  240   L  238
              
Sbjct  530   F  530



>ref|XP_006448838.1| hypothetical protein CICLE_v10014838mg [Citrus clementina]
 gb|ESR62078.1| hypothetical protein CICLE_v10014838mg [Citrus clementina]
Length=538

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/520 (57%), Positives = 388/520 (75%), Gaps = 15/520 (3%)
 Frame = -3

Query  1794  TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVI  1615
             ++ ++++F+ CL + S    P   +S  +++P N+SFSSVLQA  RN RFN+ S+PKP +
Sbjct  31    SVSVHENFIQCLLSHSQ---PSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFL  87

Query  1614  IVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIA  1435
             I+T LHESH+   ++CA+K G+++++RSGGHDYEG+SYVS   F +LDMFNL S+DVD+ 
Sbjct  88    IITALHESHIQAAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDVE  147

Query  1434  GGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGL  1255
                  ETAWVQ GATLGE+YYRI EKS  HGFP GVCPTVGVGGH+ GGGYGNM+R++GL
Sbjct  148   T----ETAWVQTGATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGL  203

Query  1254  TVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFR  1075
             TVD++VDA++VDV GR+LDR +MGEDLFWAI GGGG SFGV+LA++IKL+RVP+TVT F+
Sbjct  204   TVDNIVDAKLVDVSGRLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQ  263

Query  1074  AEKYLGLTRNFNDVVSQYFNTASK-IDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGL  898
               K   L +N  ++V ++   ASK + D LF+RL+L +V        S +KTVR+S++ L
Sbjct  264   VRK--TLEQNATEIVYRWQQVASKQLPDDLFVRLILDVV----NGTKSGTKTVRASFLSL  317

Query  897   FLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDAS  718
             FLGDS +LLSI+N  FP LGL + DC E SWI S+L W +F        LLNRTP    +
Sbjct  318   FLGDSNRLLSIMNESFPELGLAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPP-TLT  376

Query  717   FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLF  538
             FLKRKSDY++ PIPK  L+ +WK+M+EL    +  NPYGG+MAEIPST TPFPHRAG L+
Sbjct  377   FLKRKSDYVKQPIPKKGLEFIWKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLW  436

Query  537   KIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSY  358
             KIQY  +W E G  A   +++  R+L+ ++ PFVS+NPRQA+ NYRD+D+G   +G  S+
Sbjct  437   KIQYVTNWNEPGTDAANRYLNLTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNGKASF  496

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EE K YG KYF+GN+ RLVK+K++VDP NFFRNEQSIP L
Sbjct  497   EEAKAYGIKYFLGNFNRLVKIKTKVDPGNFFRNEQSIPVL  536



>ref|XP_007158993.1| hypothetical protein PHAVU_002G199100g [Phaseolus vulgaris]
 gb|ESW30987.1| hypothetical protein PHAVU_002G199100g [Phaseolus vulgaris]
Length=543

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/542 (55%), Positives = 399/542 (74%), Gaps = 19/542 (4%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             +P+ L FL++  LL    S ++P   +YD+FLHCL + +  P   D VS+IVY+  NAS+
Sbjct  3     NPISLPFLSVIVLLLH-LSNSLPTTSIYDTFLHCLQSHTNQP---DHVSNIVYAQTNASY  58

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
             +SVL+A+ARN RF + S  KP ++VTP  E+HV   V+CAK + V++++RSGGHD+EG+S
Sbjct  59    TSVLRAFARNARFTSPSIQKPSLVVTPQSENHVQASVVCAKSIDVQLKIRSGGHDFEGVS  118

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YVS   F+ILDMFN +++ VD+      E A +QAGA+LG++YYRIWEKS VHGFP G C
Sbjct  119   YVSQGPFVILDMFNFQNVTVDVQN----EIAVIQAGASLGQVYYRIWEKSKVHGFPAGAC  174

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH+SGGGYGNMIR++GL+VDHVVDA+IVDVKGRVLD+  MGEDLFWAI GGGG 
Sbjct  175   PTVGVGGHLSGGGYGNMIRKYGLSVDHVVDAKIVDVKGRVLDKATMGEDLFWAIRGGGGA  234

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL++ +KL+ VP  VT F+ +K   L +N  D+V Q+   A   DD LF+RL+LQ 
Sbjct  235   SFGVILSYTVKLVAVPDRVTVFQVDK--TLEQNATDLVVQWQQVAPHTDDRLFLRLVLQ-  291

Query  963   VPPPTKTND-SNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
                P ++N     KT+R+S   LFLG++ +L+++L  +FP LGLKK+ C EM WI+S++ 
Sbjct  292   ---PVRSNVVKGQKTIRASVEALFLGEANELVTLLGKEFPLLGLKKELCHEMRWIDSVVW  348

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W ++ +G+   ALL+RT     S  KRKSDY+Q PI +  L  +WKKM+ELG   L  NP
Sbjct  349   WANYNDGSSVNALLDRTHYSVHSN-KRKSDYVQTPISRKELTWIWKKMIELGKVELVFNP  407

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M E+PS  TPFPHRAG L+KIQY VSW+E G AA+   +S+I+ LH+++ PFVS+N
Sbjct  408   YGGKMNEVPSDSTPFPHRAGNLYKIQYTVSWQELGAAAEERFLSEIKVLHNYMTPFVSKN  467

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR AY NYRDLDIG  +HG ++Y++GKVY  KYF  N+ERLVK K+ +DP+NFF NEQSI
Sbjct  468   PRGAYFNYRDLDIGINNHGKNNYQDGKVYSMKYFKNNFERLVKAKTEIDPENFFWNEQSI  527

Query  246   PS  241
             PS
Sbjct  528   PS  529



>ref|XP_002267904.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=537

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/518 (58%), Positives = 388/518 (75%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CLS+ S    P   +S+++Y+P N+S+SSVL++Y RN RFNT ++PKP +I+T
Sbjct  28    VHGAFLQCLSSHSQ---PSHPISAVIYTPDNSSYSSVLESYIRNLRFNTPATPKPCLIIT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
               HESH+   V+C+KK G+EI++RSGGHDYEG+SYVSDA F ILDMFNLRSI VDI    
Sbjct  85    ATHESHIQAAVICSKKHGLEIKIRSGGHDYEGMSYVSDAPFFILDMFNLRSISVDIED--  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E++WV AGAT+GE+YYRI EKS   GFP G+CPTVG GGH SGGGYGNM+R++GL+VD
Sbjct  143   --ESSWVHAGATIGEIYYRIAEKSKTRGFPSGLCPTVGAGGHFSGGGYGNMMRKYGLSVD  200

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA +VDV GR+L+R +MGEDLFWAI GGGG S+GVI+++KIKL++VP TVT FR  +
Sbjct  201   NIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVAR  260

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNS--KTVRSSYVGLFL  892
                L +N  ++V ++   A K+D+ LFIRL+L +V      NDS S  KTVR++++ LFL
Sbjct  261   --TLEQNATNIVYKWQQIADKVDEDLFIRLILDVV------NDSRSGEKTVRATFLSLFL  312

Query  891   GDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFL  712
             G SE+LLSI+N+ FP LGL+  DC+EMSW ES+L    F  GT  EALLNRT      F 
Sbjct  313   GSSERLLSIMNTSFPELGLQSSDCTEMSWAESVLFSADFAIGTPVEALLNRTRRVQYHF-  371

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDYL+ PIPK  L+ LWKKM+EL    L  NPYGG+MAEI    TPFPHRAG + KI
Sbjct  372   KRKSDYLKEPIPKAGLEGLWKKMIELETPFLKFNPYGGKMAEISPAATPFPHRAGNICKI  431

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
              YA +W EEG  A   +++  R+LHS++ PFVS++PR+A+LNYRD D+G   +G +SY E
Sbjct  432   MYATNWHEEGSEAAERYLNLTRQLHSYMTPFVSKSPREAFLNYRDRDLGINHNGKNSYLE  491

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N+ RLV +K++VDP NFFRNEQSIP+L
Sbjct  492   GRVYGIKYFKKNFNRLVHIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_006448845.1| hypothetical protein CICLE_v10018073mg [Citrus clementina]
 gb|ESR62085.1| hypothetical protein CICLE_v10018073mg [Citrus clementina]
Length=535

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/520 (56%), Positives = 388/520 (75%), Gaps = 15/520 (3%)
 Frame = -3

Query  1794  TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVI  1615
             ++ ++++ + CL + S    P   +S  +++P N+SFSSVLQA  RN RFN+ S+PKP +
Sbjct  28    SVSVHENLIQCLLSHSQ---PSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFL  84

Query  1614  IVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIA  1435
             I+T LHESH+   ++CA+K G+++++RSGGHDYEG+SYVS   F +LDMFNL S+DVD+ 
Sbjct  85    IITALHESHIQAAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDVE  144

Query  1434  GGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGL  1255
                  ETAWVQ GATLGE+YYRI EKS  HGFP GVCPTVGVGGH+ GGGYGNM+R++GL
Sbjct  145   T----ETAWVQTGATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGL  200

Query  1254  TVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFR  1075
             TVD++VDA++VDV GR+LDR +MGEDLFWAI GGGG SFGV+LA++IKL+RVP+TVT F+
Sbjct  201   TVDNIVDAKLVDVNGRLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQ  260

Query  1074  AEKYLGLTRNFNDVVSQYFNTASK-IDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGL  898
               K   L +N  ++V ++   ASK + D LF+RL+L +V        S +KTVR+S++ L
Sbjct  261   VRK--TLEQNATEIVCRWQQVASKQLPDDLFVRLILDVV----NGTKSGTKTVRASFLSL  314

Query  897   FLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDAS  718
             FLGDS +LLSI+N  FP LGL + DC E SWI S+L W +F        LLNRTP    +
Sbjct  315   FLGDSNRLLSIMNESFPELGLAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPP-TLT  373

Query  717   FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLF  538
             FLKRKSDY++ PIPK+ L+ +WK+M+EL    +  NPYGG+MAEIPST TPFPHRAG L+
Sbjct  374   FLKRKSDYVKQPIPKNGLEFIWKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLW  433

Query  537   KIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSY  358
             KIQY  +W E G  A   +++  R+L+ ++ PFVS+NPRQA+ NYRD+D+G   +G  S+
Sbjct  434   KIQYVTNWNEPGTDAANRYLNLTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNGKASF  493

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EE K YG KYF+GN+ RLVK+K++VDP NFFRNEQSIP L
Sbjct  494   EEAKAYGIKYFLGNFNRLVKIKTKVDPGNFFRNEQSIPVL  533



>gb|KHN44646.1| Reticuline oxidase-like protein [Glycine soja]
Length=548

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/542 (56%), Positives = 391/542 (72%), Gaps = 15/542 (3%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG--TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSV  1675
             +F++ L +   +T+   G  +  ++D+FL CL+  + N   +  +S+IV++  N  F +V
Sbjct  13    IFVLLLVVFTSVTAQSPGPESSSLHDTFLQCLTKYTKNSSSQ--LSNIVFANTNPKFPTV  70

Query  1674  LQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS  1495
             LQ Y RN RFNT S+PKP +IVTP  ESHV   V+CAK + +++++RSGGHDYEGISY+S
Sbjct  71    LQNYIRNARFNTSSTPKPSLIVTPQKESHVQATVICAKSVNIQLKIRSGGHDYEGISYIS  130

Query  1494  DATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptv  1315
             D  FIILDMFN R I VDI      E A VQAGATLGE+YYRIW+KS VHGFP GVCPTV
Sbjct  131   DEPFIILDMFNFRRITVDIKN----EVAVVQAGATLGEVYYRIWKKSKVHGFPAGVCPTV  186

Query  1314  gvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFG  1135
             GVGGH SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFG
Sbjct  187   GVGGHFSGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFG  246

Query  1134  VILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPP  955
             VIL++ IKL+ VP+TVT FR EK L       D+V Q+   A   DD LF+RLLLQ   P
Sbjct  247   VILSYTIKLVPVPETVTVFRVEKTLETNVTATDLVVQWQKVAPNTDDRLFMRLLLQ---P  303

Query  954   PTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG--  781
              +      + TVR+S V LFLG + +++SIL   FP LGLKK++C+E+SWI S+L W   
Sbjct  304   VSSKVVKGTITVRASVVALFLGGANEVVSILAKQFPLLGLKKENCTEVSWINSVLWWNDN  363

Query  780   -SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              S  NG KPEALL+R     A FLKRKSDY+QN I +  L+ L+K+M+ELG TGL  NPY
Sbjct  364   NSLKNGVKPEALLDRN-LNSAGFLKRKSDYVQNAISRDGLEWLFKRMIELGKTGLVFNPY  422

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+M+EIPS  TPFPHR G L+KIQY+V+W +    A     +Q + L S++ PFVS+NP
Sbjct  423   GGKMSEIPSDATPFPHRKGNLYKIQYSVNWDDRSPGAALNFTNQAKRLFSYMTPFVSKNP  482

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R A+LNYRDLDIG    G +S++EG VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  483   RSAFLNYRDLDIGVNSFGENSFQEGVVYGTKYFNDNFQRLVKIKTIVDPENFFRNEQSIP  542

Query  243   SL  238
              L
Sbjct  543   VL  544



>gb|KHN44648.1| Reticuline oxidase-like protein [Glycine soja]
Length=533

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/536 (56%), Positives = 395/536 (74%), Gaps = 24/536 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
              VFL++ + L S  S    +YD+FLHCL+  +    P   +S+IV++  ++ F +VL+ Y
Sbjct  13    FVFLSVFSSL-SARSPNPSLYDTFLHCLTQHTN---PSTQLSNIVFANTDSKFPTVLENY  68

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RN RFNT S+PKP++IVTPL ESHV   V+CAK + +++++RSGGHDYEGISY+S   F
Sbjct  69    IRNARFNTSSTPKPLLIVTPLVESHVKAAVICAKSVNIQLKIRSGGHDYEGISYISQKPF  128

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
             I+LDM NLR I VD+      E A VQAGA LGELY+RIWEKS +HGFP  VCPTVGVGG
Sbjct  129   ILLDMSNLRKITVDVKN----ELAVVQAGAILGELYFRIWEKSKLHGFPAAVCPTVGVGG  184

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H+SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFGVI++
Sbjct  185   HISGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFGVIVS  244

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             F IKL+ VP+TVT+FR +K   L +N  D+V Q+   A   DD LF+RL+L         
Sbjct  245   FTIKLVPVPETVTFFRIDK--TLEQNATDLVLQWQQVAPTTDDRLFMRLILA--------  294

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFG  772
                + KT R+S V LFLG + +++SIL  +FP LGLKK +C+E+SWI+S++ W    +F 
Sbjct  295   --PSGKTARASVVALFLGGANEVVSILEKEFPLLGLKKDNCTEVSWIDSVIWWNDDEAFK  352

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
              G KPE LL+R     A FLKRKSDY+QN IP+  L+ +WKKM+ELG TGL  NPYGG+M
Sbjct  353   KGAKPETLLDRH-LNSAPFLKRKSDYVQNAIPREGLELIWKKMIELGKTGLVFNPYGGKM  411

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
             A+IPS  TPFPHR G LFK+QY+V+W +   AA +  ++Q R L+S + P+VS++PR A+
Sbjct  412   AQIPSDATPFPHRKGNLFKVQYSVTWSDSSPAAAQNFLNQTRILYSEMTPYVSKSPRSAF  471

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             LNYRD+DIGT   G +S++EGKVYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP
Sbjct  472   LNYRDIDIGTNSFGKNSFQEGKVYGAKYFNDNFQRLVKVKTAVDPENFFRNEQSIP  527



>ref|XP_010316563.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=529

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/523 (59%), Positives = 381/523 (73%), Gaps = 15/523 (3%)
 Frame = -3

Query  1803  FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPK  1624
              S +   Y SFL CLS  S    P D + S VY+P N+S+ SVLQ Y RN+RFN  ++PK
Sbjct  21    LSASTLSYLSFLQCLSEHSR---PSDHILSRVYTPNNSSYKSVLQHYIRNQRFNRSTTPK  77

Query  1623  PVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDV  1444
             P II TPL ESHV   V C +K    +++RSGGHDYEGISYVS+ +F++LDM NL SIDV
Sbjct  78    PDIIFTPLQESHVQVAVTCCRKTDKYLKIRSGGHDYEGISYVSNISFVLLDMSNLHSIDV  137

Query  1443  DIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRR  1264
             DI      ETAWVQAGA LGELYYRIWEKS VH FP GVCPTVGVGGH++GGGYGN++R+
Sbjct  138   DIQN----ETAWVQAGALLGELYYRIWEKSKVHAFPAGVCPTVGVGGHITGGGYGNLLRK  193

Query  1263  FGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVT  1084
             +GL+VD++VDARIVDV GR+L+R +MGEDLFWAI GGGG SFGVI A+K++L++VP  VT
Sbjct  194   YGLSVDNLVDARIVDVHGRILNRESMGEDLFWAIRGGGGASFGVISAYKLRLVKVPDVVT  253

Query  1083  YFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYV  904
                      L  N  D+V  +   A KID +LFIRL L+    P       +KT+ +++V
Sbjct  254   --VFRVVRTLEENAIDIVYWWQFIAEKIDSNLFIRLALK----PIDEKQKGTKTITATFV  307

Query  903   GLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGD  724
              LFLGDS++LLSI+N DFP LGL  +DC EMSWIES L W SF NGT P+ LLNR P   
Sbjct  308   SLFLGDSKELLSIMNRDFPQLGLHIEDCKEMSWIESALFWASFPNGTLPDVLLNRKPG--  365

Query  723   ASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGV  544
             A FLKRKSDYLQ PIPK  L SL  KM+ELG+T L  N YGGRM+EIP   TPFPHRAG 
Sbjct  366   AKFLKRKSDYLQKPIPKDELKSLLDKMIELGDTELVFNQYGGRMSEIPEWGTPFPHRAGN  425

Query  543   LFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLH  364
             +FKIQYA +W +EG  A+  +++Q R L++++ PFVS++PR AYLNYRDLDIG   +G +
Sbjct  426   IFKIQYAANWGKEGNEAENFYLNQTRVLYNYMTPFVSKSPRCAYLNYRDLDIGVNHNGNN  485

Query  363   SYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
              Y EG+VYG KYF  N+ +LV+VK+ VDPDNFF NEQSIP L+
Sbjct  486   RYIEGRVYGLKYFKDNFNKLVQVKTFVDPDNFFWNEQSIPPLA  528



>ref|XP_007211543.1| hypothetical protein PRUPE_ppa004021mg [Prunus persica]
 gb|EMJ12742.1| hypothetical protein PRUPE_ppa004021mg [Prunus persica]
Length=535

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 384/516 (74%), Gaps = 15/516 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             + F+ CL   S    P   +   +Y+P NAS+SSVL++Y RN RFNT S+ KP +IVT L
Sbjct  31    EKFVQCLLNHSQ---PSHPIGPAIYTPNNASYSSVLESYIRNLRFNTSSTRKPFLIVTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV++  F ILDMFNLRSI VDI      
Sbjct  88    HESHVQLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIKVDIKS----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YYRI E+S +HGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD+V
Sbjct  144   ETAWVQAGATLGEVYYRIAERSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNV  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV GR+LDR AMGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT FR  +  
Sbjct  204   VDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVPR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +N  ++V ++   A K+DD LFIRL + IV     +   N+KT+R+S++G+FLGDSE
Sbjct  262   TLEQNATEIVYRWQYVADKLDDDLFIRLTMDIV---NGSGGENNKTLRASFIGMFLGDSE  318

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LLS++N  FP LGLK+ DC EMSW+ES L W SF NGT PEALL+R P    + LKRKS
Sbjct  319   RLLSVMNKSFPELGLKQSDCMEMSWVESTLFWTSFPNGTAPEALLSRIPQV-LTHLKRKS  377

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIPK  L  +++KM+EL    L  NPYGGRM EI ++ TPFPHRAG L+K+QYA 
Sbjct  378   DYVKKPIPKAGLKWIFQKMIELEAPMLTFNPYGGRMGEISASATPFPHRAGNLWKVQYAT  437

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG--LHSYEEGK  346
             +W  EG  A   +I   R+LH ++ PFVS+NPR+A+ NY+DLDIG   +     SY EG+
Sbjct  438   NWDTEGSEASEYYIDLTRKLHMYMTPFVSKNPREAFFNYKDLDIGINHNANSKASYLEGR  497

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  498   VYGIKYFKDNFDRLVHVKTKVDPKNFFRNEQSIPTL  533



>ref|XP_007226571.1| hypothetical protein PRUPE_ppa024148mg [Prunus persica]
 gb|EMJ27770.1| hypothetical protein PRUPE_ppa024148mg [Prunus persica]
Length=542

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/515 (57%), Positives = 388/515 (75%), Gaps = 13/515 (3%)
 Frame = -3

Query  1773  FLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHE  1594
             F+ CL + S    P   +S  +Y P NAS+SSVL++Y RN RFNT S+PKP +I+TPLHE
Sbjct  37    FVQCLLSHSQ---PSHPISEAIYIPNNASYSSVLRSYIRNLRFNTSSTPKPFLIITPLHE  93

Query  1593  SHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGET  1414
             SHV   ++CA+K  + +++RSGGHDYEG+SYVSD  F +LDMFNLRSID+DI      ET
Sbjct  94    SHVQQAIVCAQKQNLLMKIRSGGHDYEGVSYVSDVPFFLLDMFNLRSIDIDI----NSET  149

Query  1413  AWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVD  1234
             AWVQAGATLGEL+YRI+EKS +HGFP GVCPTVGVGGH SG GYGN++R++GL+VD+++D
Sbjct  150   AWVQAGATLGELFYRIYEKSKIHGFPAGVCPTVGVGGHFSGAGYGNLMRKYGLSVDNIID  209

Query  1233  ARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGL  1054
             A+++DV GR+LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+TVT FR E+   L
Sbjct  210   AQLMDVHGRLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPQTVTVFRVER--TL  267

Query  1053  TRNFNDVVSQYFNTASKIDDHLFIRLLLQIV---PPPTKTNDSNSKTVRSSYVGLFLGDS  883
              +N  D+V ++   A K+D  LFIRL +++V     P  T   N KT+R+S++G FLG+S
Sbjct  268   EQNATDIVYRWQYVAPKLDTDLFIRLTMEVVNITGGPLSTGGENYKTIRASFIGFFLGNS  327

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LLS++ + FP L LK+ DC EMSW+ES+L W SF  GT+PEALL+R P      LKRK
Sbjct  328   ERLLSVMETGFPELSLKQSDCIEMSWVESVLFWTSFPIGTEPEALLSRKPQ-VLVHLKRK  386

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PIPK  L  +W+KM+E     ++ NPYGG+M+EIP + TP PHRAG L+KIQYA
Sbjct  387   SDYVKTPIPKIGLMWIWQKMIEFEVPIMSFNPYGGKMSEIPESATPCPHRAGNLWKIQYA  446

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W+  G  A   H++  ++L+ ++ PFVS NPR+AY NY+DLD+G  ++G  SY EGK 
Sbjct  447   TNWEVSGAEASDYHLNLTKKLYFYMTPFVSMNPREAYFNYKDLDLGINNNGKASYFEGKA  506

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YG +YF  N++RLV++K+ VDP NFFRNEQSIP+L
Sbjct  507   YGIRYFKDNFDRLVRIKTEVDPGNFFRNEQSIPTL  541



>ref|XP_007203267.1| hypothetical protein PRUPE_ppa019803mg [Prunus persica]
 gb|EMJ04466.1| hypothetical protein PRUPE_ppa019803mg [Prunus persica]
Length=535

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/516 (58%), Positives = 378/516 (73%), Gaps = 15/516 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             + F+ CL   S    P   +   +Y+P NAS+SSVL++Y RN RFNT S+ KP +IVT L
Sbjct  31    EKFVQCLLNHSQPSYP---IGPAIYTPNNASYSSVLKSYLRNLRFNTSSTRKPFLIVTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV++  F ILDMFNLRSI+VDI      
Sbjct  88    HESHVKLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSINVDIKS----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YYRI EKS +HGF   V PTVGVGGH SGGGYGNM+R++GLTVD+V
Sbjct  144   ETAWVQAGATLGEVYYRISEKSKIHGFSASVEPTVGVGGHFSGGGYGNMMRKYGLTVDNV  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV GR+LDR AMGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT F   +  
Sbjct  204   VDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFNVTR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +N  ++V ++   A K+DD LFIRL + IV     +   N+KT+ +S++ +FLGDSE
Sbjct  262   TLEQNATEIVYRWQYVADKLDDDLFIRLTMVIV---NGSGGDNNKTLSASFMSMFLGDSE  318

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LLS++N  FP LGLK+ DC EMSW+ES + W  F  GT PE LL+RTP     F KRKS
Sbjct  319   RLLSVMNKSFPELGLKQSDCREMSWVESTVFWAPFPYGTSPERLLSRTPQFHKHF-KRKS  377

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIPK  L  +++KM+EL +  LA NPYGGRM EI ++ TPFPHRAG L+ +QYA 
Sbjct  378   DYVKKPIPKAGLKWIFQKMIELVSPALAFNPYGGRMGEISASATPFPHRAGNLWMVQYAT  437

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEEGK  346
              W EEG  A   HI   R+LH F+ PFVS+NPR+AY NY+DLDIG     +G  SY EG+
Sbjct  438   DWDEEGSEASEHHIDLTRKLHMFMTPFVSKNPREAYFNYKDLDIGINHNANGKASYLEGR  497

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  498   VYGIKYFKDNFDRLVHVKTKVDPSNFFRNEQSIPTL  533



>ref|XP_007147447.1| hypothetical protein PHAVU_006G125400g [Phaseolus vulgaris]
 gb|ESW19441.1| hypothetical protein PHAVU_006G125400g [Phaseolus vulgaris]
Length=542

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 381/516 (74%), Gaps = 14/516 (3%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             YDSFL CL+  + +  P   +S+IV++  N SF +VLQ Y RN R+NT  + KP++IVTP
Sbjct  32    YDSFLRCLTQQTKSSTP---LSNIVFAQINPSFPTVLQNYIRNARYNTSQTQKPLLIVTP  88

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
             L E HV   V+CAK   V+I++RSGGHD+EG+SYVS   FI++DMFNLR+I VD      
Sbjct  89    LQEFHVQGAVICAKAANVQIKIRSGGHDFEGLSYVSVEPFIVVDMFNLRAITVDTTN---  145

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              + A VQAGATLGELYYRIWEKS V GFP GVCPTVG+GGH+SGGGYGNM+R++GL+VD+
Sbjct  146   -QVAVVQAGATLGELYYRIWEKSKVLGFPAGVCPTVGIGGHISGGGYGNMLRKYGLSVDN  204

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             V+DA+IVDVKG +L+R +MGEDLFWAI GGGGGSFGVI++F IKL+ VP  VT FR EK 
Sbjct  205   VIDAQIVDVKGNLLNRKSMGEDLFWAIRGGGGGSFGVIVSFTIKLVPVPAAVTIFRVEKT  264

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
             L       D+V Q+   A   D+ LF+RLLLQ   P +       +TVR++ V LFLG +
Sbjct  265   LETNVTATDLVVQWQQVAPTTDERLFMRLLLQ---PVSSDVVKGGRTVRATVVALFLGGA  321

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPAGDASFL  712
             ++++SIL  +FP LGLKK+DCSE+SWI+S+L W    S  NG KPE LLNR     ASFL
Sbjct  322   DEVVSILGKEFPLLGLKKEDCSEVSWIDSVLWWDDDESLKNGGKPETLLNRN-VNSASFL  380

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+QN I K  L  ++KKM+E+G  GL  NPYGG+M EIPS  TPFPHR G LFK+
Sbjct  381   KRKSDYVQNAISKQGLTLIFKKMIEVGKIGLVFNPYGGKMGEIPSDATPFPHRKGNLFKM  440

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WK+    A    +++ + L+S++ PFVS+NPR AYLNYRDLDIG  D G +S+ E
Sbjct  441   QYSVTWKDPSPGATLNFLNEAKMLYSYMTPFVSKNPRSAYLNYRDLDIGVNDFGKNSFAE  500

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G+VYG KYF GN++RLV VK++VDP NFFRNEQSIP
Sbjct  501   GQVYGSKYFNGNFDRLVNVKTKVDPQNFFRNEQSIP  536



>ref|XP_007023039.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25661.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=575

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/514 (57%), Positives = 380/514 (74%), Gaps = 13/514 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++FL CL     N  P   +S  +++P N S+SSVLQ+  RN RFN   +PKP +I+T  
Sbjct  70    ETFLQCLLD---NSHPSYPISEAIFTPQNPSYSSVLQSSIRNLRFNETFTPKPFLILTAK  126

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESH+   ++CA+K  +++++RSGGHDYEG+SYV+   F +LDMFNLRSIDVD+A     
Sbjct  127   HESHIQAAIVCARKDNIQMKIRSGGHDYEGLSYVATVPFFVLDMFNLRSIDVDVAN----  182

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQ GATLGE+YYRI EKS  HGFP GVCPTVGVGGH  GGGYGNM+R++GL+VD++
Sbjct  183   ETAWVQTGATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDNI  242

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA  +DV GR+ DR +MGED+FWAI GGG  SFGV+LA+KIKL+RVP+TVT FR EK  
Sbjct  243   VDAYFIDVNGRLHDRKSMGEDIFWAIRGGGAASFGVVLAYKIKLVRVPETVTVFRVEK--  300

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L  N  D+V Q+ + A K+ + LF+RL+L +V     + ++  KTVR++++ LFLGDSE
Sbjct  301   TLEENATDIVDQWQHVADKLPEDLFVRLVLDVV---NSSRNTGEKTVRAAFISLFLGDSE  357

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LLSI+N  FPALGL + DC E SW++S+L W +    T+   LL+RTP+    FLKRKS
Sbjct  358   RLLSIMNERFPALGLTQSDCIETSWVQSVLFWTNIPIETETAILLDRTPSS-LVFLKRKS  416

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIPK  L+ LWK+M+EL    L  NPYGGRMAEIPST TPFPHRAG L+KIQY  
Sbjct  417   DYVKKPIPKAGLEWLWKRMIELQVPQLLFNPYGGRMAEIPSTATPFPHRAGNLWKIQYVT  476

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W E G  A   +I   R+LH ++  FVS+NPR+A+LNYRD+D+G   +G  SY EG+VY
Sbjct  477   NWNEAGTEAADHYIGLTRKLHGYMTRFVSKNPREAFLNYRDIDLGVNHNGRQSYMEGRVY  536

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G KYF GN+ RLV++K+RVDP NFFRNEQSIP+L
Sbjct  537   GIKYFKGNFNRLVQIKTRVDPGNFFRNEQSIPTL  570



>ref|XP_002317086.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE97698.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=534

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/545 (54%), Positives = 399/545 (73%), Gaps = 20/545 (4%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             M S  VF   L    L++     +I + D+FL CL+    N  P + +S  +++P N SF
Sbjct  1     MKSPFVFFSVL----LISVSLPNSIALPDNFLQCLT---ENSQPTNPISDAIHTPDNPSF  53

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
             ++VLQ+YARN RF T S+PKP+ I+   HESHV   ++C+KKLG++IR+RSGGHDY+G+S
Sbjct  54    TTVLQSYARNLRFLTLSTPKPLAIIAAKHESHVQATIICSKKLGLQIRIRSGGHDYDGLS  113

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YVSD  FIILDMFNLRSI++DI      E+AWVQAGATLGE+YYRI EKS+VHGFP GVC
Sbjct  114   YVSDVAFIILDMFNLRSINIDIED----ESAWVQAGATLGEVYYRIAEKSNVHGFPAGVC  169

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PT+GVGGH SGGGYGNM+R++GL+VD++VDA+I+DV+GR+LDR +MGEDLFWAI GGG  
Sbjct  170   PTLGVGGHFSGGGYGNMMRKYGLSVDNIVDAQIIDVRGRILDRKSMGEDLFWAIRGGGAA  229

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTAS-KIDDHLFIRLLLQ  967
             SFGVIL++KIKL+ VP+ VT F  ++   L    +D+  ++   A+ K+D+ LFIRL+LQ
Sbjct  230   SFGVILSWKIKLVPVPEIVTVFSVDR--TLEEGVSDLAWKWQQIAADKLDNDLFIRLMLQ  287

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
                 P        KT+++S+V +FLG +E+LLS++N  FP LGL+ +DC+EM WIES+L 
Sbjct  288   ----PVNGTQEGKKTIQASFVAMFLGRAERLLSVMNESFPELGLQAKDCAEMRWIESVLS  343

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W     GT  E LL+R P G  S+LKRKSDY++ PI K  L+S+WK M E+G   +  NP
Sbjct  344   WVGMPKGTPIEVLLDRIPKG-VSYLKRKSDYVKEPISKEGLESIWKVMTEVGEVAMLWNP  402

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M+EI  T+T FPHRAG +FKIQY+V+WK+EG      +++  R L   + P+VS+N
Sbjct  403   YGGKMSEISETETAFPHRAGNIFKIQYSVNWKQEGIDTTNHYVNLTRTLFEAMTPYVSKN  462

Query  426   PRQAYLNYRDLDIGTT-DHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             PR+A+LNYRD+DIG+   HG  +++E  VYGHKYF  N++RLV++K+RVDPDNFF  EQS
Sbjct  463   PREAFLNYRDIDIGSIGSHGNGTFQEASVYGHKYFKDNFDRLVQIKTRVDPDNFFGYEQS  522

Query  249   IPSLS  235
             IP+ S
Sbjct  523   IPTQS  527



>ref|XP_003594612.1| Reticuline oxidase-like protein [Medicago truncatula]
 gb|AES64863.1| FAD-binding berberine family protein [Medicago truncatula]
Length=544

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/526 (58%), Positives = 387/526 (74%), Gaps = 17/526 (3%)
 Frame = -3

Query  1800  SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             + T  +Y +FLHCL+  + +P     +S+IV+S  N SFS+VLQ Y RN RFNT S  KP
Sbjct  31    TKTDSLYTTFLHCLTQNTKDP----SISNIVFSQTNLSFSTVLQNYIRNARFNTTSITKP  86

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVD  1441
             ++IVTP   SHV   V+CAK++ ++I++RSGGHDYEGISY+S+  FIILDMFNLR+I+VD
Sbjct  87    LLIVTPKQPSHVQSTVICAKQVNIQIKIRSGGHDYEGISYISNQPFIILDMFNLRTINVD  146

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             I      E A++QAGATLGE+YYRI EKS VHGFP GVCPTVGVGGHVSGGGYG M+R++
Sbjct  147   IKN----EVAYIQAGATLGEVYYRISEKSKVHGFPAGVCPTVGVGGHVSGGGYGAMLRKY  202

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL+VD+++DA IVDVKGR+L+R +MGEDLFWAI GGGG SFGV+L++ IKL+ VPKTVT 
Sbjct  203   GLSVDNIIDAEIVDVKGRLLNRKSMGEDLFWAIRGGGGASFGVVLSYTIKLVAVPKTVTV  262

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR EK   L +N  D+V Q+   A   D+ +F+RLLLQ   P + T    +KT+R+S V 
Sbjct  263   FRIEK--TLEQNATDLVVQWQQVAPTTDNRIFMRLLLQ---PKSSTVVKGTKTIRASVVA  317

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPA  730
             LFLG +++++ IL  +FP LGLKK+DC E+SWI S+L +    S  NG KP  LL+R   
Sbjct  318   LFLGRADEVVKILGKEFPRLGLKKKDCIELSWINSVLWYNDELSLKNGKKPVNLLDRN-V  376

Query  729   GDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
               A   KRKSDY+Q  I K  L+ +WKKM+ELG  G   NPYGG++AEIP+  TPFPHRA
Sbjct  377   NSAGLGKRKSDYVQKAISKDDLEGIWKKMIELGKIGFVFNPYGGKIAEIPADATPFPHRA  436

Query  549   GVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG  370
             G LFKIQY+V+W +    A    ++Q + LHS++ PFVS+NPR AY+NYRDLDIG    G
Sbjct  437   GNLFKIQYSVNWDDPSPNATVGFLNQAKVLHSYMTPFVSKNPRSAYINYRDLDIGINSFG  496

Query  369   LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
              +SY+EGKVYG  YF  N++RLVK+K+ VDP NFFRNEQSIP L R
Sbjct  497   KNSYQEGKVYGTMYFNNNFDRLVKIKTAVDPGNFFRNEQSIPILPR  542



>ref|XP_006432918.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 ref|XP_006432919.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 ref|XP_006471689.1| PREDICTED: reticuline oxidase-like protein-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471690.1| PREDICTED: reticuline oxidase-like protein-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471691.1| PREDICTED: reticuline oxidase-like protein-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471692.1| PREDICTED: reticuline oxidase-like protein-like isoform X4 [Citrus 
sinensis]
 gb|ESR46158.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 gb|ESR46159.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
Length=538

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/544 (55%), Positives = 400/544 (74%), Gaps = 16/544 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             M+   P  +  L++  L  S +S  +  ++SF  CL     N  P   +   +++P N+S
Sbjct  3     MVILKPAVISLLSVLVLYIS-WSWRVNSHESFNQCLLN---NSPPSHPIFQAIHTPQNSS  58

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             +SSVLQ+Y RN RFNT S+PKPV+IV  +HESHV   ++CAKK  +++++RSGGHDYEG+
Sbjct  59    YSSVLQSYIRNLRFNTSSTPKPVLIVAAMHESHVQAAIICAKKHNLQMKIRSGGHDYEGL  118

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggv  1327
             SYVS+  F ILDMFNLRSIDVDI      ETAWVQAGA LGE++YRI EKS  HGFP GV
Sbjct  119   SYVSNIPFFILDMFNLRSIDVDIES----ETAWVQAGAILGEVFYRIAEKSKTHGFPAGV  174

Query  1326  cptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgggg  1147
             CPTVGVGGH S GGYGNM+R++GL+VD++VDA++VDV GR+LDR +MGEDLFWAI GGG 
Sbjct  175   CPTVGVGGHFSAGGYGNMMRKYGLSVDNIVDAKLVDVNGRILDRNSMGEDLFWAIRGGGA  234

Query  1146  GSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ  967
              SFGV+LA+KI ++ VP+TVT F+ EK   L ++  D V ++ + A K+DD LFIRL+L 
Sbjct  235   -SFGVVLAYKINIVPVPETVTVFKVEK--TLEQDATDAVDKWQHVAHKLDDGLFIRLVLD  291

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
             +V   T+T +   KTVR++++ LFLG SE+LL+I +  FP LGL + DC+E+SWI+S++ 
Sbjct  292   VVNSSTRTGE---KTVRATFIALFLGGSERLLTITDEGFPELGLTRSDCTELSWIDSVVY  348

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             WGSF  GT    LL+RTP   +S LKRKSDY++ PIP+  L+ LWKKM+EL    +  NP
Sbjct  349   WGSFPAGTPASVLLDRTPLTLSS-LKRKSDYVKEPIPREGLEGLWKKMIELERPYMNFNP  407

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M E+ +T++PFPHRAG L+KIQY  +W EEG  A   +I   R+L+ +L PFVS+N
Sbjct  408   YGGKMHEVSATESPFPHRAGNLWKIQYVTNWNEEGVDAANYYIDLTRQLYDYLTPFVSKN  467

Query  426   PRQAYLNYRDLDIGTTDHGLHS-YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             PRQ++L YRDLD+GT +H   + Y EG+ YG  YF+ N++RLV++K++VDPDNFFRNEQS
Sbjct  468   PRQSFLAYRDLDLGTNNHKFETGYSEGRAYGINYFLENFDRLVEIKTKVDPDNFFRNEQS  527

Query  249   IPSL  238
             IP L
Sbjct  528   IPVL  531



>ref|XP_011039280.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=533

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/515 (57%), Positives = 385/515 (75%), Gaps = 13/515 (3%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             +++FL CL   S    P   +S+ +Y+P N S+SSVLQ+Y RN RFN  ++PKP++I+T 
Sbjct  27    HENFLQCLLNHSQPSYP---ISTAIYTPNNDSYSSVLQSYIRNLRFNMSTTPKPLLILTA  83

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
             LH+SHV   ++CA++  +++++RSGGHDYEG+SYVSD  F +LDMFNLRSIDVD+A    
Sbjct  84    LHDSHVQSAIICAREHNLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRSIDVDVAS---  140

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAW+Q GATLGE+YYR+ EKS  HGFP GVCPTVGVGGH  GGGYGNM+R++GL+VD+
Sbjct  141   -ETAWIQVGATLGEVYYRVSEKSKAHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDN  199

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             ++DA +VDV GR+LDR +MGEDLFWAI GGGG SFGV+LA+KIK++RVP+ VT FR  + 
Sbjct  200   IIDATMVDVNGRLLDRKSMGEDLFWAITGGGGSSFGVVLAYKIKIVRVPEVVTVFRVRR-  258

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
               + +N  D+V Q+   A  IDD LFIRL + +V   T+  +   KTVR+++  LFLGDS
Sbjct  259   -TVDQNATDIVEQWQQVAYNIDDDLFIRLSMDVVNSTTRIGE---KTVRTTFRALFLGDS  314

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LLSI N+ FP LGL + DC EMSW+ES+L W  F  GT  +ALL+RTP      LKRK
Sbjct  315   ERLLSITNASFPKLGLLRSDCIEMSWLESVLFWTDFPLGTPTDALLSRTPQS-LVHLKRK  373

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY+Q PIP+  L+ +WK M+EL    L  NPYGG+M EIP+T+ PFPHRAG L+KIQYA
Sbjct  374   SDYVQKPIPRDGLEGIWKIMIELQVPQLTFNPYGGKMWEIPATERPFPHRAGNLWKIQYA  433

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W E G+     +I   R+L+S++ PFVS+NPRQA+LNYRDLD+G   +G  SY EG+V
Sbjct  434   TNWNEGGQEVANYYIDLTRQLYSYMTPFVSKNPRQAFLNYRDLDLGINHNGKESYLEGRV  493

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YG KYF  N+ RLVK+K++VDP NFFRNEQSIP+ 
Sbjct  494   YGIKYFQENFNRLVKIKTKVDPGNFFRNEQSIPTF  528



>ref|XP_003531066.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=539

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/540 (55%), Positives = 395/540 (73%), Gaps = 14/540 (3%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             V ++ L + N LT+    +I  +D+FLHCL + + N    D VS+IVY+  N S++SVL+
Sbjct  12    VIVLLLHVSNSLTTPTRESI--HDTFLHCLQSHTTNQ--PDHVSNIVYAQTNTSYTSVLR  67

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             A+ARN RF+  S+ KP++IVTPL E+ V   V+CAK +G+++++RSGGHD+EG+SY+S  
Sbjct  68    AFARNARFSAPSTQKPLLIVTPLSENQVQATVVCAKSIGLQLKIRSGGHDFEGVSYISQV  127

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              FIILDMFN + + VD+      E A +QAGA+LG++YYRIWEKS VHGFP G CPTVGV
Sbjct  128   PFIILDMFNFQDVTVDVQN----EIAVIQAGASLGQVYYRIWEKSKVHGFPAGACPTVGV  183

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SGGGYGNMIR++GL+VDHVVDA+IVDVKGR+LD+ +MGEDLFWAI GGGG SFGVI
Sbjct  184   GGHLSGGGYGNMIRKYGLSVDHVVDAKIVDVKGRILDKESMGEDLFWAIRGGGGASFGVI  243

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++ +KL+ VP+ VT F+ +K   L  N  D+V Q+   A   DD L++RL+LQ   P +
Sbjct  244   LSYTVKLVPVPENVTVFQIDK--TLEENATDLVVQWQKVAPHTDDRLYLRLVLQ---PVS  298

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
                    KT+R+S   LFLG++++L+ +L  +FP LGLKK+ C EM WI+S++ W ++ +
Sbjct  299   SNFVKGKKTIRASVEALFLGEADELVKLLGQEFPLLGLKKELCHEMRWIDSVVWWANYND  358

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             G+   ALL+R      S  KRKSDY+Q PI K     +WKKM+ELG   +  NPYGG+M 
Sbjct  359   GSSVNALLDRNHYSVHSN-KRKSDYVQTPISKDGFTWIWKKMIELGKVSIVFNPYGGKMN  417

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             E+PS  TPFPHRAG L+KIQY VSW+E G A ++  +SQIR LH+++ PFVS+NPR AY 
Sbjct  418   EVPSDATPFPHRAGNLYKIQYTVSWQEPGAAVEKSFLSQIRVLHNYMTPFVSKNPRSAYF  477

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRN  229
             NYRDLDIG   HG  ++E+GKVYG KYF  N+ERLVKVKS +DP+NFF NEQSIP+  R+
Sbjct  478   NYRDLDIGINSHGKDNFEDGKVYGIKYFNKNFERLVKVKSAIDPENFFWNEQSIPTYPRS  537



>gb|KDO48902.1| hypothetical protein CISIN_1g009297mg [Citrus sinensis]
Length=538

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/528 (56%), Positives = 391/528 (74%), Gaps = 15/528 (3%)
 Frame = -3

Query  1818  LLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNT  1639
             +L   +S  +  ++SF  CL     N  P   +   +++P N+S+SSVLQ+Y RN RFNT
Sbjct  18    VLYISWSWRVNSHESFHQCLLN---NSPPSHPIFQAIHTPQNSSYSSVLQSYIRNLRFNT  74

Query  1638  GSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNL  1459
              S+PKPV+IV  +HESHV   ++CAKK  +++++RSGGHDYEG+SYVS+  F ILDMFNL
Sbjct  75    SSTPKPVLIVAAMHESHVQAAIICAKKHNLQMKIRSGGHDYEGLSYVSNVPFFILDMFNL  134

Query  1458  RSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyG  1279
             RSIDVDI      ETAWVQAGA LGE++YRI EKS  HGFP GVCPTVGVGGH S GGYG
Sbjct  135   RSIDVDIES----ETAWVQAGAILGEVFYRIAEKSKTHGFPAGVCPTVGVGGHFSAGGYG  190

Query  1278  NMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRV  1099
             NM+R++GL+VD++VDA++VDV GR+LDR +MGEDLFWAI GGG  SFGV+LA+KI L+ V
Sbjct  191   NMMRKYGLSVDNIVDAKLVDVNGRILDRNSMGEDLFWAIRGGGA-SFGVVLAYKINLVPV  249

Query  1098  PKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTV  919
             P+TVT F+ EK   L ++  D V ++ + A K+DD LFIRL+L +V   T+T +   +TV
Sbjct  250   PETVTVFKVEK--TLEQDATDAVDKWQHVAHKLDDGLFIRLVLDVVNSSTRTGE---RTV  304

Query  918   RSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNR  739
             R++++ LFLG SE+LLSI +  FP LGL + DC+E+SWI+S++ WGSF  GT    LL+R
Sbjct  305   RATFIALFLGGSERLLSITDKGFPELGLTRSDCTELSWIDSVVYWGSFPAGTPASVLLDR  364

Query  738   TPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFP  559
             TP   +S LKRKSDY+  PIP+  L+ LWKKM+EL    +  NPYGG+M EIP+T +PFP
Sbjct  365   TPLTLSS-LKRKSDYVTEPIPREGLEGLWKKMIELERPYMNFNPYGGKMHEIPATASPFP  423

Query  558   HRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTT  379
             HR G L+KIQY  +W EEG  A   +I   R+L+ +L PFVS+NPRQ++L YRDLD+GT 
Sbjct  424   HRDGNLWKIQYVTNWNEEGVDAANYYIDLTRQLYDYLTPFVSKNPRQSFLAYRDLDLGTN  483

Query  378   DHGLHS-YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +H   + Y EG+ YG  YF+ N++RLV++K++VDPDNFFRNEQSIP L
Sbjct  484   NHKFETGYSEGRAYGINYFLENFDRLVEIKTKVDPDNFFRNEQSIPVL  531



>gb|KDP36348.1| hypothetical protein JCGZ_09768 [Jatropha curcas]
Length=533

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/529 (55%), Positives = 389/529 (74%), Gaps = 16/529 (3%)
 Frame = -3

Query  1824  CNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF  1645
             C + TS  S   P  ++ + CL T S +  P   +S+ +Y+P N S+SSVLQ Y RN RF
Sbjct  16    CIISTSASSS--PDGETIIECLLTHSQSSNP---ISNAIYTPKNTSYSSVLQTYIRNLRF  70

Query  1644  NTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMF  1465
             N  ++ KP++IVT LHESHV   ++CA+K G+++++RSGGHDYEGISYVS   F ILDMF
Sbjct  71    NESTTRKPLLIVTALHESHVQASIICARKHGLQMKIRSGGHDYEGISYVSIVPFFILDMF  130

Query  1464  NLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsggg  1285
             NLR I+VD+      ETAWV+AGATLGE+YY I  KS++HGFP GVCPTVGVGGH  GGG
Sbjct  131   NLRKIEVDVVS----ETAWVEAGATLGEVYYNIGNKSNIHGFPAGVCPTVGVGGHFGGGG  186

Query  1284  yGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLL  1105
             YGNM+R++GL+VD+++DA+++DV GR+LDR +MGEDLFWAI GGGG S+GV++A+KIK++
Sbjct  187   YGNMMRKYGLSVDNIIDAKLIDVNGRLLDRKSMGEDLFWAITGGGGASYGVVIAYKIKIV  246

Query  1104  RVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSK  925
             RVP+ VT FR ++     +N  D+V Q+   A KIDD LF+R+   ++     +   + K
Sbjct  247   RVPEIVTVFRVQR--TQEQNVTDIVYQWQQIAPKIDDDLFLRVTFDVI----NSTQGSGK  300

Query  924   TVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALL  745
             T+R++   LFLGDS KLLSI+N+  P LGL + +C EMSW+ES+L W  F  GT   ALL
Sbjct  301   TIRATLRALFLGDSTKLLSIINAKLPQLGLIQSECIEMSWLESVLFWTDFSLGTPTTALL  360

Query  744   NRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTP  565
             +RTP    + LKRKSDY+Q PIP++ L+S+WKKM+EL    L  NPYGG+MAEIP+   P
Sbjct  361   SRTPQV-LTHLKRKSDYVQEPIPRNGLESIWKKMIELQVPQLTFNPYGGKMAEIPADAKP  419

Query  564   FPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIG  385
             FPHRAG L+KIQYA +W E+G  A   +I+  R+L++F+ PFVS+NPR A+LNYRDLD+G
Sbjct  420   FPHRAGNLWKIQYATNWNEDGTEAANRYINLTRQLYNFMTPFVSKNPRAAFLNYRDLDLG  479

Query  384   TTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
                +G  SY EG+VYG KYF  N+ RLVK+K++VDP NFFRNEQSIP+ 
Sbjct  480   INHNGKRSYLEGRVYGIKYFKDNFNRLVKIKTKVDPGNFFRNEQSIPTF  528



>ref|XP_003535121.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=548

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/542 (56%), Positives = 390/542 (72%), Gaps = 15/542 (3%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG--TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSV  1675
             +F++ L +   +T+   G  +  ++D+FL CL+  + N   +  +S+IV++  N  F +V
Sbjct  13    IFVLLLVVFTSVTAQSPGPESSSLHDTFLQCLTKYTKNSSSQ--LSNIVFANTNPKFPTV  70

Query  1674  LQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS  1495
             LQ Y RN RFNT S+PKP +IVTP  ESHV   V+CAK + +++++RSGGHDYEGISY+S
Sbjct  71    LQNYIRNARFNTSSTPKPSLIVTPQKESHVQATVICAKSVNIQLKIRSGGHDYEGISYIS  130

Query  1494  DATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptv  1315
             D  FIILDMFN R I VDI      E A VQAGATLGE+YYRIW+KS VHGFP GVCPTV
Sbjct  131   DEPFIILDMFNFRRITVDIKN----EVAVVQAGATLGEVYYRIWKKSKVHGFPAGVCPTV  186

Query  1314  gvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFG  1135
             GVGGH SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFG
Sbjct  187   GVGGHFSGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFG  246

Query  1134  VILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPP  955
             VIL++ IKL+ VP+TVT FR EK L       D+V Q+   A   DD LF+RLLLQ   P
Sbjct  247   VILSYTIKLVPVPETVTVFRVEKTLETNVTATDLVVQWQKVAPNTDDRLFMRLLLQ---P  303

Query  954   PTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG--  781
              +      + TVR+S V LFLG + +++SIL   F  LGLKK++C+E+SWI S+L W   
Sbjct  304   VSSKVVKGTITVRASVVALFLGGANEVVSILAKQFSLLGLKKENCTEVSWINSVLWWNDN  363

Query  780   -SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              S  NG KPEALL+R     A FLKRKSDY+QN I +  L+ L+K+M+ELG TGL  NPY
Sbjct  364   NSLKNGVKPEALLDRN-LNSAGFLKRKSDYVQNAISRDGLEWLFKRMIELGKTGLVFNPY  422

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+M+EIPS  TPFPHR G L+KIQY+V+W +    A     +Q + L S++ PFVS+NP
Sbjct  423   GGKMSEIPSDATPFPHRKGNLYKIQYSVNWDDRSPGAALNFTNQAKRLFSYMTPFVSKNP  482

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R A+LNYRDLDIG    G +S++EG VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  483   RSAFLNYRDLDIGVNSFGENSFQEGVVYGTKYFNDNFQRLVKIKTIVDPENFFRNEQSIP  542

Query  243   SL  238
              L
Sbjct  543   VL  544



>gb|KEH37087.1| FAD-binding berberine family protein [Medicago truncatula]
Length=537

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/543 (54%), Positives = 396/543 (73%), Gaps = 12/543 (2%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCF-SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             M  S VF   L L  L  SC  S T    ++F+HCL   S    P   ++S +++P N+S
Sbjct  1     MKLSLVFPPILGL--LFLSCLASATNSHQNTFIHCLVNHSQ---PSHPITSSIFTPNNSS  55

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             FSSVL  Y RN RFNT ++ KP +I+T LH SH+   ++CAK+  +++++RSGGHDYEG+
Sbjct  56    FSSVLNDYVRNLRFNTSTTRKPYLIITALHVSHIQASIICAKQHNLQMKIRSGGHDYEGV  115

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggv  1327
             SYV++  F ILDMFNLRSI VD+      ETAWVQ GA LGELYYRI EKS VHGFP GV
Sbjct  116   SYVAEVPFFILDMFNLRSIQVDVEN----ETAWVQTGAQLGELYYRINEKSKVHGFPAGV  171

Query  1326  cptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgggg  1147
             CPTVGVGGH+SGGGYGNM+R++GL+VD+++DA+I+DV GR+LDR +MGEDLFWAI GGGG
Sbjct  172   CPTVGVGGHLSGGGYGNMMRKYGLSVDNIIDAQIIDVNGRLLDRKSMGEDLFWAIKGGGG  231

Query  1146  GSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ  967
              SFGV+L++KIKL++VPK VT F+  K   L +N +D+V  + + A  ID+ LFIRL++ 
Sbjct  232   ASFGVVLSYKIKLVKVPKIVTVFQIRK--TLDQNASDIVYNWQHVAPTIDNDLFIRLIID  289

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
             +V       ++ +KT+R++++ LFLGDS+ L+S++N  FP LGLK+ DC E SW++S+L 
Sbjct  290   VVNVTQNATNNGAKTIRATFISLFLGDSKTLVSLMNEKFPQLGLKESDCIETSWLQSVLF  349

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W +    T  E LLNR P    ++LKRKSDY++ PI    L+ +WKKM+EL +  L  NP
Sbjct  350   WTNIDITTPVEILLNRKPQSLVNYLKRKSDYVKEPISSKGLEGIWKKMIELEDAILYFNP  409

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+MAEI ST TPFPHRAG L+K+QY  +W + G+     +I   R+LH ++ PFVS+N
Sbjct  410   YGGKMAEISSTDTPFPHRAGNLWKVQYQANWNKAGKDVADHYIGLTRKLHRYMTPFVSKN  469

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR+A+ NY+DLD+G   +G +SY EG+VYG +YF  N++RLV++K++VDPDNFFRNEQSI
Sbjct  470   PREAFFNYKDLDLGINHNGKNSYAEGRVYGVEYFKDNFDRLVEIKTKVDPDNFFRNEQSI  529

Query  246   PSL  238
             P+L
Sbjct  530   PTL  532



>ref|XP_003546281.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN14307.1| Reticuline oxidase-like protein [Glycine soja]
Length=544

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/545 (55%), Positives = 394/545 (72%), Gaps = 17/545 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             +SS+ + L+ + +   +++    +  +Y++FL CL+  + NP      S+IV++  N  F
Sbjct  10    LSSTFLLLLVVTVFTSVSAQAPESPSLYNTFLQCLTKYTNNP------SNIVFANTNPKF  63

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
              ++LQ Y RN RFNT S+ KP++IVTP  ESHV   V+CAK + +++++RSGGHDYEGIS
Sbjct  64    PTILQNYIRNARFNTSSTRKPLLIVTPQQESHVQGTVICAKSVEIQLKIRSGGHDYEGIS  123

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             Y+S+  F+ILDMFN R I VD+      E A V+AGATLGE+YYRIWEKS V GFP GVC
Sbjct  124   YISEEPFVILDMFNYRRITVDVKN----EVAVVEAGATLGEVYYRIWEKSKVLGFPAGVC  179

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG 
Sbjct  180   PTVGVGGHFSGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGA  239

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL+F IKL+ VP+TVT FR EK L       D+V Q+   A   DD LF+RLLLQ 
Sbjct  240   SFGVILSFTIKLVPVPETVTVFRVEKTLETNVTATDLVVQWQQVAPNTDDRLFMRLLLQ-  298

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
               P +      ++TVR+S V LFLG + +++SIL  +FP LGLKK++C+E+SWI+S+L W
Sbjct  299   --PVSSKVVKGTRTVRASVVALFLGGANEVVSILAKEFPLLGLKKENCTEVSWIDSVLWW  356

Query  783   G---SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
                 S  NG KPE LL+R    +A FLKRKSDY+QN I +  L+ L+K+M+ELG TGL  
Sbjct  357   NDDNSLKNGDKPETLLDRN-LNNAGFLKRKSDYVQNAISRDGLEWLFKRMIELGKTGLVF  415

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGG+MAEIPS  TPFPHR G L+KIQY+V+W +    A     +Q + L S++ PFVS
Sbjct  416   NPYGGKMAEIPSDATPFPHRKGNLYKIQYSVNWDDPSPGAALNFTNQAKRLFSYMTPFVS  475

Query  432   RNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQ  253
             +NPR A+LNYRDLDIG    G +S++EG VYG KYF  N++RLVK+K+ VDP+NFFRNEQ
Sbjct  476   KNPRSAFLNYRDLDIGVNSFGENSFQEGLVYGTKYFNDNFQRLVKIKTTVDPENFFRNEQ  535

Query  252   SIPSL  238
             SIP L
Sbjct  536   SIPVL  540



>gb|EPS70046.1| hypothetical protein M569_04712 [Genlisea aurea]
Length=537

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 394/538 (73%), Gaps = 18/538 (3%)
 Frame = -3

Query  1845  FLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQA  1666
             FL    +  +L S  +    +Y SF++CLS    N +    +SS VYSP N SF +VL +
Sbjct  4     FLCIFFVVFILLSAAANGDEVYASFVNCLSR---NAVSDAEISSTVYSPRNPSFQNVLLS  60

Query  1665  YARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA-  1489
               RNRRF+  ++ KP  I  P  ESHV   V+C+K+LG+++++RSGGHDYEG+SYVS+  
Sbjct  61    AVRNRRFSQSTTRKPSAIFAPAAESHVAAAVICSKELGIQLKIRSGGHDYEGVSYVSNGG  120

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              FI+LD+ N RSI VDI G    ETAWV AGA LGELYYRIWEKS VHG+P G+CPTVGV
Sbjct  121   EFILLDVSNFRSISVDIPG----ETAWVGAGAYLGELYYRIWEKSGVHGYPAGLCPTVGV  176

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SG GYG M+R++GLTVD+++DARIVD  GRVLDR +MGEDLFWAI GGGGGSF VI
Sbjct  177   GGHISGAGYGTMLRKYGLTVDNLIDARIVDAGGRVLDRASMGEDLFWAIRGGGGGSFAVI  236

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             LA++IKL+RVP TVT F  +++ G   N  + V ++     +IDD+LFIR+LLQ    P 
Sbjct  237   LAYRIKLVRVPATVTVFNLQRFFG--ENATEAVYEFQQIIPQIDDNLFIRVLLQ----PV  290

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
               N  N++ +R++++G FLG+S++LL I +S FP LGL+K+DC EM+WI+S++ W ++ N
Sbjct  291   TVN--NNRVLRATFMGQFLGNSDQLLPITSSQFPKLGLRKEDCREMTWIQSVIFWANYKN  348

Query  768   GTKPEA-LLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
                  A LLNR+P     FLKRKSDY++ PIP   L S++++M+++G  GL +N YGG M
Sbjct  349   PPNSTAVLLNRSPE-SVIFLKRKSDYVRTPIPISALRSIFQRMVQIGKAGLVLNSYGGVM  407

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
               IP ++TPFPHR GVL+KIQY+V+W E+G AA+  ++ Q R+LH F+ PFVS NPR+AY
Sbjct  408   DRIPESETPFPHRRGVLYKIQYSVNWNEDGPAAESNYVKQARDLHDFMTPFVSSNPREAY  467

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             LNYRDLDIGTTD+G  SY +G VYG KYF  N+ RLV++K++VDPDN FRNEQSIP+ 
Sbjct  468   LNYRDLDIGTTDNGNDSYAQGLVYGLKYFNNNFYRLVQIKTKVDPDNVFRNEQSIPTF  525



>ref|XP_008222794.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=544

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/515 (56%), Positives = 390/515 (76%), Gaps = 14/515 (3%)
 Frame = -3

Query  1773  FLHCLSTVSANPIPKDLVSSIVYSPANAS-FSSVLQAYARNRRFNTGSSPKPVIIVTPLH  1597
             F+ CL + S    P   +S  +Y+P NAS +SSVL++Y RN RFNT S+PKP +I+TPLH
Sbjct  38    FVQCLLSHSQ---PSHPISEAIYTPNNASSYSSVLRSYIRNLRFNTCSTPKPFLIITPLH  94

Query  1596  ESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGE  1417
             ESHV   ++CA+K  + +++RSGGHDYEG+SYVS+  F +LDMFNLRSID+DI+     E
Sbjct  95    ESHVQQAIVCAQKQNLLMKIRSGGHDYEGVSYVSEVPFFLLDMFNLRSIDIDISS----E  150

Query  1416  TAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVV  1237
             TAWVQAGATLGEL+YRI+EKS +HGFP GVCPTVGVGGH SG GYGN++R++GL+VD+++
Sbjct  151   TAWVQAGATLGELFYRIYEKSKIHGFPAGVCPTVGVGGHFSGAGYGNLMRKYGLSVDNII  210

Query  1236  DARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLG  1057
             DA+++DV GR+LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+TVT FR E+   
Sbjct  211   DAQLMDVHGRLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPQTVTVFRVER--T  268

Query  1056  LTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV---PPPTKTNDSNSKTVRSSYVGLFLGD  886
             L +N  D+V ++   A K+D  LFIRL +++V     P  T   N KT+R+S++G FLG+
Sbjct  269   LEQNATDIVYRWQYVAPKLDTDLFIRLTMEVVNITGGPLSTGGENYKTIRASFIGFFLGN  328

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLS++ + FP LGLK+ DC EMSW+ES+L W +F  GT+PEALL+R P      LKR
Sbjct  329   SERLLSVMETGFPELGLKQSDCIEMSWVESVLFWTNFSIGTEPEALLSRKPQ-VLVHLKR  387

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  +W+KM+E     ++ NPYGG+M+EIP + TP PHRAG L+KIQY
Sbjct  388   KSDYVKTPIPKIGLMWIWQKMIEFEVPIMSFNPYGGKMSEIPESATPCPHRAGNLWKIQY  447

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W+  G  A   H++  R+L+ ++ PFVS NPR+AY NY+DLD+G  ++G  SY EG+
Sbjct  448   ATNWEVSGAEASDYHLNLTRKLYFYMTPFVSMNPREAYFNYKDLDLGINNNGKASYFEGR  507

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
              YG +YF  N++RLV++K+ VDP NFFRNEQSIP+
Sbjct  508   AYGIRYFKDNFDRLVRIKTEVDPGNFFRNEQSIPT  542



>ref|XP_004295437.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=802

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/523 (60%), Positives = 386/523 (74%), Gaps = 18/523 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD F+ CL+T      P    S IV    N SF+S L+AY RN RFNT S+PKPV+I+T
Sbjct  30    LYDDFVRCLNT-----HPNSSASQIVIPQNNPSFTSTLRAYIRNARFNTTSTPKPVLILT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS-DATFIILDMFNLRSIDVDIAGG  1429
             P  ESHV   VLCAKKL V+++ RSGGHDYEGISYVS + TF++LD+FN RSIDV+   G
Sbjct  85    PKTESHVQASVLCAKKLNVQLKTRSGGHDYEGISYVSTEPTFVVLDLFNFRSIDVNAEAG  144

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                  AW QAGATLGELYYRI EKS   GFP G+CPTVGVGGHVS GGYGN++R++GL+V
Sbjct  145   ----YAWAQAGATLGELYYRIAEKSKTLGFPAGICPTVGVGGHVSAGGYGNLLRKYGLSV  200

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DA IVDV G++LDR AMGEDLFWAI GGGGGSFGVILA+K+KL+ VP+ VT FR  
Sbjct  201   DNVLDALIVDVNGKLLDRKAMGEDLFWAIRGGGGGSFGVILAYKLKLVPVPEKVTVFRVM  260

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
              Y     N  DVV ++ + A    D L++R+L+Q V  PTK     + TVR S +G +LG
Sbjct  261   SYT--ESNATDVVLKWQDVAPSTVDDLWMRMLVQPVSSPTK---KGTNTVRISVLGQYLG  315

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW--GSFGNGTKPEALLNRTPAGDASF  715
             +S +L+S+L   FP LGLKK+DC EMSWIES++ W  GS  N TKPE LL+R P   A F
Sbjct  316   NSNQLVSVLGKQFPELGLKKEDCLEMSWIESVVWWNDGSTPNVTKPEVLLDRNP-DQAKF  374

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
              KRKSDY+Q PI +  L+SLWKK++ELG TGL  N YGG+MA + ++  PFPHRAG LFK
Sbjct  375   GKRKSDYVQTPISREGLESLWKKLIELGKTGLVFNAYGGKMARVSASDAPFPHRAGNLFK  434

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+VSW++ GE A +E+++Q R L+SF+ PFVS+NPR A+L YRDLDIG  + G  SYE
Sbjct  435   IQYSVSWEDGGEEATKEYLNQTRVLYSFMTPFVSKNPRSAFLAYRDLDIGVNNFGKDSYE  494

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQ  226
             +GKVYG KYF  N+ RLVKVK+ VDP+NFFRNEQSIP L R +
Sbjct  495   QGKVYGLKYFNDNFNRLVKVKTAVDPENFFRNEQSIPPLPRKE  537



>ref|XP_004486494.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=547

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/544 (53%), Positives = 401/544 (74%), Gaps = 18/544 (3%)
 Frame = -3

Query  1869  TMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             +++ S    L+F++ CN+ +S     +P +++F+HCL   S    P   ++S +++P N 
Sbjct  17    SLLLSPMCVLLFISSCNIASST---NLP-HNTFIHCLVNHSQTSYP---ITSAIFTPNNP  69

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             SFSSVLQAY RN RFNT ++ KP +I+T LH SH+   ++CA+K  +++++RSGGHDYEG
Sbjct  70    SFSSVLQAYIRNLRFNTSTTRKPFLIITALHVSHIQASIICAQKHNLQMKIRSGGHDYEG  129

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             +SYV++  F ILDMFNLRSID+DI      ETAW+Q+GATLGE+YYRI EKS +HGFP G
Sbjct  130   VSYVAEVPFFILDMFNLRSIDIDIEN----ETAWIQSGATLGEVYYRIAEKSEIHGFPAG  185

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             VCPTVGVGGHVSGGGYGN++R++GL+VD+V+DA+I+DV G++LDR  MGEDLFWAI GGG
Sbjct  186   VCPTVGVGGHVSGGGYGNLMRKYGLSVDNVIDAQIIDVNGKLLDREEMGEDLFWAIRGGG  245

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGV+L++KIKL++VPK VT F+  K   L  N  ++V  + + A  ID+ LFIRL++
Sbjct  246   GASFGVVLSYKIKLVKVPKIVTVFQVRK--TLEENATNIVYNWQHVAPTIDNDLFIRLIM  303

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
              +V     T  + +KT+R+S++ L+LGDS+ L+S++N  FP LGLK+ DC E SWI+S+L
Sbjct  304   DVV----NTTKNGTKTIRASFIALYLGDSKSLVSLMNKSFPQLGLKESDCIETSWIKSVL  359

Query  789   RWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVN  610
              W +     K E LL+R P    ++LKRKSDY++ PI K  L+ +WKKM+EL    L  N
Sbjct  360   FWTNINLTEKVEILLDRQPQS-LNYLKRKSDYVKKPISKKGLEGIWKKMIELEGAILYFN  418

Query  609   PYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSR  430
             PYGG+MAEI S +TPFPHRAG L+K+QY  +W E G+     +I+  R+LH ++ PFVS+
Sbjct  419   PYGGKMAEISSKETPFPHRAGNLWKVQYQANWNEAGKDVADYNINLTRKLHKYMTPFVSK  478

Query  429   NPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             NPR+A+ NY+DLD+G   +G  SY EG+VYG +YF  N+ RLV++KS+VDPDNFFRNEQS
Sbjct  479   NPREAFFNYKDLDLGINHNGKDSYIEGRVYGVEYFKDNFNRLVEIKSKVDPDNFFRNEQS  538

Query  249   IPSL  238
             IP L
Sbjct  539   IPIL  542



>emb|CDP12593.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/537 (58%), Positives = 396/537 (74%), Gaps = 19/537 (4%)
 Frame = -3

Query  1836  FLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYAR  1657
             F+   +   S  S TI  YD+F +CL+    N IP + +S I+YSP+N+SFSSVL AY R
Sbjct  11    FITFSSQPFSATSDTI--YDNFAYCLT---RNGIPSNQISKILYSPSNSSFSSVLDAYVR  65

Query  1656  NRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFII  1477
             N+R NT ++ KP IIVTPL   H+   +LC K  G+++ +RSGGHD+EG+SYVSD  FII
Sbjct  66    NKRLNTPTTRKPSIIVTPLQVQHIQAAILCTKGTGLQLNIRSGGHDFEGLSYVSDVPFII  125

Query  1476  LDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghv  1297
             LD+FNLRSI VD A     ETAWVQAGATLGELYYRIWEKS + GFP GVCPTVGVGGH+
Sbjct  126   LDLFNLRSISVDTAT----ETAWVQAGATLGELYYRIWEKSKILGFPAGVCPTVGVGGHI  181

Query  1296  sgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFK  1117
             SGGGYG+++RR+GLTVD+V+DA+I+DV GRVLDR AMGEDLFWAI GGGG SFGV+LA++
Sbjct  182   SGGGYGSLLRRYGLTVDNVLDAQIIDVNGRVLDRKAMGEDLFWAIRGGGGASFGVVLAYR  241

Query  1116  IKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTND  937
             I+L+RV +  + F  +K      N  DV+ ++ N A KID+ LFIR+L+Q    P     
Sbjct  242   IRLVRVLEIHSVFTVQKTEA--ENATDVLYKWQNVADKIDNDLFIRVLVQ----PITGKV  295

Query  936   SNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKP  757
                K +R +++G FLGD+ +L+S++N+ FP LGLK+ DC E SWI++ML W  +  GT  
Sbjct  296   KGQKIIRLTFMGHFLGDANRLISVMNTGFPELGLKRSDCLETSWIDTMLWWYKYKIGTAK  355

Query  756   EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLEL---GNTGLAVNPYGGRMAE  586
             E LL+R       F KRKSDY+QNPIPK  L SL+KKM E+   G  GL  NPYGGRM E
Sbjct  356   EVLLSRA-YDQLIFFKRKSDYVQNPIPKDGLVSLFKKMSEITYGGKIGLVFNPYGGRMRE  414

Query  585   IPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLN  406
             IP  +TPFPHRAG++FKIQY+V+W++       E++ + R L+SF+ PFVS+NPRQA+LN
Sbjct  415   IPENETPFPHRAGIIFKIQYSVNWEDADPNLINEYVGEARNLYSFMTPFVSKNPRQAFLN  474

Query  405   YRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             YRDLDIGTTD+G + Y EG+VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP+L+
Sbjct  475   YRDLDIGTTDNGKNRYNEGQVYGVKYFKNNFDRLVKVKTMVDPQNFFRNEQSIPTLN  531



>ref|XP_007212419.1| hypothetical protein PRUPE_ppa016588mg, partial [Prunus persica]
 gb|EMJ13618.1| hypothetical protein PRUPE_ppa016588mg, partial [Prunus persica]
Length=509

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/520 (56%), Positives = 383/520 (74%), Gaps = 25/520 (5%)
 Frame = -3

Query  1776  SFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLH  1597
             +FL CLS  S    P   +S  +Y+  +ASFSSVLQ+Y RN RF + ++PKP++IV   H
Sbjct  11    NFLQCLSKHSQRSNP---ISEAIYTSKSASFSSVLQSYVRNLRFISPTTPKPLLIVAAKH  67

Query  1596  ESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT--FIILDMFNLRSIDVDIAGGDG  1423
             ESHVP  V+CAK LG+EIR+RSGGHDYEG+SYVS  T  FI+LDMFNLRSI++D+A    
Sbjct  68    ESHVPATVICAKSLGLEIRIRSGGHDYEGVSYVSRNTKDFIVLDMFNLRSINIDMAD---  124

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              E+AWVQ+GA LGE++Y I  KS  H FP GVCP++G GGH +GGGYGNM+R++GL+ D+
Sbjct  125   -ESAWVQSGAILGEIFYAISMKSKNHAFPAGVCPSIGAGGHFTGGGYGNMMRKYGLSTDN  183

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             +VDA+IV+V G++LDR AMGEDLFWAI GGGG SFGVILA+KIK +RVP TVT F  ++ 
Sbjct  184   IVDAKIVNVNGKILDRKAMGEDLFWAIRGGGGSSFGVILAWKIKFVRVPATVTVFEVKRT  243

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
             L L     +++ ++   A K+D  LFIR    I+ P        + T+  S++ LFLG+S
Sbjct  244   LAL--GATEILVKWQQVADKLDHDLFIR---AIIKPA-------NGTIEVSFMSLFLGNS  291

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT-KPEALLNRTPAGDASFLKR  706
             E+LL +++  FP LGL+K DC EMSWI+S+L W ++ NGT  PE LLNR P G   FLKR
Sbjct  292   ERLLKLMSQSFPQLGLQKTDCHEMSWIQSVLYWTNYQNGTTSPEVLLNRVPKGQV-FLKR  350

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PI K  L++LWK M+E+G   +  NPYGG+M+EIP T TPFPHRAG LFKIQY
Sbjct  351   KSDYVKQPISKTDLEALWKVMIEIGEVTMLWNPYGGKMSEIPETATPFPHRAGNLFKIQY  410

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +V+WKEEG  + + ++S +++L+  + P+VS+NPR A+ NYRDLDIGT   G   Y+E K
Sbjct  411   SVNWKEEGFESTKRYLSLMKKLYVAMTPYVSKNPRMAFYNYRDLDIGTNSKG--GYDEAK  468

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQ  226
             VYG KYF GN+ERLV++K+ VDP+NFFRNEQSIP+L   Q
Sbjct  469   VYGTKYFKGNFERLVRIKTEVDPENFFRNEQSIPTLPSKQ  508



>ref|XP_010537531.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Tarenaya 
hassleriana]
Length=586

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/527 (57%), Positives = 394/527 (75%), Gaps = 18/527 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YDSF+ C S  + +P  +  +S  V+S  N S+SSVL+AY RN RFNT SSPKP IIVT
Sbjct  33    VYDSFIKCFSDQTKSP--QSEISDDVFSQTNPSYSSVLRAYIRNARFNTSSSPKPTIIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  E+HV   V+C+K LG  +++RSGGHDYEG+SY+SD  F ILDM NLR I VDIA   
Sbjct  91    PRSENHVSAAVICSKTLGFLLKIRSGGHDYEGLSYISDQPFFILDMSNLRDISVDIAE--  148

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AW+ +GATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SG GYGNM+R++GL+VD
Sbjct  149   --ESAWISSGATLGEVYYRIWEKSQVHGFPAGVCPTVGVGGHISGAGYGNMLRKYGLSVD  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +VVDA+IVDV GR+LDR  MGEDLFWAI+GGGG SFGV+L +KIKL+ VP+TVT FR E+
Sbjct  207   NVVDAKIVDVNGRILDRRTMGEDLFWAISGGGGASFGVLLGYKIKLVPVPETVTVFRIEQ  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             ++G  +   ++V ++   A K D +LF+R+L+Q   P T+      +TVR+S V LFLG 
Sbjct  267   FMG--QGATEMVHRWQFVAPKTDPNLFMRMLIQ---PVTR---KKQRTVRASVVALFLGR  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             ++ ++S+L+ +FP LGLKK++C+EMSWI+S+L W +  N T   P  LL+R     A FL
Sbjct  319   ADNVVSLLSKEFPELGLKKENCTEMSWIQSVLWWDNHVNATAINPNVLLDRD-LDSAGFL  377

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   I K  LD L+K+M+++G  GL  NPYGGRM+EIP  QTPFPHR   LFKI
Sbjct  378   KRKSDYVATEISKDGLDWLFKRMIDVGKVGLVFNPYGGRMSEIPVGQTPFPHR-NKLFKI  436

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+W +    ++++ ++Q + L+S+   FV++NPR AYLNYRDLDIG  DHG +S+EE
Sbjct  437   QYSVNWNDPSAESEKDFLAQAKRLYSYTTAFVTKNPRNAYLNYRDLDIGVNDHGKNSFEE  496

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSES  211
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L+  +T + S
Sbjct  497   GEVYGRKYFGDNFDRLVKIKTEVDPKNFFRNEQSIPTLATARTAAGS  543



>ref|XP_010537539.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Tarenaya 
hassleriana]
Length=556

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/520 (57%), Positives = 391/520 (75%), Gaps = 18/520 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YDSF+ C S  + +P  +  +S  V+S  N S+SSVL+AY RN RFNT SSPKP IIVT
Sbjct  33    VYDSFIKCFSDQTKSP--QSEISDDVFSQTNPSYSSVLRAYIRNARFNTSSSPKPTIIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  E+HV   V+C+K LG  +++RSGGHDYEG+SY+SD  F ILDM NLR I VDIA   
Sbjct  91    PRSENHVSAAVICSKTLGFLLKIRSGGHDYEGLSYISDQPFFILDMSNLRDISVDIAE--  148

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AW+ +GATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SG GYGNM+R++GL+VD
Sbjct  149   --ESAWISSGATLGEVYYRIWEKSQVHGFPAGVCPTVGVGGHISGAGYGNMLRKYGLSVD  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +VVDA+IVDV GR+LDR  MGEDLFWAI+GGGG SFGV+L +KIKL+ VP+TVT FR E+
Sbjct  207   NVVDAKIVDVNGRILDRRTMGEDLFWAISGGGGASFGVLLGYKIKLVPVPETVTVFRIEQ  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             ++G  +   ++V ++   A K D +LF+R+L+Q   P T+      +TVR+S V LFLG 
Sbjct  267   FMG--QGATEMVHRWQFVAPKTDPNLFMRMLIQ---PVTR---KKQRTVRASVVALFLGR  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             ++ ++S+L+ +FP LGLKK++C+EMSWI+S+L W +  N T   P  LL+R     A FL
Sbjct  319   ADNVVSLLSKEFPELGLKKENCTEMSWIQSVLWWDNHVNATAINPNVLLDRD-LDSAGFL  377

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   I K  LD L+K+M+++G  GL  NPYGGRM+EIP  QTPFPHR   LFKI
Sbjct  378   KRKSDYVATEISKDGLDWLFKRMIDVGKVGLVFNPYGGRMSEIPVGQTPFPHR-NKLFKI  436

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+W +    ++++ ++Q + L+S+   FV++NPR AYLNYRDLDIG  DHG +S+EE
Sbjct  437   QYSVNWNDPSAESEKDFLAQAKRLYSYTTAFVTKNPRNAYLNYRDLDIGVNDHGKNSFEE  496

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L+R
Sbjct  497   GEVYGRKYFGDNFDRLVKIKTEVDPKNFFRNEQSIPTLAR  536



>ref|XP_002523151.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39182.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=540

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/516 (56%), Positives = 383/516 (74%), Gaps = 16/516 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D+F  CL  +S    P   ++S +++P NAS+SSVLQ+Y RN RFN  S+PKP++IVT L
Sbjct  35    DNFFQCLLNLSQ---PSHPITSAIFAPDNASYSSVLQSYIRNLRFNMSSTPKPLLIVTAL  91

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA K G+++++RSGGHDYEG+SYVSD  F +LDMFNLR++DVD+      
Sbjct  92    HESHVQASVVCAWKHGLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRAVDVDVET----  147

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGA LGE+YYRI EKS VHGFP G+CPTVGVGGH+SGGGYGNM+R++GL+ D++
Sbjct  148   ETAWVQAGAILGEVYYRIAEKSKVHGFPAGICPTVGVGGHLSGGGYGNMMRKYGLSADNI  207

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA++VDV GR+LDR +MGEDLFWAI GGGG SFGV++++KI ++RVP+ VT FR ++  
Sbjct  208   IDAQLVDVNGRLLDRKSMGEDLFWAIRGGGGASFGVVISYKINIVRVPEVVTVFRVQR--  265

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +N  D+V ++ + A  +DD +FIRL L++V         N KTVR+++  +FLGDS 
Sbjct  266   TLEQNATDIVDKWQHVAYNLDDDIFIRLTLEVV----NATQGNGKTVRATFRCMFLGDSA  321

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LL+ +   FP +GL + DC EMSW+ES+L W  F  GT   ALL RTP    ++LKRKS
Sbjct  322   RLLATMKESFPEMGLVQSDCLEMSWLESVLFWTDFAVGTPTTALLRRTPPS-ITYLKRKS  380

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIP+  L+ LW+KM+EL    LA NPYGG+M EIPST  PFPHRAG L+KIQYA 
Sbjct  381   DYVKKPIPRDGLEKLWQKMVELQVPSLAFNPYGGKMGEIPSTALPFPHRAGNLWKIQYAT  440

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGT--TDHGLHSYEEGK  346
             +W  EG  A   +I   R+L+ F+ P+VS++PR+A+LNYRDLD+G    D    SY EG+
Sbjct  441   NWNVEGTEAANHYIDLTRQLYDFMTPYVSKDPREAFLNYRDLDLGINHNDGKKKSYLEGR  500

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              YG +YF  N++RLV+VK++VDP NFFRNEQSIP+ 
Sbjct  501   TYGIQYFKENFDRLVQVKTKVDPGNFFRNEQSIPTF  536



>gb|KCW75699.1| hypothetical protein EUGRSUZ_D00073 [Eucalyptus grandis]
Length=536

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/546 (54%), Positives = 397/546 (73%), Gaps = 19/546 (3%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLTSCFSGTIPMY--DSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             +S  ++L FL +  L    FS     +  +S   CL   S    P   ++S +Y+P  +S
Sbjct  7     NSKTLYLFFLIV--LFIGSFSSPSKAFANESLTQCLINHSQ---PSHPITSAIYTPNKSS  61

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             +S+VLQ+Y RN RFNT  +PKP +I+T LHESHV   ++CA+KL V++++RSGGHDYEGI
Sbjct  62    YSNVLQSYIRNLRFNTSDTPKPTLILTALHESHVQAAIVCAQKLSVQMKIRSGGHDYEGI  121

Query  1506  SYVSDAT-FIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             SYVS ++ F ILDMFNLRS+DVDI      E AWVQAGATLGE+YY I  KS VHGFP G
Sbjct  122   SYVSISSPFFILDMFNLRSVDVDIEA----EMAWVQAGATLGEVYYGIAAKSKVHGFPAG  177

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             VCPTVGVGGH SGGGYGNM+R++GLTVD++VDARI++V G +LDR +MGEDLFWAI GGG
Sbjct  178   VCPTVGVGGHFSGGGYGNMMRKYGLTVDNIVDARIINVNGEILDRESMGEDLFWAIRGGG  237

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGV+LA+KI L+RVP+TVT F   +     +N  +VV ++   A ++ + LFIRL +
Sbjct  238   GASFGVVLAYKINLVRVPQTVTVFSVPR--TWEQNATEVVYKWEQVAPQLHEDLFIRLTM  295

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
              +V        +  KT+R++++ LFLGD+++LLS++++ FP LGL+  DC EMSW+ES L
Sbjct  296   DVV----NGTKAGEKTIRATFIALFLGDAQRLLSLMSNSFPELGLRSSDCIEMSWVESTL  351

Query  789   RWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVN  610
              W +F  GT  +ALL+RTP    + LKRKSDY++  IPK  L+ +W++M+EL    L  N
Sbjct  352   FWTNFPIGTPADALLSRTPQ-VLTHLKRKSDYVKQIIPKDGLELIWRRMIELERPMLTFN  410

Query  609   PYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSR  430
             PYGG+M EIP+T TPFPHRAG L+K+QYA +W E G+ A R +I   R+L+ ++ PFVS+
Sbjct  411   PYGGKMGEIPATNTPFPHRAGNLWKVQYATNWDENGDEAARHYIELTRKLYRYMTPFVSK  470

Query  429   NPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             NPR+A+LNYRDLD+G   +G  SYEEG+VYG KYF GN+ RLV++K++VDP NFFRNEQS
Sbjct  471   NPREAFLNYRDLDLGINHNGDESYEEGRVYGVKYFKGNFNRLVEIKTKVDPGNFFRNEQS  530

Query  249   IPSLSR  232
             IP L +
Sbjct  531   IPVLPQ  536



>ref|XP_004486488.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=545

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/522 (56%), Positives = 387/522 (74%), Gaps = 20/522 (4%)
 Frame = -3

Query  1797  GTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPV  1618
              ++ +Y +FL+C +  + N       S++V+S  N SFS+VLQ Y RN RFN  ++PKP+
Sbjct  37    SSLSLYTNFLNCFTQHTTNS------SNVVFSQTNPSFSTVLQDYIRNARFNKTTTPKPL  90

Query  1617  IIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT-FIILDMFNLRSIDVD  1441
             IIVTP   SH+   V+C+K L ++I++RSGGHDYEG+SYVS  + FIILDMFNLR+I+VD
Sbjct  91    IIVTPKTPSHIQSTVICSKSLNLQIKIRSGGHDYEGLSYVSSQSPFIILDMFNLRTINVD  150

Query  1440  IAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRF  1261
             I      E A++Q GATLGE+YYRI+EKS VHGFP GVCPTVGVGGH+SGGGYG M+R++
Sbjct  151   IER----EQAYIQTGATLGEVYYRIYEKSKVHGFPAGVCPTVGVGGHLSGGGYGTMLRKY  206

Query  1260  GLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTY  1081
             GL VD+++DA IVDVKGR+L+R  MGED+FWAI GGGGGSFGV+L++ ++L+ VP+ VT 
Sbjct  207   GLAVDNIIDAEIVDVKGRILNRKLMGEDVFWAIRGGGGGSFGVVLSYTVQLVSVPEIVTV  266

Query  1080  FRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVG  901
             FR EK   L  N  D+V Q+   A   D+ LF+RLLLQ   P T      +KT+R+S V 
Sbjct  267   FRIEK--TLEENATDLVVQWQQVAPTTDERLFMRLLLQ---PITSKTVKGTKTMRASVVA  321

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPA  730
             +FLG +++++ IL  +FP LGLKK+DC E+SWI S+L +    S  +G KPE LL+R   
Sbjct  322   MFLGGADEVVEILGKEFPLLGLKKEDCLELSWINSVLWYNDDQSIESGAKPETLLDRN-V  380

Query  729   GDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
               AS+ KRKSDY+Q  IPK  L+ +WKKM+ELG  G   NPYGG+MAEI S  TPFPHRA
Sbjct  381   NSASYGKRKSDYVQKAIPKDSLELIWKKMIELGKVGFVFNPYGGKMAEIASDATPFPHRA  440

Query  549   GVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG  370
             G LFK+QY+V+WK++ EA++  +++Q + L+SF+ P+VS NPR A+LNYRD+DIGT   G
Sbjct  441   GNLFKVQYSVNWKDDTEASETNYLNQAKSLYSFMTPYVSSNPRSAFLNYRDIDIGTNSFG  500

Query  369   LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
              +SY+EG+VYG KYF  N++RLVK K+ +DP NFFRNEQSIP
Sbjct  501   KNSYQEGQVYGSKYFNDNFDRLVKTKTAIDPQNFFRNEQSIP  542



>ref|XP_011006009.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=533

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/535 (54%), Positives = 396/535 (74%), Gaps = 18/535 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
              VF +L  L++     +I + DSFL CL+    N  P + +S  +++P N  F++VLQ+Y
Sbjct  5     FVFFSLL-LISVSLPNSIALPDSFLQCLT---ENSQPTNPISDAIHTPENPLFTTVLQSY  60

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
             ARN RF T S+PKP+ I+   HESHV   ++C+KKLG++IR+RSGGHDY+G+SYVSD  F
Sbjct  61    ARNLRFLTLSTPKPLAIIAAKHESHVQATIICSKKLGLQIRIRSGGHDYDGLSYVSDVPF  120

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
             IILDMFNLRSI++DI      E+AWVQAGATLGE+YYRI EKS+VHGFP GVCPT+GVGG
Sbjct  121   IILDMFNLRSINIDIED----ESAWVQAGATLGEVYYRIAEKSNVHGFPAGVCPTLGVGG  176

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H SGGGYGNM+R++GL+VD++VDA+I+DV+GR+LDR +MGEDLFWAI GGG  SFGVIL+
Sbjct  177   HFSGGGYGNMMRKYGLSVDNIVDAQIIDVRGRILDRKSMGEDLFWAIRGGGAASFGVILS  236

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTAS-KIDDHLFIRLLLQIVPPPTK  946
             +KIKL+ VP+ VT F  ++   L    +D+  ++   A+ K+D+ +FIRL+LQ V     
Sbjct  237   WKIKLVPVPEIVTVFSVDR--TLEEGVSDLAWKWQQIAADKLDNDIFIRLMLQPV-----  289

Query  945   TNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNG  766
                   KT+++S+V +FLG +E+LLS++N  FP LGL+ +DC+E+ WIES+L W    +G
Sbjct  290   NGTQGKKTIQASFVAMFLGRAERLLSVMNESFPELGLQAKDCAEIRWIESVLFWVGMPHG  349

Query  765   TKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAE  586
             T  E LL+R P G  ++LKRKSDY++ PI K  L+S+WK M E+G   +  NPYGG+M+E
Sbjct  350   TPIEVLLDRIPKG-VNYLKRKSDYVKEPISKEGLESIWKVMAEVGEVAMLWNPYGGKMSE  408

Query  585   IPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLN  406
             I   +T FPHRAG +FKIQY+V+WK+EG A    +++  R L   + P+VS+NPR+A+LN
Sbjct  409   ISEAETAFPHRAGNIFKIQYSVNWKQEGIATTNHYVNLTRTLFEAMTPYVSKNPREAFLN  468

Query  405   YRDLDIGTT-DHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YRD+DIG+    G  +++E  VYGHKYF  N++RLV++K+RVDPDNFFR EQSIP
Sbjct  469   YRDIDIGSIGSQGNGTFQEASVYGHKYFKDNFDRLVQIKTRVDPDNFFRYEQSIP  523



>ref|XP_004293691.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=536

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/519 (59%), Positives = 381/519 (73%), Gaps = 19/519 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD F+ CL+T      P    S IV    N SF+S L+AY RN RFNT S+PKPV+I+T
Sbjct  30    LYDDFVQCLNT-----HPNSSASQIVIPQNNPSFTSTLRAYIRNARFNTTSTPKPVLILT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS-DATFIILDMFNLRSIDVDIAGG  1429
             P  ESHV   VLCAKKL V++++RSGGHDYEG SYVS + TF++LD+FN RSIDV+   G
Sbjct  85    PTTESHVQASVLCAKKLNVQLKIRSGGHDYEGRSYVSTEPTFVVLDLFNFRSIDVNAEAG  144

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                  AW QAGATLGELYYRI EKS   GFP G+CPTVGVGGHVSGGGYGN++R++GL V
Sbjct  145   ----YAWAQAGATLGELYYRIAEKSKTLGFPAGICPTVGVGGHVSGGGYGNLLRKYGLAV  200

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DA IVDV G++LDR  MGEDLFWAI GGGGGSFGVIL++K+KL+ VP+TVT FR  
Sbjct  201   DNVLDALIVDVNGKLLDRKTMGEDLFWAIRGGGGGSFGVILSYKLKLVPVPETVTVFRVM  260

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
              Y     N  DVV ++   A    D L++R+L+Q V  PTK     +KTVR S +  +LG
Sbjct  261   SYT--ESNATDVVLRWQEVAPSTVDDLWMRMLVQPVTSPTK---KGTKTVRISVLAQYLG  315

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW--GSFGNGTKPEALLNRTPAGDASF  715
             ++ +L+SIL  +FP L LKK+DC E+SWIES++ W  GS  N TKPE LL+R     ASF
Sbjct  316   NANQLVSILGKEFPELSLKKEDCLEVSWIESVVWWNDGSTPNTTKPEVLLDRN-LDQASF  374

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
              KRKSDY+Q PI +  L+SLW KM+E G TGL  NPYGG+MA+IP++  PFPHR G LFK
Sbjct  375   GKRKSDYVQTPISREGLESLWNKMIE-GKTGLVFNPYGGKMAQIPASDAPFPHRTGNLFK  433

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+V+W + GE A   +++Q R L+SF+ PFVS+NPR A+LNYRDLDIG  D G  SYE
Sbjct  434   IQYSVNWDDGGEEAINMYLNQSRVLYSFMTPFVSKNPRSAFLNYRDLDIGVNDFGKDSYE  493

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +GKVYG  YF  N++RLVKVK+ VDP+NFFRNEQSIP L
Sbjct  494   QGKVYGLMYFNDNFDRLVKVKTAVDPENFFRNEQSIPPL  532



>ref|XP_010051867.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=553

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/546 (54%), Positives = 396/546 (73%), Gaps = 19/546 (3%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLTSCFSGTIPMY--DSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             +S  ++L FL +  L    FS     +  +S   CL   S    P   ++S +Y+P  +S
Sbjct  24    NSKTLYLFFLIV--LFIGSFSSPSKAFANESLTQCLINHSQ---PSHPITSAIYTPNKSS  78

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             +S+VLQ+Y RN RFNT  +PKP +I+T LHESHV   ++CA+KL V++++RSGGHDYEGI
Sbjct  79    YSNVLQSYIRNLRFNTSDTPKPTLILTALHESHVQAAIVCAQKLSVQMKIRSGGHDYEGI  138

Query  1506  SYVS-DATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             SYVS  + F ILDMFNLRS+DVDI      E AWVQAGATLGE+YY I  KS VHGFP G
Sbjct  139   SYVSISSPFFILDMFNLRSVDVDIEA----EMAWVQAGATLGEVYYGIAAKSKVHGFPAG  194

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
             VCPTVGVGGH SGGGYGNM+R++GLTVD++VDARI++V G +LDR +MGEDLFWAI GGG
Sbjct  195   VCPTVGVGGHFSGGGYGNMMRKYGLTVDNIVDARIINVNGEILDRESMGEDLFWAIRGGG  254

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGV+LA+KI L+RVP+TVT F   +     +N  +VV ++   A ++ + LFIRL +
Sbjct  255   GASFGVVLAYKINLVRVPQTVTVFSVPR--TWEQNATEVVYKWEQVAPQLHEDLFIRLTM  312

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
              +V        +  KT+R++++ LFLGD+++LLS++++ FP LGL+  DC EMSW+ES L
Sbjct  313   DVV----NGTKAGEKTIRATFIALFLGDAQRLLSLMSNSFPELGLRSSDCIEMSWVESTL  368

Query  789   RWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVN  610
              W +F  GT  +ALL+RTP    + LKRKSDY++  IPK  L+ +W++M+EL    L  N
Sbjct  369   FWTNFPIGTPADALLSRTPQ-VLTHLKRKSDYVKQIIPKDGLELIWRRMIELERPMLTFN  427

Query  609   PYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSR  430
             PYGG+M EIP+T TPFPHRAG L+K+QYA +W E G+ A R +I   R+L+ ++ PFVS+
Sbjct  428   PYGGKMGEIPATNTPFPHRAGNLWKVQYATNWDENGDEAARHYIELTRKLYRYMTPFVSK  487

Query  429   NPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             NPR+A+LNYRDLD+G   +G  SYEEG+VYG KYF GN+ RLV++K++VDP NFFRNEQS
Sbjct  488   NPREAFLNYRDLDLGINHNGDESYEEGRVYGVKYFKGNFNRLVEIKTKVDPGNFFRNEQS  547

Query  249   IPSLSR  232
             IP L +
Sbjct  548   IPVLPQ  553



>ref|XP_007033584.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
 gb|EOY04510.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
Length=539

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/544 (56%), Positives = 393/544 (72%), Gaps = 15/544 (3%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLTSCFSGTIPM-YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             SPV +V      LL+  +  T+ +  +SFL CL   S    P   +S+ +Y+P ++S+SS
Sbjct  5     SPVVVVTTLSTILLSILWRATLDLPQESFLQCLLENSLRSHP---ISAAIYTPQSSSYSS  61

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL++Y RN RFN  S+PKP +I+T  HESH+   VLCAKK   ++++RSGGHDYEG+SYV
Sbjct  62    VLESYIRNLRFNETSTPKPFLILTASHESHIQAAVLCAKKQDFQMKIRSGGHDYEGLSYV  121

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             S   F ILDMFNLRS+DVDI    G ETAWVQ GATLGE+YYRI E+S++HGFP GVCPT
Sbjct  122   SSVPFFILDMFNLRSVDVDI----GNETAWVQTGATLGEVYYRIAERSNIHGFPAGVCPT  177

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SG GYGNM+R++G++ D+++DA+ +D  GR+ DR +MGEDLFWAI GGGG SF
Sbjct  178   VGVGGHLSGAGYGNMMRKYGVSADNIIDAQFIDADGRLHDRKSMGEDLFWAIRGGGGASF  237

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GVILA+KI L+RVP+ VT F+ EK   L  N  D V Q+ + A K+ + LFIRL L +V 
Sbjct  238   GVILAYKIMLVRVPQKVTSFQVEK--TLEENATDFVDQWQHVADKLPEELFIRLALDVV-  294

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
                  + S  KTVR+S++ LFLGDS+ LLSI+N  FP LGL K DC E SWI S+L W +
Sbjct  295   ---NRSQSGEKTVRASFISLFLGDSDTLLSIMNERFPKLGLSKSDCVETSWIRSVLFWAN  351

Query  777   FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
                 TK + LL+RTP    S LKRKSDY++ PIPK  L+ +WK+M+EL    +  NPYGG
Sbjct  352   IPIETKIDVLLDRTPQTLVS-LKRKSDYVKEPIPKAGLEGIWKRMIELQVPKMFFNPYGG  410

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
             +MAEIPST+ PFPHRAG L+KIQY  +W E G  A   H+   R+L+ ++ PFVS+NPR+
Sbjct  411   KMAEIPSTKIPFPHRAGNLWKIQYLANWNESGIEAANHHLGLTRKLYDYMTPFVSKNPRE  470

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             AYLNYRD+D+GT+ +G   Y EG+VYG +YF GN+ERLV++KS+VDP NFFRNEQSIP L
Sbjct  471   AYLNYRDVDLGTSYNGKPVYSEGRVYGIRYFKGNFERLVQIKSKVDPSNFFRNEQSIPVL  530

Query  237   SRNQ  226
                +
Sbjct  531   PHQE  534



>ref|XP_009362182.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=540

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/517 (57%), Positives = 387/517 (75%), Gaps = 13/517 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F+HCL   S    P   ++  +YSP NAS+SSVL++Y RN RFNT ++ KP +I+T L
Sbjct  32    ENFVHCLLNHSK---PSHPIAPAIYSPNNASYSSVLESYIRNLRFNTSTTRKPFLILTAL  88

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV++  F ILDMFNLRSI VDI      
Sbjct  89    HESHVQISVVCAQIHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKS----  144

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGELYYRI EKS +HGFP GV PTVGVGGH SGGGYGNM+R++GL+VD++
Sbjct  145   ETAWVQAGATLGELYYRIAEKSKIHGFPAGVRPTVGVGGHFSGGGYGNMMRKYGLSVDNI  204

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA++V+V G +LDR +MGEDLFWA+ GGGG SFGV++A+KI L+RVP+ VT FR  + L
Sbjct  205   VDAQLVNVHGELLDRKSMGEDLFWAVTGGGGASFGVVIAYKINLVRVPEIVTVFRVSRIL  264

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDS-NSKTVRSSYVGLFLGDS  883
                +N  D+V ++   A K+DD LFIRL + +V   +  N   N+KT+R+S++ +FLGDS
Sbjct  265   --EQNATDIVYRWQYIADKLDDDLFIRLTMDVVNGTSSNNSGGNNKTLRASFIAMFLGDS  322

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LLSI+N  FP LGLK+ DC+EMSW +S+L W SF  GT  EALL+RTP    + LKRK
Sbjct  323   ERLLSIMNKSFPELGLKQSDCAEMSWAQSVLFWTSFPTGTATEALLSRTPQV-LTRLKRK  381

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PIPK  L  +++KM+EL    L  NPYGG+M+EI ++ TPFPHRAG L+K+QYA
Sbjct  382   SDYVKKPIPKTGLKWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHRAGNLWKVQYA  441

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEEG  349
              +W   G  A   +I   R+LH ++ PFVS+NPR+A+ NY+DLDIG     +G+ SY EG
Sbjct  442   TNWDILGTKAADHYIELTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGISSYLEG  501

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  502   RVYGIKYFKHNFDRLVNVKTKVDPGNFFRNEQSIPTL  538



>ref|XP_010054196.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75700.1| hypothetical protein EUGRSUZ_D00074 [Eucalyptus grandis]
Length=536

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/540 (55%), Positives = 389/540 (72%), Gaps = 17/540 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMY--DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             L   +L  L    FS     +  +S   CL   S    P   ++S +Y+P  +S+S+VLQ
Sbjct  11    LYLFSLLVLFIGSFSSPSKAFANESLTQCLINHSQ---PSHPITSAIYTPNKSSYSNVLQ  67

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS-D  1492
             +Y RN RFNT  +PKP +I+T LHESHV   ++C +KL V++++RSGGHDYEGISYVS  
Sbjct  68    SYIRNLRFNTSDTPKPALILTALHESHVQAAIVCTQKLSVQMKIRSGGHDYEGISYVSIS  127

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
             + F ILDMFNLR +DVDI      ETAWVQAGATLGE+YY I  KS VHGFP GVCPT+G
Sbjct  128   SPFFILDMFNLRLVDVDIEA----ETAWVQAGATLGEVYYGIGAKSKVHGFPAGVCPTLG  183

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             VGGH SGGGYGNM+R++GL+VD++VDARI++V G +LDR +MGEDLFWAI GGGG SFGV
Sbjct  184   VGGHFSGGGYGNMMRKYGLSVDNIVDARIINVNGEILDRESMGEDLFWAIRGGGGASFGV  243

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             +LA+KI L+RVP+TVT F   +     RN  +VV ++   A K+ + LFIRL + +V   
Sbjct  244   VLAYKINLVRVPETVTVFSVPR--TWERNATEVVYKWEQVAPKLHEDLFIRLTMDVV---  298

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
                  +  KT+R+++  LFLGD+++LLS++++ FP LGL+  DC EMSW+ES+L W +F 
Sbjct  299   -NGTKAGEKTIRATFFALFLGDAQRLLSLMSNSFPELGLRSSDCIEMSWVESILFWTNFP  357

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
              GT   ALL+RTP    + LKRKSDY++  IPK  L+ +W++M+EL    L  NPYGG+M
Sbjct  358   IGTPANALLSRTPQ-VLTHLKRKSDYVKQIIPKDGLELIWRRMIELERPMLTFNPYGGKM  416

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
              EIP+T TPFPHRAG L+KIQYA +W E+G+ A R +I   R+LH ++ PFVS+NPR+A+
Sbjct  417   GEIPATNTPFPHRAGNLWKIQYATNWDEDGDEAARHYIKLTRKLHRYMTPFVSKNPREAF  476

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             LNYR LD+G   +G  SYEEG+VYG KYF GN+ RLV++K++VDP NFFRNEQSIP L +
Sbjct  477   LNYRHLDLGINHNGDESYEEGRVYGVKYFKGNFNRLVEIKTKVDPGNFFRNEQSIPVLPQ  536



>ref|XP_006448837.1| hypothetical protein CICLE_v10017768mg, partial [Citrus clementina]
 gb|ESR62077.1| hypothetical protein CICLE_v10017768mg, partial [Citrus clementina]
Length=504

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/513 (56%), Positives = 382/513 (74%), Gaps = 17/513 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++FL CLS  S + +    +S  +Y+ +NASFSSVLQ+Y RN RF T ++ KP++IV   
Sbjct  4     ENFLQCLSMQSQSSVA---ISEAIYTSSNASFSSVLQSYVRNLRFATPTTLKPLVIVAAK  60

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+C+KK G++IR+RSGGHDY+G+SYVS+  F+ILDMFNLRSI++ +      
Sbjct  61    HESHVQATVICSKKFGLQIRIRSGGHDYDGLSYVSNVPFVILDMFNLRSINISLTD----  116

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGAT+GE+YY+I E S +HGFP GVCPT+GVGGH SGGGYGNM+R+FGL+VD++
Sbjct  117   ETAWVQAGATVGEVYYKIAEASKIHGFPAGVCPTLGVGGHFSGGGYGNMMRKFGLSVDNI  176

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV+GR+LDR +MGEDLFWAI GGG  SF VIL++KIKL++VP+TVT FR  K  
Sbjct  177   VDAQIVDVQGRILDRKSMGEDLFWAIRGGGAASFCVILSWKIKLVQVPETVTVFRVVK--  234

Query  1059  GLTRNFNDVVSQYFNTAS-KIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
              L +   D+V+++   A+ K+D  LFIRL++  V      +    KTV+ S+V +FLG +
Sbjct  235   TLEQGATDLVAKWQQVAADKLDQDLFIRLIINAV----NGSKDGEKTVKVSFVAMFLGQT  290

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             EKLLS++   FP LG++K+DC EM W+ES L W S   GT  E LLNR P    S LKRK
Sbjct  291   EKLLSLMKQSFPELGIQKKDCFEMRWVESALFWFSQPTGTPVEVLLNRIPKSQVS-LKRK  349

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY+Q PIPK  L+S+WK M+ELG  G+  NPYGG M+EIP+T+TPFPHRAG +FKIQY+
Sbjct  350   SDYVQEPIPKTGLESIWKLMIELGEVGMQWNPYGGIMSEIPATETPFPHRAGNIFKIQYS  409

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W + G      +++  R  +  + P+VS+NPR+A+LNYRD+DIG+  +G  +YEEGK+
Sbjct  410   ANWNQPGIEVTNRYLNLTRTFYEAMTPYVSKNPREAFLNYRDIDIGSNTNG--TYEEGKI  467

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YG KYF  N++RLV+VK+ VDPDNFF  EQSIP
Sbjct  468   YGIKYFKNNFDRLVRVKTSVDPDNFFTYEQSIP  500



>ref|XP_007147438.1| hypothetical protein PHAVU_006G124600g [Phaseolus vulgaris]
 gb|ESW19432.1| hypothetical protein PHAVU_006G124600g [Phaseolus vulgaris]
Length=540

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/538 (54%), Positives = 398/538 (74%), Gaps = 14/538 (3%)
 Frame = -3

Query  1851  PVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
             P+F + + L  L T   S     +++FLHCL   S    P   ++S +++P NASFSSVL
Sbjct  12    PIFSI-VGLVLLSTIACSAANSAHNTFLHCLVNHSE---PSHPITSAIFTPNNASFSSVL  67

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
             +AY RN RFNT ++ KP +IVT LH SH+   ++CA+K  +++++RSGGHDY+G+SYV++
Sbjct  68    EAYVRNLRFNTSTTRKPFLIVTALHVSHIQASIICAQKYNLQMKIRSGGHDYDGLSYVAE  127

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               F ILDMF LR+I+VDI      ETAWVQAGAT+GE++Y+I  KS +H FP G+CPTVG
Sbjct  128   VPFFILDMFKLRTIEVDIHT----ETAWVQAGATVGEVFYKIANKSKIHAFPAGICPTVG  183

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             +GGH+SGG YGN++R++GL+VD++VDA++VDV+GR+LDR +MGEDLFWAI GGGG SFGV
Sbjct  184   IGGHLSGGSYGNLMRKYGLSVDNIVDAQMVDVQGRLLDRKSMGEDLFWAITGGGGSSFGV  243

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             +LA+KIKL+RVP+TVT F  ++   L +N  D+V ++ + A  ID+ LFIRL+L +V   
Sbjct  244   VLAYKIKLVRVPETVTVFNVQR--TLEQNATDIVYKWQHVAPTIDNDLFIRLVLDVVNG-  300

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
             TKT    +KTVR+S+V LFLGDS+ L+S+LN  FP LGLK+ DC E SW+ S+L W +  
Sbjct  301   TKTG---TKTVRASFVALFLGDSKSLVSLLNEKFPQLGLKQSDCIETSWLRSVLFWTNIN  357

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
                  E LL+R P    +FLKRKSDY+Q PI K   + +WKKM+EL +T    NPYGGRM
Sbjct  358   ITAPLEILLDRQPQSPVNFLKRKSDYVQKPISKDGFEGIWKKMIELEDTLFQFNPYGGRM  417

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
             AEIPST TPFPHRAG L+K+QY  +W++ G+     +I+  R+LH ++ PFVS+NPR+A+
Sbjct  418   AEIPSTATPFPHRAGNLWKLQYQANWRQAGKEVTNHYINLTRKLHKYMTPFVSKNPREAF  477

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              NY+DLD+G   +G  SY EGKVYG +YF  N++RLV++K++VDP NFFRNEQSIP+L
Sbjct  478   YNYKDLDLGINHNGKKSYAEGKVYGVEYFKDNFDRLVEIKTKVDPHNFFRNEQSIPTL  535



>ref|XP_007158994.1| hypothetical protein PHAVU_002G199200g [Phaseolus vulgaris]
 gb|ESW30988.1| hypothetical protein PHAVU_002G199200g [Phaseolus vulgaris]
Length=566

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/541 (55%), Positives = 392/541 (72%), Gaps = 17/541 (3%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLT--SCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             +P+ L FL++  LL   S    T  +Y +FLHCL + ++ P   D VS+IVYS  NAS++
Sbjct  28    NPISLPFLSVIVLLLHLSNSQPTTSIYHTFLHCLQSHTSQP---DHVSNIVYSQTNASYT  84

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
             SVL+A+ARN RF + S  KP++++TPL E HV   V+CAK + V++++RSGGHD+EG+SY
Sbjct  85    SVLEAFARNARFTSPSIQKPLLVLTPLSEHHVQASVVCAKSMDVQLKIRSGGHDFEGVSY  144

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VS   F+ILDM N +++ VD+      E A +QAGA+LG++YYRIWEKS VHGFP G CP
Sbjct  145   VSQGPFVILDMLNFQNVTVDVQN----EIAVIQAGASLGQVYYRIWEKSKVHGFPAGACP  200

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVGVGGH+SGGGYGNMIR++GL+VDHVVDA+IVDV+GRVLD+  MGEDLFWAI GGGG S
Sbjct  201   TVGVGGHLSGGGYGNMIRKYGLSVDHVVDAKIVDVRGRVLDKATMGEDLFWAIRGGGGAS  260

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVIL++ +KL+ VP  VT F+ +K   L +N  D+V ++   A   DD LF+RL+LQ  
Sbjct  261   FGVILSYTVKLVAVPDRVTVFQVDK--TLEQNATDLVVEWQQVAPHTDDRLFLRLVLQ--  316

Query  960   PPPTKTND-SNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
               P  +N     KT+R+S   LFLG++ +L+ +L  +FP LGLKK+ C EM WI+S++ W
Sbjct  317   --PVGSNVVKGQKTIRASVEALFLGEANELVPLLGKEFPLLGLKKELCHEMRWIDSVIWW  374

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              ++ +G+    LL+R      S  KRKSDY+Q PI +  L  +WKKM+ELG   LA  PY
Sbjct  375   VNYSDGSSLNPLLDRNHYSVNSN-KRKSDYVQIPISRKGLTWIWKKMIELGKVELAFIPY  433

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+M E+PS  TPFPHRAG L+KIQY VSW+E G  A+ + +SQIR LH+++ PFVS+NP
Sbjct  434   GGKMNEVPSNATPFPHRAGNLYKIQYTVSWQEPGAEAEEKFLSQIRMLHNYMTPFVSKNP  493

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AY NYRDLDIG   HG  +Y++GK+Y  KYF  N+ERLVKVKS +DP+NFF NEQSIP
Sbjct  494   RSAYFNYRDLDIGINSHGKDNYQDGKIYSMKYFKKNFERLVKVKSEIDPENFFWNEQSIP  553

Query  243   S  241
             S
Sbjct  554   S  554



>ref|XP_008225669.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=531

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 389/541 (72%), Gaps = 26/541 (5%)
 Frame = -3

Query  1839  VFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYA  1660
             VF   C +  SC + +   Y+ FL CLS  S    P   +S  +Y+  +ASFSSVLQ+Y 
Sbjct  13    VFSIFCVISVSCTNSSSVEYN-FLQCLSKHSQRSNP---ISEAIYTSKSASFSSVLQSYV  68

Query  1659  RNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT--  1486
             RN RF + ++PKP++IV   HESHVP  V+CAK LG+EIR+RSGGHDYEG+SYVS  T  
Sbjct  69    RNLRFISPTTPKPLLIVAAKHESHVPATVICAKSLGLEIRIRSGGHDYEGVSYVSRNTKD  128

Query  1485  FIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvg  1306
             FI+LDMFNLRSI++D+A     E+AWVQ+GA LGE++Y I+ KS  H FP GVCP++G G
Sbjct  129   FIVLDMFNLRSINIDMAD----ESAWVQSGAILGEIFYAIYMKSKNHAFPAGVCPSIGAG  184

Query  1305  ghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVIL  1126
             GH +GGGYGNM+R++GL+ D++VDA+IV+V G++LDR AMGEDLFWAI GGGG SFGVIL
Sbjct  185   GHFTGGGYGNMMRKYGLSTDNIVDAKIVNVNGKILDRKAMGEDLFWAIRGGGGSSFGVIL  244

Query  1125  AFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTK  946
             ++KIK + VP TVT F  ++ L   +   +++ ++   A K+D  LFIR    I+ P   
Sbjct  245   SWKIKFVWVPATVTVFEVKRTLA--QGATEILVKWQQVADKLDHDLFIR---AIIKPA--  297

Query  945   TNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNG  766
                  + T+  S++ LFLG+SE+LL +++  FP LGL+K DC EMSWI+S+L W ++ NG
Sbjct  298   -----NGTIEVSFMSLFLGNSERLLKLMSQSFPQLGLQKTDCHEMSWIQSVLYWTNYQNG  352

Query  765   T-KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             T  PE LLNR P G   FLKRKSDY++ PI K  L++LWK M+E+G   +  NPYGG+M+
Sbjct  353   TTSPEVLLNRVPKGQV-FLKRKSDYVKEPISKTDLEALWKVMIEIGEVTMLWNPYGGKMS  411

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI  T TPFPHRAG LFKIQY+V+WKEEG  + + ++S +++L+  + P VS+NPR A+ 
Sbjct  412   EILETATPFPHRAGTLFKIQYSVNWKEEGFESTKRYLSLMKKLYVAMTPHVSKNPRMAFY  471

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRN  229
             NYRDLDIGT   G   Y+E KVYG KYF  N+ERLV++K+ VDP+NFFRNEQSIP+L   
Sbjct  472   NYRDLDIGTNSKG--GYDEAKVYGTKYFKCNFERLVRIKTEVDPENFFRNEQSIPTLPSK  529

Query  228   Q  226
             Q
Sbjct  530   Q  530



>ref|XP_003534766.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=533

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/543 (56%), Positives = 389/543 (72%), Gaps = 26/543 (5%)
 Frame = -3

Query  1851  PVFLVFLALCNLL---TSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             P  L +L+   LL   ++  S    ++ +FL CL+  + N   +  +S IV++  N  F 
Sbjct  4     PNSLAYLSATFLLLTVSTLVSAHSSLHHTFLQCLTHHTKNCSTQ--LSDIVFANTNPKFP  61

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
             +VLQ Y RN RFNT S+PKP++IVTPL ESHV   V+CAK + V++++RSGGHDYEGISY
Sbjct  62    TVLQNYIRNARFNTSSTPKPLLIVTPLTESHVQAAVICAKTVNVQLKIRSGGHDYEGISY  121

Query  1500  VSDA-TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             +S    FI+LDMFNLR I VDI      E A VQAGA +GE+YYRIW+KS VHGF   VC
Sbjct  122   ISKKHPFIVLDMFNLRKIKVDIKN----EVAVVQAGAVMGEVYYRIWKKSKVHGFSAAVC  177

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH+SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG 
Sbjct  178   PTVGVGGHISGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGA  237

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVI++F IKLL VPKTVT FR E+   L +N  D+V Q+   A   D  LF+RLLLQ 
Sbjct  238   SFGVIVSFTIKLLPVPKTVTVFRVER--TLEQNATDLVLQWQQVAPTTDPGLFLRLLLQ-  294

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                         KTV +S V LFLG +++L+SIL  +FP LGLKK+ C+EM WI+S+L +
Sbjct  295   ---------PEGKTVTASVVALFLGGAKELVSILEKEFPLLGLKKESCTEMRWIDSVLWF  345

Query  783   ---GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
                 S  NG KPE LL+R     A FLKRKSDY+Q  IP+  L+ ++K+M++LG  GL  
Sbjct  346   YDDKSLKNGAKPETLLDRH-VNTAFFLKRKSDYVQKAIPREGLECIFKRMIKLGKIGLVF  404

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGGRMAEIPS  TPFPHR G LFKIQY+V+W +    A +   +Q ++L++++ PFVS
Sbjct  405   NPYGGRMAEIPSDATPFPHRKGNLFKIQYSVNWFDPSVGAAKNFTNQAKKLYNYMTPFVS  464

Query  432   RNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQ  253
             +NPR A+LNYRDLDIG    G +S++EG+VYG KYF  N++RLVKVK++VDPDNFFRNEQ
Sbjct  465   KNPRSAFLNYRDLDIGVNRFGKNSFQEGEVYGAKYFNNNFQRLVKVKTKVDPDNFFRNEQ  524

Query  252   SIP  244
             SIP
Sbjct  525   SIP  527



>ref|XP_004295439.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=534

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/544 (53%), Positives = 394/544 (72%), Gaps = 21/544 (4%)
 Frame = -3

Query  1851  PVFLVFLALCNLL-----TSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             P+ L  +++ ++L      S  + +  +  +FL CLS  S +  P   +S +VY+  NA+
Sbjct  3     PLVLAMISVFSILGVISPVSYATNSSSVETTFLQCLSNHSQSSSP---ISEVVYTSKNAN  59

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             FSSVLQ+Y RN RF+T ++PKP++IV   + SHV   V+CAK++G+EIR+RSGGHDYEG+
Sbjct  60    FSSVLQSYVRNLRFSTPTTPKPLLIVAAKNYSHVQATVVCAKRVGLEIRIRSGGHDYEGL  119

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggv  1327
             SYVS   FI+LDMFNLRSI++D+A     E+AWVQ+GATLGE+YY I  KS VHGFP GV
Sbjct  120   SYVSSKPFIVLDMFNLRSINIDLAD----ESAWVQSGATLGEIYYAISTKSKVHGFPAGV  175

Query  1326  cptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgggg  1147
             C T+G GGH +GGGYGNM+R++GL+VD++VD +IV+V G +LDR +MGEDLFWAI GGG 
Sbjct  176   CLTLGAGGHFTGGGYGNMMRKYGLSVDNIVDVQIVNVNGEILDRKSMGEDLFWAIRGGGA  235

Query  1146  GSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ  967
              SFGVILA+KIKL++VP+ VT F+ ++   L +   D+V Q+   A  ID+ LFIR++L 
Sbjct  236   ASFGVILAWKIKLVKVPEKVTVFQVDR--TLEQGATDIVVQWQKVADNIDNDLFIRVML-  292

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
                 P   +    KT++ ++V LFLGDS +LL +LN   P LGL+++DC EMSWIES+L 
Sbjct  293   ---APGNGSREGEKTIKVTFVSLFLGDSARLLRLLNQSLPQLGLQQKDCIEMSWIESILF  349

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W  + NGT  + LL+R P G   +LKRKSDY+Q PI K  +++LWK M+E+G+ G+  NP
Sbjct  350   WAGYPNGTSLDVLLSRVPMG-MIYLKRKSDYVQEPISKTDMEALWKVMIEIGDGGMLWNP  408

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M+EIP T+TPFPHRAG +FKIQY+ +W +        +++   +LH  + P VS+N
Sbjct  409   YGGKMSEIPDTETPFPHRAGNIFKIQYSFNWIDGRLETTNRYLNLTTKLHEAMTPHVSKN  468

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR+A+LNYRD+DIGT   G   Y+E +VYG KYF  N+ERLV+ K++VDPDNFFRNEQSI
Sbjct  469   PREAFLNYRDIDIGTNTKG--DYKEAEVYGVKYFKHNFERLVQTKTKVDPDNFFRNEQSI  526

Query  246   PSLS  235
             P+L+
Sbjct  527   PTLA  530



>ref|XP_006413851.1| hypothetical protein EUTSA_v10027426mg [Eutrema salsugineum]
 gb|ESQ55304.1| hypothetical protein EUTSA_v10027426mg [Eutrema salsugineum]
Length=538

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/518 (57%), Positives = 387/518 (75%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SF+ C S  + +P  +  ++  V+S  N S+SSVL+AY RN RFNT S+PKP IIVT
Sbjct  33    VYESFVQCFSDKTKSP--QTQITQKVFSQTNPSYSSVLRAYIRNARFNTSSTPKPTIIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  +SHV   V+C+K L   +++RSGGHDY+G+SY+SD  F ILDM NLR + VDIA   
Sbjct  91    PRSDSHVSAAVICSKPLNFVLKIRSGGHDYDGLSYISDKPFFILDMSNLREVSVDIAD--  148

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AW+ AGATLGE+YYRIWEKS +HGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD
Sbjct  149   --QSAWISAGATLGEVYYRIWEKSKIHGFPAGVCPTVGVGGHLSGGGYGNMVRKFGLSVD  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDVKG++LDR +MGEDLFWAI GGGG SFGV+L +K+KL+ VP TVT FR E+
Sbjct  207   YVEDAKIVDVKGQILDRKSMGEDLFWAICGGGGASFGVVLGYKVKLVPVPDTVTVFRVEQ  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V LFLG 
Sbjct  267   YMDT--GAVDMVHKWQSVGPKTDPNLFMRMLIQ---PVTR---KKVKTVRASVVALFLGK  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             ++ ++S+L  DF  LGLKK++C+EM+WI+S L W +  N T+  P+ LL+R     ASF 
Sbjct  319   ADDVVSLLAKDFQELGLKKENCTEMTWIQSALWWDNDENATQTDPKVLLDRN-LDSASFG  377

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  IP+  ++SL+KKM+ELG  GL  NPYGG+MAE+    TPFPHR   LFKI
Sbjct  378   KRKSDYVEAEIPRDGIESLFKKMIELGKIGLVFNPYGGKMAEVAVDATPFPHRKK-LFKI  436

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++  + Q + L+SF+  FVS+NPR AYLNYRD+DIG  DHG++SYEE
Sbjct  437   QYSVNWKESSPEIEKGFLDQAKVLYSFMTGFVSKNPRNAYLNYRDVDIGVNDHGVNSYEE  496

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLVKVK+ VDP+NFFRNEQSIP+L
Sbjct  497   GEVYGRKYFGANFDRLVKVKTAVDPENFFRNEQSIPTL  534



>ref|XP_006377911.1| hypothetical protein POPTR_0011s16160g [Populus trichocarpa]
 gb|ERP55708.1| hypothetical protein POPTR_0011s16160g [Populus trichocarpa]
Length=514

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/515 (57%), Positives = 376/515 (73%), Gaps = 15/515 (3%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             Y++F   L + S    P   +S  +Y+P N S+SS+LQAY RN RFNT ++PKP+ I+T 
Sbjct  9     YETFYLSLLSHSDPSYP---ISKAIYNPDNPSYSSILQAYIRNLRFNTSTTPKPLFILTA  65

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
             LHESHV   V CAKK G+++++RSGGHDYEG SYVSD  F ILDM NLRSIDVDI     
Sbjct  66    LHESHVQAAVFCAKKHGLQMKIRSGGHDYEGTSYVSDVPFFILDMCNLRSIDVDIEN---  122

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAWVQ GATLGE++Y I EKSS HGFP GVCPTVGVGGH++G GYGN++R++GL+VD+
Sbjct  123   -ETAWVQTGATLGEVFYSIAEKSSTHGFPAGVCPTVGVGGHLTGAGYGNLMRKYGLSVDN  181

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             + DA +VD +GR+LDR +MGEDLFWAI GGG  SFGV++++K+ L+RV + VT FR E+ 
Sbjct  182   ITDAILVDAEGRILDRKSMGEDLFWAIRGGGA-SFGVVVSYKLNLVRVAEVVTVFRVER-  239

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
               L  N  D+V Q+ + A KID+ LFIRLLL +V    K + S  KTVR+S++G FLGDS
Sbjct  240   -TLEENATDIVFQWQHVAHKIDEDLFIRLLLDVV----KDSPSGEKTVRASFIGFFLGDS  294

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LLSI    FP LGL K DC E SW+ES+L W  F  GT  + +L+RTP     +LKRK
Sbjct  295   ERLLSITAESFPELGLLKSDCIETSWLESILFWADFPVGTPIDVMLSRTPPS-LVYLKRK  353

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY+Q PI K  L+ +WKKM+EL    +  NPYGG+M+EI +  TPFPHRAG L+KIQY 
Sbjct  354   SDYVQEPISKDDLEGIWKKMIELEVPKMGFNPYGGKMSEISAAATPFPHRAGNLWKIQYQ  413

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
             ++W EEG  A   H+   R+L+ ++ PFVS+NPR A+LNY+DLD+G   HG  SY EG  
Sbjct  414   INWNEEGTEAVEYHLDLARQLYRYMTPFVSKNPRAAFLNYKDLDLGINHHGKASYIEGSA  473

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YG KYF GN++RLV++K++VDP NFFR+EQS+P+ 
Sbjct  474   YGIKYFKGNFKRLVQIKTKVDPGNFFRHEQSVPTF  508



>ref|XP_003546286.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN14295.1| Reticuline oxidase-like protein [Glycine soja]
Length=535

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/514 (55%), Positives = 383/514 (75%), Gaps = 14/514 (3%)
 Frame = -3

Query  1776  SFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLH  1597
             +FLHCL   S    P   ++S +++P N SFSSVL+AY RN RFNT ++ KP +I+T LH
Sbjct  32    TFLHCLVNHSE---PSHPITSAIFTPNNTSFSSVLEAYIRNLRFNTSTTRKPFLIITALH  88

Query  1596  ESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGE  1417
              SH+   ++CA+K  +++++RSGGHDYEG+SYV++  F ILDMFNLR+I+VDI    G E
Sbjct  89    VSHIQASIICAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRTIEVDI----GTE  144

Query  1416  TAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVV  1237
             TAWVQAGATLGE+YYRI EKS  H FP GVC TVGVGGH+SGGGYGNM+R++GL+VD+V+
Sbjct  145   TAWVQAGATLGEVYYRIAEKSKTHAFPAGVCHTVGVGGHISGGGYGNMMRKYGLSVDNVI  204

Query  1236  DARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLG  1057
             DA++VDV+GR+LDR +MGEDLFWAI GGGG SFGV+LA+KIKL+RVP+ VT F+  +   
Sbjct  205   DAQMVDVQGRLLDRKSMGEDLFWAITGGGGASFGVVLAYKIKLVRVPEIVTVFQVGR--T  262

Query  1056  LTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEK  877
             L +N  D+V  + + A  ID+ LF+R++L +V        + +KTVR+ ++ LFLGDS+ 
Sbjct  263   LEQNATDIVYNWQHVAPTIDNDLFLRVILDVV----NGTRNGTKTVRARFIALFLGDSKS  318

Query  876   LLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSD  697
             L+S+LN  FP LGLK+ DC E SW+ S+L W +    +  + LL R P    ++LKRKSD
Sbjct  319   LVSLLNDKFPQLGLKQSDCIETSWLRSVLFWDNIDIASSLDILLERQPRS-LNYLKRKSD  377

Query  696   YLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVS  517
             Y++ PI     + +WKKM+EL +T    NPYGGRMAEIPST +PFPHRAG L+KIQY  +
Sbjct  378   YVKKPISIEGFEGIWKKMIELEDTLFQFNPYGGRMAEIPSTASPFPHRAGNLWKIQYQAN  437

Query  516   WKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYG  337
             W + G+     +I+  R+LH F+ PFVS+NPR+A+ NY+DLD+G   +G +SY EG+VYG
Sbjct  438   WNKPGKEVADHYINLTRKLHKFMTPFVSKNPREAFYNYKDLDLGINHNGKNSYAEGRVYG  497

Query  336   HKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
              +YF  N++RLV++K++VDP NFFRNEQSIP+LS
Sbjct  498   VEYFKDNFDRLVQIKTKVDPHNFFRNEQSIPTLS  531



>ref|XP_007147450.1| hypothetical protein PHAVU_006G125700g [Phaseolus vulgaris]
 gb|ESW19444.1| hypothetical protein PHAVU_006G125700g [Phaseolus vulgaris]
Length=542

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/519 (59%), Positives = 386/519 (74%), Gaps = 14/519 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+FL CL+  + +      +S+IV++  N SF +VLQ Y RN RFNT  +PKP++IVT
Sbjct  31    IYDTFLQCLTQHTNSSTQ---LSNIVFAQTNPSFPTVLQNYIRNARFNTSQTPKPLLIVT  87

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL ESHV   V+CAK + V++++RSGGHDYEGISY+SD  FIILD+FNLR+I VDI    
Sbjct  88    PLQESHVQGAVICAKSVKVQLKIRSGGHDYEGISYISDEPFIILDLFNLRTITVDIKN--  145

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQAGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD
Sbjct  146   --EVAVVQAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHFSGGGYGNMLRKYGLSVD  203

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVDVKG +LDR +MGEDLFWAI GGGG SFGVIL+F IKL+ VP+TVT FR EK
Sbjct  204   NVIDAQIVDVKGNILDRKSMGEDLFWAIRGGGGASFGVILSFTIKLVPVPETVTVFRVEK  263

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
              L       D+V Q+   A   DD LF+RLLLQ   P +      +KTVR+S V LFLG 
Sbjct  264   TLETNVTATDLVLQWQQVAPNTDDRLFLRLLLQ---PVSSRVVKGTKTVRASVVALFLGG  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPAGDASF  715
             +++++SIL  +FP LGLKK+ C+E+SWI+S+L W    S  NG KPE LL+R     ASF
Sbjct  321   ADEVVSILEKEFPLLGLKKESCTEVSWIDSVLWWNDDESLINGDKPETLLDRN-VNSASF  379

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY+QN I +  L  +++KM+ELG TG   NPYGG+M EI    T FPHR G LFK
Sbjct  380   LKRKSDYVQNAISRDGLVWIFQKMIELGKTGFVFNPYGGKMGEISPDATAFPHRKGNLFK  439

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+V+W +    A +   +Q + L+S++ PFVS+NPR+A+LNYRDLDIG  + G +S+E
Sbjct  440   IQYSVNWDDPSAGAGQNFTNQAKRLYSYMTPFVSKNPRRAFLNYRDLDIGVNNFGKNSFE  499

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EG+VYG KYF  N++RLV +K++VDPDNFFRNEQS+P L
Sbjct  500   EGEVYGSKYFSENFKRLVNIKTKVDPDNFFRNEQSVPVL  538



>ref|XP_007217510.1| hypothetical protein PRUPE_ppa024922mg [Prunus persica]
 gb|EMJ18709.1| hypothetical protein PRUPE_ppa024922mg [Prunus persica]
Length=534

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/516 (58%), Positives = 373/516 (72%), Gaps = 37/516 (7%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +YD+FL CL+T + NP    L S+I+Y+  N S+SS L+AY RN RFNT S+PKPV+IVT
Sbjct  27    VYDNFLQCLNT-NTNPSSTQL-SNIIYAENNPSYSSALRAYIRNSRFNTTSTPKPVLIVT  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   V+CAK+LG+++R+RSGGHDYEG+SY SD TFI+LDMFNLR++ VDI    
Sbjct  85    PSASSHVQASVVCAKQLGIQLRIRSGGHDYEGLSYWSDQTFIVLDMFNLRTVTVDIVDS-  143

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                                   KS VHGFP G+CPTVG+GGH+SGGGYGNM+R+FGL VD
Sbjct  144   ---------------------SKSKVHGFPAGICPTVGIGGHISGGGYGNMLRKFGLAVD  182

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V+DA+IVD KGR+LDR AMGEDLFWAI GGGGGSFGVI+A+K+KL+ VP+TVT F+A +
Sbjct  183   NVLDAQIVDAKGRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLVPVPETVTVFQAAR  242

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N   VVS++   A   DD LF+RLLLQ            S TV+++ +  FLG+
Sbjct  243   --TLEENATKVVSRWQEVAPTTDDGLFMRLLLQ----------PGSNTVKATIMAEFLGN  290

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+S+L   FP LGLKK DC EMSWIES+L W ++ NGT P+ LL+R P   A+FLKR
Sbjct  291   ADQLVSLLGKQFPELGLKKDDCKEMSWIESVLWWANYDNGTSPDVLLDRNP-DHANFLKR  349

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q PI K  L+ +WKKM+E+G  GL  NPYGG M+ IP++ TPFPHRAG LFK+QY
Sbjct  350   KSDYVQTPISKSRLELVWKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGNLFKVQY  409

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             +VSW E G  A++ + +  R L  F+ PFVS+NPR A+LNYRDLDIG    G  SYE+GK
Sbjct  410   SVSWGEAGAEAEKNYTTDTRRLFRFMTPFVSKNPRSAFLNYRDLDIGVNKFGNRSYEQGK  469

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ERLVKVK+ VDP NFFRNEQSIP L
Sbjct  470   VYGLKYFNDNFERLVKVKTAVDPANFFRNEQSIPPL  505



>ref|XP_004504723.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=540

 Score =   536 bits (1381),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 285/516 (55%), Positives = 380/516 (74%), Gaps = 13/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +FL CL + +  P   D VS+IVY+  NAS++S+ +A+ RN RFNT S+ KP++IVT
Sbjct  34    IFVTFLQCLKSHTTQP---DQVSNIVYAQTNASYTSIFEAFVRNARFNTPSTTKPLLIVT  90

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PLHE+ V   ++C+K +G+ +++RSGGHD+EGISY+S+  F+ILDMFN ++I VDI    
Sbjct  91    PLHENQVQATIVCSKTIGLHLKIRSGGHDFEGISYISEVPFVILDMFNFQNITVDIQN--  148

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A +Q GA+LG++YYRIWEKS VHGFP GVC TVGVGGH+SGGGYGNM+R+FGL++D
Sbjct  149   --EIAVIQTGASLGQVYYRIWEKSKVHGFPAGVCSTVGVGGHLSGGGYGNMMRKFGLSID  206

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +VVDA+IVDV GRVLD+ +MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ V  F+ +K
Sbjct  207   NVVDAKIVDVNGRVLDKNSMGEDLFWAIRGGGGASFGVILSYTVKLVSVPEKVAVFQVDK  266

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V Q+   A   DD LF+RL+LQ   P +       KT+R+S+  LFLG 
Sbjct  267   --TLDQNATDLVFQWQQVAPHTDDRLFMRLVLQ---PVSSKTLKGQKTIRASFQALFLGG  321

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+++L  +FP LGLKK+ C EMSWIES+  W +F +G+   ALL R      S  KR
Sbjct  322   ADELVTLLEKEFPLLGLKKETCKEMSWIESVFWWANFNDGSSLNALLERNHYKVHS-SKR  380

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+Q+PIPK  L  + KKM+ELG   L  NPYGG+M E+    TPFPHRAG L+KIQY
Sbjct  381   KSDYVQSPIPKDGLKWILKKMVELGKVELVFNPYGGKMNEVAFDATPFPHRAGYLYKIQY  440

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
              VSW+E+G+  ++  +SQIR L+S++ PFVS+NPR AY+NYRDLDIG   HG   Y +G 
Sbjct  441   TVSWEEKGDDVEKSLLSQIRMLYSYMTPFVSKNPRSAYVNYRDLDIGINRHGKDDYNDGV  500

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VY  KYF  N+ERLV VK++VDP+NFF NEQSIP+L
Sbjct  501   VYSIKYFNKNFERLVNVKTKVDPENFFWNEQSIPTL  536



>ref|XP_010449155.1| PREDICTED: reticuline oxidase-like protein isoform X3 [Camelina 
sativa]
Length=539

 Score =   536 bits (1381),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 396/542 (73%), Gaps = 21/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG---TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             V  V L L +L  S F+    +  +Y+SF+ C S  + +P  +  ++  V+S +N S++S
Sbjct  10    VLCVVLFLVSLPFSTFAAPPSSDSIYESFVQCFSDKTKSP--QTQITDNVFSHSNPSYTS  67

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFNT S+PKP IIVTP  ESHV   V+C+K     +++RSGGHDYEG+SY+
Sbjct  68    VLRAYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKTQNFLVKIRSGGHDYEGLSYI  127

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDM NLR + V+IA     ++AW+ AGATLGE+Y+ IWEKS VHGFP GVCPT
Sbjct  128   SDKPFFILDMSNLRDVTVNIAD----QSAWISAGATLGEVYHGIWEKSKVHGFPAGVCPT  183

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLFWAI+GGGG SF
Sbjct  184   VGVGGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLFWAISGGGGASF  243

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L +K+KL+ VPKTVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   
Sbjct  244   GVVLGYKVKLVPVPKTVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPSLFMRMLIQ---  298

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+      KTVR+S V LFLG +++++++L  +FP LGLKK+DC EM+WI+S+L W +
Sbjct  299   PVTR---KKVKTVRASVVALFLGRADEVVALLRKEFPELGLKKKDCQEMTWIQSVLWWDN  355

Query  777   FGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N TK  P+ LL+R     ASF KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPY
Sbjct  356   NENATKTNPKVLLDRE-LDTASFGKRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPY  414

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+MAE+    TPFPHR   LFKIQY+V+WKE     ++ +++Q + L+ F+  FVS+ P
Sbjct  415   GGKMAEVAVDATPFPHRKK-LFKIQYSVNWKENSPEIEKGYLNQAKVLYRFMTGFVSKKP  473

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AYLNYRD+DIG  DHG +SY+EGKVYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  474   RSAYLNYRDVDIGVNDHGKNSYKEGKVYGKKYFGVNFDRLVKIKTAVDPENFFRNEQSIP  533

Query  243   SL  238
             +L
Sbjct  534   TL  535



>ref|XP_004134894.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=526

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 290/541 (54%), Positives = 396/541 (73%), Gaps = 18/541 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
              SSS +FL F +L  + +   S ++    SFL CLST S    P   +S  +++P N+SF
Sbjct  3     FSSSSIFLTFFSLTFIFSPLLS-SVSAQQSFLQCLSTTSQPQFP---ISDAIFTPNNSSF  58

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
              +VL +Y RN RF   ++PKP+ IVT  H SHV   V+CAK++G++IR+RSGGHDYEG+S
Sbjct  59    LTVLNSYIRNLRFQNPTTPKPLFIVTAKHYSHVQSTVVCAKRVGLQIRIRSGGHDYEGLS  118

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YVS   F+ILD+FNLR+I+VDI      +TAWV++GATLGELYY I +KS++HGFPGGVC
Sbjct  119   YVSQQPFVILDLFNLRAINVDIPS----QTAWVESGATLGELYYAIAKKSNLHGFPGGVC  174

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVG GGH SGGGYGN+IR+FGLTVD+++DA+IV+  G++L+R  MGEDLFWAI GGGGG
Sbjct  175   PTVGTGGHFSGGGYGNLIRKFGLTVDNILDAQIVNADGKILNRQTMGEDLFWAIRGGGGG  234

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL++KI L++VP TVT F  ++   +     DVV ++     K+D++LFIRL+L  
Sbjct  235   SFGVILSWKISLVQVPSTVTVFDVDR--KIEDGATDVVFEWQQVMDKLDENLFIRLMLH-  291

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                 +   ++  KT +++ V LFLG  EK++ I+N + P+L L+KQ+C EMSWI+S+L W
Sbjct  292   ----SSKGENGQKTGKATLVALFLGPVEKVMDIMNQNIPSLKLQKQECFEMSWIQSVLFW  347

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              +F +GT PEALL+R  A    +LKRKSDY++ PI +  ++++WK ++++   GL  NPY
Sbjct  348   ANFPSGTAPEALLSRQMAS-TPYLKRKSDYVREPISREGVEAIWKALMDVEEVGLTWNPY  406

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM+EI  T TPFPHRAGV FKIQY+ +WKE G+    E I+  R+L+  + PFVS+NP
Sbjct  407   GGRMSEISETATPFPHRAGVKFKIQYSSNWKEAGDTEAEEEIALSRKLYEAMTPFVSKNP  466

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R+A+LNYRD+DIG++     S EEG+VYG +YF GN+ERLV VK++VDP NFFRNEQSIP
Sbjct  467   REAFLNYRDIDIGSSR--TWSLEEGRVYGERYFKGNFERLVNVKTKVDPQNFFRNEQSIP  524

Query  243   S  241
             +
Sbjct  525   T  525



>ref|XP_011006011.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=514

 Score =   534 bits (1376),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 290/515 (56%), Positives = 375/515 (73%), Gaps = 15/515 (3%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             Y++F   L + S    P   +S  +Y+P N S+SS+LQAY RN RFNT ++PKP+ I+T 
Sbjct  9     YETFYLTLLSHSDPSYP---ISKAIYNPDNPSYSSILQAYIRNLRFNTSTTPKPLFILTA  65

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
             LHESHV   V  AKK G+++++RSGGHDYEG SYVSD  F ILDM NLRSIDVDI     
Sbjct  66    LHESHVQAAVFWAKKHGLQMKIRSGGHDYEGKSYVSDVPFFILDMCNLRSIDVDIEN---  122

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAWVQAGATLGE++Y I EKSS HG P GVCPTVGVGGH+ G GYGN++R++GL+VD+
Sbjct  123   -ETAWVQAGATLGEVFYSIAEKSSTHGCPAGVCPTVGVGGHLIGAGYGNLMRKYGLSVDN  181

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             + DA +VD +GR+L R +MGEDLFWAI GGG  SFGV++++KI L+RV + VT FR E+ 
Sbjct  182   ITDAILVDAEGRILHRKSMGEDLFWAIRGGGA-SFGVVVSYKINLVRVTEVVTVFRVER-  239

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
               L  N  D++ Q+ + A KI + LFIRLLL +V    K + S  KTVR+S++G FLGDS
Sbjct  240   -TLKENATDIMYQWQHVAHKIHEDLFIRLLLDVV----KDSPSGEKTVRASFIGFFLGDS  294

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LLSI    FP LGL K DC E SW+ES+L W  F  GT  + +L+RTP     +LKRK
Sbjct  295   ERLLSITAESFPELGLLKSDCIETSWLESILFWADFPVGTPIDVMLSRTPP-SLVYLKRK  353

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY+Q PI K  L+++WKKM+EL    +  NPYGG+M+EI +  TPFPHRAG L+KIQY 
Sbjct  354   SDYVQEPISKDDLEAIWKKMMELEVPKMGFNPYGGKMSEISAAATPFPHRAGNLWKIQYQ  413

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
             ++W EEG  A+  H+   R+L+ ++ PFVS+NPR A+LNY+DLD+G   HG  SY EG+ 
Sbjct  414   INWNEEGTEAEEYHLDLARQLYRYMTPFVSKNPRAAFLNYKDLDLGINHHGKTSYIEGRA  473

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YG KYF GN+ERLV++K+RVDP NFFR+EQS+P+ 
Sbjct  474   YGIKYFKGNFERLVQIKTRVDPGNFFRHEQSVPTF  508



>ref|XP_004162850.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=526

 Score =   535 bits (1378),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 290/540 (54%), Positives = 395/540 (73%), Gaps = 18/540 (3%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             SSS +FL F +L  + +   S ++    SFL CLST S    P   +S  +++P N+SF 
Sbjct  4     SSSSIFLTFFSLTFIFSPLLS-SVSAQQSFLQCLSTTSQPQFP---ISDAIFTPNNSSFL  59

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
             +VL +Y RN RF   ++PKP+ IVT  H SHV   V+CAK++G++IR+RSGGHDYEG+SY
Sbjct  60    TVLDSYIRNLRFQNPTTPKPLFIVTAKHYSHVQSTVVCAKRVGLQIRIRSGGHDYEGLSY  119

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VS   F+ILD+FNLR+I+VDI      +TAWV++GATLGELYY I +KS++HGFPGGVCP
Sbjct  120   VSQQPFVILDLFNLRAINVDIPS----QTAWVESGATLGELYYAIAKKSNLHGFPGGVCP  175

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVG GGH SGGGYGN+IR+FGLTVD+++DA+IV+  G++L+R  MGEDLFWAI GGGGGS
Sbjct  176   TVGTGGHFSGGGYGNLIRKFGLTVDNILDAQIVNADGKILNRQTMGEDLFWAIRGGGGGS  235

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVIL++KI L++VP TVT F  ++   +     DVV ++     K+D++LFIRL+L   
Sbjct  236   FGVILSWKISLVQVPSTVTVFDVDR--KIEDGATDVVFEWQQVMDKLDENLFIRLMLH--  291

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
                +   ++  KT +++ V LFLG  EK++ I+N + P+L L+KQ+C EMSWI+S+L W 
Sbjct  292   ---SSKGENGXKTGKATLVALFLGPVEKVMDIMNQNIPSLKLQKQECFEMSWIQSVLFWA  348

Query  780   SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYG  601
             +F +GT PEALL+R  A    +LKRKSDY++ PI +  ++++WK ++++   GL  NPYG
Sbjct  349   NFPSGTAPEALLSRQMAS-TPYLKRKSDYVREPISREGVEAIWKALMDVEEVGLTWNPYG  407

Query  600   GRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPR  421
             GRM+EI  T TPFPHRAGV FKIQY+ +WKE G+    E I   R+L+  + PFVS+NPR
Sbjct  408   GRMSEISETATPFPHRAGVKFKIQYSSNWKEAGDTEAEEEIELSRKLYEAMTPFVSKNPR  467

Query  420   QAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             +A+LNYRD+DIG++     S EEG+VYG +YF GN+ERLV VK++VDP NFFRNEQSIP+
Sbjct  468   EAFLNYRDIDIGSSRT--WSLEEGRVYGERYFKGNFERLVNVKTKVDPQNFFRNEQSIPT  525



>gb|KHN14296.1| Reticuline oxidase-like protein [Glycine soja]
Length=541

 Score =   535 bits (1379),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 292/546 (53%), Positives = 398/546 (73%), Gaps = 17/546 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIPMY--DSFLHCLSTVSANPIPKDLVSSIVYSPAN  1693
             ++S   + L F ++  LL+  +S +      ++F+ CL   S    P   ++S +++P N
Sbjct  3     VLSPHRIQLSFFSIVVLLSIPWSASAANSAPNTFVQCLLNNSEPSYP---ITSAIFTPNN  59

Query  1692  ASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYE  1513
             + FSSVL+AY RN RFNT ++ KP +IVTP H SHV   ++CAKK  + +++RSGGHDYE
Sbjct  60    SLFSSVLEAYIRNLRFNTSTTRKPFLIVTPSHVSHVQAAIVCAKKHKLLMKIRSGGHDYE  119

Query  1512  GISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpg  1333
             G+SYV+     ILDMFNLRSI++D+      ETAWV+AGATLGE+YYRI EKS +H FP 
Sbjct  120   GLSYVASQPLFILDMFNLRSIEIDMKT----ETAWVEAGATLGEVYYRIAEKSKIHAFPA  175

Query  1332  gvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgg  1153
             GVCPTVGVGGH+SGGGYGNM+R++GL+VD+V+DA +VDV+GR+LDR +MGEDLFWAI GG
Sbjct  176   GVCPTVGVGGHISGGGYGNMMRKYGLSVDNVIDALMVDVQGRLLDRKSMGEDLFWAITGG  235

Query  1152  ggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLL  973
             GG SFGV+LA+KIKL+RVP+TVT FR  K   L +N  D+V  + + A  I+++LFIRL+
Sbjct  236   GGASFGVVLAYKIKLVRVPETVTVFRVPK--TLEQNATDIVYNWQHVAPTINNNLFIRLV  293

Query  972   LQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESM  793
             L +V        + +KT+R+++V LFLGDS+ L+S+LN  FP LGLK+ DC E SW+ S+
Sbjct  294   LNVV----NVTQNETKTIRATFVALFLGDSKSLVSLLNDKFPQLGLKQSDCIETSWLGSV  349

Query  792   LRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
             L W +       E LLNR P    ++LKRKSDY++  I K  L+ +W+KM+EL +T L  
Sbjct  350   LFWTNINITAPVEVLLNRQPQS-VNYLKRKSDYVKKSISKEGLEGIWRKMIELVDTSLNF  408

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGGRMAEIPST +PFPHRAG L+KIQY  +W + G+     +I+  R+LH ++ PFVS
Sbjct  409   NPYGGRMAEIPSTTSPFPHRAGNLWKIQYQANWNKPGKEVADHYINLTRKLHKYMTPFVS  468

Query  432   RNPRQAYLNYRDLDIGTTDH-GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             +NPR A+ NYRDLD+G+ ++ G +SY +G+VYG KYF  N+ +LV++K++VDPDNFFRNE
Sbjct  469   KNPRGAFFNYRDLDLGSNNYNGKNSYAKGRVYGVKYFKDNFNKLVQIKTKVDPDNFFRNE  528

Query  255   QSIPSL  238
             QSIP L
Sbjct  529   QSIPML  534



>ref|XP_002523152.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39183.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=511

 Score =   534 bits (1375),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 279/499 (56%), Positives = 371/499 (74%), Gaps = 12/499 (2%)
 Frame = -3

Query  1734  PKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKL  1555
             P   +S+ +Y+P + S+ S+LQAY RN RFNT  +PKP++I+T LHESHV   VL AKK 
Sbjct  22    PSHPISNAIYTPQHPSYPSILQAYIRNLRFNTSKTPKPLLILTALHESHVQAAVLAAKKH  81

Query  1554  GVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELY  1375
             G+++++RSGGHDYEG SYVSD  F ILDM+NLRSID+D+      ETAWVQAGATLGEL+
Sbjct  82    GLQMKIRSGGHDYEGTSYVSDVPFFILDMYNLRSIDIDLEN----ETAWVQAGATLGELF  137

Query  1374  YRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDR  1195
             Y I E+S   GFP GVCPTVGVGGH+ G GYGN++R++GL+VD+V+DA++VD +GR+LDR
Sbjct  138   YGIAERSKTRGFPAGVCPTVGVGGHLVGAGYGNLMRKYGLSVDNVIDAKLVDAEGRILDR  197

Query  1194  TAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFN  1015
              +MGE+LFWAI GGG  SFGV+LA+KI L+RVP+ VT FR E+   L +N  D+V Q+ +
Sbjct  198   KSMGENLFWAIKGGGA-SFGVVLAYKINLVRVPEVVTVFRVER--TLEQNATDIVYQWQH  254

Query  1014  TASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGL  835
              A +ID+ LFIRL+L ++    K + +  KTVR S++ LFLGDSE+LLSI+   FP LGL
Sbjct  255   AAPEIDEDLFIRLVLDVL----KNDQTGQKTVRGSFIALFLGDSERLLSIMKESFPELGL  310

Query  834   KKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSL  655
              K DC EMSW+ES+L W ++  GT  +  L+R P     +LKRKSDY+Q PI K  L+ +
Sbjct  311   LKSDCIEMSWLESVLFWTNYPIGTPTDVCLSREPQ-TLVYLKRKSDYVQEPISKQGLEGI  369

Query  654   WKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHIS  475
             WKKM+EL    +  NPYGG+M EI  T+TPFPHRAG L+KIQY ++W +EGE A   H+ 
Sbjct  370   WKKMMELEVPMMGFNPYGGKMKEIAETETPFPHRAGNLWKIQYQINWTQEGEEAANHHLD  429

Query  474   QIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKV  295
               R+L+ ++ PFVS+NPR A+LNY+DLD+G  +H   SY+ G  YG KYF  N+ RLV++
Sbjct  430   LARQLYDYMTPFVSKNPRAAFLNYKDLDLGINNHDKESYKVGSAYGIKYFKNNFNRLVQI  489

Query  294   KSRVDPDNFFRNEQSIPSL  238
             K++ DPDNFFR+EQS+P+ 
Sbjct  490   KTKFDPDNFFRHEQSVPTF  508



>ref|XP_010449154.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Camelina 
sativa]
Length=554

 Score =   535 bits (1379),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 396/542 (73%), Gaps = 21/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG---TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             V  V L L +L  S F+    +  +Y+SF+ C S  + +P  +  ++  V+S +N S++S
Sbjct  10    VLCVVLFLVSLPFSTFAAPPSSDSIYESFVQCFSDKTKSP--QTQITDNVFSHSNPSYTS  67

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFNT S+PKP IIVTP  ESHV   V+C+K     +++RSGGHDYEG+SY+
Sbjct  68    VLRAYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKTQNFLVKIRSGGHDYEGLSYI  127

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDM NLR + V+IA     ++AW+ AGATLGE+Y+ IWEKS VHGFP GVCPT
Sbjct  128   SDKPFFILDMSNLRDVTVNIAD----QSAWISAGATLGEVYHGIWEKSKVHGFPAGVCPT  183

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLFWAI+GGGG SF
Sbjct  184   VGVGGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLFWAISGGGGASF  243

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L +K+KL+ VPKTVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   
Sbjct  244   GVVLGYKVKLVPVPKTVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPSLFMRMLIQ---  298

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+      KTVR+S V LFLG +++++++L  +FP LGLKK+DC EM+WI+S+L W +
Sbjct  299   PVTR---KKVKTVRASVVALFLGRADEVVALLRKEFPELGLKKKDCQEMTWIQSVLWWDN  355

Query  777   FGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N TK  P+ LL+R     ASF KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPY
Sbjct  356   NENATKTNPKVLLDRE-LDTASFGKRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPY  414

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+MAE+    TPFPHR   LFKIQY+V+WKE     ++ +++Q + L+ F+  FVS+ P
Sbjct  415   GGKMAEVAVDATPFPHRKK-LFKIQYSVNWKENSPEIEKGYLNQAKVLYRFMTGFVSKKP  473

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AYLNYRD+DIG  DHG +SY+EGKVYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  474   RSAYLNYRDVDIGVNDHGKNSYKEGKVYGKKYFGVNFDRLVKIKTAVDPENFFRNEQSIP  533

Query  243   SL  238
             +L
Sbjct  534   TL  535



>ref|XP_003547341.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=541

 Score =   535 bits (1377),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 292/546 (53%), Positives = 398/546 (73%), Gaps = 17/546 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIPMY--DSFLHCLSTVSANPIPKDLVSSIVYSPAN  1693
             ++S   + L F ++  LL+  +S +      ++F+ CL   S    P   ++S +++P N
Sbjct  3     VLSPHRIQLSFFSIVVLLSIPWSASAANSAPNTFVQCLLNNSEPSYP---ITSAIFTPNN  59

Query  1692  ASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYE  1513
             + FSSVL+AY RN RFNT ++ KP +IVTP H SHV   ++CAKK  + +++RSGGHDYE
Sbjct  60    SLFSSVLEAYIRNLRFNTSTTRKPFLIVTPSHVSHVQAAIVCAKKHKLLMKIRSGGHDYE  119

Query  1512  GISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpg  1333
             G+SYV+     ILDMFNLRSI++D+      ETAWV+AGATLGE+YYRI EKS +H FP 
Sbjct  120   GLSYVASQPLFILDMFNLRSIEIDMKT----ETAWVEAGATLGEVYYRIAEKSKIHAFPA  175

Query  1332  gvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgg  1153
             GVCPTVGVGGH+SGGGYGNM+R++GL+VD+V+DA +VDV+GR+LDR +MGEDLFWAI GG
Sbjct  176   GVCPTVGVGGHISGGGYGNMMRKYGLSVDNVIDALMVDVQGRLLDRKSMGEDLFWAITGG  235

Query  1152  ggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLL  973
             GG SFGV+LA+KIKL+RVP+TVT FR  K   L +N  D+V  + + A  I+++LFIRL+
Sbjct  236   GGASFGVVLAYKIKLVRVPETVTVFRVPK--TLEQNATDIVYNWQHVAPTINNNLFIRLV  293

Query  972   LQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESM  793
             L +V        + +KT+R+++V LFLGDS+ L+S+LN  FP LGLK+ DC E SW+ S+
Sbjct  294   LNVV----NVTQNETKTIRATFVALFLGDSKSLVSLLNDKFPQLGLKQSDCIETSWLGSV  349

Query  792   LRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
             L W +       E LLNR P    ++LKRKSDY++  I K  L+ +W+KM+EL +T L  
Sbjct  350   LFWTNINITAPVEVLLNRQPQS-VNYLKRKSDYVKKSISKEGLEGIWRKMIELVDTSLNF  408

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGGRMAEIPST +PFPHRAG L+KIQY  +W + G+     +I+  R+LH ++ PFVS
Sbjct  409   NPYGGRMAEIPSTTSPFPHRAGNLWKIQYLANWNKPGKEVADHYINLTRKLHKYMTPFVS  468

Query  432   RNPRQAYLNYRDLDIGTTDH-GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             +NPR A+ NYRDLD+G+ ++ G +SY +G+VYG KYF  N+ +LV++K++VDPDNFFRNE
Sbjct  469   KNPRGAFFNYRDLDLGSNNYNGKNSYAKGRVYGVKYFKDNFNKLVQIKTKVDPDNFFRNE  528

Query  255   QSIPSL  238
             QSIP L
Sbjct  529   QSIPML  534



>ref|XP_010449153.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Camelina 
sativa]
Length=555

 Score =   535 bits (1377),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 396/542 (73%), Gaps = 21/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG---TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             V  V L L +L  S F+    +  +Y+SF+ C S  + +P  +  ++  V+S +N S++S
Sbjct  10    VLCVVLFLVSLPFSTFAAPPSSDSIYESFVQCFSDKTKSP--QTQITDNVFSHSNPSYTS  67

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFNT S+PKP IIVTP  ESHV   V+C+K     +++RSGGHDYEG+SY+
Sbjct  68    VLRAYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKTQNFLVKIRSGGHDYEGLSYI  127

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDM NLR + V+IA     ++AW+ AGATLGE+Y+ IWEKS VHGFP GVCPT
Sbjct  128   SDKPFFILDMSNLRDVTVNIAD----QSAWISAGATLGEVYHGIWEKSKVHGFPAGVCPT  183

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLFWAI+GGGG SF
Sbjct  184   VGVGGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLFWAISGGGGASF  243

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L +K+KL+ VPKTVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   
Sbjct  244   GVVLGYKVKLVPVPKTVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPSLFMRMLIQ---  298

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+      KTVR+S V LFLG +++++++L  +FP LGLKK+DC EM+WI+S+L W +
Sbjct  299   PVTR---KKVKTVRASVVALFLGRADEVVALLRKEFPELGLKKKDCQEMTWIQSVLWWDN  355

Query  777   FGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N TK  P+ LL+R     ASF KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPY
Sbjct  356   NENATKTNPKVLLDRE-LDTASFGKRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPY  414

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+MAE+    TPFPHR   LFKIQY+V+WKE     ++ +++Q + L+ F+  FVS+ P
Sbjct  415   GGKMAEVAVDATPFPHRKK-LFKIQYSVNWKENSPEIEKGYLNQAKVLYRFMTGFVSKKP  473

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AYLNYRD+DIG  DHG +SY+EGKVYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  474   RSAYLNYRDVDIGVNDHGKNSYKEGKVYGKKYFGVNFDRLVKIKTAVDPENFFRNEQSIP  533

Query  243   SL  238
             +L
Sbjct  534   TL  535



>ref|XP_007023052.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25674.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=540

 Score =   534 bits (1375),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 284/527 (54%), Positives = 387/527 (73%), Gaps = 25/527 (5%)
 Frame = -3

Query  1785  MYDSFLHCL--STVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVII  1612
             + D F+ CL   + S+NPI     +  +Y+P NASFSSVL++Y RN RF T  +PKP++I
Sbjct  34    IQDKFVQCLCKQSQSSNPI-----AGAIYTPNNASFSSVLESYVRNLRFMTPETPKPLVI  88

Query  1611  VTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAG  1432
             VT LHESHV   V+C+K +G++IR+RSGGHDYEG+SYVS   F+ILDMFNLR ID+++  
Sbjct  89    VTALHESHVQATVVCSKSVGLQIRIRSGGHDYEGLSYVSSVPFVILDMFNLRGIDINVRD  148

Query  1431  GDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLT  1252
                 E+AWVQAGA+LGE+YYRI EKS VHGFP GVCPT+GVGGH +GGGYGNM+R++GL+
Sbjct  149   ----ESAWVQAGASLGEVYYRIAEKSPVHGFPAGVCPTLGVGGHFTGGGYGNMMRKYGLS  204

Query  1251  VDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRA  1072
             VD+++DA++VD  GR+LDR +MGEDLFWAI GGG  SF V+L++KIKL+ VP+TVT FR 
Sbjct  205   VDNIIDAKVVDASGRILDRASMGEDLFWAIRGGGAASFCVVLSWKIKLVPVPETVTVFRV  264

Query  1071  EKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL---QIVPPPTKTNDSNSKTVRSSYVG  901
             +K   L     D+V ++   A ++DD LFIRL+L   +I  PP +       T+++S+V 
Sbjct  265   DK--TLEEGATDLVVKWQQVADRLDDDLFIRLMLSPEKIGSPPGQN------TIQASFVA  316

Query  900   LFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDA  721
             +FLG +E+LL ++N  FP LGL+K+DC +M W+ES+L W ++ N +  + LL R P  + 
Sbjct  317   MFLGQTERLLQLMNESFPELGLQKKDCIKMRWVESVLFWINYPNVSSTDVLLQRIPKSE-  375

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             SFLKRKSDY+Q PIPK  L+++WK M+E  N G+  NPYGG+M+EI  T TPFPHRAG +
Sbjct  376   SFLKRKSDYVQQPIPKAGLEAIWKVMMEAENVGMNWNPYGGKMSEILPTATPFPHRAGNI  435

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FKIQY  +WK+ G       ++  R+L+  + P+VS+NPR+++LNYRD+DIG   +G  +
Sbjct  436   FKIQYGSNWKKPGNEVADNFLNWTRKLYEAMTPYVSKNPRESFLNYRDIDIGVNSNG--T  493

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
              EEG+VYG KYF  N++RLV VK++VDPDNFF  EQSIP+ S +  G
Sbjct  494   LEEGRVYGSKYFKENFDRLVDVKTQVDPDNFFSYEQSIPTRSSDCRG  540



>ref|XP_010680366.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=532

 Score =   533 bits (1374),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 294/538 (55%), Positives = 400/538 (74%), Gaps = 21/538 (4%)
 Frame = -3

Query  1836  FLALCNL--LTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
             +L LC +  L S FS  +    +Y++FL CL+T + +      +++I+YS    +++SVL
Sbjct  9     YLLLCCIIPLFSPFSLALSSGSIYNNFLQCLNTQTTSSTN---LATILYSKQTTNYNSVL  65

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
              AY RN RF   ++PKP +I+TP++ S V   ++C++KLG+++R+RSGGHD+EG+SYVSD
Sbjct  66    LAYIRNLRFTDPTTPKPQLIITPINPSQVSATIICSRKLGLQVRIRSGGHDFEGLSYVSD  125

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               F+ILDM NLR IDVD       ETA+V+AG+TLGELYYRI EKS++ GFP GVCPTVG
Sbjct  126   TPFLILDMKNLRRIDVDPIA----ETAYVEAGSTLGELYYRIQEKSNILGFPAGVCPTVG  181

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             VGGHVSGGGYGN+IR+ GLT+DH+VDA +VDVKGR+L+R +MGEDLFWAI GGGG SFGV
Sbjct  182   VGGHVSGGGYGNLIRKHGLTIDHIVDATVVDVKGRILNRKSMGEDLFWAIRGGGGASFGV  241

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             +++F  KL+RVP+ VT F  ++YL  T N  D+V ++      ID +LFIRLLLQ   P 
Sbjct  242   VVSFTFKLVRVPEIVTVFNIKRYL--TENATDLVYKWQFLMKDIDQNLFIRLLLQ---PV  296

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
             T   +   KT R++++ LFLGDS+ L+S+L   FP LG+K++DC EM+W +S+L W +F 
Sbjct  297   TDPQNRGKKTGRATFICLFLGDSKTLVSLLQKSFPELGVKEEDCFEMNWGKSVLYWANFD  356

Query  771   NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRM  592
             N T  + LL+R  + +A +LKRKSDY++ P+ K  L+ LWKK++EL  TGL  NPYGGRM
Sbjct  357   NKTSVDVLLSR--SYEADYLKRKSDYVKEPMSKAGLELLWKKLVELDRTGLVFNPYGGRM  414

Query  591   AEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
              EI S++TPFPHR G LFKIQY++ WK  G+  + ++I  +REL+ F+ P+VS+NPR AY
Sbjct  415   NEIGSSETPFPHRRGNLFKIQYSIGWKVAGKVEEDKNIGLLRELYKFMTPYVSKNPRGAY  474

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              NYRD+DIG   +G  +Y+EG+VYG KYF+GN++RLVKVKS +DP NFFRNEQSIP+L
Sbjct  475   FNYRDVDIGVNHNG--TYKEGEVYGRKYFLGNFDRLVKVKSVIDPSNFFRNEQSIPTL  530



>ref|XP_006285850.1| hypothetical protein CARUB_v10007331mg [Capsella rubella]
 gb|EOA18748.1| hypothetical protein CARUB_v10007331mg [Capsella rubella]
Length=555

 Score =   534 bits (1376),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 299/553 (54%), Positives = 399/553 (72%), Gaps = 26/553 (5%)
 Frame = -3

Query  1866  MMSSSPVFL-VFLALCNLLTSCFSGTIP-------MYDSFLHCLSTVSANPIPKDLVSSI  1711
             MM     F+ V L +  L++  FS T         +Y+SF+ C S  + +P  +  ++  
Sbjct  1     MMIKGQTFVSVLLFVIFLVSIPFSTTFAAPPSSDSIYESFVQCFSDKTKSP--QSQITDN  58

Query  1710  VYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRS  1531
             V+S  N +FSSVL+AY RN RFNT S+PKP IIVTPL +SHV   V+C+  L   +++RS
Sbjct  59    VFSQTNPAFSSVLRAYIRNARFNTSSTPKPTIIVTPLSDSHVSAAVVCSNSLNFLLKIRS  118

Query  1530  GGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSS  1351
             GGHDYEG+SY+SD  F ILDM NLR + VDIA     ++AW+ AGATLGE+YY IWEKS 
Sbjct  119   GGHDYEGLSYISDKPFFILDMSNLRDVSVDIAA----QSAWISAGATLGEVYYGIWEKSK  174

Query  1350  VHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLF  1171
             VHGFP GVCPTVGVGGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLF
Sbjct  175   VHGFPAGVCPTVGVGGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLF  234

Query  1170  WAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDH  991
             WAI GGGG SFGV+L +K+KL+ VP+TVT FR E+Y+       D+V ++ +   K D +
Sbjct  235   WAICGGGGASFGVVLGYKVKLVPVPETVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPN  292

Query  990   LFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEM  811
             LF+R+L+Q   P T+      KTVR++ V LFLG +++++++L  +FP LGLKK+ C EM
Sbjct  293   LFMRMLIQ---PVTR---KKVKTVRATVVALFLGRADEVVALLAKEFPELGLKKEVCEEM  346

Query  810   SWIESMLRWGSFGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLE  637
             +WI+S L W +  N T+  P+  L+R     ASF KRKSDY+ + +P+  ++SL+KKM+E
Sbjct  347   TWIQSALWWDNDENATQTDPKVFLDRN-LDTASFGKRKSDYVASEMPRDGIESLFKKMIE  405

Query  636   LGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELH  457
             LG  GL  NPYGG+MAE+    TPFPHR   LFKIQY+V+WKE   + ++  ++Q + L+
Sbjct  406   LGKIGLVFNPYGGKMAEVAVNATPFPHRNN-LFKIQYSVNWKENSASIEKGFLNQAKVLY  464

Query  456   SFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDP  277
             SF+  FVS+NPR AYLNYRD+DIG  DHG +SY+EG+VYG KYF  N++RLVK+K+ VDP
Sbjct  465   SFMTGFVSKNPRSAYLNYRDVDIGVNDHGTNSYKEGEVYGRKYFGENFDRLVKIKTTVDP  524

Query  276   DNFFRNEQSIPSL  238
             DNFFRNEQSIP+L
Sbjct  525   DNFFRNEQSIPTL  537



>ref|XP_002317074.2| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE97686.2| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=531

 Score =   533 bits (1372),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 291/540 (54%), Positives = 382/540 (71%), Gaps = 15/540 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             +S + +  VF AL  L  S  + + P  D+FL CL +   N +P   +S  +Y+ AN SF
Sbjct  3     VSMTVILSVFSALL-LSVSLAANSDPSLDNFLKCLPS---NSLPSYPISEAIYTTANPSF  58

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
              SVL  Y  NRRF T ++PKP+ IVT LHESHV   V+CAK  G+++R+RSGGHDYEG+S
Sbjct  59    ESVLLTYINNRRFLTPTTPKPLAIVTALHESHVQATVVCAKSHGLQVRIRSGGHDYEGLS  118

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YVS+  F+ILDMFNLRSID+D+A     ETAWVQAGATLGE+YY I  KS+VH FP GVC
Sbjct  119   YVSEVPFVILDMFNLRSIDIDLAS----ETAWVQAGATLGEIYYNIANKSNVHAFPAGVC  174

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PT+G GGH+SGGGYG ++R++GL+VD+V+DA++VDVKG +LDR  MGEDLFWAI GGGG 
Sbjct  175   PTIGAGGHISGGGYGTLMRKYGLSVDNVIDAKVVDVKGNILDRQTMGEDLFWAIRGGGGA  234

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL++KI L+RVP  VT F+ ++   L     D+  Q+   ++++D  LFIR + Q+
Sbjct  235   SFGVILSWKINLVRVPAKVTVFKVDR--TLEEGATDIFYQWQQVSTELDKELFIRAMPQV  292

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                    +   +KT+R S+ GLFLG S  L+S++N  FP LGL++ DC EM WIES L W
Sbjct  293   ----ANGSVEGTKTIRISFYGLFLGQSGTLISMMNKRFPELGLQQSDCIEMRWIESTLFW  348

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
                 NGT  + LLNR P G  SF K KSDY+ + +PK  L+ +WK M++     +  NP 
Sbjct  349   FDLPNGTSIDVLLNR-PRGAQSFYKNKSDYVNHIVPKEALERIWKMMIKAEPMWMQWNPI  407

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM+EIP T TPFPHRAG LFK+QY+++W+EEG  A   +IS IRE+H  +AP+V++ P
Sbjct  408   GGRMSEIPDTATPFPHRAGYLFKLQYSINWREEGTEATDRYISLIREMHDAMAPYVTKFP  467

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R+A+ NYRDLDIG++     ++EE K YG KYF GN+ RLVKVK  VDPDNFF++EQSIP
Sbjct  468   REAFQNYRDLDIGSSPSNQTNFEEAKEYGLKYFKGNFLRLVKVKGMVDPDNFFKHEQSIP  527



>ref|XP_010434267.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=542

 Score =   533 bits (1372),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 297/539 (55%), Positives = 394/539 (73%), Gaps = 20/539 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             +FLV L L        S +I  Y+SF+ C S  + +P  +  ++  V+S  N S+SSVL+
Sbjct  17    IFLVSLPLSMFAAPPSSDSI--YESFVQCFSDKTKSP--QTQITDNVFSQTNPSYSSVLR  72

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFNT S+PKP IIVTP  ESHV   V+C+K L   +++RSGGHDY+G+SY+SD 
Sbjct  73    AYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKTLNFLVKIRSGGHDYDGLSYISDK  132

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ILDM NLR + VDIA     ++AW+ AGATLGE+Y+ IW KS VHGFP GVCPTVGV
Sbjct  133   PFFILDMSNLRDVSVDIAD----QSAWISAGATLGEVYHGIWGKSKVHGFPAGVCPTVGV  188

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLFWAI GGGG SFGV+
Sbjct  189   GGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLFWAICGGGGASFGVV  248

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L +K+KL+ VP+TVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   P T
Sbjct  249   LGYKVKLVPVPETVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPSLFMRMLIQ---PVT  303

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             +   +  KTVR++ V LFLG +++++++L  +FP LGLKK+ C EM+WI+S+L W +  N
Sbjct  304   R---NKVKTVRATVVALFLGRADEVVALLAKEFPELGLKKESCQEMTWIQSVLWWDNDEN  360

Query  768   GTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGR  595
              TK  P+ LL+R     ASF KRKSDY+ + IP+  ++SL+KKM+ELG  GL  NPYGG+
Sbjct  361   ATKTNPKVLLDRE-LDTASFGKRKSDYVASEIPRDGIESLFKKMIELGKIGLVFNPYGGK  419

Query  594   MAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQA  415
             MAE+    TPFPHR   LFKIQY+V+WKE     ++  ++Q + L+SF+  FVS+NPR A
Sbjct  420   MAEVAVDATPFPHRKK-LFKIQYSVNWKENSATIEKGFLNQAKVLYSFMTEFVSKNPRNA  478

Query  414   YLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YLNYRD+DIG  DHG +SY+EG+VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP+L
Sbjct  479   YLNYRDVDIGVNDHGKNSYKEGEVYGRKYFGENFDRLVKIKTEVDPENFFRNEQSIPTL  537



>gb|KEH31331.1| FAD-binding berberine family protein [Medicago truncatula]
Length=1154

 Score =   553 bits (1424),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 300/526 (57%), Positives = 388/526 (74%), Gaps = 13/526 (2%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y SFL CL+  +    P D VS+I++S  N SFSS+LQAY RN R N  S+PKP++I+T
Sbjct  36    VYTSFLECLTNHTN---PSDQVSNILFSQTNVSFSSILQAYIRNARLNKTSTPKPLLIIT  92

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PL +SHV   +LCAK + ++++VRSGGHD+EGISYVS+  FIILDMF  R+I VDI    
Sbjct  93    PLQQSHVQATILCAKAIKIQLKVRSGGHDFEGISYVSNQPFIILDMFQFRNITVDIQN--  150

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A VQ+GA LGE+YYRIWEKS VHGFP GVC TVGVGGH+SGGGYGNM+R+FGL++D
Sbjct  151   --EVAVVQSGAILGEVYYRIWEKSKVHGFPAGVCITVGVGGHLSGGGYGNMMRKFGLSID  208

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +VVDA IVDV GR+LDR +MGE+LFWAI GGGG SFGVIL++ IKL++VP+ VT FR E+
Sbjct  209   NVVDAEIVDVNGRILDRKSMGEELFWAIRGGGGASFGVILSYSIKLVQVPEVVTVFRVEE  268

Query  1065  YL-GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
              L  L +N  + V Q+ N A + DD LF+RL +Q   P +        TVR S + LFLG
Sbjct  269   SLDSLDQNITEFVLQWQNVAPRTDDRLFMRLHIQ---PASSKVVKGEITVRVSVMALFLG  325

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLK  709
              +++L+++L  +FP+LGLKK++CSEMSWI S L WG   N +KP+ LL+R     A FLK
Sbjct  326   GADELVTLLGKEFPSLGLKKENCSEMSWIGSALWWGISSN-SKPDELLDRN-IDSAKFLK  383

Query  708   RKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQ  529
             RKSDY++NPI K  L+ ++KK++ELG  GL  NPYGG+M  I S  T FPHRAG LFKIQ
Sbjct  384   RKSDYVENPISKDGLEGIYKKLIELGKVGLTFNPYGGKMNSIASNATAFPHRAGNLFKIQ  443

Query  528   YAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEG  349
             Y+V+W + G   +    +Q R L+ ++ PFVS NPR+A+LNYRDLDIGT D G +SYE+G
Sbjct  444   YSVNWDKPGIDIENNFTNQARMLYDYMTPFVSNNPRRAFLNYRDLDIGTNDFGNNSYEQG  503

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSES  211
              VYG KYF  N+ERLVK+K+ VDP+NFFRNEQSIP+   + +G+ +
Sbjct  504   VVYGMKYFSSNFERLVKIKTAVDPENFFRNEQSIPTHPGSDSGAST  549


 Score =   525 bits (1352),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 281/516 (54%), Positives = 372/516 (72%), Gaps = 13/516 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL CL   +  P   + VS+IVYS  NAS++S+ QA+ RN RFNT S+ KP++I+T
Sbjct  648   IYVTFLQCLKNHTTQP---NQVSNIVYSQTNASYTSIFQAFIRNARFNTPSTTKPLLIIT  704

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             PLHE  V   VLC+K +G+ +++RSGGHD+EGISY+SD  FIILDMFN ++I VDI    
Sbjct  705   PLHEDQVQATVLCSKTIGLHLKIRSGGHDFEGISYISDTPFIILDMFNFQNITVDIQN--  762

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E A +Q GA+LG++YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL++D
Sbjct  763   --EIAIIQTGASLGQVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMMRKFGLSID  820

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++VDA+I+DV GR+LD+  MGEDLFWAI GGGG SFGVIL++ +KL+ VP+ VT F+ +K
Sbjct  821   NIVDAKIIDVNGRILDKKTMGEDLFWAIRGGGGASFGVILSYTVKLVSVPEKVTVFQVDK  880

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V Q+   A   DD LF+RL+LQ   P         KTV +S   +FLG 
Sbjct  881   --SLEQNATDIVFQWQQVAPHTDDRLFMRLVLQ---PVNSKIVKGKKTVSASIQAMFLGG  935

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +++L+++   +FP LGLKK+ C EMSWIES+  W ++ +G+    LL+R+      F KR
Sbjct  936   ADELVTLFGKEFPLLGLKKEICKEMSWIESVFYWANYNDGSSLITLLDRSHY-KVHFSKR  994

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY+++PIPK  L  +  K++ELG   L  NPYGG+M+EI S  T F HRAG L+KIQY
Sbjct  995   KSDYVKSPIPKDGLKWIMNKLIELGKVELVFNPYGGKMSEISSAATAFAHRAGNLYKIQY  1054

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
               SW+      ++  ISQIR ++S++ PFVS+NPR AYLNYRDLDIG   H  ++Y +G 
Sbjct  1055  TASWENSAAGMEKSFISQIRMMYSYMTPFVSKNPRSAYLNYRDLDIGINGHDKNAYNDGV  1114

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             VYG KYF  N+ERLVKVK+ VDP+NFF NEQSIP+L
Sbjct  1115  VYGMKYFGENFERLVKVKTAVDPENFFWNEQSIPTL  1150



>ref|XP_008445642.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=532

 Score =   532 bits (1371),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 291/513 (57%), Positives = 378/513 (74%), Gaps = 14/513 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++FL CL   S    P   ++  +++P NAS+SSVL+ Y RN RFNT ++PKP +I+T L
Sbjct  28    ENFLQCLLRHSPPSYP---IAPAIFTPNNASYSSVLETYIRNLRFNTSTTPKPFLILTAL  84

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT-FIILDMFNLRSIDVDIAGGDG  1423
             HESHV   +LCA+   +++++RSGGHDYEG+SYVSD   F +LDMFNLR I VD      
Sbjct  85    HESHVKVAILCARIHNLQMKIRSGGHDYEGVSYVSDVVPFFVLDMFNLREITVDAKT---  141

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAWVQ GATLGE+YYR+ EK+  +GFP GVCPTVGVGGH  GGGYGNM+R+ GL+VD 
Sbjct  142   -ETAWVQTGATLGEVYYRVAEKNKSYGFPAGVCPTVGVGGHFGGGGYGNMMRKHGLSVDQ  200

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             ++DA+I+DV G++LDR AMGEDLFWAI GGGG SFGV++A+KI+++RVP+ VT FR ++ 
Sbjct  201   IIDAKIIDVNGKLLDRKAMGEDLFWAIIGGGGSSFGVVVAYKIRMVRVPERVTVFRVQRT  260

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
             L       ++V ++   A  ID+ LFIR+   +V       D   KT+R++++ LFLGDS
Sbjct  261   LE-QNELTEIVDEWQQVAHVIDNDLFIRVTFDVV----NGTDKEKKTLRATFIALFLGDS  315

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
              +LL ++N+ FP LGLKK DC EMSW++S+L W +F  GT  EALL+RTP    + LKRK
Sbjct  316   GRLLFVINNSFPKLGLKKSDCIEMSWLQSVLFWTNFPLGTSVEALLSRTPQV-LTHLKRK  374

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PIPK  LD +WKKM+EL    +  NPYGGRMAEIPS  TPFPHRAG L+KIQYA
Sbjct  375   SDYVKAPIPKEGLDKIWKKMIELEKPMMTFNPYGGRMAEIPSNATPFPHRAGNLWKIQYA  434

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W EEG+   +  I   R+L+ F+ PFVS+NPR A+LNYRDLDIG   +G +SY EG+V
Sbjct  435   TNWDEEGKREAKHFIDLTRKLYKFMTPFVSKNPRTAFLNYRDLDIGVNHNGKNSYYEGRV  494

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YG KYF GN+ERLVK+K++VDP NFFRNEQSIP
Sbjct  495   YGIKYFEGNFERLVKIKTKVDPHNFFRNEQSIP  527



>ref|XP_008360665.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=542

 Score =   532 bits (1370),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 293/518 (57%), Positives = 384/518 (74%), Gaps = 15/518 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F+HCL   S    P   ++  +YSP NAS+SSVL++Y  N RFNT ++ KP +I+T L
Sbjct  34    ENFVHCLLNHSQ---PSHPIAPAIYSPNNASYSSVLESYIXNLRFNTSTTRKPFLILTAL  90

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV+   F ILDMFNLRSI VDI      
Sbjct  91    HESHVQISVVCAQIHNLQMKIRSGGHDYEGVSYVAXVPFFILDMFNLRSIHVDIKS----  146

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
              TAWVQAGATLGE+ YRI EKS  HGFP GV PTVGVGGH SGGGYGNM+R++GL+VD++
Sbjct  147   XTAWVQAGATLGEVXYRIAEKSKTHGFPAGVXPTVGVGGHFSGGGYGNMMRKYGLSVDNI  206

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA++V+V G +LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT FR  +  
Sbjct  207   VDAQLVNVHGELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVSR--  264

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDS--NSKTVRSSYVGLFLGD  886
              L +N  D+V ++   A K+DD LFIRL + +V   T +N S  N+KT+R+S++ +FLGD
Sbjct  265   TLEQNATDIVYRWQYIADKLDDDLFIRLTMDVVNG-TSSNSSGENNKTLRASFIAMFLGD  323

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N  FP LGLK+ DC+EMSW +S+L W SF  GT  EALL+RTP    + LKR
Sbjct  324   SERLLSIMNKSFPELGLKQSDCAEMSWAQSVLFWTSFPTGTSTEALLSRTPQV-LTRLKR  382

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  +++KM+EL    L  NPYGG+M+EI ++ TPFPHRAG L+K+QY
Sbjct  383   KSDYVKKPIPKTGLKWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHRAGNLWKVQY  442

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEE  352
             A +W   G  A   +I   R+LH ++ PFVS+NPR+A+ NY+DLDIG     +G+ SY E
Sbjct  443   ATNWDILGTEASDHYIELTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLE  502

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  503   GRVYGIKYFKHNFDRLVNVKTKVDPGNFFRNEQSIPTL  540



>ref|XP_006417310.1| hypothetical protein EUTSA_v10007344mg [Eutrema salsugineum]
 gb|ESQ35663.1| hypothetical protein EUTSA_v10007344mg [Eutrema salsugineum]
Length=530

 Score =   531 bits (1368),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 295/524 (56%), Positives = 381/524 (73%), Gaps = 20/524 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C +  +  P P  L + +V      SF+SVL+AY RN RFNT +SPKP I++ 
Sbjct  24    IYQNFLQCFTNQTRAP-PSSL-TDVVLPQTAPSFTSVLRAYIRNARFNTSASPKPAIVIA  81

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                E+HV   V+C K L   ++ RSGGHDYEGISY+S+  F +LDM NLR+I VD     
Sbjct  82    ARSEAHVQAAVVCTKSLNFLLKTRSGGHDYEGISYLSNLPFFVLDMSNLRNITVD-----  136

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
              G++AWV AGATLGE+YYRIWEK+  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  137   -GDSAWVGAGATLGEVYYRIWEKTKTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  195

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVILAFKI L+ VP+TVT FR EK
Sbjct  196   YVTDAKIVDVNGRILDRKSMGEDLFWAIRGGGGASFGVILAFKITLVPVPRTVTVFRVEK  255

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A K D  LF+RLLLQ   P T+   +  +TVR+S V LFLG+
Sbjct  256   --NLDQNALDMVHKWQFVAPKTDPALFMRLLLQ---PVTR---NKIQTVRASVVALFLGN  307

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  +LS+L  DFP LGL K++C+E++WI+S++ W +  N T  KPE LL+R P   ASFL
Sbjct  308   SSDVLSLLTRDFPELGLVKENCTELTWIQSVMWWANNDNATQVKPEILLDRDP-DSASFL  366

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  I K  LD L+KKM+E+G  GL  NPYGGRM+E+ +T+TPFPHR   L+K+
Sbjct  367   KRKSDYVEKEITKEGLDYLFKKMVEVGKIGLVFNPYGGRMSEVAATETPFPHR-NKLYKV  425

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G  A+   + Q R  +S++APFV++NPR  YLNYRDLDIG   HG +SY E
Sbjct  426   QHSMNWKDPGTEAESSFLQQTRSFYSYMAPFVTKNPRHTYLNYRDLDIGVNSHGPNSYRE  485

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTG  220
              +VYG KYF  N++RLVKVK+ VDP NFFR+EQSIP+LS   +G
Sbjct  486   AEVYGRKYFGENFDRLVKVKTAVDPQNFFRDEQSIPTLSSKPSG  529



>ref|XP_004486573.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=533

 Score =   531 bits (1367),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 286/536 (53%), Positives = 384/536 (72%), Gaps = 14/536 (3%)
 Frame = -3

Query  1845  FLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQA  1666
             FL  + +   L+   S T   Y++F+ CL     N  P   ++S +++P N+SFSSVLQA
Sbjct  3     FLPHIFVLLFLSCMVSATNSSYNTFIQCLVN---NSQPSHPITSAIFTPNNSSFSSVLQA  59

Query  1665  YARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT  1486
             Y RN RFNT ++PKP +I+T LH SH+   ++CA+K   ++++RSGGHDYEG+SYV++  
Sbjct  60    YIRNLRFNTTTTPKPFLIITALHVSHIQASIICAQKQNFQMKIRSGGHDYEGVSYVAEVP  119

Query  1485  FIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvg  1306
             F ILDMFNLRSIDVD+      ETAW+Q+GATLGE+YY I EKS +HGFP GVCPTVGVG
Sbjct  120   FFILDMFNLRSIDVDLEN----ETAWIQSGATLGEVYYTIAEKSEIHGFPAGVCPTVGVG  175

Query  1305  ghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVIL  1126
             GHVSGGGYGN++R++G ++D+V+DA+I+D KGR+LDR  MGEDLFWAI GGGG SFGV+L
Sbjct  176   GHVSGGGYGNLMRKYGTSIDNVIDAQIIDAKGRLLDREEMGEDLFWAIRGGGGASFGVVL  235

Query  1125  AFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTK  946
             ++KIKL++VPK VT F   +   L  N  ++V  + + A    D LFIRL+L++V    K
Sbjct  236   SYKIKLIKVPKIVTVFLVHR--TLEENATNIVYNWQHVAPTTSDDLFIRLMLEVV----K  289

Query  945   TNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNG  766
                + +KT+R+ +V L+LGDS+ LLS++N  FP LGLK+ DC E SWI+S++ W +    
Sbjct  290   DAKTGNKTIRAGFVALYLGDSKSLLSLMNESFPQLGLKESDCIETSWIKSLMFWANINIT  349

Query  765   TKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAE  586
              K E LL+R P     +LKRKSDY++ PI    L+ + KKM+EL N     NPYGG+M E
Sbjct  350   EKAETLLDRQPQS-MIYLKRKSDYVKKPISMEGLEGIMKKMIELENVTFYFNPYGGKMNE  408

Query  585   IPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLN  406
             I S  T FPHRAG L+KIQY  +W E G  A   HI+  REL+S++ PFVS NPR+A+LN
Sbjct  409   ISSNATSFPHRAGNLWKIQYQGNWNEAGIEAASYHINVTRELYSYMTPFVSNNPREAFLN  468

Query  405   YRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             Y+D+D+G   +G  SY EGKVYG +YF  N++RLV++K++VDP NFFRNEQSIP+L
Sbjct  469   YKDIDLGVNHNGKDSYIEGKVYGVQYFKDNFDRLVEIKTKVDPGNFFRNEQSIPTL  524



>ref|XP_011040560.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=531

 Score =   531 bits (1367),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 291/540 (54%), Positives = 378/540 (70%), Gaps = 15/540 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             +S + +  VF AL  L  S  + + P  D FL CL     N +P   +S  +Y+ AN SF
Sbjct  3     VSMAVILSVFSALL-LSVSLAANSDPSLDKFLQCLPN---NSLPSYPISEAIYTTANPSF  58

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
              SVL  Y  NRRF T ++PKP+ IVT LHESHV   V+CAK  G+++R+RSGGHDYEG+S
Sbjct  59    ESVLLTYINNRRFLTPTTPKPLAIVTALHESHVQATVVCAKSHGLQVRIRSGGHDYEGLS  118

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YVS+  FIILDMFNLRSID+D+A     ETAWVQAGATLGE+YY I  KS+VH FP GVC
Sbjct  119   YVSEVPFIILDMFNLRSIDIDLAS----ETAWVQAGATLGEIYYNIANKSNVHAFPAGVC  174

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PT+G GGH+SGGGYG ++R++GL+VD+V+DA++VDVKG +LDR  MGEDLFWAI GGGG 
Sbjct  175   PTIGAGGHISGGGYGTLMRKYGLSVDNVIDAKVVDVKGNILDRQTMGEDLFWAIRGGGGA  234

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVIL++KI L+RVP  VT F+ ++   L     D+  Q+   ++++D  LFIR + Q+
Sbjct  235   SFGVILSWKINLVRVPAKVTVFKVDR--TLEEGATDIFYQWQQVSTELDKELFIRAMPQV  292

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                    +   +KT+R S+ GLFLG S  L+S++N  FP LGL++ DC EM WIES L W
Sbjct  293   ----ANGSVEGTKTIRISFYGLFLGQSGTLISMMNKRFPKLGLQQSDCIEMRWIESTLFW  348

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
                 NGT  + LLNR P G  S+ K KSDY+ + +PK  L+ +WK M++     +  NP 
Sbjct  349   FDLPNGTSIDVLLNR-PRGAQSYFKNKSDYVNHIVPKEALERIWKMMIKAEPMWMQWNPI  407

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM+EIP T TPFPHRAG LFK+QY+++W EEG  A   +IS IRE+H  +AP+V++ P
Sbjct  408   GGRMSEIPDTATPFPHRAGYLFKLQYSINWSEEGTEATDRYISLIREMHDAMAPYVTKFP  467

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R+A+ NYRDLDIG+      ++EE K YG KYF GN+ RLVKVK  VDPDNFF++EQSIP
Sbjct  468   REAFQNYRDLDIGSNPSNQTNFEEAKEYGLKYFKGNFLRLVKVKGMVDPDNFFKHEQSIP  527



>gb|AFK34476.1| unknown [Lotus japonicus]
Length=575

 Score =   532 bits (1371),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 290/527 (55%), Positives = 381/527 (72%), Gaps = 15/527 (3%)
 Frame = -3

Query  1815  LTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTG  1636
             L    S T   +++F+ CL   S    P   ++  +++P   SFSSVLQAY RN RFNT 
Sbjct  22    LVCAASATNSAHNTFVQCLVNHSE---PSHPIAEAIFTPNTPSFSSVLQAYIRNLRFNTS  78

Query  1635  SSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLR  1456
             ++ KP +I+TPLH SHV   ++C +K  ++++ RSGGHDYEG+SYV++  F ILDMFNLR
Sbjct  79    TTRKPFLILTPLHVSHVQAAIICGQKHNLQMKTRSGGHDYEGVSYVAEDPFFILDMFNLR  138

Query  1455  SIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGN  1276
             SI+VDIA     ETAWVQAGATLGE+YYRI EKS  HGFP GVCPTVGVGGHVSGGGYGN
Sbjct  139   SIEVDIAT----ETAWVQAGATLGEVYYRIAEKSRKHGFPAGVCPTVGVGGHVSGGGYGN  194

Query  1275  MIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVP  1096
             M+R++G +VD+VVDA+IVD +GR+LDR +MGEDLFWAI GGGG SFGV+L++KIKL++VP
Sbjct  195   MMRKYGTSVDNVVDAQIVDAQGRLLDRKSMGEDLFWAIAGGGGASFGVVLSYKIKLVQVP  254

Query  1095  KTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVR  916
             +TVT F+ ++   L +N  D+V  + + A    + LFIRL+L++V    K     +KTVR
Sbjct  255   ETVTVFQVQR--SLQQNATDIVYNWQHVAPTTSNDLFIRLILEVV----KDAHEGTKTVR  308

Query  915   SSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRT  736
             ++++ LFLGDS+ LLS+++  FP LGL++ DC E +W+ S+L W +    T  E LL R 
Sbjct  309   ATFIALFLGDSKTLLSLMSETFPQLGLRQSDCIETTWLRSVLFWDNIDISTPVEILLERQ  368

Query  735   PAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPH  556
             P     +LKRKSDY++ PI K   + +W KM+EL N  +  NPYGGRM EI  + TP PH
Sbjct  369   PQA-LRYLKRKSDYVKKPISKEGWEGIWNKMIELENGVMFFNPYGGRMDEISPSATPLPH  427

Query  555   RAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD  376
             RAG L+KIQY  +W + GE     HI+ IREL+ F+ PFVS+NPRQAYLNY+DLD+GT  
Sbjct  428   RAGNLWKIQYQANWNQPGEVVANHHINVIRELYKFMTPFVSKNPRQAYLNYKDLDLGTNH  487

Query  375   HG-LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             HG L SY EG VYG +Y+M N+ RLV++K++VDP NFFR+EQSIP L
Sbjct  488   HGFLSSYSEGSVYGVQYYMDNFNRLVQIKTKVDPGNFFRSEQSIPVL  534



>gb|EYU43213.1| hypothetical protein MIMGU_mgv1a021270mg [Erythranthe guttata]
Length=524

 Score =   530 bits (1366),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 281/530 (53%), Positives = 380/530 (72%), Gaps = 16/530 (3%)
 Frame = -3

Query  1818  LLTSCFSGTIPMYDSFL--HCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF  1645
             L + C+  +     S+L   CL+    + IPK+ + +I+++  + ++++VL  Y RN RF
Sbjct  6     LFSFCYFNSFHTATSYLFSDCLAN---SKIPKNQLKNIIHTQCSTNYTTVLDDYIRNGRF  62

Query  1644  NTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMF  1465
             NT ++ KP +I+TP  ES V  +V CAKK+ + +++RSGGHDYEG+SY S  TF ILDMF
Sbjct  63    NTSTTHKPALIITPFQESEVQEIVSCAKKVNLHLKIRSGGHDYEGLSYTSKTTFAILDMF  122

Query  1464  NLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsggg  1285
             NLRSID++I      ETAWVQAGATLGELY++IWE S VH FP GVC T+GVGGH+SGGG
Sbjct  123   NLRSIDLNIKE----ETAWVQAGATLGELYHKIWENSKVHAFPAGVCLTLGVGGHISGGG  178

Query  1284  yGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLL  1105
             YG M+R++G +VD+VVDA+IVD  GR++DR  MGEDLFWAI GGGGGSFG++L++KI L+
Sbjct  179   YGTMLRKYGTSVDNVVDAKIVDANGRIMDRECMGEDLFWAIRGGGGGSFGIVLSYKINLV  238

Query  1104  RVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSK  925
              VPK VT F+  +   L +N  D+V  + N A K +  LF+R+ LQ V     T      
Sbjct  239   PVPKNVTVFKVRR--TLEQNATDIVYSWQNIADKFEKELFVRVFLQAV---NSTTTPGKM  293

Query  924   TVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALL  745
             T R+S++ ++LGDS+KL+SI++  FP LGLKK+DC+EMSWI+S L W  F   T  EA+L
Sbjct  294   TARASFIAMYLGDSDKLVSIMDEKFPELGLKKEDCNEMSWIKSTLFWADFPENTPEEAML  353

Query  744   NRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTP  565
             NR      +F K KSDY++ PI K  L +++ KM+E     +  NPYGGRM+EIP T+T 
Sbjct  354   NRKSRSSLAF-KMKSDYVKTPISKGNLGTIFDKMIESKIVWMMWNPYGGRMSEIPETETA  412

Query  564   FPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIG  385
             FPHRAG ++KIQY   W E G A+D+ +I  +R+ H F+ PFVS+NPRQA+LNYRD+DIG
Sbjct  413   FPHRAGNIYKIQYLTYWNETGPASDKANIDIVRKFHDFMTPFVSKNPRQAFLNYRDIDIG  472

Query  384   TTDH-GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +TD+ G ++Y E +VYG KYF GN++RLV+VK++VDP NFFRNEQSIP L
Sbjct  473   STDNVGPNAYGEARVYGEKYFNGNFDRLVQVKTKVDPTNFFRNEQSIPVL  522



>ref|XP_002529891.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF32494.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=524

 Score =   530 bits (1364),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 282/514 (55%), Positives = 367/514 (71%), Gaps = 13/514 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D+FL CL     +  P   +   +Y+P N+SF SVLQAY +NRRF T S+ KP+ IVT L
Sbjct  19    DNFLQCLPN---HVEPSKPILEAIYTPNNSSFQSVLQAYIKNRRFLTPSTTKPLAIVTAL  75

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CAK  G+++R+RSGGHD+EG+SY+SD  F+ILDMFNLRSID+DIA     
Sbjct  76    HESHVQATVVCAKYHGMQLRIRSGGHDFEGLSYMSDVPFVILDMFNLRSIDIDIAS----  131

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGA LGELYY+I +KS VH FP G+C T+G GGH SGGGYG M+R++GL+VDH+
Sbjct  132   ETAWVQAGAILGELYYKIAKKSKVHAFPAGICLTLGAGGHFSGGGYGTMMRKYGLSVDHI  191

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA+IVDV G +LDR +MGEDLFWAI GGGG SFGVIL++KIKL+RVP  VT F  ++  
Sbjct  192   IDAQIVDVNGNILDRKSMGEDLFWAIRGGGGASFGVILSWKIKLVRVPAKVTIFSVQR--  249

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +    +V ++   A KID  LFIR   ++  P    N +  KTVR +++G FLG + 
Sbjct  250   TLEQGATGIVYKWQQVAKKIDKELFIRAQPEVQNP---RNATEKKTVRVTFIGQFLGQTS  306

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             KLL+++N  FP LGLK++DC ++SW++S + W +    + PE LLNRT   +  F K KS
Sbjct  307   KLLTLMNKKFPELGLKQEDCKQVSWLQSTMFWTNLPIESPPEVLLNRTIPAEL-FFKSKS  365

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY+++ I K  L+ +WK  L+     +  N YGGRM+EIP T TPFPHRAG LFKIQY  
Sbjct  366   DYVKDVISKKDLEKIWKMFLKTEGMVMQWNLYGGRMSEIPDTSTPFPHRAGYLFKIQYFT  425

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
              W +EG  A   HIS  RE++  +AP+VS++PR+A+LNYRDLDIG+    L ++EE +VY
Sbjct  426   LWFQEGTEASNRHISLAREMYDSMAPYVSKDPREAFLNYRDLDIGSNPSNLTNFEEAEVY  485

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             GHKYF  N+ RL +VK RVDPDNFF+NEQSIP L
Sbjct  486   GHKYFRNNFRRLTEVKKRVDPDNFFKNEQSIPPL  519



>ref|XP_010674638.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   529 bits (1362),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 283/539 (53%), Positives = 385/539 (71%), Gaps = 16/539 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSC--FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             L+FL    + ++    S    + D+ ++CL+  S   +P   +S  +Y+P N SFS+VLQ
Sbjct  14    LIFLQTLGITSAAPIISNHNSIQDTLINCLNDHS---VPSHPISPQIYAPQNPSFSTVLQ  70

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             +Y RN RFN  ++ KP+ I+T  H SH+   ++CAK+ G+E++VRSGGHDYEG+SYVS  
Sbjct  71    SYIRNLRFNESTTRKPLFIITATHVSHIQAAIICAKQHGIEMKVRSGGHDYEGLSYVSIV  130

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ++DMFN RSIDV+I      ETAWV AG+TLGE+YY I   S +H +P GVCPTVG 
Sbjct  131   PFFMVDMFNFRSIDVNI----DEETAWVDAGSTLGEVYYNIGNNSRIHAYPAGVCPTVGS  186

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH++G GYGN++R++GLTVD+++DA+IVDV GR+LDR  MGEDLFWAI GGGG SF VI
Sbjct  187   GGHITGAGYGNLMRKYGLTVDNLIDAKIVDVNGRILDRATMGEDLFWAIKGGGGASFCVI  246

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++KIKL+RVP+ VT FR  + L   +N  D+V QY + A  +D + FIRL L +    T
Sbjct  247   LSYKIKLVRVPERVTVFRVSRLL--EQNLTDIVDQYQHVAPNLDHNAFIRLTLGV----T  300

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
              ++++   T ++++  LFLGD+E L+S+++ +FP LGL+K DC EMSW+ES+L +  +  
Sbjct  301   NSSETGLLTNQATFRCLFLGDTESLISLVHENFPLLGLEKSDCLEMSWLESILFYSDYSM  360

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             GT  E LL+R P    ++LKRKSDY++ PIP++ L+ LWK M+EL    L  NPYGGRMA
Sbjct  361   GTPVETLLDRQPP-SVTYLKRKSDYVKKPIPRYGLEGLWKIMVELQPLQLTFNPYGGRMA  419

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI +  TPFPHRAG LFK+QYA++W E G    + +I   R+LH+++ PFVS+NPR+A+L
Sbjct  420   EIAANATPFPHRAGNLFKLQYAINWNEGGSERAKYYIDLTRKLHAYMTPFVSKNPREAFL  479

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             NYRDLD+G    G  SY EGK YG  YF  N++RLVK+KS VDPDNFFRNEQSIP+L R
Sbjct  480   NYRDLDLGINHQGSRSYVEGKKYGVMYFKDNFDRLVKIKSMVDPDNFFRNEQSIPTLPR  538



>ref|XP_011085610.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   528 bits (1359),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 282/527 (54%), Positives = 376/527 (71%), Gaps = 22/527 (4%)
 Frame = -3

Query  1803  FSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPK  1624
             F+ + P    FL CLS+     IP   +++I Y+P + +++SVLQ Y RN RFNT ++PK
Sbjct  25    FAASAP----FLDCLSS---RKIPPQQLANITYTPKSTNYTSVLQEYIRNSRFNTSTTPK  77

Query  1623  PVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT--FIILDMFNLRSI  1450
             P +I+TP  ES V  +V CAK  G+++++RSGGHDYEG+SY S +   FI+LD+FNLRSI
Sbjct  78    PTLILTPFLESQVQDIVTCAKISGIQLKIRSGGHDYEGLSYTSKSNNPFIVLDLFNLRSI  137

Query  1449  DVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMI  1270
             D+++      ETAWV+AGATLGELYY IW+KS VH FP GVC T+G+GGH SGGGYGN++
Sbjct  138   DINLED----ETAWVEAGATLGELYYSIWQKSKVHAFPAGVCTTLGIGGHFSGGGYGNLM  193

Query  1269  RRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKT  1090
             R+FGL+VD+VVDA+IVD  GR+LDR AMGEDLFWAI GGG  SFGV+LAFKI L+RVP  
Sbjct  194   RKFGLSVDNVVDAKIVDANGRILDRKAMGEDLFWAIRGGGAASFGVVLAFKINLIRVPPE  253

Query  1089  VTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSS  910
             VT FR  K   L  N  D+V ++   A K D  LF+R+ LQ     T   + N  +VR+S
Sbjct  254   VTVFRVTK--TLEENATDLVHRWQYIADKFDKDLFVRVFLQ-----TYAGEKNKTSVRAS  306

Query  909   YVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPA  730
             ++ LFLGD+ KL++++ S FP LGLKK++C E+SWI S+L +  +  GT   ALL R  A
Sbjct  307   FIALFLGDANKLVALIKSGFPELGLKKEECKEISWIRSVLYFADYPEGTPETALLVRKSA  366

Query  729   GDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRA  550
               ++  K KSDY++ PIPK  L     +M   GN  +  NPYGGRM EIP  + PFPHRA
Sbjct  367   FPSA-SKMKSDYVKTPIPKDGLREALNRMAASGNIWMQFNPYGGRMGEIPEAEIPFPHRA  425

Query  549   GVLFKIQYAVSWKEEGEAA-DREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDH  373
             G +FKIQY V W E G AA ++ +I  + + + F+ P+VS+NPR+A+LNYRD++IG+TD+
Sbjct  426   GNIFKIQYLVIWNEAGGAAVEKSNIENLSKFYQFMTPYVSKNPREAFLNYRDINIGSTDN  485

Query  372   GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             G  +YE+ KVYG KYF GN++RLV+VK++VDP N FRNEQSIP+L +
Sbjct  486   GGDAYEKAKVYGIKYFKGNFDRLVQVKTKVDPTNLFRNEQSIPTLRK  532



>ref|XP_010449156.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=572

 Score =   529 bits (1362),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 302/531 (57%), Positives = 394/531 (74%), Gaps = 19/531 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  + +P  +  ++  V+S ++ +FSSVL+AY RN RFNT S+PKP IIVT
Sbjct  37    VYNSFLKCFSEKTKSP--QSQITDNVFSQSSPAFSSVLRAYIRNARFNTSSTPKPTIIVT  94

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   VLC+K L   +++RSGGHDY+G+SY+SD  F ILDM NLR + VDIA   
Sbjct  95    PRSESHVSAAVLCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNLRDVSVDIAA--  152

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGHVSGGGYGNM+R FGLTVD
Sbjct  153   --NSAWISAGATLGEVYYRIWEKSRVHGFPAGVCPTVGVGGHVSGGGYGNMVRNFGLTVD  210

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++ DA+IVDV GRVLDR AMGEDLFWAI+GGGGGSFGV+L +K+KL+ VP TVT FR E+
Sbjct  211   YIEDAKIVDVNGRVLDRKAMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPSTVTVFRVEQ  270

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+VS++ + A K D +LF+R+L+Q   P T+   +  KTVR+S V LFLG 
Sbjct  271   YMN--SGAVDMVSKWQSVAPKTDPNLFMRMLIQ---PVTR---NKVKTVRASVVALFLGR  322

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++++L  +FP LGLKK++C+EM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  323   ADEVVTLLAKEFPELGLKKENCTEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDSSSFG  381

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IPK  ++SL+K+M+ELG  GL  NPYGG+MAE+  T TPFPHR   LFKI
Sbjct  382   KRKSDYVATAIPKKGIESLFKRMIELGKIGLVFNPYGGKMAEVAVTATPFPHRKK-LFKI  440

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+ F+  FVS+ PR AYLNYRD+DIG  DHG +SY+E
Sbjct  441   QYSVNWKENSPEIEKGYLNQAKVLYRFMTGFVSKKPRSAYLNYRDVDIGVNDHGKNSYKE  500

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             GKVYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L  N TG+    PG
Sbjct  501   GKVYGKKYFGVNFDRLVKIKTAVDPGNFFRNEQSIPTLP-NATGTLLPAPG  550



>ref|XP_004135723.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004158100.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=533

 Score =   527 bits (1358),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 288/513 (56%), Positives = 378/513 (74%), Gaps = 14/513 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F  CL   S    P   ++  +++P NAS+SSVL+ Y RN RFNT ++PKP +I+T L
Sbjct  28    ENFFQCLLRHSPPSYP---IAPAIFTPNNASYSSVLETYIRNLRFNTSTTPKPFLILTAL  84

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT-FIILDMFNLRSIDVDIAGGDG  1423
             HESHV   +LCA+   +++++RSGGHDYEG+SYVSD   F ILDMFNLR I VD      
Sbjct  85    HESHVKAAILCARIHNLQMKIRSGGHDYEGVSYVSDVVPFFILDMFNLREITVDAKT---  141

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              +TAWVQ GATLGE+YYR+ E +  +GFP GVCPTVGVGGH  GGGYGNM+R++GL+VD 
Sbjct  142   -KTAWVQTGATLGEVYYRVAENNKSYGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDQ  200

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             ++DA+I+DV G++LDR AMGEDLFWAI GGGG SFGV++A+KI+++ VP+TVT FR ++ 
Sbjct  201   IIDAKIIDVNGKLLDRKAMGEDLFWAIIGGGGSSFGVVVAYKIRMVPVPETVTVFRVQRT  260

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
             L    +  ++V ++   A  ID+ LFIR+   +V       +   KT+R++++ LFLGDS
Sbjct  261   LE-QNDLTEIVDEWQQVAHVIDNDLFIRVTFDVV----NGTNKGKKTLRATFIALFLGDS  315

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             E+LL ++N+ FP LGLKK DC EMSW++S+L W +F  GT  EALL+RTP    + LKRK
Sbjct  316   ERLLFVINNSFPKLGLKKSDCIEMSWLQSVLFWTNFPLGTSVEALLSRTPQV-LTHLKRK  374

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PIPK  L+ +WKKM+EL    L  NPYGGRMAEIPS  TPFPHRAG L+KIQYA
Sbjct  375   SDYVKTPIPKEGLNKIWKKMIELEKPMLTFNPYGGRMAEIPSNATPFPHRAGNLWKIQYA  434

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W EEG    +  I   R+L+ F+ PFVS+NPR A+LNYRDLDIG   +G +SY EG+V
Sbjct  435   TNWVEEGNKEAKHFIDLTRKLYKFMTPFVSKNPRTAFLNYRDLDIGVNHNGKNSYYEGRV  494

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YG KYF GN++RLVK+K++VDP NFFRNEQSIP
Sbjct  495   YGIKYFEGNFDRLVKIKTKVDPHNFFRNEQSIP  527



>ref|XP_011005333.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=532

 Score =   527 bits (1358),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 280/512 (55%), Positives = 365/512 (71%), Gaps = 14/512 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             + FL CL     N +P   +S  +Y+ AN+SF SVLQ Y  NRRF T ++PKP+ IVT L
Sbjct  31    EKFLQCLPN---NSLPSYPISEAIYTTANSSFESVLQTYINNRRFLTPTTPKPIAIVTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CAK  G+++R+RSGGHDYEG+SYVS+  F+ILDMFNLRSIDVDIA     
Sbjct  88    HESHVQATVICAKASGLQVRIRSGGHDYEGLSYVSEVPFVILDMFNLRSIDVDIAN----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YY I  KS+VH FP GVCPTVG GGH+SGGGYG ++R++GL+VD++
Sbjct  144   ETAWVQAGATLGEIYYNIANKSNVHAFPAGVCPTVGAGGHISGGGYGTLMRKYGLSVDNI  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA++VDV G +LDR  MGEDLFWAI GGGG SF V+L++K+ L+RVP+ VT F+ ++  
Sbjct  204   IDAKVVDVNGNILDRETMGEDLFWAIRGGGGASFAVVLSWKMNLVRVPEKVTVFKVDR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L  +  D+  Q+   ++++D  LFIR + Q+       +   SKT+  S+  LFLG SE
Sbjct  262   TLEEDATDIFYQWQQVSTELDKDLFIRAMPQV----ANGSQEGSKTISISFYALFLGQSE  317

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
              LLS++N  FP LGL+++DC EM WIES L W     GT  + LLNR P G  SF K KS
Sbjct  318   ALLSMMNKSFPKLGLQQKDCIEMRWIESTLFWFDLPIGTSIDVLLNR-PQGAQSFYKNKS  376

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY+   +PK  L+ +WK M++     +  NPYGGRM+EIP T TPFPHR+G LFK+QY++
Sbjct  377   DYVNQIVPKEALERIWKMMIKADPMWMQWNPYGGRMSEIPDTATPFPHRSGYLFKLQYSI  436

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W EEG  A   +IS IRE+H  +AP+V+  PR+A+ NYRDLDIG+       +E  KVY
Sbjct  437   NWDEEGTEATDRYISLIREMHDAMAPYVTSYPREAFQNYRDLDIGSNPSNQTDFERAKVY  496

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G KYF GN+ RLVK+K +VDPDNFF++EQSIP
Sbjct  497   GLKYFKGNFLRLVKIKGKVDPDNFFKHEQSIP  528



>ref|XP_008352411.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein 
[Malus domestica]
Length=524

 Score =   526 bits (1355),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 285/493 (58%), Positives = 369/493 (75%), Gaps = 9/493 (2%)
 Frame = -3

Query  1710  VYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRS  1531
             +YSP NAS+SSV  +Y RN RFNT ++ KP +I+T LHESHV   V+CA+   +++++RS
Sbjct  11    IYSPNNASYSSVFXSYIRNLRFNTSTTRKPFLILTALHESHVQISVVCAQIHNLQMKIRS  70

Query  1530  GGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSS  1351
             GGHDYEG+SYV++  F ILDMFNLRSI VDI      ETAWVQ GATLGE+YYRI EKS 
Sbjct  71    GGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKS----ETAWVQTGATLGEVYYRIAEKSK  126

Query  1350  VHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLF  1171
              HGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD++VDA++V+V G +LDR  MGEDLF
Sbjct  127   THGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHGELLDRKTMGEDLF  186

Query  1170  WAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDH  991
             WAI GGGG SFGV++A+KI L+ VP+TVT FR  +   L  N  D+V ++   A K+DD 
Sbjct  187   WAITGGGGASFGVVIAYKINLVHVPETVTVFRVPR--TLEENATDIVYRWQYIADKLDDD  244

Query  990   LFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEM  811
             LFIRL + IV   T  +  N+KT+R+S++ +FLGDSE+LLSIL+  FP LG+K+ DC+EM
Sbjct  245   LFIRLTMDIVNGTTNCSGENNKTLRASFIAMFLGDSERLLSILDKSFPELGVKQSDCNEM  304

Query  810   SWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELG  631
             SW +S+L W SF  GT  EALL+RTP    + L RKSDY++ PIPK  L  +++KM+EL 
Sbjct  305   SWAQSVLFWTSFPTGTATEALLSRTPQV-LTHLTRKSDYVKKPIPKTGLMWIFQKMIELE  363

Query  630   NTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSF  451
                +  NPYGG+M+EI +  TPFPHRAG L+KIQYA +W  EG  A   +I   R+LH +
Sbjct  364   APTMTFNPYGGKMSEISALATPFPHRAGNLWKIQYATNWNIEGTEASDHYIDLTRKLHMY  423

Query  450   LAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDP  277
             + PFVS+NPR+A+ NY+DLDIG     +G+ SY EG+ +G  YFM N++RLV VK++VDP
Sbjct  424   MTPFVSKNPREAFYNYKDLDIGINHNANGMASYLEGRGFGIMYFMHNFDRLVNVKTKVDP  483

Query  276   DNFFRNEQSIPSL  238
              NFFRNEQSIP+L
Sbjct  484   GNFFRNEQSIPTL  496



>ref|XP_006283416.1| hypothetical protein CARUB_v10004466mg [Capsella rubella]
 gb|EOA16314.1| hypothetical protein CARUB_v10004466mg [Capsella rubella]
Length=572

 Score =   528 bits (1360),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 297/531 (56%), Positives = 396/531 (75%), Gaps = 19/531 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +++SFL C S  + +P  +  ++  V+S ++ +FSSVL+AY RN RFNT S+PKP IIVT
Sbjct  37    VHNSFLKCFSEKTKSP--QSQITDNVFSQSSPAFSSVLRAYIRNARFNTSSTPKPTIIVT  94

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   V+C+K L   +++RSGGHDY+G+SY+SD  F ILDM N+R + VDIA   
Sbjct  95    PRSESHVSAAVICSKSLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNIRDVSVDIAAN-  153

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS  HGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD
Sbjct  154   ---SAWISAGATLGEVYYRIWEKSRTHGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSVD  210

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             HV DA+IVDV GRVLDR AMGEDLFWAI GGGGGS+GV+L +K+KL+ VP  VT FR E+
Sbjct  211   HVEDAKIVDVNGRVLDRKAMGEDLFWAITGGGGGSYGVVLGYKVKLVPVPSIVTVFRVEQ  270

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+VS++ + A K D +LF+R+L+Q   P T+   +  KTVR+S V LFLG 
Sbjct  271   YMN--SGAVDMVSKWQSVAPKTDRNLFMRMLIQ---PVTR---NKVKTVRASVVALFLGR  322

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++++L  +FP L LKK++C+EM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  323   ADEVVTLLRKEFPELSLKKENCTEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDTSSFG  381

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  +PK  ++SL+KKM+ELG  GL  NPYGG+MAE+P + TPFPHR   LFKI
Sbjct  382   KRKSDYVETAMPKKGIESLFKKMIELGKIGLVFNPYGGKMAEVPVSATPFPHR-NKLFKI  440

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE   A ++ ++++ R L+SF+  FVS+NPR AYLNYRD+DIG  DHG +SY+E
Sbjct  441   QYSVNWKENSPAIEKGYLNEARALYSFMTGFVSKNPRSAYLNYRDVDIGVNDHGKNSYKE  500

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L  N  G+   EPG
Sbjct  501   GEVYGRKYFGVNFDRLVKIKTAVDPGNFFRNEQSIPTLP-NAKGTLLPEPG  550



>ref|XP_002299026.2| hypothetical protein POPTR_0001s46680g [Populus trichocarpa]
 gb|EEE83831.2| hypothetical protein POPTR_0001s46680g [Populus trichocarpa]
Length=537

 Score =   526 bits (1356),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 294/547 (54%), Positives = 386/547 (71%), Gaps = 29/547 (5%)
 Frame = -3

Query  1833  LALCNLLTSCFSGTIPM-YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYAR  1657
             L L  LL+  +  T  + +++FL CL   S    P   +S+ +Y+P N S+S VLQ+Y R
Sbjct  4     LLLVFLLSISWEATSDLAHENFLQCLLNHSQLTYP---ISTAIYTPKNESYSYVLQSYIR  60

Query  1656  NRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFII  1477
             N RFN  ++PKP++I+T LHESHV   +  A++  +++++RSGGHDYEG+SYVSD  F +
Sbjct  61    NLRFNMSTTPKPLLILTALHESHVQAAISYAREHNLQMKIRSGGHDYEGVSYVSDVPFFV  120

Query  1476  LDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghv  1297
             LDMFNLRSIDVD+A     ETAW+Q GATLGE+YYRI EKS  HGFP  V PTVGVGGH 
Sbjct  121   LDMFNLRSIDVDVAS----ETAWIQVGATLGEVYYRISEKSKAHGFPASVEPTVGVGGHF  176

Query  1296  sgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFW--------------AIN  1159
              GGGYGNM+R++GL+VD+++DA++VDVKGR+LDR +MGEDLFW              AI 
Sbjct  177   GGGGYGNMMRKYGLSVDNIIDAKMVDVKGRLLDRKSMGEDLFWDGDAARVFFDVRHWAIT  236

Query  1158  ggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIR  979
             GGGG SFGV+LA+KI ++RVP+ VT F   +   + +N  D+V Q+   A  IDD LFIR
Sbjct  237   GGGGSSFGVVLAYKINIVRVPEVVTVFLVRR--NVDQNATDIVEQWQQVAYNIDDDLFIR  294

Query  978   LLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIE  799
             L + +V   T+ ++   KTVR+++  LFLGDSE+LLS  N+ FP LGL + DC+EMSW+E
Sbjct  295   LTMNVVNSTTRISE---KTVRTTFRALFLGDSERLLSFTNASFPKLGLLRSDCTEMSWLE  351

Query  798   SMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
             S+L W     GT P  LL RTP     F KRKSDY+Q PIP+  L+ +WKKM+EL    L
Sbjct  352   SVLFWTDPPLGT-PTDLLRRTPPSLVHF-KRKSDYVQKPIPRDGLEGIWKKMIELQVPQL  409

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPF  439
               NPYGG+M EIP+T+ PFPHRAG L+K+QYA  W + G+     +I   R+L+S++ PF
Sbjct  410   TFNPYGGKMWEIPATERPFPHRAGNLWKVQYATDWNKGGQGKANYYIDLTRQLYSYMTPF  469

Query  438   VSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRN  259
             VS+NPRQA+LNYRDLD+G   +G  SY EG+VYG KYF  N+ RLVK+K++VDP NFFRN
Sbjct  470   VSKNPRQAFLNYRDLDLGINHNGKESYLEGRVYGIKYFQENFNRLVKIKTKVDPGNFFRN  529

Query  258   EQSIPSL  238
             EQSIP+ 
Sbjct  530   EQSIPTF  536



>ref|XP_010501432.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=536

 Score =   526 bits (1356),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 290/518 (56%), Positives = 378/518 (73%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C +  +  P P  L S +V     A+F+ VL+AY RN RFNT +SPKP I++ 
Sbjct  28    IYQNFLQCFTNQTKAP-PNSL-SDVVLPKTAAAFTPVLRAYIRNARFNTTASPKPAIVIA  85

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                ESHV   V+C K L ++++ RSGGHDYEG+SYVS+  F +LDM NLR++ VD A   
Sbjct  86    ARSESHVQAAVVCTKSLNIQLKTRSGGHDYEGVSYVSNVPFFVLDMSNLRNVTVDPAT--  143

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWV AGATLGE+YYRIWEK+  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  144   --ESAWVGAGATLGEVYYRIWEKTKTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  201

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV G++LDR AMGEDLFWAINGGGG SFGVILAF+IKL+ VP TVT FR EK
Sbjct  202   YVTDAKIVDVNGQILDRKAMGEDLFWAINGGGGASFGVILAFRIKLVPVPPTVTVFRVEK  261

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  D+V ++   A K D  LF+RLLLQ V     T + N +TVR+S V +FLG+
Sbjct  262   --NLDENALDMVHKWQFVAPKTDPGLFMRLLLQPV-----TRNQN-QTVRASVVAMFLGN  313

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  ++S+L  DFP LGLKK++C+EM+WI+S++ W +  N T  KPE LL+R P   A FL
Sbjct  314   SNDVMSLLTKDFPELGLKKENCTEMTWIQSVMWWANNDNATSIKPEILLDRDP-DSAYFL  372

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSD+++  I K  LD L+KKM+E+G  GL  NPYGG M E+P+T+TPFPHR   L+K+
Sbjct  373   KRKSDFVEKEITKEGLDFLFKKMIEVGKIGLVFNPYGGIMTEVPTTKTPFPHRTK-LYKV  431

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G  A+   + + R  +S++AP+V++NPR  Y+NYRDLDIG   HG +SY E
Sbjct  432   QHSMNWKDPGTEAESSFLQKARTFYSYMAPYVTKNPRHTYINYRDLDIGVNSHGPNSYRE  491

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              +VYG  YF  N++RLVKVK+ VDP NFFR+EQSIP+L
Sbjct  492   AEVYGRMYFGENFDRLVKVKTAVDPLNFFRDEQSIPTL  529



>ref|XP_007023054.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25676.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=534

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 289/536 (54%), Positives = 389/536 (73%), Gaps = 20/536 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
             ++FL LCN   S  +  I    S L CLS  S    P   +SS+ Y P N S++S+LQ+Y
Sbjct  11    IIFL-LCN---SMANSDILEESSILQCLSNHSVTSPP---ISSVTYFPTNPSYTSILQSY  63

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RN RF + ++ KP+ IV P H+SH+   ++C K  G+E+R+RSGGHDY+G+SYVS A F
Sbjct  64    IRNLRFTSATTAKPLFIVVPSHDSHIQASIICCKIHGLEMRIRSGGHDYDGLSYVSAAPF  123

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
             +ILDMFNLRSI VD+      E+AWV++GATLGEL+YRI EKS  HGFP GVCPTVGVGG
Sbjct  124   MILDMFNLRSIIVDMED----ESAWVESGATLGELFYRIAEKSKNHGFPAGVCPTVGVGG  179

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H SGGGYGNM+R+ GL+ D++VDA++VD  GR+LDR +MGEDLFWAI GGGG SFGVIL+
Sbjct  180   HFSGGGYGNMMRKHGLSTDNIVDAKLVDANGRILDRESMGEDLFWAIRGGGGASFGVILS  239

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             +KIK++ VP+ VT FR EK   L +   D+V ++   A KID++LFIR++L    P TK 
Sbjct  240   WKIKVVSVPEIVTVFRIEK--TLEQGATDIVHKWQYIADKIDENLFIRVVLL---PVTK-  293

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT  763
                + +++++ ++ LFLG++EKL+S++N  FP LGL  ++C EMSWIES+L W ++  GT
Sbjct  294   --KHLQSIKAKFIALFLGNAEKLISLMNGTFPELGLSPENCVEMSWIESVLFWSNYPKGT  351

Query  762   KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEI  583
               E LLNR P  +  +LK+KSDY+Q PI K  L+ +WKKM+EL    L +NPYGG+M+EI
Sbjct  352   SLEVLLNRHPQPE-KYLKKKSDYVQEPISKKDLEGIWKKMIELRRPALTLNPYGGKMSEI  410

Query  582   PSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNY  403
               ++TPFPHRAG ++KIQY+V+WKE+G  A    + QI  ++ ++ P+VS+ PR +YLNY
Sbjct  411   SESETPFPHRAGNIYKIQYSVTWKEDGAEASDRSLDQITRIYDYMTPYVSKYPRSSYLNY  470

Query  402   RDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             RD+DIG  + G  SY E KV+  KYF GN++RLV+VKS VDP NFFR EQSIPSL+
Sbjct  471   RDVDIGINEIGNASYSEAKVWASKYFKGNFDRLVQVKSMVDPGNFFRYEQSIPSLT  526



>ref|NP_193816.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 emb|CAB45850.1| reticuline oxidase-like protein [Arabidopsis thaliana]
 emb|CAB79084.1| reticuline oxidase-like protein [Arabidopsis thaliana]
 dbj|BAH20300.1| AT4G20840 [Arabidopsis thaliana]
 gb|AEE84367.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=539

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 289/518 (56%), Positives = 384/518 (74%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SF+ C S  + +P  +  ++  V+S  N SFSSVL+AY RN RFNT S+PKP IIVT
Sbjct  34    IYESFVQCFSDKTKSPQAQ--ITDNVFSRTNPSFSSVLRAYIRNGRFNTSSTPKPAIIVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  + HV   V C+K L   +++RSGGHDYEG+SY+SD  F ILDM NLR + VDIA   
Sbjct  92    PRSDIHVSAAVTCSKSLNFLLKIRSGGHDYEGLSYISDKPFFILDMSNLRDVSVDIAD--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AW+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD
Sbjct  150   --QSAWISAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHISGGGYGNMLRKFGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +++DA+IVDV G++LDR +MGEDLFWAI+GGGG SFGV+L +K+KL+ VP+TVT FR EK
Sbjct  208   NLIDAKIVDVNGQILDRKSMGEDLFWAISGGGGASFGVVLGYKVKLVPVPETVTVFRVEK  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR++ V LFLG 
Sbjct  268   YM--DSGAVDMVHKWQSVGPKTDRNLFLRMLIQ---PVTR---KKVKTVRATVVALFLGR  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +E+++++L  +FP L LKK++CSEM+W +S L W +  N T+  P+  L+R     A+F 
Sbjct  320   AEEVVALLGKEFPELSLKKENCSEMTWFQSALWWDNRVNPTQIDPKVFLDRN-LDRANFG  378

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+ + IP+  ++SL+KKM ELG  GL  NPYGG+MAE+    TPFPHR+  LFKI
Sbjct  379   KRKSDYVASEIPRDGIESLFKKMTELGKIGLVFNPYGGKMAEVTVNATPFPHRSK-LFKI  437

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+W+E     ++  ++Q   L+SF+  FVS+NPR AYLNYRD+DIG  DHG +SYEE
Sbjct  438   QYSVTWQENSVEIEKGFLNQANVLYSFMTGFVSKNPRNAYLNYRDVDIGVNDHGTNSYEE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLVKVK+  DPDNFFRNEQSIP++
Sbjct  498   GEVYGRKYFGDNFDRLVKVKTAADPDNFFRNEQSIPTV  535



>ref|XP_010434269.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=574

 Score =   527 bits (1357),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 301/531 (57%), Positives = 395/531 (74%), Gaps = 19/531 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ SFL C S  + +P  +  ++  V+S ++ +FSSVL+AY RN RFNT S+PKP+IIVT
Sbjct  39    VHTSFLKCFSEKTKSP--QSQITDNVFSQSSPAFSSVLRAYIRNARFNTSSTPKPMIIVT  96

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   VLC+K L   +++RSGGHDY+G+SY+SD  F ILDM NLR + VDIA   
Sbjct  97    PRSESHVSAAVLCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNLRDVSVDIAAN-  155

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS V GFP GVCPTVGVGGHVSGGGYGNM+R+FGLTVD
Sbjct  156   ---SAWISAGATLGEVYYRIWEKSRVRGFPAGVCPTVGVGGHVSGGGYGNMVRKFGLTVD  212

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             ++ DA+IVDV GRVLDR AMGEDLFWAI+GGGGGS+GV+L +K+KL+ VP TVT FR E+
Sbjct  213   YIEDAKIVDVNGRVLDRKAMGEDLFWAISGGGGGSYGVVLGYKVKLVPVPSTVTVFRVEQ  272

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ + A K D +LF+R+L+Q   P T+   +  KTVR+S V LFLG 
Sbjct  273   YMN--SGAVDMVYKWQSVAPKTDPNLFMRMLIQ---PVTR---NKVKTVRASVVALFLGR  324

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++S+L  +FP LGLKK++C+EM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  325   ADEVVSLLRKEFPELGLKKENCTEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDSSSFG  383

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPYGG+MAE+P T TPFPHR   LFKI
Sbjct  384   KRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPYGGQMAEVPVTATPFPHRKK-LFKI  442

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE   A ++ +++Q + L+ F+  FVS+NPR AYLNYRD+DIG  DHG +SY+E
Sbjct  443   QYSVNWKENSPAIEKGYLNQAKVLYRFMTGFVSKNPRSAYLNYRDVDIGVNDHGKNSYKE  502

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L  N  G+    PG
Sbjct  503   GEVYGKKYFGVNFDRLVKIKTAVDPGNFFRNEQSIPTLP-NAKGTLLPAPG  552



>ref|XP_010462643.1| PREDICTED: reticuline oxidase-like protein, partial [Camelina 
sativa]
Length=522

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 286/518 (55%), Positives = 376/518 (73%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C +  +    P D +S +V     A+F+ VL+AY RN RFNT +SPKP I++ 
Sbjct  14    IYQNFLQCFTNQTK--APPDSLSDVVLPKTAAAFTPVLRAYIRNARFNTTASPKPAIVIA  71

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                ESHV   V+C K L ++++ RSGGHDYEGISYVS+  F +LDM NLR++ VD A   
Sbjct  72    ARSESHVQAAVVCTKSLNIQLKTRSGGHDYEGISYVSNVPFFVLDMSNLRNVTVDPAS--  129

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWV AGATLGE+YYRIWEK+  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  130   --ESAWVGAGATLGEVYYRIWEKTKTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  187

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V D +I+DV G++LDR AMGEDLFWAINGGGG SFGVILAF+IKL+ VP TV  FR EK
Sbjct  188   YVTDTKIIDVNGQILDRKAMGEDLFWAINGGGGASFGVILAFRIKLVPVPPTVIVFRVEK  247

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  D+V ++   A K D  LF+RLLLQ   P T+   +  +TVR+S V +FLG+
Sbjct  248   --NLDKNALDMVHKWQFVAPKTDPGLFMRLLLQ---PVTR---NKIQTVRASVVAMFLGN  299

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  ++++L  DFP LGLKK++C+EM+WI+S++ W +  N T  KPE LL+R P   A FL
Sbjct  300   SNDVMTLLTKDFPELGLKKENCTEMTWIQSVMWWANNDNATAIKPEILLDRDP-DSAYFL  358

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSD++   I K  LD L+KKM+E+G  GL  NPYGG M E+P+T+TPFPHR   L+KI
Sbjct  359   KRKSDFIDKEITKEGLDFLFKKMIEVGKIGLVFNPYGGIMTEVPTTKTPFPHRTK-LYKI  417

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G  A+   + + R  +S++AP+V++NPR  Y+NYRDLDIG   HG +SY E
Sbjct  418   QHSMNWKDPGTEAESSFLQKARTFYSYMAPYVTKNPRHTYINYRDLDIGVNSHGTNSYRE  477

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              +VYG  YF  N++RLVKVK+ VDP NFFR+EQSIP+L
Sbjct  478   AEVYGRMYFGENFDRLVKVKTAVDPQNFFRDEQSIPTL  515



>ref|XP_008441073.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=527

 Score =   524 bits (1350),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 291/541 (54%), Positives = 401/541 (74%), Gaps = 20/541 (4%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             SSS   L F +L  L + C S    +  SFL CL++   N  PK  +S  +++P +ASF 
Sbjct  5     SSSSSILTFFSLILLFSPCLSSDT-VQQSFLQCLAS---NSHPKFPISDAIFTPDDASFL  60

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
              VL +Y RNR F T ++PKP++IVT  H SHV   V+CAK++ +EIR+RSGGHDYEG+SY
Sbjct  61    PVLNSYIRNRIFQTPTTPKPLVIVTAKHPSHVQSTVVCAKRVALEIRIRSGGHDYEGLSY  120

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VS   FI+LD+FNLR+I+VDI      ETAWV+AGAT+GELYY I ++S VH FPGGVCP
Sbjct  121   VSQQPFIVLDLFNLRAINVDIPT----ETAWVEAGATMGELYYAIAKQSKVHAFPGGVCP  176

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             T+G GGH+SGGGYGN++R+FGL+VD+++DA+IV+V+G++L+R  MGEDLFWAI GGGGGS
Sbjct  177   TLGAGGHISGGGYGNLMRKFGLSVDNILDAQIVNVEGKILNRQQMGEDLFWAIRGGGGGS  236

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVIL++KIKL++VP TVT F  E+   +     DVV ++ N   K+D +LFIR+++   
Sbjct  237   FGVILSWKIKLVQVPSTVTVFDVER--KIEEGATDVVWEWQNVMDKLDGNLFIRMMMH--  292

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
                + + ++  KT +++ V LFLG  EKL+ I+N + P+L L+KQ+C EM+WIES+L + 
Sbjct  293   ---SASGENGQKTGKTTLVALFLGPVEKLMEIVNQNIPSLKLQKQECIEMNWIESVLFFA  349

Query  780   SFGNGTKPEALLNR-TPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
             +F NGT PEALL R +P+G  ++LKRKSDY++  I K  ++ +WK ++E+   GL  NPY
Sbjct  350   NFANGTAPEALLKRESPSG--TYLKRKSDYVREGISKKGIEDIWKLLMEIEGVGLTCNPY  407

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM EI  T TPFPHRAGV FKIQY+ +WK+EGE   +E+I   R+L+  ++P+V++NP
Sbjct  408   GGRMGEISETATPFPHRAGVKFKIQYSANWKKEGEEEAKENIELARKLYEAMSPYVTKNP  467

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R+A+LNYRD+D+G++ +   S  EG+VYG KYF GN+ERLV VK++VDP NFFRNEQSIP
Sbjct  468   REAFLNYRDIDVGSSRN--WSLAEGRVYGEKYFKGNFERLVNVKTKVDPQNFFRNEQSIP  525

Query  243   S  241
             +
Sbjct  526   T  526



>ref|XP_010476115.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=536

 Score =   525 bits (1351),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 384/543 (71%), Gaps = 22/543 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIP----MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             +F + L L +   S      P    +Y +FL C +  +  P P  L S +V     A+F+
Sbjct  3     IFCLILLLFSFFVSTSLAVEPPPDTIYQNFLQCFTNQTKAP-PNSL-SDVVLPKTAAAFT  60

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
              VL+AY RN RFNT +SPKP I++    ESHV   V+C K L ++++ RSGGHDYEGISY
Sbjct  61    PVLRAYIRNARFNTTTSPKPAIVIAARSESHVQAAVVCTKSLNIQLKTRSGGHDYEGISY  120

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VS+  F +LDM NLR++ VD A     E+AWV AGATLGE+YYRIWEK+  HGFP GVCP
Sbjct  121   VSNNPFFVLDMSNLRNVTVDPAT----ESAWVGAGATLGEVYYRIWEKTKTHGFPAGVCP  176

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVG GGH+SGGGYGNMIR++GL+VD+V DA+IVDV G++LDR AMGEDLFWAINGGGG S
Sbjct  177   TVGAGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGQILDRKAMGEDLFWAINGGGGAS  236

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVILAF+IKL+ VP TVT FR EK   L  N  D+V ++   A K D  LF+RLLLQ  
Sbjct  237   FGVILAFRIKLVPVPPTVTVFRVEK--NLDENALDMVHKWQFVAPKTDPGLFMRLLLQ--  292

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
              P T+   +  +TVR+S V +FLG+S  + S+L  DFP LGLKK++C+EM+WI+S++ W 
Sbjct  293   -PVTR---NKIQTVRASVVAMFLGNSNDVFSLLTKDFPELGLKKENCTEMTWIQSVMWWA  348

Query  780   SFGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             +  N T  KPE LL+R P   A FLKRKSD++   I K  LD L+KKM+E+G  GL  NP
Sbjct  349   NNDNATAIKPEILLDRDP-DSAYFLKRKSDFVDKEITKEGLDFLFKKMIEVGKIGLVFNP  407

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG M E+P+T+TPFPHR   L+K+Q++++WK+ G  A+   + + R  +S++AP+V++N
Sbjct  408   YGGIMTEVPTTKTPFPHRTK-LYKVQHSMNWKDPGTEAESSFLQKARTFYSYMAPYVTKN  466

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR  Y+NYRDLDIG   HG +S+ E +VYG  YF  N++RLVKVK+ VDP NFFR+EQSI
Sbjct  467   PRHTYINYRDLDIGVNSHGPNSFREAEVYGRMYFGENFDRLVKVKTAVDPQNFFRDEQSI  526

Query  246   PSL  238
             P+L
Sbjct  527   PTL  529



>ref|XP_009362291.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=532

 Score =   525 bits (1351),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 290/529 (55%), Positives = 384/529 (73%), Gaps = 29/529 (5%)
 Frame = -3

Query  1812  TSCFSGTIPMYDSFLHCLS--TVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNT  1639
              SC + +   Y+ FL CLS  + S+NPI     S  +++P +ASFSS+LQ+Y RN RF  
Sbjct  22    VSCINSSSVEYN-FLQCLSNHSHSSNPI-----SEALFTPKSASFSSILQSYVRNLRFMD  75

Query  1638  GSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS-DAT-FIILDMF  1465
                PKP++I+   HESHV   V+CAK LG+EIR+RSGGHDYEG+SYVS DA  FI+LDMF
Sbjct  76    PIIPKPMVIIAAKHESHVQATVICAKTLGLEIRIRSGGHDYEGVSYVSRDAKDFILLDMF  135

Query  1464  NLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsggg  1285
             NLRSI+VD+A     E+AWVQ+GA LGE++Y I++KS  H FP GVCPT+G GGH +GGG
Sbjct  136   NLRSINVDLAD----ESAWVQSGAILGEIFYAIFKKSKYHAFPAGVCPTIGAGGHFTGGG  191

Query  1284  yGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLL  1105
             YGNM+R++GL+ D++VDA+IV+V G +LDR +M EDLFWAI GGGG SFGVILA+KIKL+
Sbjct  192   YGNMMRKYGLSSDNIVDAKIVNVNGTILDRKSMREDLFWAIRGGGGSSFGVILAWKIKLV  251

Query  1104  RVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSK  925
             RVP  VT F  +K L       D++ ++   A K+D+ LFIR + + V          ++
Sbjct  252   RVPAMVTVFDVKKTLA--EGATDILVKWQQVADKLDNDLFIRAVHKPV----------NR  299

Query  924   TVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKP-EAL  748
             T+  S+V LFLG+S++LL +++   P LGL+K+DC EMSWI+S+L W  + NGT P + L
Sbjct  300   TIEVSFVSLFLGNSDRLLKLMSQSLPQLGLQKKDCIEMSWIQSVLFWADYRNGTTPPDVL  359

Query  747   LNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQT  568
             LNR P+    FLKRKSDY++ PI K  L++LWK M+ +G   +  NPYGG+M+EIP T T
Sbjct  360   LNRFPSSGKVFLKRKSDYVKEPISKTDLEALWKVMIGIGEVMMLWNPYGGKMSEIPETAT  419

Query  567   PFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDI  388
             PFPHRAG LFKIQY+V+WKEEG  A ++++  +R+L   + P VS+NPR+A+ NYRDLD+
Sbjct  420   PFPHRAGNLFKIQYSVNWKEEGVEATKKYLRLMRKLFEAMTPHVSKNPREAFYNYRDLDV  479

Query  387   GTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             GT   G   Y E KVYG KYF GN+ERLV++K+ VDPDNFFRNEQSIP+
Sbjct  480   GTNLKG--GYTEAKVYGTKYFKGNFERLVRIKTAVDPDNFFRNEQSIPT  526



>ref|XP_003547339.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN14297.1| Reticuline oxidase-like protein [Glycine soja]
Length=559

 Score =   525 bits (1353),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 286/540 (53%), Positives = 385/540 (71%), Gaps = 16/540 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             +SS+ +  + + L  L T+C   +    ++F+HCL   S    P   +S+ +++  ++SF
Sbjct  3     LSSTTLLPIVVLLSLLCTACARNSAE--NNFVHCLVNHSE---PSHPISAAIFTQKSSSF  57

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
             SSVLQAY RN RFNT ++ KP +IVTP   SHV   ++CAKK  + +++RSGGHDYEG+S
Sbjct  58    SSVLQAYIRNLRFNTSTTHKPFLIVTPFQVSHVQAAIVCAKKHSLLMKIRSGGHDYEGVS  117

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             YV+   F ILDMFNLRSI++D+      ETAWVQAGATLGE+YYRI EKS  HGFP GVC
Sbjct  118   YVASQPFFILDMFNLRSIEIDM----DTETAWVQAGATLGEVYYRIAEKSKTHGFPAGVC  173

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH+SGGGYGN++R++G +VD+VVDA IVD +GR+L+R  MGEDLFWA+ GGGGG
Sbjct  174   PTVGVGGHISGGGYGNLMRKYGTSVDNVVDAHIVDAQGRLLNRRTMGEDLFWAVRGGGGG  233

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGV+LA+KIKL+RVP+ VT F+  +   L +N  D+V  + + A  ID+ LFIRL+L++
Sbjct  234   SFGVVLAYKIKLVRVPEKVTVFQVGR--TLEQNATDIVYNWQHVAPSIDNDLFIRLILEV  291

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
             V        + +KTVR++++ LFLGDS+ L+S+++  FP LGLK+ DC E +W+ S+L W
Sbjct  292   V----NGTQTATKTVRATFIALFLGDSKSLVSLMDEKFPQLGLKQFDCIETTWLRSVLFW  347

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
              +    T  E LL R P     +LKRKSDY++ PI K   + +W KM+EL    +  NPY
Sbjct  348   DNIDIATPVEILLERQPQS-FKYLKRKSDYVKKPISKEGWEGIWNKMIELEKAIMYFNPY  406

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRMAEIPST+T FPHRAG L+KIQY  +W E GE     HI+ +RELH ++ PFVS+NP
Sbjct  407   GGRMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINLVRELHKYMTPFVSQNP  466

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             RQA++ Y+DL++G   HG + Y EG  YG +YF  N+ RLV++K+RVDP NFFR EQSIP
Sbjct  467   RQAFICYKDLELGINHHGYYGYFEGSAYGVQYFDDNFRRLVQIKTRVDPSNFFRTEQSIP  526



>ref|XP_004295451.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=534

 Score =   524 bits (1350),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 285/514 (55%), Positives = 377/514 (73%), Gaps = 12/514 (2%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D+F+ CL + S   +P   +   +Y+P NAS+SSVL++Y RN RFN   + KP +I+T L
Sbjct  31    DNFVSCLLSHS---LPSHPIGPAIYTPNNASYSSVLESYIRNLRFNESYTRKPYLIITAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             H SHV  V+LCA+K  +++++RSGGHDYEG+SYV++  F ILD+FNLR+I+VDI      
Sbjct  88    HVSHVQQVILCAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDLFNLRTINVDIKT----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YYRI EKS VHGFP GVCPTVGVGG  SGGGYG M+R++GL+VD++
Sbjct  144   ETAWVQAGATLGEVYYRIHEKSKVHGFPAGVCPTVGVGGLFSGGGYGVMLRKYGLSVDNI  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV GR+LDR +MGEDLFWAI GGGG SFGV++A+KI L+ VP+TVT F+  +  
Sbjct  204   VDAQIVDVHGRLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVPVPETVTVFKVIR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +N  D+V  +   A K+D+ LFIRL + +V      + +  KT+R++++ LFLGDS 
Sbjct  262   TLEQNATDIVYHWQYVAHKLDNDLFIRLTMDVVN--VTGSQTGEKTLRATFMALFLGDSA  319

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             +LLS++N  FP LGLK+ DC EMSW+ES L W SF NGT  +ALL R P    + LKRKS
Sbjct  320   RLLSVMNKSFPELGLKQSDCQEMSWVESTLFWTSFPNGTALDALLRRDPQV-LTHLKRKS  378

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY++ PIPK  L  + +KM+EL    L  NPYGGRMAEI ++  PFPHRAG L+K+QYA 
Sbjct  379   DYVKQPIPKAGLKWIIQKMIELQTPMLTFNPYGGRMAEIAASAKPFPHRAGNLWKVQYAT  438

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W   G  A  ++I   R+L  ++ PFVS+NPR+A+ NY+DLDIG   +   SY EG+VY
Sbjct  439   NWNASGSEAAEKYIDLTRKLFKYMTPFVSKNPREAFFNYKDLDIGINHNDKGSYFEGRVY  498

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G KYF  N+++LV +K++VDP NFFRNEQSIP+L
Sbjct  499   GVKYFKENFDKLVLIKTKVDPGNFFRNEQSIPTL  532



>gb|KFK31563.1| hypothetical protein AALP_AA6G128100 [Arabis alpina]
Length=535

 Score =   524 bits (1350),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 289/518 (56%), Positives = 379/518 (73%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +++SF+ C S  + +P  +  ++  V+S  N SFSSVL+AY RN RFNT S+ KP II+T
Sbjct  30    VHESFVQCFSDKTKSP--QTQITQNVFSQTNPSFSSVLRAYIRNARFNTSSTLKPTIIIT  87

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   V+CAK L    ++RSGGHDY+G+SY+SD  F ILDM NLR ++++IA   
Sbjct  88    PRSESHVSAAVICAKPLNFVFKIRSGGHDYDGLSYISDKPFFILDMSNLRDVNINIAD--  145

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ++AW+ AGATLGE+YY IWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  146   --QSAWISAGATLGEVYYNIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMVRKYGLSVD  203

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GR+LDR AMGEDLFWAI GGGG SFGV+L +K+KL+ VP+TVT FR E+
Sbjct  204   YVEDAKIVDVNGRILDRKAMGEDLFWAICGGGGASFGVVLGYKVKLVPVPETVTVFRVEQ  263

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V  FLG 
Sbjct  264   YM--DSGAVDMVYKWQSVGPKTDPNLFMRMLIQ---PVTR---KKVKTVRASVVAQFLGR  315

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             +  ++S+L  +FP LGLKK DC+EM+W++S L W +  N T   P+  L+R     ASF 
Sbjct  316   ANDVVSLLAKEFPELGLKKGDCTEMTWLQSALWWDNHVNATMTDPKVFLDRE-LDTASFG  374

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+ + IP+  ++SL+KKM+ELG  GL  NPYGG+MAE+    TPFPHR   LFKI
Sbjct  375   KRKSDYVASEIPRDGIESLFKKMIELGKIGLVFNPYGGKMAEVAEDATPFPHRKK-LFKI  433

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++  ++Q + L+SF+  FVS+NPR AYLNYRD+DIG  DHG  SYEE
Sbjct  434   QYSVNWKESSAEIEKGFLNQAKVLYSFMTGFVSKNPRNAYLNYRDVDIGVNDHGAKSYEE  493

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+ YG KYF  N++RLVK+K+ VDPDNFFRNEQSIP+L
Sbjct  494   GEEYGRKYFGDNFDRLVKIKTAVDPDNFFRNEQSIPTL  531



>ref|XP_010439562.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=542

 Score =   524 bits (1350),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 396/542 (73%), Gaps = 21/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG---TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             V  + L L  L  S F+    +  +Y+SF+ C S  + +P  +  ++  V+S  N S+SS
Sbjct  12    VLFIVLFLVTLPLSMFAAPPSSDSIYESFVQCFSDKTKSP--QTQITDNVFSQTNPSYSS  69

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFNT S+PKP IIVTP  ESHV   V+C+K L   +++RSGGHDYEG+SY+
Sbjct  70    VLRAYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKSLNFLVKIRSGGHDYEGLSYI  129

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDM NLR + VDIA     ++AW+ AGATLGE+YY IW+KS VHGFP GVCPT
Sbjct  130   SDKPFFILDMSNLRDVSVDIAD----QSAWISAGATLGEVYYGIWQKSKVHGFPAGVCPT  185

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SG GYGNM+R+FGL+VD+V DA++VDVKG++LDR AMGEDLFWAI+GGGGGSF
Sbjct  186   VGVGGHLSGAGYGNMVRKFGLSVDYVEDAKLVDVKGQILDRKAMGEDLFWAISGGGGGSF  245

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L +K+KL+ VP+TVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   
Sbjct  246   GVVLGYKVKLVPVPETVTVFRVEQYM--DSGAVDMVYKWQSVGPKTDPSLFMRMLIQ---  300

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+      KTVR++ V LFLG +++++++L  +FP LGLKK+ C EM+WI+S+L W +
Sbjct  301   PVTR---KKVKTVRATVVALFLGRADEVVALLAKEFPELGLKKESCQEMTWIQSVLWWDN  357

Query  777   FGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N TK  P+ LL+R     ASF KRKSDY+ + IP+  + SL+KKM+ELG  GL  NPY
Sbjct  358   DENATKTNPKVLLDRE-LDTASFGKRKSDYVASEIPRDGIKSLFKKMIELGKIGLVFNPY  416

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+MAE+    TPFPHR   LFKIQY+V+WKE   A ++  ++Q + L+SF+  FVS+NP
Sbjct  417   GGKMAEVAVDATPFPHRKK-LFKIQYSVNWKENSAAIEKGFLNQAKVLYSFMTGFVSKNP  475

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AYLNYRD+DIG  DHG  SY+EG+VYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP
Sbjct  476   RNAYLNYRDVDIGVNDHGADSYKEGEVYGRKYFGENFDRLVKIKTAVDPENFFRNEQSIP  535

Query  243   SL  238
             +L
Sbjct  536   TL  537



>ref|XP_002869923.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46182.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   524 bits (1350),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 295/542 (54%), Positives = 391/542 (72%), Gaps = 21/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSG---TIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             V    L L +L  S F+    +   Y+SF+ C S  + +P  +  ++  V+S  N SFSS
Sbjct  10    VLFFVLFLISLPFSTFAAPPSSDSTYESFVQCFSDKTKSP--QTQITDNVFSQTNPSFSS  67

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFNT  +PKP IIVTP  +SHV   V C+K L   +++RSGGHDYEG+SY+
Sbjct  68    VLRAYIRNGRFNTSFTPKPTIIVTPRSDSHVSAAVTCSKTLNFLLKIRSGGHDYEGLSYI  127

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDM NLR + VDIA     ++AW+ AGATLGE+YYRIWEKS VHGFP GVCPT
Sbjct  128   SDKPFFILDMSNLRDVSVDIAD----QSAWISAGATLGEVYYRIWEKSKVHGFPAGVCPT  183

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGHVSGGGYGNM+R+FGL+VD+++DA+IVDV G+VLDR AMGEDLFWAI GGGG SF
Sbjct  184   VGVGGHVSGGGYGNMLRKFGLSVDNLIDAKIVDVNGQVLDRKAMGEDLFWAICGGGGASF  243

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L +K+KL+ VP+TVT FR EKY+       D+V ++ +   K D +LF+R+L+Q   
Sbjct  244   GVVLGYKVKLVPVPETVTVFRVEKYMD--SGAVDMVHKWQSVGPKTDRNLFLRMLIQ---  298

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+      KTVR++ V LFLG +++++++L  +FP L LKK++C EMSW +S L W +
Sbjct  299   PATR---KKVKTVRATVVALFLGRADEVVALLRKEFPELSLKKENCIEMSWFQSALWWDN  355

Query  777   FGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N T+  P+  L+R     A+F KRKSDY+ + IP+  ++SL+KKM+ELG  GL  NPY
Sbjct  356   RVNATQIDPKVFLDRN-LDKANFGKRKSDYVASEIPRDGIESLFKKMIELGKIGLVFNPY  414

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG+MAE+    TPFPHR   LFK+QY+V+W+E     ++  ++Q   L+SF++ FVS+NP
Sbjct  415   GGKMAEVTVNSTPFPHR-NKLFKVQYSVTWQENSAEIEKGFLNQANVLYSFMSGFVSKNP  473

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R AYLNYRD+DIG  +HG +SYEEG+VYG KYF  N++RLVKVK+ VDPDNFF +EQSIP
Sbjct  474   RNAYLNYRDVDIGVNNHGANSYEEGEVYGRKYFGDNFDRLVKVKTAVDPDNFFMHEQSIP  533

Query  243   SL  238
             +L
Sbjct  534   TL  535



>emb|CDP12594.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 281/514 (55%), Positives = 374/514 (73%), Gaps = 16/514 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +F+ CL   S+  I     S+++Y+P N+SF +VLQAY RN RFN  ++ KP +I+T
Sbjct  28    VHQTFVQCLEKHSSPNI-----SAVIYTPNNSSFPTVLQAYIRNLRFNESTTRKPFLILT  82

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
              L  SH+   ++CAK  G++++ RSGGHDYEG+SY+S+  F ILD+FN+RSI V+I    
Sbjct  83    ALDVSHIQAAIICAKAQGLQMKTRSGGHDYEGVSYISEVPFFILDLFNIRSISVNIEE--  140

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQ GATLGE+YYRI+EKS VHGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD
Sbjct  141   --ETAWVQVGATLGEVYYRIYEKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVD  198

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +++DA+I+DV GR+LDR AMGEDLFWAI GGG  SFGV LA+KI L+RVP  VT FR E+
Sbjct  199   NIIDAQIIDVNGRILDRAAMGEDLFWAITGGGASSFGVALAYKINLVRVPPKVTVFRVER  258

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                  +N   +V ++   A K+D+ +FIR+++ +V      N +  KT+RS++  LFLGD
Sbjct  259   --TYEQNATFLVHRWQEVADKLDNDIFIRMIIDVV----NNNRTGGKTIRSAFFTLFLGD  312

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             S +LLS++N  FP LGL++ DC EMSW ES++ + SF  GT  + LL+R P    + LKR
Sbjct  313   SARLLSLMNESFPELGLRQSDCIEMSWAESVIYYTSFPLGTPVDMLLSRVPQV-LTHLKR  371

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDYL+ P+P   ++ ++KKM+EL    L  NPYGGRMAEIP++  PFPHRAG + KIQY
Sbjct  372   KSDYLKKPMPIEGIEFIFKKMIELQTPVLTFNPYGGRMAEIPASAKPFPHRAGNIAKIQY  431

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGK  346
             A +W + G      +I+  R LH ++ PFVS+ PR+A+LNYRDLDIG T +G +SY EG 
Sbjct  432   ATNWDQNGVQTAEYYINLTRALHKYMTPFVSKFPREAFLNYRDLDIGITHNGKNSYAEGL  491

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             VYG KYF  N+ RLVKVK+ VDPDNFFRNEQ+IP
Sbjct  492   VYGIKYFKENFNRLVKVKTAVDPDNFFRNEQTIP  525



>ref|XP_010439563.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=569

 Score =   525 bits (1351),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 299/531 (56%), Positives = 392/531 (74%), Gaps = 19/531 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +++SFL C S      +P+  ++  V+S ++ +FSSVL+AY RN RFNT S+PKP IIVT
Sbjct  34    VHNSFLKCFS--EKTKLPQSQITDNVFSQSSPAFSSVLRAYIRNARFNTSSTPKPTIIVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   VLC+K L   +++RSGGHDY+G+SY+SD  F ILDM NLR + VDIA   
Sbjct  92    PRSESHVSAAVLCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNLRDVSVDIAAN-  150

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS V GFP GVCPTVGVGGHVSGGGYGNM+R+FGLTVD
Sbjct  151   ---SAWISAGATLGEVYYRIWEKSRVRGFPAGVCPTVGVGGHVSGGGYGNMVRKFGLTVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             H+ DA+IVDV GR+LDR AMGEDLFWAI+GGGGGSFGV+L +K+KL+ VP TVT FR E+
Sbjct  208   HIEDAKIVDVNGRILDRKAMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPSTVTVFRVEQ  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ + A K D +LF+R+L+Q   P T+   +  KTVR+S V LFLG 
Sbjct  268   YMN--SGAVDMVYKWQSVAPKTDPNLFMRMLIQ---PVTR---NKVKTVRASVVALFLGR  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++++L  +FP LGLKK++C+EM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  320   ADEVVALLRKEFPELGLKKENCTEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDSSSFG  378

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPYGG+MAE+  T TPFPHR   LFKI
Sbjct  379   KRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPYGGKMAEVAVTATPFPHRKK-LFKI  437

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+ F+  FVS+ PR AYLNYRD+DIG  DHG +SY+E
Sbjct  438   QYSVNWKENSPEIEKGYLNQAKVLYRFMTGFVSKKPRSAYLNYRDVDIGVNDHGKNSYKE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             GKVYG KYF  N++RLVK+K+ VDP+NFFRNEQSIP+L  N  G+    PG
Sbjct  498   GKVYGKKYFGVNFDRLVKIKTAVDPENFFRNEQSIPTLP-NTKGTLLPAPG  547



>ref|XP_010556147.1| PREDICTED: reticuline oxidase-like protein [Tarenaya hassleriana]
Length=558

 Score =   524 bits (1349),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 289/537 (54%), Positives = 390/537 (73%), Gaps = 15/537 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAY  1663
             L+FL L  +  S  +    +Y +FL C +  +      D +S +V   +NA+F+ VL+AY
Sbjct  28    LIFL-LVFVSHSLAASDTTVYQNFLDCFAKQTKTS--PDKLSDVVLPQSNAAFTPVLRAY  84

Query  1662  ARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATF  1483
              RN RFNT ++PKP II+    E+HV   V+C K L  ++++RSGGHDYEGISYVS   F
Sbjct  85    IRNARFNTSATPKPAIIIAARSETHVQAAVVCTKSLNFQLKIRSGGHDYEGISYVSAVPF  144

Query  1482  IILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgg  1303
              +LD+ NLR+I VD AG  G  +AW++AGATLGELYYRIWEKS VHGFP G+CPTVG GG
Sbjct  145   FVLDLSNLRTITVDAAGPGGAASAWIEAGATLGELYYRIWEKSKVHGFPAGICPTVGAGG  204

Query  1302  hvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILA  1123
             H+SG GYGNM+R+ GL+VD+V DA+IVDV GR+LDR +MGEDLFWAI GGGGGSFGVI+A
Sbjct  205   HISGAGYGNMVRKHGLSVDYVTDAKIVDVNGRILDRKSMGEDLFWAIRGGGGGSFGVIVA  264

Query  1122  FKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKT  943
             FK+ L+ VP+ VT FR  +YL    N  D+V ++ + A K D +L++RLLLQ V      
Sbjct  265   FKVNLVPVPEIVTVFRIPRYLD--ENALDLVHKWQSVAPKTDPNLWMRLLLQTV------  316

Query  942   NDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT  763
               + ++TV+++ + L+LG ++ ++S+L  DFP LGLK ++C+E+SWI+S + W +  +  
Sbjct  317   TKNKAQTVKATVMALYLGRAKDVVSLLAKDFPELGLKAENCTELSWIQSAVWWDNHEDAA  376

Query  762   --KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
                PE LL R P   ASF KRKSDY++  IPK  LD L+KKM+E+G  GL  NPYGG+M+
Sbjct  377   TINPEILLEREP-DTASFGKRKSDYVETEIPKEGLDYLFKKMVEVGKVGLVFNPYGGKMS  435

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             E+P+T+TPFPHR   LFKIQ++++WK+ G  A+ + +++ R  + F+APFVS+NPR +YL
Sbjct  436   EVPTTETPFPHRKK-LFKIQHSMNWKDAGTVAENDFLNKSRTFYGFMAPFVSKNPRLSYL  494

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             NYRDLDIG  DHG  SY++G+VYG KYF  N++RLVKVK+ VDP NFFRNEQSIP+L
Sbjct  495   NYRDLDIGINDHGRDSYKQGEVYGRKYFAENFDRLVKVKTAVDPQNFFRNEQSIPTL  551



>ref|XP_009148512.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=531

 Score =   523 bits (1347),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 289/518 (56%), Positives = 374/518 (72%), Gaps = 20/518 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C S  + +P P  L S +V      +F+  L+AY RN RFNT ++ KP I++ 
Sbjct  28    LYQNFLQCFSNQTKSP-PNSL-SDVVLPQTTPAFTPTLRAYIRNARFNTSTTSKPAIVIA  85

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                E HV   VLC K L V+++ RSGGHDYEG+SY S+  F +LDM NLR+I V      
Sbjct  86    ARSEPHVQAAVLCTKSLNVQLKTRSGGHDYEGVSYTSNVPFFVLDMSNLRNITV------  139

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
              GE+AWV AGATLGE+YYRIWEK+ +HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  140   VGESAWVGAGATLGEVYYRIWEKTKLHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  199

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR AMGEDLFWAI GGGG SFGVILA+KI L+ VP TVT FR EK
Sbjct  200   YVTDAKIVDVNGRVLDRKAMGEDLFWAIRGGGGASFGVILAYKITLVPVPPTVTVFRVEK  259

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  D+V ++   A K D  LF+RLLLQ   P T+   + ++TVR+S V LFLG 
Sbjct  260   --NLDENAVDMVHKWQFVAPKTDPSLFMRLLLQ---PVTR---NKAQTVRASVVALFLGK  311

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  +LS+L  DFP LGLK+++C+E++WI+S+L W +  N T  KPE LL+R P   AS+ 
Sbjct  312   SSDVLSLLTRDFPELGLKQENCTELTWIQSVLWWANNDNATQVKPEILLDRNP-DSASYG  370

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  I K  LD L +KM+E+G TGL  NPYGG+M+E+ +T TPFPHR   L+K+
Sbjct  371   KRKSDYVEKEITKEGLDYLMRKMIEVGKTGLVFNPYGGKMSEVATTATPFPHRTK-LYKV  429

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G AA+   + Q R  +S++AP+V++NPR  YLNYRDLDIG   HG +SY E
Sbjct  430   QHSINWKDPGTAAESSFLQQTRSFYSYMAPYVTQNPRHTYLNYRDLDIGVNTHGPNSYRE  489

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              +VYG KYF  N++RLVKVK+ VDP NFFR+EQS+P+L
Sbjct  490   AEVYGRKYFGENFDRLVKVKTAVDPQNFFRDEQSVPTL  527



>ref|XP_002299008.1| hypothetical protein POPTR_0001s46340g [Populus trichocarpa]
 gb|EEE83813.1| hypothetical protein POPTR_0001s46340g [Populus trichocarpa]
Length=526

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 278/512 (54%), Positives = 362/512 (71%), Gaps = 14/512 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             + FL CL     N +P   +S  +Y+ AN+SF SVLQ Y  NRRF T ++PKP+ IVT L
Sbjct  25    EKFLQCLPN---NSLPSYPISEAIYTTANSSFESVLQTYINNRRFLTPTTPKPIAIVTAL  81

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CAK  G+++R+RSGGHDYEG+SYVS+  F+ILDMFNLRSIDVDIA     
Sbjct  82    HESHVQATVICAKASGLQVRIRSGGHDYEGLSYVSEVPFVILDMFNLRSIDVDIAN----  137

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGATLGE+YY I   S+VH FP GVCPTVG GGH+SGGGYG ++R++GL+VD++
Sbjct  138   ETAWVQAGATLGEIYYNIANNSNVHAFPAGVCPTVGAGGHISGGGYGTLMRKYGLSVDNI  197

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA++VDV G +LDR  MGEDLFWAI GGGG SF V+L++K+ L+RVP+ VT F+ ++  
Sbjct  198   IDAKVVDVNGNILDRETMGEDLFWAIRGGGGASFAVVLSWKMNLVRVPEKVTVFKVDR--  255

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L     D+  Q+   ++++D  LFIR + Q+       +   +KT+  S+  LFLG SE
Sbjct  256   TLEEGATDIFYQWQQVSTELDKDLFIRAMPQV----ANGSQEGTKTISISFYALFLGQSE  311

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
              LLS++N  FP LGL+++DC EM WIES L W     GT  + LLNR P G  SF K KS
Sbjct  312   ALLSMMNKSFPKLGLQQKDCIEMRWIESTLFWFDLPIGTSIDVLLNR-PQGAQSFYKNKS  370

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY+   +PK  L+ +WK M++     +  NPYGGRM+EIP T TPFPHRAG LFK+QY++
Sbjct  371   DYVNQIVPKEALERIWKMMIKADPMWMQWNPYGGRMSEIPDTATPFPHRAGYLFKLQYSI  430

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W EEG  A   +IS IRE+H  +AP+V+  PR+A+ NYRDLDIG+       +E  KVY
Sbjct  431   NWDEEGTEATERYISLIREMHDAMAPYVTSYPREAFQNYRDLDIGSNPSNQTDFERAKVY  490

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G KYF GN+ RLVK+K +VDPDNF ++EQSIP
Sbjct  491   GLKYFKGNFLRLVKIKGKVDPDNFLKHEQSIP  522



>ref|XP_003534791.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=565

 Score =   524 bits (1349),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 285/538 (53%), Positives = 387/538 (72%), Gaps = 15/538 (3%)
 Frame = -3

Query  1857  SSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             SS   L  + L +LL + ++ T    ++F+HCL   S    P   +S+ +++  ++SFSS
Sbjct  5     SSTKLLPIVVLFSLLFTSYA-TNSAENNFVHCLVNHSE---PSHPISAAIFTQNSSSFSS  60

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VLQAY RN RFNT ++ KP +IVTP H SHV   ++CAKK  + +++RSGGHDYEG+SYV
Sbjct  61    VLQAYIRNLRFNTSTTRKPFLIVTPFHVSHVQASIVCAKKHNLLMKIRSGGHDYEGVSYV  120

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             +   F ILDMFNLRSI++D+      ETAWV+AGA LGE+YYRI EKS  HGFP GVCPT
Sbjct  121   ASQPFFILDMFNLRSIEIDMES----ETAWVEAGAMLGEVYYRIAEKSKTHGFPAGVCPT  176

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SGGGYGN++R++G +VD+VVDA+IVD +GR+L+R  MGEDLFWA+ GGGGGSF
Sbjct  177   VGVGGHISGGGYGNLMRKYGTSVDNVVDAQIVDARGRLLNRRTMGEDLFWAVRGGGGGSF  236

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+LA+KI+L+RVP+ VT F+    + L +N  D+V  + + A  ID+ LFIRL+L++V 
Sbjct  237   GVVLAYKIRLVRVPEKVTVFQVG--VTLEQNATDIVYNWQHVAPTIDNDLFIRLILEVV-  293

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
                    + +KTVR++++ LFLGDS+ L+S++N  FP LGLK+ DC E +W++S+L W +
Sbjct  294   ---NGTQTATKTVRATFIALFLGDSKSLVSLMNDKFPQLGLKQSDCIETTWLKSVLFWDN  350

Query  777   FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
                 T  E LL R P     +LKRKSDY++ PI K   + +W KM+EL    +  NPYGG
Sbjct  351   IDIATPVEILLERQPQS-FKYLKRKSDYVKKPISKEGWEGIWNKMIELEKAIMYFNPYGG  409

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
             RMAEIPST+T FPHRAG L+KIQY  +W E GE     HI+ +RELH ++ PFVS+NPRQ
Sbjct  410   RMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINLVRELHKYMTPFVSQNPRQ  469

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             A++ Y+DL++G   HG + Y EG  YG +YF  N++RLV++K++VDP NFFR EQSIP
Sbjct  470   AFICYKDLELGINHHGFYGYFEGSAYGVQYFDDNFKRLVQIKTKVDPSNFFRTEQSIP  527



>gb|KHN44657.1| Reticuline oxidase-like protein [Glycine soja]
Length=565

 Score =   524 bits (1349),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 285/538 (53%), Positives = 387/538 (72%), Gaps = 15/538 (3%)
 Frame = -3

Query  1857  SSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             SS   L  + L +LL + ++ T    ++F+HCL   S    P   +S+ +++  ++SFSS
Sbjct  5     SSTKLLPIVVLFSLLFTSYA-TNSAENNFVHCLVNHSE---PSHPISAAIFTQNSSSFSS  60

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VLQAY RN RFNT ++ KP +IVTP H SHV   ++CAKK  + +++RSGGHDYEG+SYV
Sbjct  61    VLQAYIRNLRFNTSTTRKPFLIVTPFHVSHVQASIVCAKKHNLLMKIRSGGHDYEGVSYV  120

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             +   F ILDMFNLRSI++D+      ETAWV+AGA LGE+YYRI EKS  HGFP GVCPT
Sbjct  121   ASQPFFILDMFNLRSIEIDMES----ETAWVEAGAMLGEVYYRIAEKSKTHGFPAGVCPT  176

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SGGGYGN++R++G +VD+VVDA+IVD +GR+L+R  MGEDLFWA+ GGGGGSF
Sbjct  177   VGVGGHISGGGYGNLMRKYGTSVDNVVDAQIVDARGRLLNRRTMGEDLFWAVRGGGGGSF  236

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+LA+KI+L+RVP+ VT F+    + L +N  D+V  + + A  ID+ LFIRL+L++V 
Sbjct  237   GVVLAYKIRLVRVPEKVTVFQVG--VTLEQNATDIVYNWQHVAPTIDNDLFIRLILEVV-  293

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
                    + +KTVR++++ LFLGDS+ L+S++N  FP LGLK+ DC E +W++S+L W +
Sbjct  294   ---NGTQTATKTVRATFIALFLGDSKSLVSLMNDKFPQLGLKQSDCIETTWLKSVLFWDN  350

Query  777   FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
                 T  E LL R P     +LKRKSDY++ PI K   + +W KM+EL    +  NPYGG
Sbjct  351   IDIATPVEILLERQPQS-FKYLKRKSDYVKKPISKEGWEGIWNKMIELEKAIMYFNPYGG  409

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
             RMAEIPST+T FPHRAG L+KIQY  +W E GE     HI+ +RELH ++ PFVS+NPRQ
Sbjct  410   RMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINLVRELHKYMTPFVSQNPRQ  469

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             A++ Y+DL++G   HG + Y EG  YG +YF  N++RLV++K++VDP NFFR EQSIP
Sbjct  470   AFICYKDLELGINHHGFYGYFEGSAYGVQYFDDNFKRLVQIKTKVDPSNFFRTEQSIP  527



>emb|CDY13353.1| BnaC06g14040D [Brassica napus]
Length=537

 Score =   523 bits (1347),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 289/544 (53%), Positives = 384/544 (71%), Gaps = 16/544 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             M      ++FL+L +   +      P+Y+SFL C S  +     K  +  +V   ++ASF
Sbjct  1     MKKLSCLIIFLSLASSSLAVDPSNQPIYESFLKCFSNQTCTAPNK--LCDVVLPQSSASF  58

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
             +  L+AY RN R+NT +SPKP+I++    E+HV   VLC K L  +++ RSGGHDY+G+S
Sbjct  59    TPTLRAYIRNARYNTSTSPKPLIVIAARSEAHVQATVLCTKSLNFQLKTRSGGHDYDGVS  118

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             Y+S+  + +LDM  LR+I VD+A  DGG +AWV AGATLGE+YY IW+KS  HGFP GVC
Sbjct  119   YISNRPYFVLDMSYLRNITVDMA--DGGGSAWVGAGATLGEVYYSIWQKSKSHGFPAGVC  176

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVG GGH+SGGGYGNMIR++GL+VD+V DA+IVDV GR+LDR +MGEDLFWAI GGGG 
Sbjct  177   PTVGAGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGRILDRKSMGEDLFWAIGGGGGA  236

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVILAFKIKL+ VP TVT FR EK   L  N  D+V ++   A K    LF+RLLLQ 
Sbjct  237   SFGVILAFKIKLVAVPPTVTVFRVEK--TLEENALDMVHKWQFVAPKTSPDLFMRLLLQ-  293

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                P   N   ++TVR+S V LFLG    LLS+L  +FP LGL+ ++C+EM+WI+S++ W
Sbjct  294   ---PKTMN--TTQTVRASVVALFLGRQSDLLSLLGKEFPELGLRTENCTEMTWIQSVMWW  348

Query  783   GSFGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVN  610
              +  N T  KPE LL+R P   ASFLKRKSDY++  I K  L  L+ K++E G  GL  N
Sbjct  349   ANSDNATLIKPEILLDREP-DSASFLKRKSDYVETEISKEGLGFLFTKLMETGKLGLVFN  407

Query  609   PYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSR  430
             PYGG M ++P+T+TPFPHR   LFK+Q++++WK+ G  A+   + + R  +S++APFV++
Sbjct  408   PYGGIMCQVPTTKTPFPHRKR-LFKVQHSMNWKDAGIEAENSFMEKTRSFYSYMAPFVTK  466

Query  429   NPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQS  250
             NPR  YLNYRDL+IGT  HG +SY E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQS
Sbjct  467   NPRHTYLNYRDLEIGTNSHGPNSYREAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQS  526

Query  249   IPSL  238
             +P+L
Sbjct  527   VPTL  530



>emb|CDX67534.1| BnaA07g15740D [Brassica napus]
Length=537

 Score =   523 bits (1346),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 288/519 (55%), Positives = 379/519 (73%), Gaps = 16/519 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+Y+SFL C S  +      D + S+V   ++ASF+  L+AY RN R+NT +SPKP+I++
Sbjct  26    PIYESFLKCFSNQTCTA--PDKLCSVVLPQSSASFTPTLRAYIRNARYNTSTSPKPLIVI  83

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
                 E+HV   VLC K L  +++ RSGGHDY+G+SY+S+  + +LDM  LR+I VD+A  
Sbjct  84    AARSEAHVQATVLCTKSLNFQLKTRSGGHDYDGLSYISNRPYFVLDMSYLRNITVDMA--  141

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
             DGG +AWV AGATLGE+YY IW+KS  HGFP GVCPTVGVGGH+SGGGYGNMIR++GL+V
Sbjct  142   DGGGSAWVGAGATLGEVYYSIWQKSKSHGFPAGVCPTVGVGGHISGGGYGNMIRKYGLSV  201

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V DA+IVDVKGR+LDR +MGEDLFWAI GGGG SFGVILAFKIKL+ VP TVT FR E
Sbjct  202   DYVTDAKIVDVKGRILDRKSMGEDLFWAIGGGGGASFGVILAFKIKLVPVPPTVTVFRVE  261

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   L     D+V ++   A K    LF+RLLLQ   P TK   + ++TVR+S V LFLG
Sbjct  262   K--TLEEGALDMVHKWQFVAPKTSPDLFMRLLLQ---PKTK---NTTQTVRASVVALFLG  313

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASF  715
                 LLS+L  +FP LGL+ ++C+EM+WI+S++ W +  N T  KPE LL+R P   ASF
Sbjct  314   RQSDLLSLLGKEFPELGLRTENCTEMTWIQSVMWWANSDNATLIKPEILLDREP-DSASF  372

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY++  I K  L  L+ K++E G  GL  NPYGG M ++P+T+TPFPHR   LFK
Sbjct  373   LKRKSDYVETEISKEGLGFLFTKLMETGKLGLVFNPYGGIMCQVPTTKTPFPHRKR-LFK  431

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             +Q++++WK+ G  A+   + + R  +S++APFV++NPR  YLNYRDL+IGT  HG +SY 
Sbjct  432   VQHSMNWKDAGIEAENSFMEKTRSFYSYMAPFVTKNPRHTYLNYRDLEIGTNSHGPNSYR  491

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQS+P+L
Sbjct  492   EAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQSVPTL  530



>emb|CDX98676.1| BnaA03g44610D [Brassica napus]
Length=539

 Score =   523 bits (1346),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 298/520 (57%), Positives = 384/520 (74%), Gaps = 18/520 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SF+ C S  + +P  +  ++  V+S  N S+SSVL+AY RN RFNT S+PKP IIVT
Sbjct  34    VYESFVQCFSDKTKSPQAQ--IAENVFSQTNPSYSSVLRAYIRNARFNTSSTPKPTIIVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   VLCAK L +  ++RSGGHDY+G+SY+SD  F ILDM NLR + V+I    
Sbjct  92    PRSYSHVSAAVLCAKPLTIVFKIRSGGHDYDGLSYISDKPFFILDMSNLRDVTVNITD--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               +TAW+ AGATLGE+YY IW +S VHGFP GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  150   --QTAWISAGATLGEVYYGIWRESKVHGFPAGVCPTVGVGGHLSGGGYGNMVRKYGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDVKGRVLDR AMGEDLFWAI+GGGGGSFGV+L +K+KL+ VP TVT FR E+
Sbjct  208   YVEDAKIVDVKGRVLDRKAMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPSTVTVFRVEQ  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++     K D +LF+R+L+Q    PT  N    KTVR+S V LFLG 
Sbjct  268   YMD--SGAVDMVHKWQFVGPKTDRNLFMRMLIQ----PTTRN--KVKTVRASVVALFLGG  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             ++ ++S+L  +FP LGLKK+ C EM+WI+S L W +  N T+  P+  L+R     ASF 
Sbjct  320   ADDVVSLLAKEFPELGLKKEACKEMTWIQSALWWDNDENATQTDPKVFLDRD-LDSASFG  378

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IP+  ++SL+KKM+ELG  GL  NPYGGRMAE+    TPFPHR   LFKI
Sbjct  379   KRKSDYVATEIPRDGIESLFKKMIELGKIGLVFNPYGGRMAEVAEDATPFPHRKK-LFKI  437

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+SF+  +VS+NPR AYLNYRD+DIG  DHG++SY+E
Sbjct  438   QYSVNWKESSAEIEKGYLNQAKVLYSFMTGYVSKNPRNAYLNYRDVDIGVNDHGVNSYKE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             GKVYG KYF  N++RLVKVK+ VDPDNFFRNEQSIP+L R
Sbjct  498   GKVYGRKYFGKNFDRLVKVKTAVDPDNFFRNEQSIPTLPR  537



>ref|XP_010449152.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=552

 Score =   523 bits (1347),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 299/539 (55%), Positives = 396/539 (73%), Gaps = 20/539 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             +FLV L L        S +I  Y+SF+ C S  + +P  +  ++  V+S  N S+SSVL+
Sbjct  27    IFLVSLPLSMFAAPPSSDSI--YESFVQCFSDKTKSP--QTQITDNVFSQTNPSYSSVLR  82

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFNT S+PKP IIVTP  ESHV   V+C+K L   +++RSGGHDY+G+SY+SD 
Sbjct  83    AYIRNARFNTSSTPKPTIIVTPRSESHVSAAVVCSKTLNFLVKIRSGGHDYDGLSYISDK  142

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ILDM NLR + VDIA     ++AW+ AGATLGE+Y+ IW+KS VHGFP GVCPTVGV
Sbjct  143   PFFILDMSNLRDVTVDIAD----QSAWISAGATLGEVYHGIWQKSKVHGFPAGVCPTVGV  198

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH+SG GYGNM+R+FGL+VD+V DA+IVDVKG++LDR AMGEDLFWAI GGGGGSFGV+
Sbjct  199   GGHISGAGYGNMVRKFGLSVDYVEDAKIVDVKGQILDRKAMGEDLFWAICGGGGGSFGVV  258

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L +K+KL+ VP+TVT FR E+Y+       D+V ++ +   K D  LF+R+L+Q   P T
Sbjct  259   LGYKVKLVPVPETVTVFRVEQYMD--SGAVDMVYKWQSVGPKTDQRLFMRMLIQ---PVT  313

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             +      KTVR+S V LFLG +++++++L  +FP LGLKK+ C EM+WI+S+L W +  N
Sbjct  314   R---KKVKTVRASVVALFLGRADEVVALLAKEFPELGLKKESCQEMTWIQSVLWWDNDEN  370

Query  768   GTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGR  595
              TK  P+ LL+R     ASF KRKSDY+ + IP+  ++SL+KKM+ELG  GL  NPYGG+
Sbjct  371   ATKTNPKVLLDRE-LDTASFGKRKSDYVASEIPRDGIESLFKKMIELGKIGLVFNPYGGK  429

Query  594   MAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQA  415
             MAE+    TPFPHR   LFKIQY+V+WKE   A ++  ++Q + L+SF+  FVS+NPR A
Sbjct  430   MAEVAVNATPFPHR-NKLFKIQYSVNWKENSPAIEKGFLNQAKVLYSFMTEFVSKNPRNA  488

Query  414   YLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             YLNYRD+DIG  DHG +SY+EG+VYG KYF  N++RLVK+K+ VDP+NF+RNEQSIP+L
Sbjct  489   YLNYRDVDIGVNDHGANSYKEGEVYGRKYFGENFDRLVKIKTAVDPENFYRNEQSIPTL  547



>emb|CDX97984.1| BnaA06g07350D [Brassica napus]
Length=531

 Score =   522 bits (1345),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 289/518 (56%), Positives = 374/518 (72%), Gaps = 20/518 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C S  + +P P  L S +V      +F+  L+AY RN RFNT ++ KP I++ 
Sbjct  28    LYQNFLQCFSNQTKSP-PNSL-SDVVLPQTAPAFTPTLRAYIRNARFNTSTTSKPAIVIA  85

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                E HV   VLC K L V+++ RSGGHDYEG+SY S+  F +LDM NLR+I V      
Sbjct  86    ARSEPHVQAAVLCTKSLNVQLKTRSGGHDYEGVSYTSNVPFFVLDMSNLRNITV------  139

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
              GE+AWV AGATLGE+YYRIWEK+ +HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  140   VGESAWVGAGATLGEVYYRIWEKTKLHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  199

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR AMGEDLFWAI GGGG SFGVILA+KI L+ VP TVT FR EK
Sbjct  200   YVTDAKIVDVNGRVLDRKAMGEDLFWAIRGGGGASFGVILAYKITLVPVPPTVTVFRVEK  259

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  D+V ++   A K D  LF+RLLLQ   P T+   + ++TVR+S V LFLG 
Sbjct  260   --NLDENAVDMVHKWQFVAPKTDPSLFMRLLLQ---PVTR---NKAQTVRASVVALFLGK  311

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  +LS+L  DFP LGLK+++C+E++WI+S+L W +  N T  KPE LL+R P   AS+ 
Sbjct  312   SSDVLSLLTRDFPELGLKQENCTELTWIQSVLWWANNDNATQVKPEILLDRNP-DSASYG  370

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  I K  LD L +KM+E+G TGL  NPYGG+M+E+ +T TPFPHR   L+K+
Sbjct  371   KRKSDYVEKEITKEGLDYLMRKMIEVGKTGLVFNPYGGKMSEVATTATPFPHRTK-LYKV  429

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G AA+   + Q R  +S++AP+V++NPR  YLNYRDLDIG   HG +SY E
Sbjct  430   QHSINWKDPGTAAESSFLQQTRSFYSYMAPYVTQNPRHTYLNYRDLDIGVNTHGPNSYRE  489

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              +VYG KYF  N++RLVKVK+ VDP NFFR+EQS+P+L
Sbjct  490   AEVYGRKYFGENFDRLVKVKTAVDPQNFFRDEQSVPTL  527



>ref|XP_009137153.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=539

 Score =   521 bits (1343),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 297/520 (57%), Positives = 382/520 (73%), Gaps = 18/520 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SF+ C S  +  P  +  ++  V+S  N S+SSVL+AY RN RFNT S+PKP IIVT
Sbjct  34    VYESFVQCFSDKTKTPQAQ--IAKNVFSQTNPSYSSVLRAYIRNARFNTSSTPKPTIIVT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   VLC+K L    ++RSGGHDY+G+SY+SD  F ILDM NLR + V+I    
Sbjct  92    PRSYSHVSAAVLCSKPLNFVFKIRSGGHDYDGLSYISDKPFFILDMSNLRDVTVNITD--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               +TAW+ AGATLGE+YY IW +S VHGFP GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  150   --QTAWISAGATLGEVYYGIWRESKVHGFPAGVCPTVGVGGHLSGGGYGNMVRKYGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDVKGRVLDR AMGEDLFWAI+GGGGGSFGV+L +K+KL+ VP TVT FR E+
Sbjct  208   YVEDAKIVDVKGRVLDRKAMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPSTVTVFRVEQ  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++     K D +LF+R+L+Q    PT  N    KTVR+S V LFLG 
Sbjct  268   YMD--SGAVDMVHKWQFVGPKTDKNLFMRMLIQ----PTTRN--KVKTVRASVVALFLGG  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             ++ ++S+L  +FP LGLKK+ C EM+WI+S L W +  N T+  P+  L+R     ASF 
Sbjct  320   ADDVVSLLAKEFPELGLKKEACKEMTWIQSALWWDNDENATQTDPKVFLDRD-LDSASFG  378

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IP+  ++SL+KKM+ELG  GL  NPYGGRMAE+    TPFPHR   LFKI
Sbjct  379   KRKSDYVATEIPRDGIESLFKKMIELGKIGLVFNPYGGRMAEVAEDATPFPHRKK-LFKI  437

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+SF+  FVS+NPR AYLNYRD+DIG  DHG++SY+E
Sbjct  438   QYSVNWKESSAEIEKGYLNQAKVLYSFMTGFVSKNPRNAYLNYRDVDIGVNDHGVNSYKE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             GKVYG KYF  N++RLVK+K+ VDPDNFFRNEQSIP+L R
Sbjct  498   GKVYGRKYFGKNFDRLVKIKTAVDPDNFFRNEQSIPTLPR  537



>emb|CDY49803.1| BnaCnng18160D [Brassica napus]
Length=530

 Score =   521 bits (1342),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 374/518 (72%), Gaps = 20/518 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C S  + +P P  L S +V      +F+  L+AY RN RFNT ++ KP I++ 
Sbjct  27    LYQNFLQCFSNQTQSP-PNSL-SDVVLPQTAPAFTPTLRAYIRNARFNTSTTSKPAIVIA  84

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                E HV   VLC K L ++++ RSGGHDYEG+SY S+  F +LDM NLR+I V      
Sbjct  85    ARSEPHVQAAVLCTKSLNIQLKTRSGGHDYEGVSYTSNVPFFVLDMSNLRNITV------  138

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
              GE+AWV AGATLGE+YYRIWEK+ +HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  139   VGESAWVGAGATLGEVYYRIWEKTKLHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  198

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR AMGEDLFWAI GGGG SFGVILA+KI L+ VP TVT FR EK
Sbjct  199   YVTDAKIVDVNGRVLDRKAMGEDLFWAIRGGGGASFGVILAYKITLVPVPPTVTVFRVEK  258

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  D+V ++   A K D  LF+RLLLQ   P T+   + ++TVR+S V LFLG 
Sbjct  259   --NLDENAVDMVHKWQFVAPKTDPSLFMRLLLQ---PVTR---NKAQTVRASVVALFLGK  310

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
             S  +LS+L  DFP LGLK+++C+E++WI+S+L W +  N T  KPE LL+R P   AS+ 
Sbjct  311   SSDVLSLLTRDFPELGLKQENCTELTWIQSVLWWANNDNTTQVKPEILLDRNP-DSASYG  369

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY++  I K  LD L +KM+E+G TGL  NPYGG+M+E+ +T TPFPHR   L+K+
Sbjct  370   KRKSDYVEKEITKEGLDYLMRKMIEVGKTGLVFNPYGGKMSEVATTATPFPHRTK-LYKV  428

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G AA+   + Q R  +S++AP+V++NPR  YLNYRDLDIG   HG +SY E
Sbjct  429   QHSINWKDPGTAAESSFLQQTRSFYSYMAPYVTQNPRHTYLNYRDLDIGVNTHGPNSYRE  488

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              +VYG KYF  N++RLVKVK+ VDP NFFR+EQS+P+L
Sbjct  489   AEVYGRKYFGENFDRLVKVKTAVDPQNFFRDEQSVPTL  526



>ref|XP_007147442.1| hypothetical protein PHAVU_006G125000g [Phaseolus vulgaris]
 gb|ESW19436.1| hypothetical protein PHAVU_006G125000g [Phaseolus vulgaris]
Length=560

 Score =   522 bits (1344),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 293/549 (53%), Positives = 395/549 (72%), Gaps = 16/549 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             ++SS  +F +   LC LL S F+     +++F+HCL   S    P   +S+ ++S  ++S
Sbjct  3     LLSSRTLFSIVSLLC-LLCSYFAPN-SAHNTFVHCLLNHSEPSYP---ISAAIFSQNSSS  57

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             FSSVLQAY RN RFNT ++PKP +IVTP H SHV   V+CAK+  + +++RSGGHDYEG+
Sbjct  58    FSSVLQAYIRNLRFNTSTTPKPFLIVTPFHVSHVQTAVVCAKRHNLLMKIRSGGHDYEGV  117

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggv  1327
             SYV+   F +LDMFNLRSID D+      E AWVQAGATLGE+YYRI EKS  HGFP GV
Sbjct  118   SYVASHPFFLLDMFNLRSIDFDMES----EVAWVQAGATLGEVYYRIAEKSKTHGFPAGV  173

Query  1326  cptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINgggg  1147
             CPTVGVGGH+SGGGYGN++R++G  VD+VVDA+IVD +GR+L+R +MGEDLFWA+ GGGG
Sbjct  174   CPTVGVGGHISGGGYGNLMRKYGTAVDNVVDAQIVDAQGRLLNRRSMGEDLFWAVRGGGG  233

Query  1146  GSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQ  967
             GSFGVI+A+KIKL+RVP+ VT F+  K   L +N  ++V  + + A  ID++LFIRL+L+
Sbjct  234   GSFGVIIAYKIKLVRVPEKVTVFKVGK--TLEQNATNIVYNWQHVAPTIDNNLFIRLILE  291

Query  966   IVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLR  787
             +V       +  +KTVR++++ LFLGDS+ L+S++   FP LGLK+ DC E SW++S++ 
Sbjct  292   VV----NGTEVGTKTVRATFIALFLGDSKSLVSLMKDKFPELGLKQSDCIETSWLQSVMF  347

Query  786   WGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             W +    T  E LL R P     +LKRKSDY++ PI K   + +WKKM+EL    + +NP
Sbjct  348   WDNIDIATPVEILLERQPQ-SLKYLKRKSDYVKKPISKEGWEGIWKKMIELEKAVMFLNP  406

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGGRM EIPST+TP PHRAG L+KIQY  +W E GE   + HI+ +REL+ ++ PFVS+N
Sbjct  407   YGGRMGEIPSTETPLPHRAGNLWKIQYQGNWYEAGEEVAQYHINLLRELYKYMTPFVSQN  466

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PRQA++ Y+DLD+G   HG   Y EG  YG +YF  N++RLV++KS+VDP NFFR EQSI
Sbjct  467   PRQAFMCYKDLDLGINHHGFLGYFEGSAYGVQYFNDNFKRLVEIKSKVDPTNFFRTEQSI  526

Query  246   PSLSRNQTG  220
             P L+  + G
Sbjct  527   PVLTLVEFG  535



>ref|XP_009362286.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=569

 Score =   522 bits (1344),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 284/528 (54%), Positives = 392/528 (74%), Gaps = 13/528 (2%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             +++F+ CL   S    P   ++  +++  N S+SS+L++Y RN RFNT ++ KP +I+T 
Sbjct  32    HETFVDCLLNHSQ---PSHPIAPAIHTSNNDSYSSILESYIRNLRFNTSTTRKPFLILTA  88

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
             LHESHV   V+CA+    ++++RSGGHD+EG+SYV++  F ILDMFNLRSI VDI     
Sbjct  89    LHESHVQISVVCAQIHNFQMKIRSGGHDFEGLSYVAEFPFFILDMFNLRSIHVDIKS---  145

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAW+QAGATLGELYYRI EKS +HGFP GVCPTVGVGGH SGGGYGNM+R++GL+VD+
Sbjct  146   -ETAWIQAGATLGELYYRIAEKSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDN  204

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             +VDA++V+V G++LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+TVT F+  + 
Sbjct  205   IVDAQLVNVHGKLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPETVTVFKVPR-  263

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT-KTNDSNSKTVRSSYVGLFLGD  886
               L +N  D+V ++   A K+D+ LFIRL++ IV   T  ++  N+KT+R+S++ +FLGD
Sbjct  264   -TLEQNATDIVYRWQYIADKLDNDLFIRLIMDIVNGTTSNSSGENNKTLRASFIAMFLGD  322

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI++  FP LG+K+ DC+EMSW +S+L W SF  GT  EALL+RTP     F KR
Sbjct  323   SERLLSIMDKSFPELGMKQSDCNEMSWAQSVLFWTSFPTGTATEALLSRTPQVLTHF-KR  381

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  +++KM+EL    L  NP+GG+M+EI ++ TPFPHRAG L+ +QY
Sbjct  382   KSDYVKKPIPKAGLKWIFQKMIELEAPLLTFNPHGGKMSEISASATPFPHRAGNLWMVQY  441

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEE  352
             A +W  +G  A   +I   R+L+ ++ PFVS+NPR+A+ +Y+DLDIGT    +G+ SY E
Sbjct  442   ATNWNIQGTEASDHYIDLTRKLYMYMTPFVSKNPREAFYSYKDLDIGTNHNANGIASYLE  501

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESC  208
             G+V+G KYF  N++RLV VK++VDP NFFRNEQSIP L  +Q  +  C
Sbjct  502   GRVFGIKYFRHNFDRLVNVKTKVDPGNFFRNEQSIPPLPYSQYLASCC  549



>ref|XP_002300550.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa]
 gb|EEE85355.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa]
Length=532

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 287/512 (56%), Positives = 367/512 (72%), Gaps = 16/512 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D FL CL + S    P   +S  +YS  N SF S+LQA  +NRRF T ++PKP+ I+  +
Sbjct  29    DRFLQCLPSHSH---PSHPISQAIYSNTNPSFESILQALIKNRRFLTPATPKPLAIIAAV  85

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CAK  G++IR+RSGGHDYEG+SYVS   F+ILDMFNLRSID+DIA     
Sbjct  86    HESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSAVPFVILDMFNLRSIDIDIAS----  141

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQ+GATLGELYY I  KS++HGFP GVCPTVG+GGH SGGG+G M+R++GL+VD++
Sbjct  142   ETAWVQSGATLGELYYNIASKSNIHGFPAGVCPTVGIGGHFSGGGFGTMMRKYGLSVDNI  201

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA++VDV G +L+R  MGEDLFWAI GGG  SFGVIL++KI L++VP TVT FR  +  
Sbjct  202   IDAQLVDVNGNILNRKTMGEDLFWAIRGGGA-SFGVILSWKISLVQVPPTVTAFRVAR--  258

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L     DV  ++   ASKID  LFIR + Q+V    K +   SK +  S++GLFLG S 
Sbjct  259   TLEEGATDVFYKWQLVASKIDKDLFIRAMSQVV----KGSSGGSKRISISFIGLFLGQSG  314

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
              LLS+L+  FP LGL+++DC EM WIES++ W +  N T    LLNR     ASF K+KS
Sbjct  315   ALLSLLSKSFPELGLQQKDCKEMRWIESVVFWANLPNATSTGVLLNR--PNQASFFKKKS  372

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             D+++  IPK+ L+S+WK M+++    +  NPYGGRM EI +T TPFPHRAG LFKI+Y+ 
Sbjct  373   DFVKYVIPKNALESIWKVMIKVEPIWMQWNPYGGRMDEISATATPFPHRAGNLFKIEYST  432

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W EEG  A   H S +R+LH  +AP+VS+ PR+A+LNYRDLDIG+       +EE KVY
Sbjct  433   TWIEEGIEATNHHTSLLRQLHDAMAPYVSKYPREAFLNYRDLDIGSNPSNQTIFEEAKVY  492

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G KYF  N+ RLV VKSRVDPDNFF+NEQSIP
Sbjct  493   GSKYFKDNFLRLVTVKSRVDPDNFFKNEQSIP  524



>ref|XP_009362285.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=537

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 287/518 (55%), Positives = 383/518 (74%), Gaps = 15/518 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F+HCL   S    P   ++  +YSP NAS+SSVL++Y RN RFNT ++ KP +I+T L
Sbjct  29    ENFVHCLLNHSQ---PSHPIAPAIYSPNNASYSSVLESYIRNLRFNTSTTRKPFLILTAL  85

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV++  F ILDMFNLRSI VDI      
Sbjct  86    HESHVQISVVCAQIHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKS----  141

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAW QAGATLGELYYRI EKS +HGFP GV PTVGVGGH SGGGYGNM+R++GL+VD++
Sbjct  142   ETAWAQAGATLGELYYRIAEKSKIHGFPAGVRPTVGVGGHFSGGGYGNMMRKYGLSVDNI  201

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA++V+V G +LDR +MGEDLFWA+ GGGG SFGV++A+KI L+RVP+ VT F   + L
Sbjct  202   VDAQLVNVHGELLDRKSMGEDLFWAVTGGGGASFGVVIAYKINLVRVPEIVTVFNVSRIL  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDS--NSKTVRSSYVGLFLGD  886
                +N  D+V ++   A K+DD LFIRL +  V   T +N+S  N+KT+R+S++ +FL D
Sbjct  262   --EQNATDIVYRWQYIAHKLDDDLFIRLTMD-VRNGTSSNNSGGNNKTLRASFLAMFLRD  318

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI+N  FP LGLK+ DC+EMSW +S+L W  F  GT  EALL+R      + LKR
Sbjct  319   SERLLSIMNKSFPELGLKQSDCAEMSWAQSVLFWTKFPTGTATEALLSRKHQA-LTHLKR  377

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  +++KM+EL    L  NPYGG+M+EI ++ TPFPH+AG L+K+QY
Sbjct  378   KSDYVKKPIPKTGLMWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHKAGNLWKVQY  437

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEE  352
             A +W   G  A   +I   R+LH ++ PFVS+NPR+A+ +Y+DLDIG     +G+ SY E
Sbjct  438   ATNWDILGTKAADHYIELTRKLHMYMTPFVSKNPREAFYSYKDLDIGINHNANGISSYLE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLV VK++V+P NFFRNEQSIP+L
Sbjct  498   GRVYGIKYFKHNFDRLVNVKTKVNPGNFFRNEQSIPTL  535



>ref|XP_009125223.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=569

 Score =   521 bits (1343),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 287/519 (55%), Positives = 378/519 (73%), Gaps = 16/519 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+Y+SFL C S  +      D + S+V   ++ASF+  L+AY RN R+NT +SPKP+I++
Sbjct  58    PIYESFLKCFSNQTCTA--PDKLCSVVLPQSSASFTPTLRAYIRNARYNTSTSPKPLIVI  115

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
                 E+HV   VLC K L  +++ RSGGHDY+G+SY+S+  + +LDM  LR+I VD+A  
Sbjct  116   AARSEAHVKATVLCTKSLNFQLKTRSGGHDYDGLSYISNRPYFVLDMSYLRNITVDMA--  173

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
             DGG +AWV AGATLGE+YY IW+KS  HGFP GVCPTVGVGGH+SGGGYGNMIR++GL+V
Sbjct  174   DGGGSAWVGAGATLGEVYYSIWQKSKSHGFPAGVCPTVGVGGHISGGGYGNMIRKYGLSV  233

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVILAFKIKL+ VP TVT FR E
Sbjct  234   DYVTDAKIVDVNGRILDRKSMGEDLFWAIGGGGGASFGVILAFKIKLVPVPPTVTVFRVE  293

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   L     D+V ++   A K    LF+RLLLQ   P TK   + ++TVR+S V LFLG
Sbjct  294   K--TLEEGALDMVHKWQFVAPKTSPDLFMRLLLQ---PKTK---NTTQTVRASVVALFLG  345

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASF  715
                 LLS+L  +FP LGL+ ++C+EM+WI+S++ W +  N T  KPE LL+R P   ASF
Sbjct  346   RQSDLLSLLGKEFPELGLRTENCTEMTWIQSVMWWANSDNATLIKPEILLDREP-DSASF  404

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY++  I K  L  L+ K++E G  GL  NPYGG M ++P+T+TPFPHR   LFK
Sbjct  405   LKRKSDYVETEISKEGLGFLFTKLMETGKLGLVFNPYGGIMCQVPTTKTPFPHRKR-LFK  463

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             +Q++++WK+ G  A+   + + R  +S++APFV++NPR  YLNYRDL+IGT  HG +SY 
Sbjct  464   VQHSMNWKDAGIEAENSFMEKTRSFYSYMAPFVTKNPRHTYLNYRDLEIGTNSHGPNSYR  523

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQS+P+L
Sbjct  524   EAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQSVPTL  562



>ref|XP_006304944.1| hypothetical protein CARUB_v10011431mg [Capsella rubella]
 gb|EOA37842.1| hypothetical protein CARUB_v10011431mg [Capsella rubella]
Length=533

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 294/543 (54%), Positives = 383/543 (71%), Gaps = 23/543 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             +F + L L   +++C +   P   +Y +FL C +  ++ P P  L S +V     A+F+ 
Sbjct  3     IFCLILFL--FVSTCLAVEPPPETIYQNFLQCFTNQTSAP-PNSL-SDVVLPKTAAAFTP  58

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VL+AY RN RFN  ++PKP I++    ESHV   V+C K L +++R RSGGHDYEG+SYV
Sbjct  59    VLRAYIRNSRFNVTTTPKPAIVIAARSESHVQAAVVCTKSLNIQLRTRSGGHDYEGVSYV  118

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             S+  F +LDM NLR+I VD A      +AWV AGATLGE+YY IWEK+  HGFP GVCPT
Sbjct  119   SNVPFFVLDMSNLRNITVDAASA----SAWVGAGATLGEVYYMIWEKTKSHGFPAGVCPT  174

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VG GGH+SGGGYGNMIR++GL+VD+V DA+IVDV GRVLDR  MGEDLFWAINGGGG SF
Sbjct  175   VGAGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGRVLDRKGMGEDLFWAINGGGGASF  234

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GVILAF+IKL+ VP TVT FR EK   L  N  D+V ++   A K D  LF+RLLLQ   
Sbjct  235   GVILAFRIKLVPVPPTVTVFRVEK--NLDENAVDMVHKWQFVAPKTDPGLFMRLLLQ---  289

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+   +N +TVR+S V LFLG+ + ++S L  DFP LGLKK++C+EM+WI+S++ W +
Sbjct  290   PVTR---NNIQTVRASVVALFLGNRDTVMSTLTKDFPELGLKKENCTEMTWIQSVMWWAN  346

Query  777   FGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N T  KPE LL+R P   A FLKRKSD++   I K  LD L+KKM+E+G  GL  NPY
Sbjct  347   NDNATQIKPEILLDRNP-DSAYFLKRKSDFVDKEITKEGLDFLFKKMIEVGKIGLVFNPY  405

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GG M E+  T+TPFPHR   L+KIQ++++WK+ G  A+   + + R  +S++AP+V++NP
Sbjct  406   GGIMTEVAPTKTPFPHR-NKLYKIQHSMNWKDPGTEAESSFLQKARTFYSYMAPYVTKNP  464

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R  Y+NYRDLDIG   HG +SY E +VYG  YF  N++RLVKVK+ VDP NFFR+EQSIP
Sbjct  465   RHTYINYRDLDIGVNSHGPNSYREAEVYGRMYFGENFDRLVKVKTAVDPQNFFRDEQSIP  524

Query  243   SLS  235
             + S
Sbjct  525   TSS  527



>ref|XP_002523156.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39187.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=510

 Score =   519 bits (1337),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 377/513 (73%), Gaps = 16/513 (3%)
 Frame = -3

Query  1776  SFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLH  1597
             + L CLST S    P   +S + Y P+N  ++S+LQ+Y RN RFN+ +SPKP  IVTP H
Sbjct  11    TILQCLSTHSITNPP---ISEVTYFPSNPKYTSILQSYIRNLRFNSSASPKPFFIVTPTH  67

Query  1596  ESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGE  1417
              SH+   ++C+K  G+E+R+RSGGHD++G+SY+S+  FIILDMFN+RS+ +D+      E
Sbjct  68    SSHIQASIICSKIHGLELRIRSGGHDFDGLSYISNLPFIILDMFNMRSVSIDMED----E  123

Query  1416  TAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVV  1237
             +AW+++GATLGE+YY I ++S VHG+P GVCPTVGVGGH+SGGGYGN++R++GL+VD+VV
Sbjct  124   SAWIESGATLGEVYYWIAKRSGVHGYPAGVCPTVGVGGHLSGGGYGNLMRKYGLSVDNVV  183

Query  1236  DARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLG  1057
             DA ++D  GRVLDR AMGEDLFWAI GGGG SFGVI+++KIKL+ VP+ VT FR EK   
Sbjct  184   DAVVIDADGRVLDREAMGEDLFWAIRGGGGASFGVIVSWKIKLVLVPEIVTVFRVEK--T  241

Query  1056  LTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEK  877
             L    +D+V Q+   A KI   LFIR++L       +      +TV++ +  LFLG++E+
Sbjct  242   LEEGASDIVYQWQQVADKIHKDLFIRVVL------NRAVRHGQETVKAKFNALFLGNAER  295

Query  876   LLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSD  697
             L+ +++  FP LGL  +DC EMSWIES+L W ++  GT  + LL R    +  FLKRKSD
Sbjct  296   LVGLMDEKFPELGLLHKDCKEMSWIESVLFWSNYPIGTSVDVLLERHSQAE-KFLKRKSD  354

Query  696   YLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVS  517
             Y+Q PI K  L+ +WKKM+EL    L +NPYGGRM+EIP  +TPFPHRAG ++KIQYAVS
Sbjct  355   YVQEPISKQDLEGIWKKMIELKQAALTLNPYGGRMSEIPECETPFPHRAGNIYKIQYAVS  414

Query  516   WKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYG  337
             WK+    A+ +++  IR+++ ++ PFVS++PR +YLNYRD+D+G  + G  SYEE   +G
Sbjct  415   WKDASVEAEEQNLDIIRKMYDYMTPFVSKSPRCSYLNYRDVDLGVNEVGNESYEEASRWG  474

Query  336   HKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             +KYF GN++RLV+VK++VDP NFFR EQSIPSL
Sbjct  475   YKYFKGNFDRLVEVKTKVDPCNFFRYEQSIPSL  507



>emb|CDX94009.1| BnaC07g36430D [Brassica napus]
Length=539

 Score =   520 bits (1338),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 294/518 (57%), Positives = 383/518 (74%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SF+ C S  + +P  +  ++  V+SP N S+SSVL+AY RN RFNT S+PKP II T
Sbjct  34    VYESFVQCFSDKTKSPQAQ--IAENVFSPTNPSYSSVLRAYIRNARFNTSSTPKPTIIFT  91

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   VLC+K L    ++RSGGHDY+G+SYVSD  F ILDM NLR + V+I+   
Sbjct  92    PRSYSHVSAAVLCSKPLNFVFKIRSGGHDYDGLSYVSDKPFFILDMSNLRDVTVNISD--  149

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               +TAW+ AGATLGE+YY IW +S VHGFP GVCPTVGVGGH+SGGGYGNM+R++GL+VD
Sbjct  150   --QTAWISAGATLGEVYYGIWRESKVHGFPAGVCPTVGVGGHLSGGGYGNMVRKYGLSVD  207

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDVKGRVLDR AMGEDLFWAI+GGGGGSFGV+L +K+KL+ VP TVT FR E+
Sbjct  208   YVEDAKIVDVKGRVLDRKAMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPSTVTVFRVEQ  267

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++     K D +LF+R+L+Q    PT  N    KTVR+S V LFLG 
Sbjct  268   YMDA--GAVDMVHKWQFVGPKTDRNLFMRMLIQ----PTTRN--KVKTVRASVVALFLGR  319

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             ++ ++S+L  DFP LGLKK+ C EM+WI+S + W +  N T+  P+  L+R     ASF 
Sbjct  320   ADDVVSLLAKDFPELGLKKEACKEMTWIQSAIWWDNDENATQTDPKVFLDRD-LDSASFG  378

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IP+  +++L+KKM+ELG  GL  NPYGG+MAE+    TPFPHR   LFKI
Sbjct  379   KRKSDYVATEIPRDGIETLFKKMIELGKIGLVFNPYGGKMAEVAEDATPFPHR-NKLFKI  437

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+SF+  FVS+NPR AYLNYRD+DIG  DHG++SY+E
Sbjct  438   QYSVNWKESSAEIEKGYLNQAKVLYSFMTGFVSKNPRNAYLNYRDVDIGVNDHGVNSYKE  497

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLVK+K+ VDPDNFFRNEQSIP+L
Sbjct  498   GEVYGRKYFGNNFDRLVKIKTAVDPDNFFRNEQSIPTL  535



>ref|XP_003534782.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=533

 Score =   519 bits (1337),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 287/518 (55%), Positives = 371/518 (72%), Gaps = 23/518 (4%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P++D+FL CL+  + +  P   ++ IV+   N  F  VL  Y RN  FNT S+ KP++IV
Sbjct  30    PIHDTFLQCLTQHANSTTP---LADIVFDNTNPKFPIVLANYIRNAGFNTSSTTKPLLIV  86

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP+ ESHV   VLCAK   V++R+RSGGHDYEG+SY+S   FI+LDM NLR+I VD+   
Sbjct  87    TPMVESHVQAAVLCAKSANVQLRIRSGGHDYEGLSYISPKPFILLDMSNLRTITVDVKN-  145

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                E A VQAGA LGELYYRIWEKS VHGF   VCPTVGVGGH+SGGGYG M+R++GL+V
Sbjct  146   ---ELAVVQAGAILGELYYRIWEKSKVHGFSAAVCPTVGVGGHISGGGYGTMLRKYGLSV  202

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFGVI++F IK++ VP+TVT+FR +
Sbjct  203   DNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFGVIVSFTIKIVPVPETVTFFRVD  262

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +   L +N  D+V Q+   A   DD LF+RLLL            + KT  +S V LFLG
Sbjct  263   R--TLEQNATDLVLQWQQVAPTTDDRLFMRLLLS----------PSGKTATASVVALFLG  310

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPAGDAS  718
              + +LL IL+  FP LGLKK++C+E  WI+S++ +    +F  G KPE LL R P   A 
Sbjct  311   GANELLPILDKQFPLLGLKKENCTEGRWIDSVIWFDDEEAFEKGAKPEVLLERNPNW-AL  369

Query  717   FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLF  538
             FLKRKSDY+QN IP+  L+ LWK ++E+G TGLA NPYGG+M++I    TPFPHR G LF
Sbjct  370   FLKRKSDYVQNAIPREGLELLWKTIIEMGKTGLAFNPYGGKMSQILPDATPFPHRKGNLF  429

Query  537   KIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSY  358
             KIQY+V+W +   AA +  ++Q R L+S + P+VS+NPR A+LNYRD+DIGT   G +S+
Sbjct  430   KIQYSVTWSDPSPAAAQNFLNQTRVLYSVMTPYVSKNPRSAFLNYRDIDIGTNSFGKNSF  489

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             EEG+VYG KYF  N++RLVKVK+ VDP+NFF  EQSIP
Sbjct  490   EEGEVYGAKYFNANFQRLVKVKTAVDPENFFAYEQSIP  527



>ref|XP_008356815.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=538

 Score =   519 bits (1337),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 376/518 (73%), Gaps = 16/518 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F+HCL   S    P   ++  +YSP NAS+SSVL+ Y +N RFNT ++ KP +I+T L
Sbjct  31    ENFVHCLLNHSQTSHP---IAPAIYSPKNASYSSVLEFYIQNLRFNTSTTRKPFLILTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV+   F ILDMFNLRSI VDI      
Sbjct  88    HESHVQISVVCAQIHNLQMKIRSGGHDYEGVSYVAVVPFFILDMFNLRSIHVDIKS----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             +TAWVQAGATLGE+ YRI EKS  HGFP GV PTVGVGGH SGGGYGNM+R++GL+VD++
Sbjct  144   KTAWVQAGATLGEVSYRIAEKSKTHGFPAGVGPTVGVGGHFSGGGYGNMMRKYGLSVDNI  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA++V+V G +LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT F+  +  
Sbjct  204   VDAQLVNVHGELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFKVPR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDS--NSKTVRSSYVGLFLGD  886
              L +N  D+V ++   A K+DD LFIRL + +V   T +N S  N+KT  +S++ +FLGD
Sbjct  262   TLEQNATDIVYRWQYIADKLDDDLFIRLTMGVVNG-TSSNSSGENNKTFTASFIAMFLGD  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI++  FP L L + DC+EMSW +SML W     G+  EALLNRT      F KR
Sbjct  321   SERLLSIMDKSFPELRLTQSDCTEMSWAQSMLFWSILPTGSATEALLNRTQV--RRFFKR  378

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  ++KKM+EL    L  NPYGG+M+EI ++ TPFPHRAG L+K+QY
Sbjct  379   KSDYVKKPIPKTGLKWIFKKMIELEKPRLTFNPYGGKMSEISASATPFPHRAGNLWKVQY  438

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEE  352
             A  W   G  A   HI   R+LH ++ PFVS+NPR+A+ NY+DLDIG     +G+ SY E
Sbjct  439   ATDWDIPGTEASDHHIEFTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLE  498

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  499   GRVYGIKYFKHNFDRLVNVKTKVDPGNFFRNEQSIPTL  536



>gb|KHN44649.1| Reticuline oxidase-like protein [Glycine soja]
Length=577

 Score =   520 bits (1339),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 287/518 (55%), Positives = 371/518 (72%), Gaps = 23/518 (4%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P++D+FL CL+  + +  P   ++ IV+   N  F  VL  Y RN  FNT S+ KP++IV
Sbjct  30    PIHDTFLQCLTQHANSTTP---LADIVFDNTNPKFPIVLANYIRNAGFNTSSTTKPLLIV  86

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP+ ESHV   VLCAK   V++R+RSGGHDYEG+SY+S   FI+LDM NLR+I VD+   
Sbjct  87    TPMVESHVQAAVLCAKSANVQLRIRSGGHDYEGLSYISPKPFILLDMSNLRTITVDVKN-  145

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                E A VQAGA LGELYYRIWEKS VHGF   VCPTVGVGGH+SGGGYG M+R++GL+V
Sbjct  146   ---ELAVVQAGAILGELYYRIWEKSKVHGFSAAVCPTVGVGGHISGGGYGTMLRKYGLSV  202

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG SFGVI++F IK++ VP+TVT+FR +
Sbjct  203   DNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGASFGVIVSFTIKIVPVPETVTFFRVD  262

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +   L +N  D+V Q+   A   DD LF+RLLL            + KT  +S V LFLG
Sbjct  263   R--TLEQNATDLVLQWQQVAPTTDDRLFMRLLLS----------PSGKTATASVVALFLG  310

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG---SFGNGTKPEALLNRTPAGDAS  718
              + +LL IL+  FP LGLKK++C+E  WI+S++ +    +F  G KPE LL R P   A 
Sbjct  311   GANELLPILDKQFPLLGLKKENCTEGRWIDSVIWFDDEEAFEKGAKPEVLLERNPNW-AL  369

Query  717   FLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLF  538
             FLKRKSDY+QN IP+  L+ LWK ++E+G TGLA NPYGG+M++I    TPFPHR G LF
Sbjct  370   FLKRKSDYVQNAIPREGLELLWKTIIEMGKTGLAFNPYGGKMSQILPDATPFPHRKGNLF  429

Query  537   KIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSY  358
             KIQY+V+W +   AA +  ++Q R L+S + P+VS+NPR A+LNYRD+DIGT   G +S+
Sbjct  430   KIQYSVTWSDPSPAAAQNFLNQTRVLYSVMTPYVSKNPRSAFLNYRDIDIGTNSFGKNSF  489

Query  357   EEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             EEG+VYG KYF  N++RLVKVK+ VDP+NFF  EQSIP
Sbjct  490   EEGEVYGAKYFNANFQRLVKVKTAVDPENFFAYEQSIP  527



>ref|XP_008392313.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=538

 Score =   518 bits (1335),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 375/518 (72%), Gaps = 16/518 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F+HCL   S    P   ++  +YSP NAS+SSVL+ Y  N RFNT ++ KP +I+T L
Sbjct  31    ENFVHCLLNHSQXSHP---IAPAIYSPXNASYSSVLEXYIXNLRFNTSTTRKPFLILTAL  87

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CA+   +++++RSGGHDYEG+SYV+   F ILDMFNLRSI VDI      
Sbjct  88    HESHVQISVVCAQIHNLQMKIRSGGHDYEGVSYVAVVPFFILDMFNLRSIHVDIKS----  143

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             +TAWVQAGATLGE+ YRI EKS  HGFP GV PTVGVGGH SGGGYGNM+R++GL+VD++
Sbjct  144   KTAWVQAGATLGEVSYRIAEKSKTHGFPAGVGPTVGVGGHFSGGGYGNMMRKYGLSVDNI  203

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA++V+V G +LDR +MGEDLFWAI GGGG SFGV++A+KI L+RVP+ VT F+  +  
Sbjct  204   VDAQLVNVHGELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFKVPR--  261

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDS--NSKTVRSSYVGLFLGD  886
              L +N  D+V ++   A K+DD LFIRL + +V   T +N S  N+KT  +S++ +FLGD
Sbjct  262   TLEQNATDIVYRWQYIADKLDDDLFIRLTMGVVNG-TSSNSSGENNKTFTASFIAMFLGD  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             SE+LLSI++  FP L L + DC+EMSW +SML W     G+  EALLNRT      F KR
Sbjct  321   SERLLSIMDKSFPELRLTQSDCTEMSWAQSMLFWSILPTGSATEALLNRTQV--RRFFKR  378

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PIPK  L  ++KKM+EL    L  NPYGG+M+EI ++ TPFPHRAG L+K+QY
Sbjct  379   KSDYVKKPIPKTGLKWIFKKMIELEKPRLTFNPYGGKMSEISASATPFPHRAGNLWKVQY  438

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTD--HGLHSYEE  352
             A  W   G  A   HI   R+LH ++ PFVS+NPR+A+ NY+DLDIG     +G+ SY E
Sbjct  439   ATDWDIPGTEASDHHIEFTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLE  498

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLV VK++VDP NFFRNEQSIP+L
Sbjct  499   GRVYGIKYFKHNFDRLVNVKTKVDPGNFFRNEQSIPTL  536



>ref|XP_004293693.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   516 bits (1330),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 275/515 (53%), Positives = 377/515 (73%), Gaps = 15/515 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D+FL CLS ++ +P P   +SS+ Y P + S++ +L +Y RN RF T  +P P  IVTP 
Sbjct  9     DTFLQCLSNLTQSPSPS--ISSVTYFPTDPSYTPILHSYIRNLRFTTPKTPTPSFIVTPT  66

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             H SH+   +LC+K   +++R+RSGGHDY+G+SY+SD  FII+DMFNLRSI V+I      
Sbjct  67    HVSHIQASILCSKIHNLQVRIRSGGHDYDGLSYISDVPFIIIDMFNLRSITVNIEE----  122

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             E+AWV++GATLGE+YYRI E+S +HG+P GVCPTVGVGGH+SGGGYGNM+R+ GL+VD++
Sbjct  123   ESAWVESGATLGEVYYRIAEQSKIHGYPAGVCPTVGVGGHLSGGGYGNMMRKHGLSVDNI  182

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVI+++KIKL++VP+ VT FR E+  
Sbjct  183   LDAQIVDVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVQVPEVVTVFRVER--  240

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L +   D+V Q+ +  + IDD LFIR+++  V      N    +TV++ +V L+LG++E
Sbjct  241   TLEQGATDIVHQWQHVGNTIDDDLFIRVVVMPV------NRKTQRTVKAKFVALYLGNAE  294

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
             KL +++   FP LGLK +D  E+ WIES+L W ++  GT  + LL R P  +  FLK+KS
Sbjct  295   KLEALMGERFPRLGLKHEDYVEIGWIESVLYWSNYPIGTSADVLLERIPQSE-KFLKKKS  353

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             DY+Q P+ K  L+ LW KM EL    L  NPYGG+M++I    TPFPHRAG ++KIQY+V
Sbjct  354   DYIQEPMSKASLEGLWNKMRELKKPVLTFNPYGGKMSKISELDTPFPHRAGNVYKIQYSV  413

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +WKEEG  A+ +H+  IR L+ ++AP+VS++PR +YLNYRD+D+GT  +G  SY E  V+
Sbjct  414   NWKEEGSEAEDKHLDLIRRLYKYMAPYVSKSPRCSYLNYRDVDLGTNGNGNVSYSEASVW  473

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
             G  YF GN+ERLV+VK+ VDP NFFR EQSIP L+
Sbjct  474   GTNYFKGNFERLVQVKTAVDPGNFFRYEQSIPPLT  508



>gb|KCW76615.1| hypothetical protein EUGRSUZ_D01003, partial [Eucalyptus grandis]
Length=463

 Score =   514 bits (1324),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 274/478 (57%), Positives = 364/478 (76%), Gaps = 15/478 (3%)
 Frame = -3

Query  1710  VYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRS  1531
             +Y+P  +S+S+VLQ+Y RN RFNT  +PKP++I+T LHESHV   ++CA+KL V++++RS
Sbjct  1     IYTPNKSSYSNVLQSYIRNLRFNTSDTPKPILILTALHESHVQAAIVCAQKLSVQMKIRS  60

Query  1530  GGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSS  1351
             GGHDYEGISY     F ILDMFNLRS+DVDI      ETAWVQAGATLGE+YY I  KS 
Sbjct  61    GGHDYEGISY----PFFILDMFNLRSVDVDIEA----ETAWVQAGATLGEVYYGIAAKSK  112

Query  1350  VHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLF  1171
             VHGFP GVCPTVGVGGH+SGGGYGNM+R++GLTVD+VVDARI++V G +LDR +MGEDLF
Sbjct  113   VHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLTVDNVVDARIINVNGEILDRESMGEDLF  172

Query  1170  WAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDH  991
             WAI GGGG SFGV+LA+KI L+RVP+TVT F   +     +N  DVV ++   A ++ + 
Sbjct  173   WAIRGGGGASFGVVLAYKINLVRVPETVTVFSVPR--TWEQNATDVVYKWEEVAPQLHED  230

Query  990   LFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEM  811
             LFIRL + +V        +  KT+R++++ LFLGD+++LLS++++ FP LGL+  DC EM
Sbjct  231   LFIRLTMDVV----NGTKAGEKTIRATFIALFLGDAQRLLSLMSNSFPELGLRSSDCIEM  286

Query  810   SWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELG  631
             SW+ES L W +F  GT  +ALL+RTP    + LKRKSDY++  IPK  L+ +W++M+EL 
Sbjct  287   SWVESTLFWTNFPIGTPADALLSRTPQV-LTHLKRKSDYVKQIIPKDGLELIWRRMIELE  345

Query  630   NTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSF  451
                L  NPYGG+M EIP+T TPFPHRAG L+K+QYA +W E+G+ A R +I   R+L+ +
Sbjct  346   RPMLTFNPYGGKMGEIPATNTPFPHRAGNLWKVQYATNWDEDGDEAARHYIELTRKLYRY  405

Query  450   LAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDP  277
             + PFVS+NPR+A+LNYRDLD+G   +G  SYEEG+VYG KYF GN+ RLV++K++VDP
Sbjct  406   MTPFVSKNPREAFLNYRDLDLGINHNGDESYEEGRVYGVKYFKGNFNRLVEIKTKVDP  463



>ref|XP_009803657.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=531

 Score =   517 bits (1331),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 289/539 (54%), Positives = 394/539 (73%), Gaps = 20/539 (4%)
 Frame = -3

Query  1851  PVFLVFLALCNLLTSCFSGTIPMYD--SFLHCLSTVSANPIPKDLVSSIVYSPANASFSS  1678
             P+F   L +  +L +  S   P ++  +FL CL T   N  P   +SS+VYSP N+SF S
Sbjct  4     PLFCSSLVIFLVLATSIS---PSHENQTFLECLKT---NSNPSHPISSLVYSPNNSSFPS  57

Query  1677  VLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV  1498
             VLQAY RN RFN  ++ KP+ I+T LHESH+   ++CAK  G+++++RSGGHDYEG+SY+
Sbjct  58    VLQAYIRNLRFNESTTNKPLFILTALHESHIQAAIICAKAQGLQMKIRSGGHDYEGLSYI  117

Query  1497  SDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcpt  1318
             SD  F ILDMFN RSI+V+I      E+AWV+ GATLGE+YYRI EKS+VHGFP GVCPT
Sbjct  118   SDVPFFILDMFNFRSINVNI----DDESAWVEVGATLGEVYYRIAEKSNVHGFPAGVCPT  173

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SGGGYGNM+R++GLTVD++VDA+++DV+GR+LDR  MGEDLFWAI+GGGG SF
Sbjct  174   VGVGGHISGGGYGNMMRKYGLTVDNIVDAKLIDVQGRILDRKLMGEDLFWAISGGGGASF  233

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GV+L++KIKL+RVP  VT FR  +     +N  ++   +   A K DD +F+RL++ +V 
Sbjct  234   GVLLSYKIKLVRVPPKVTVFRVPRLYD--QNALELAYLWQRRADKWDDDMFMRLIIDVVN  291

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
               T+  +   KT+R S+  LFLGDS++L+S +N +FP LGL+++D +EMSW+ES+L + S
Sbjct  292   STTRPTE---KTIRVSFFTLFLGDSKQLVSFMNENFPELGLQQKDITEMSWVESVLYYTS  348

Query  777   FGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGN-TGLAVNPYG  601
             F      +ALL R P    ++LKRKSDYL+ P+ K  L+ ++KKM+EL   T L  NPYG
Sbjct  349   FPIAPI-DALLRRQPPS-VTYLKRKSDYLKKPMSKEGLEYIFKKMIELQTPTILTFNPYG  406

Query  600   GRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPR  421
             G+M+EI  +  PFPHRAG + KIQY+ +W E G  A   +++  R L++++ PFVS+ PR
Sbjct  407   GKMSEISPSAKPFPHRAGNIAKIQYSTNWNEGGVEAANHYLNLTRVLYNYMTPFVSKYPR  466

Query  420   QAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
              A+ NYRD+D+G T +G  SY EG+VYG KYF+GN+ RLVK+K++VDPDNFFRNEQSIP
Sbjct  467   AAFFNYRDIDLGVTHNGKFSYLEGRVYGIKYFLGNFNRLVKIKTKVDPDNFFRNEQSIP  525



>ref|XP_002889895.1| hypothetical protein ARALYDRAFT_471318 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66154.1| hypothetical protein ARALYDRAFT_471318 [Arabidopsis lyrata subsp. 
lyrata]
Length=536

 Score =   517 bits (1331),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 288/521 (55%), Positives = 372/521 (71%), Gaps = 18/521 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y +FL C +  +  P P  L S +V     A+F+ VL+AY RN RFNT ++PKP I++ 
Sbjct  28    IYQNFLQCFTNQTKAP-PNSL-SDVVLPKTAAAFTPVLRAYIRNARFNTTATPKPAIVIA  85

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                ESHV   V+C K L ++++ RSGGHDYEG+SYVS   F +LDM NLR+I VD A   
Sbjct  86    ARSESHVQAAVICTKSLNIQLKTRSGGHDYEGVSYVSHVPFFVLDMSNLRNITVDPAT--  143

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               E+AWV AGATLGE+YYRIWEK+  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+VD
Sbjct  144   --ESAWVGAGATLGEVYYRIWEKTKSHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSVD  201

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR  MGEDLFWAINGGGG SFGVILAFKIKL+ VP TVT FR EK
Sbjct  202   YVTDAKIVDVNGRVLDRKGMGEDLFWAINGGGGASFGVILAFKIKLVPVPPTVTVFRVEK  261

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L  N  D+V ++   A K D  LF+RLLLQ V        +  +TVR+S V LFLG+
Sbjct  262   --NLDENAIDMVHKWQFVAPKTDPGLFMRLLLQPV------TRNKKQTVRASVVALFLGN  313

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASFL  712
                ++S+L  DFP LGLKK++C+EM+WI+S++ W +  N T  KPE LL+R P   ASF 
Sbjct  314   QNTVMSMLTKDFPELGLKKENCTEMTWIQSVMWWANNDNATQIKPEILLDRNP-DSASFG  372

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSD+++  I K  LD L+KKM+E+G  GL  NPYGG M+E+ +T+TPFPHR   L+KI
Sbjct  373   KRKSDFVEKEITKEGLDFLFKKMIEVGKIGLVFNPYGGIMSEVATTKTPFPHRKK-LYKI  431

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             Q++++WK+ G  A+   + + +  +S++APFV++NPR  Y+NYRDLDIG    G +SY  
Sbjct  432   QHSMNWKDPGTEAETSFLQKAKSFYSYMAPFVTKNPRHTYINYRDLDIGVNTPGPNSYRV  491

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRN  229
              +V+G  YF  N++RLVKVK+ VDP NFFR+EQSIP+L  N
Sbjct  492   AEVFGRMYFGENFDRLVKVKTAVDPQNFFRDEQSIPTLPSN  532



>ref|XP_006418476.1| hypothetical protein EUTSA_v10007313mg [Eutrema salsugineum]
 gb|ESQ36829.1| hypothetical protein EUTSA_v10007313mg [Eutrema salsugineum]
Length=538

 Score =   516 bits (1330),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 289/542 (53%), Positives = 389/542 (72%), Gaps = 20/542 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             + ++FL + + L +  S   P+Y SFL C S  +      D +  +V   ++ASF+  L+
Sbjct  8     ILVLFLFVSSSLAATPSNP-PIYQSFLQCFSNQTGTT--PDKLCDVVLPQSSASFAPTLR  64

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFNT +SPKP+I++    ESHV   VLC K L  +++ RSGGHDY+G+SY+S+ 
Sbjct  65    AYIRNARFNTSTSPKPLIVIAARSESHVQATVLCTKSLNFQLKTRSGGHDYDGVSYISNR  124

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp---ggvcpt  1318
              F +LDM NLR+I VD++  D G +AWV AGATLGE+YY IW+KS  HG      GVCPT
Sbjct  125   PFFVLDMSNLRNITVDMS--DDGGSAWVGAGATLGEVYYNIWQKSKTHGTHGFPAGVCPT  182

Query  1317  vgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSF  1138
             VGVGGH+SGGGYGNMIR++GL+VD+V DA+IVDVKGR+LDR +MGEDLFWAI GGGG SF
Sbjct  183   VGVGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVKGRILDRKSMGEDLFWAIGGGGGSSF  242

Query  1137  GVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVP  958
             GVIL+FKIKL+ VP  VT FR EK   L  N  D+V ++   A K    LF+RL++Q   
Sbjct  243   GVILSFKIKLVPVPPRVTVFRVEK--TLEENALDMVHKWQFVAPKTSPDLFMRLMMQ---  297

Query  957   PPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS  778
             P T+   + ++TVR+S V LFLG    LLS+++ +FP LGLK ++C+EM+WI+S++ W +
Sbjct  298   PVTR---NGTQTVRASVVALFLGKQSDLLSLVSKEFPELGLKTENCTEMTWIQSVMWWAN  354

Query  777   FGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPY  604
               N T  KPE LL+R P   ASFLKRKSDY++  I K  L+ L+KK++E G  GL  NPY
Sbjct  355   SDNATAIKPEILLDRDP-DSASFLKRKSDYVETEISKQGLEFLFKKLMEAGKLGLVFNPY  413

Query  603   GGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNP  424
             GGRM+++ +T+TPFPHR   LFK+Q++++WK+ G  AD   +++ R  +S++APFV++NP
Sbjct  414   GGRMSQVATTKTPFPHR-NRLFKVQHSINWKDAGTEADSSFMAKTRSFYSYMAPFVTKNP  472

Query  423   RQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             R  YLNYRDLDIG   HG +SY E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQSIP
Sbjct  473   RHTYLNYRDLDIGINTHGPNSYREAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQSIP  532

Query  243   SL  238
             ++
Sbjct  533   TM  534



>gb|KDO77595.1| hypothetical protein CISIN_1g040700mg [Citrus sinensis]
Length=512

 Score =   515 bits (1327),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 282/513 (55%), Positives = 372/513 (73%), Gaps = 27/513 (5%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++FL CLS  S + I    +S  +Y+ +NASFSSVLQ+Y RN RF T ++ KP++IV   
Sbjct  22    ENFLQCLSMQSQSSIA---ISEAIYTSSNASFSSVLQSYVRNLRFATPTTLKPLVIVAAK  78

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+C+KK G++IR+RSGGHDY+G+SYVS+  F+ILDMFNLRSI++ +      
Sbjct  79    HESHVQATVICSKKFGLQIRIRSGGHDYDGLSYVSNVPFVILDMFNLRSINISLTD----  134

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQAGAT           S +HGFP GVCPT+GVGGH SGGGYGNM+R+FGL+VD++
Sbjct  135   ETAWVQAGAT----------ASKIHGFPAGVCPTLGVGGHFSGGGYGNMMRKFGLSVDNI  184

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             VDA+IVDV+GR+LDR +MGEDLFWAI GGG  SF VIL++KIKL++VP+TVT FR  K  
Sbjct  185   VDAQIVDVQGRILDRKSMGEDLFWAIRGGGAASFCVILSWKIKLVQVPETVTVFRVVK--  242

Query  1059  GLTRNFNDVVSQYFNTAS-KIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
              L +   D+V+++   A+ K+D  LFIRL +  V      +    KTV+ S+V +FLG +
Sbjct  243   TLEQGATDLVAKWQQVAADKLDQDLFIRLFINAV----NGSKEGEKTVKVSFVAMFLGQT  298

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             EKLLS++   FP LG++K+DC EM W+ES+L W     GT  E LLNR P    S LKRK
Sbjct  299   EKLLSLMKQSFPELGIQKKDCFEMRWVESVLFWFDQPIGTPLEVLLNRIPKSQVS-LKRK  357

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY+Q PIPK  L+S+WK M+ELG  G+  NPYGG M+EIP+T+TPFPHRAG +FKIQY+
Sbjct  358   SDYVQEPIPKTGLESIWKLMIELGEVGMQWNPYGGIMSEIPATETPFPHRAGNIFKIQYS  417

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKV  343
              +W + G      +++  R  +  + P+VS+NPR+A+LNYRD+DIG+  +G  +YEEGK+
Sbjct  418   ANWNQPGIEVTNRYLNLTRTFYEAMTPYVSKNPREAFLNYRDIDIGSNTNG--TYEEGKI  475

Query  342   YGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             YG KYF  N++RLV+VK+ VDPDNFF  EQSIP
Sbjct  476   YGIKYFKNNFDRLVRVKTSVDPDNFFTYEQSIP  508



>ref|NP_193815.2| FAD-binding Berberine family protein [Arabidopsis thaliana]
 sp|Q9SVG4.2|RETOL_ARATH RecName: Full=Reticuline oxidase-like protein; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAH19545.1| AT4G20830 [Arabidopsis thaliana]
 gb|AEE84365.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
Length=570

 Score =   517 bits (1331),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 293/531 (55%), Positives = 388/531 (73%), Gaps = 19/531 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  + +P  +  ++  V+S  N +FSSVL+AY RN RFNT S+ KP II+T
Sbjct  35    VYNSFLKCFSDKTKSP--QSQITDNVFSQTNPAFSSVLRAYIRNARFNTSSTLKPTIIIT  92

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   V C+K L   +++RSGGHDY+G+SY+SD  F ILDM N+R + VDIA   
Sbjct  93    PRSESHVSAAVTCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNIRDVSVDIASN-  151

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD
Sbjct  152   ---SAWISAGATLGEVYYRIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMVRKFGLSVD  208

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR AMGEDLFWAI GGGGGS+GV+L +K+KL+ VP  VT FR E+
Sbjct  209   YVEDAKIVDVNGRVLDRKAMGEDLFWAITGGGGGSYGVVLGYKVKLVPVPSVVTVFRVEQ  268

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V LFLG 
Sbjct  269   YMD--SGAVDMVHKWQSVGPKTDPNLFMRMLIQ---PVTR---KKVKTVRASVVALFLGR  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++++L+ +FP LGLKK++CSEM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  321   ADEVVALLSKEFPELGLKKENCSEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDTSSFG  379

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPYGG+MAE+     PFPHR   LFKI
Sbjct  380   KRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPYGGKMAEVAVNAKPFPHR-NKLFKI  438

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+SF+  FVS+NPR +Y NYRD+DIG  DHG +SY+E
Sbjct  439   QYSVNWKENSAEIEKGYLNQAKVLYSFMTGFVSKNPRSSYFNYRDVDIGVNDHGANSYKE  498

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L +N+ G    EPG
Sbjct  499   GEVYGRKYFGENFDRLVKIKTAVDPGNFFRNEQSIPTL-KNEKGMLLPEPG  548



>ref|XP_004504726.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=544

 Score =   516 bits (1328),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 292/550 (53%), Positives = 386/550 (70%), Gaps = 21/550 (4%)
 Frame = -3

Query  1869  TMMSSS-PVFLVFLALCNLLTSCFSGTIPMY----DSFLHCLSTVSANPIPKDLVSSIVY  1705
             T++SS  P F+  + L   ++S +S     Y    ++ L CLS  S    P   +S + Y
Sbjct  3     TILSSLLPFFIFHILLIITMSSSYSIQDNNYYNTKNTLLQCLSLYSE---PSHPISEVTY  59

Query  1704  SPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGG  1525
              P   S+S +LQ+Y RN RFN+ ++PKP+ IV P H SH+   +LC KK  +EIR+RSGG
Sbjct  60    FPNTPSYSPILQSYIRNLRFNSSTTPKPLFIVVPTHVSHIQSSILCCKKFDLEIRIRSGG  119

Query  1524  HDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVH  1345
             HDY+G+SYVS   FI+LD+F LRSI  ++      ET WV++GAT+GELYYRI EKS VH
Sbjct  120   HDYDGLSYVSQNPFIVLDIFLLRSIVFNLKD----ETLWVESGATVGELYYRIAEKSKVH  175

Query  1344  gfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWA  1165
             GFP GVCPTVGVGGH SGGGYGNM+R+FGL++D+V+DA+IVDV GRVLDR +MGEDLFWA
Sbjct  176   GFPAGVCPTVGVGGHFSGGGYGNMMRKFGLSIDNVIDAKIVDVDGRVLDRNSMGEDLFWA  235

Query  1164  INggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLF  985
             I GGGG SFGVI+++KI L+ VP+ VT FR EK   L +  +DVV Q+   A KI D LF
Sbjct  236   IRGGGGASFGVIVSWKISLVPVPEIVTVFRVEK--TLEQGASDVVHQWQYVADKIHDGLF  293

Query  984   IRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSW  805
             IR+++     P K N    KT+++ +  LFLGD+ +LL ++   FP LGL  + C EMSW
Sbjct  294   IRVVIS----PAKRN--GEKTIKAKFNALFLGDANELLDVMTERFPELGLVGEQCIEMSW  347

Query  804   IESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNT  625
             I+S+L W ++  GT  + LL R  + +  FLKRKSDY+Q PI K  LD +WKKM+ELG  
Sbjct  348   IDSVLFWYNYPVGTLTDVLLERHSSQE-KFLKRKSDYVQGPISKIGLDGIWKKMVELGKV  406

Query  624   GLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLA  445
              L  NPYGG+M+EI   +TPFPHRAG ++KIQY+VSWKEE      +++ +IR+L+ ++ 
Sbjct  407   SLTFNPYGGKMSEISEEETPFPHRAGNIYKIQYSVSWKEESNDVADQYLDKIRKLYDYMT  466

Query  444   PFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFF  265
             P+VS +PR +YLNYRD+DIG    G  SYEE  ++G+KYF  N++RLV+VKS +DP NFF
Sbjct  467   PYVSNSPRSSYLNYRDVDIGVNGGGNVSYEEASIWGNKYFKRNFDRLVEVKSAIDPSNFF  526

Query  264   RNEQSIPSLS  235
             R EQSIPSLS
Sbjct  527   RYEQSIPSLS  536



>ref|XP_008439524.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=526

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 285/540 (53%), Positives = 391/540 (72%), Gaps = 18/540 (3%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             SSS + L F +L  + +   S    +  SFL CL++ S    P   +S  +++P N+SF 
Sbjct  4     SSSSIILTFFSLTFIFSPLVSSD-SVQQSFLQCLTSTSQPQFP---ISDAIFTPNNSSFL  59

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
              VL +Y RN RF T ++PKP++IVT  H SHV   V+CAK++G++IR+RSGGHD+EG+SY
Sbjct  60    PVLNSYIRNLRFQTPTTPKPLLIVTAKHYSHVQSTVVCAKRVGLQIRIRSGGHDFEGLSY  119

Query  1500  VSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcp  1321
             VS   FIILD+FNLR+I+VDI      +TAWV++GATLGELYY I +KS++H FPGGVCP
Sbjct  120   VSQQPFIILDLFNLRAINVDIPT----QTAWVESGATLGELYYAIAKKSNLHAFPGGVCP  175

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVG GGH SGGGYGN++R++GLTVD+++DA+IV   G++L+R  MGEDLFWAI GGGGGS
Sbjct  176   TVGAGGHFSGGGYGNLLRKYGLTVDNILDAQIVTADGKILNRQTMGEDLFWAIRGGGGGS  235

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVIL++KI L++VP TVT F  ++   +     DVV ++     K+D++LFIRL+L   
Sbjct  236   FGVILSWKISLVQVPSTVTVFDVDR--KIEDGATDVVFEWQQVMDKLDENLFIRLMLH--  291

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
                +    S  KT +++ V LFLG  EKL+ I+N + P+L L++++C EMSWI+S+L W 
Sbjct  292   ---SSKGKSGQKTGKATLVSLFLGPVEKLMEIMNQNIPSLKLQREECFEMSWIQSVLFWA  348

Query  780   SFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYG  601
             +F NGT PEALL+R  A    +LKRKSDY++ PI +  ++ +WK ++++   GL  NPYG
Sbjct  349   NFANGTAPEALLSRKMAS-TPYLKRKSDYVREPISREGIEGIWKAIMDVEKVGLTWNPYG  407

Query  600   GRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPR  421
             GRM+EI  T TPFPHRAGV FKIQY+ +WKE G+    E I   R+L+  ++P+V+ NPR
Sbjct  408   GRMSEISETATPFPHRAGVKFKIQYSSNWKEAGDEEAEEEIESSRKLYEAMSPYVTNNPR  467

Query  420   QAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             +A+LNYRD+D+G++ +   S EEGKVYG KYF GN+ERLV VK++VDP NFFRNEQSIP+
Sbjct  468   EAFLNYRDIDVGSSRN--WSLEEGKVYGEKYFKGNFERLVDVKTKVDPQNFFRNEQSIPT  525



>ref|XP_009596049.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis]
Length=533

 Score =   514 bits (1325),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 285/541 (53%), Positives = 392/541 (72%), Gaps = 16/541 (3%)
 Frame = -3

Query  1863  MSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASF  1684
             M+  P+F   L +  LL +  S +     +FL CL T   N  P   +SS+VYSP N+SF
Sbjct  1     MTKIPLFCSSLVILLLLATSISPS-QGNQTFLECLKT---NSNPSYPISSLVYSPNNSSF  56

Query  1683  SSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGIS  1504
              +VLQAY RN RFN  ++ KP+ I+T LHESH+   ++CAK  G+++++RSGGHDYEG+S
Sbjct  57    PTVLQAYIRNLRFNESTTTKPLFILTALHESHIQAAIVCAKAQGLQMKIRSGGHDYEGLS  116

Query  1503  YVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             Y+SD  F ILDMFN RSI+V+I      E+AWV+ GATLGE+YYRI EKS+VHGFP GVC
Sbjct  117   YISDVPFFILDMFNFRSINVNI----DDESAWVEVGATLGEVYYRIAEKSNVHGFPAGVC  172

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH+SGGGYGNM+R++GLTVD++VDA+++DV+GR+LDR +MGEDLFWA+ GGGG 
Sbjct  173   PTVGVGGHISGGGYGNMMRKYGLTVDNIVDAKLIDVQGRILDRKSMGEDLFWAVTGGGGA  232

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             S+GV+L++KIKL+RVP  VT FR  ++    +N  ++   +   A K DD +F+R+++ +
Sbjct  233   SYGVLLSYKIKLVRVPLKVTVFRVPRFYD--QNALELAYLWQRRADKWDDDMFMRMIIDV  290

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
             V   T+  +   KT+R S+  LFLGDS++L+S +N +FP LGL+++D +EMSW+ES+L +
Sbjct  291   VNSTTRPTE---KTIRVSFFTLFLGDSKQLVSFMNENFPELGLQQKDITEMSWVESVLYY  347

Query  783   GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGN-TGLAVNP  607
              SF      +ALL R P    ++LKRKSDYL+ P+ K  L+ ++KKM+EL   T L  NP
Sbjct  348   TSFPIAPI-DALLRRQPPS-VTYLKRKSDYLKKPMSKEGLEYIFKKMIELQTPTSLTFNP  405

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M+EI  +  PFPHRAG + KIQY+ +W E G  A   +++  R L+ ++ PFVS+ 
Sbjct  406   YGGKMSEISPSAKPFPHRAGNIAKIQYSTNWNEGGVEAADHYLNLTRVLYDYMTPFVSKY  465

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR A+ NYRD+D+G T +G  SY EG+VYG KYF GN+ RLVK+K++VDPDNFFRNEQ I
Sbjct  466   PRAAFFNYRDIDLGVTHNGKLSYLEGQVYGIKYFKGNFNRLVKIKTKVDPDNFFRNEQGI  525

Query  246   P  244
             P
Sbjct  526   P  526



>gb|KHN22988.1| Reticuline oxidase-like protein [Glycine soja]
Length=527

 Score =   514 bits (1324),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 298/543 (55%), Positives = 383/543 (71%), Gaps = 32/543 (6%)
 Frame = -3

Query  1851  PVFLVFLALCNLL---TSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFS  1681
             P  L +L+   LL   ++  S    ++ +FL CL+  + N   +  +S IV++  N  F 
Sbjct  4     PNSLAYLSATFLLLTVSTLVSAHSSLHHTFLQCLTHHTKNCSTQ--LSDIVFANTNPKFP  61

Query  1680  SVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISY  1501
             +VLQ Y RN RFNT S+PKP++IVTPL ESHV   V+CAK + V++++RSGGHDYEGISY
Sbjct  62    TVLQNYIRNARFNTSSTPKPLLIVTPLTESHVQAAVICAKTVNVQLKIRSGGHDYEGISY  121

Query  1500  VSDA-TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvc  1324
             +S    FI+LDMFNLR I VDI      E A VQAGA +GE+Y      S VHGFP  VC
Sbjct  122   ISKKHPFIVLDMFNLRKIKVDIKN----EVAVVQAGAVMGEVY------SKVHGFPAAVC  171

Query  1323  ptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggG  1144
             PTVGVGGH+SGGGYGNM+R++GL+VD+V+DA+IVDVKG +L+R  MGEDLFWAI GGGG 
Sbjct  172   PTVGVGGHISGGGYGNMLRKYGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGGGA  231

Query  1143  SFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQI  964
             SFGVI++F IKLL VPKTVT FR E+   L +N  D+V Q+   A   D  LF+RLLLQ 
Sbjct  232   SFGVIVSFTIKLLPVPKTVTVFRVER--TLEQNATDLVLQWQQVAPTTDPGLFLRLLLQ-  288

Query  963   VPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRW  784
                         KTV +S V LFLG +++L+SIL  +FP LGLKK+ C+EM WI+S+L +
Sbjct  289   ---------PEGKTVTASVVALFLGGAKELVSILEKEFPLLGLKKESCTEMRWIDSVLWF  339

Query  783   ---GSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAV  613
                 S  NG KPE LL+R     A FLKRKSDY+Q  IP+  L+ ++K+M++LG  GL  
Sbjct  340   YDDKSLKNGAKPETLLDRH-VNTAFFLKRKSDYVQKAIPREGLECIFKRMIKLGKIGLVF  398

Query  612   NPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVS  433
             NPYGGRMAEIPS  TPFPHR G LFKIQY+V+W +    A +   +Q ++L++++  FVS
Sbjct  399   NPYGGRMAEIPSDATPFPHRKGNLFKIQYSVNWFDPSVGAAKNFTNQAKKLYNYMTLFVS  458

Query  432   RNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQ  253
             +NPR A+LNYRDLDIG    G +S++EG+VYG KYF  N++RLVKVK++VDPDNFFRNEQ
Sbjct  459   KNPRSAFLNYRDLDIGVNRFGKNSFQEGEVYGAKYFNNNFQRLVKVKTKVDPDNFFRNEQ  518

Query  252   SIP  244
             SIP
Sbjct  519   SIP  521



>ref|XP_002889343.1| ATSEC1A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65602.1| ATSEC1A [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   514 bits (1325),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 376/543 (69%), Gaps = 22/543 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
              VFL L +L+T   +   P    Y+SFL C S  +  P  K  +  +V   ++ASF+  L
Sbjct  6     FVFLILSSLVTCSLATAPPNASTYESFLQCFSNHTGAPPGK--LCDVVLPQSSASFTPTL  63

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
             +AY RN RFNT +SPKP++++    E HV   VLC K L  +++ RSGGHDY+G+SY+S+
Sbjct  64    RAYIRNARFNTSTSPKPLLVIAARSECHVQATVLCTKSLNFQLKTRSGGHDYDGVSYISN  123

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp---ggvcp  1321
               F +LDM  LR+I VD++  D G +AWV AGATLGE+YY IW  S  HG      GVCP
Sbjct  124   CPFFVLDMSYLRNITVDMS--DNGGSAWVGAGATLGEVYYNIWHNSKTHGTHGFPAGVCP  181

Query  1320  tvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGS  1141
             TVG GGH+SGGGYGNMIR++GL+VD+V DA+IVDV GR+LDR +MGED FWAI GGGG S
Sbjct  182   TVGAGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGRILDRKSMGEDFFWAIGGGGGAS  241

Query  1140  FGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIV  961
             FGVIL+FKIKL+ VP  VT FR EK   L  N  D+V ++   A K    LF+RL+LQ V
Sbjct  242   FGVILSFKIKLVPVPPRVTVFRVEK--TLEENALDMVHKWQFVAPKTSPDLFMRLMLQPV  299

Query  960   PPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWG  781
                     + ++TVR+S V LFLG    L+S+L  +FP LGLK ++C+EM+WI+S++ W 
Sbjct  300   ------TRNTTQTVRASVVALFLGKQSDLMSLLTKEFPELGLKPENCTEMTWIQSVMWWA  353

Query  780   SFGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNP  607
             +  N T  KPE LL+R P   ASFLKRKSDY++  I K  LD L+KK++E G  GL  NP
Sbjct  354   NNDNATEIKPEILLDRNP-DSASFLKRKSDYVETEISKDGLDFLFKKLMEAGKLGLVFNP  412

Query  606   YGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRN  427
             YGG+M+E+ +T TPFPHR   LFK+Q++++WK+ G  A+   + + R  +S++APFV++N
Sbjct  413   YGGKMSEVATTATPFPHRKR-LFKVQHSMNWKDPGTEAESSFMERTRSFYSYMAPFVTKN  471

Query  426   PRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSI  247
             PR  YLNYRDLDIG   HG  SY E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQSI
Sbjct  472   PRHTYLNYRDLDIGINSHGPKSYREAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQSI  531

Query  246   PSL  238
             P+L
Sbjct  532   PTL  534



>ref|XP_009137152.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=535

 Score =   514 bits (1324),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 297/548 (54%), Positives = 399/548 (73%), Gaps = 20/548 (4%)
 Frame = -3

Query  1869  TMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANA  1690
             T + S   FL+FL+L     S  S ++  Y+SFL C S  +  P P+  ++  V+SP N 
Sbjct  4     TCVFSVVFFLLFLSLPPPSLSQPSHSV--YNSFLKCFSKRTKTPQPQ--IAKNVFSPTNP  59

Query  1689  SFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEG  1510
             ++SSVL+AY RN RFNT S+PKP IIVTP   SHV   VLC+K L    ++RSGGHDY+G
Sbjct  60    AYSSVLRAYIRNARFNTSSTPKPTIIVTPRSYSHVSAAVLCSKPLHFVFKIRSGGHDYDG  119

Query  1509  ISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpgg  1330
             +SY+SD  F +LDM N+R + VD+A      +AW+ AGATLGE+YY+IWEKS VHGFP G
Sbjct  120   LSYISDKPFFVLDMSNIRDVSVDVAE----NSAWISAGATLGEVYYKIWEKSKVHGFPAG  175

Query  1329  vcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggg  1150
              CPTVGVGGH+SGGGYGNM+R+FGL+VDH++DA+IVDV+GRVLDR AMGEDLFWAI+GGG
Sbjct  176   GCPTVGVGGHLSGGGYGNMLRKFGLSVDHLIDAKIVDVRGRVLDRKAMGEDLFWAISGGG  235

Query  1149  gGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLL  970
             G SFGV+L +K+KL+ VP  VT FR E+Y+       D+V ++     K D +LF+R+L+
Sbjct  236   GASFGVVLGYKVKLVPVPPVVTVFRVEQYMA--GGAVDIVHKWQFVGPKTDRNLFMRMLI  293

Query  969   QIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESML  790
             Q   P T+   +  KTVR+S V LFLG ++ ++S+L+ + P L LKK++C+EM+W +S L
Sbjct  294   Q---PVTR---NKVKTVRASVVALFLGKADDVVSLLSKELPELALKKENCTEMTWFQSAL  347

Query  789   RWGSFGNGTK--PEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLA  616
              W +  N T+  P+  L+R     +SF KRKSDY+   IP++ ++SL+KKM+ELG  GL 
Sbjct  348   WWDNRVNATQTDPKVFLDRN-LDSSSFGKRKSDYVATEIPRNGIESLFKKMIELGKIGLV  406

Query  615   VNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFV  436
              NPYGG+MAEI    TPFPHR  +LFKIQY+V+WKE     ++ ++++ +ELHSF+  FV
Sbjct  407   FNPYGGKMAEIAEDATPFPHR-NMLFKIQYSVNWKESSPEIEKGYLNEAKELHSFMTRFV  465

Query  435   SRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNE  256
             S++PR AYLNYRD+DIG  DHG +SY+EG+VYG  YF  N++RLVK+K++VDP NFFRNE
Sbjct  466   SKSPRSAYLNYRDVDIGVNDHGKNSYKEGEVYGRMYFGKNFDRLVKIKTKVDPRNFFRNE  525

Query  255   QSIPSLSR  232
             QSIP+L R
Sbjct  526   QSIPTLPR  533



>ref|XP_010655770.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   514 bits (1323),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 285/546 (52%), Positives = 393/546 (72%), Gaps = 19/546 (3%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTI--PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
                L++ + L   FS T+  P++DSFL CLS +SA   P   +S + Y+P N+S++ VLQ
Sbjct  6     FAILSVLSALVLHFSLTMSDPVHDSFLQCLSHLSA---PSPPISGVFYTPTNSSYAYVLQ  62

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             +Y +N RF + ++PKP  IV   H SHV   ++C K  G+++R+RSGGHDY+G+SYVSD 
Sbjct  63    SYIQNLRFMSSTTPKPSFIVASSHVSHVQATIICCKIHGLQLRIRSGGHDYDGLSYVSDV  122

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F+ILDMFNLR + VDI      E AWVQ+GAT+GELYYRI  KS+++GFP GVCPTVGV
Sbjct  123   PFVILDMFNLREVSVDIEN----EWAWVQSGATMGELYYRIAVKSNLYGFPAGVCPTVGV  178

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH SGGGYGNM+R++GL+VD+V+DA+IVD  GR+LDR +MGEDLFWAI GGGG SFGVI
Sbjct  179   GGHFSGGGYGNMMRKYGLSVDNVLDAQIVDANGRILDRESMGEDLFWAIRGGGGASFGVI  238

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             +A+KI+L+ VP+TVT FR E+   L +   D++ Q+   A KI++ LFIR++  I+P   
Sbjct  239   VAWKIRLVPVPETVTVFRVER--TLEQGAIDLLHQWQYVADKINEDLFIRVV--ILPVIR  294

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             K    + KT+++ +V LFLG+SEKLL++++  FP LG+   +C EMSW+ES++ W ++  
Sbjct  295   K----DHKTIKAKFVSLFLGNSEKLLALMSESFPELGINGNNCIEMSWVESIVYWSNYVK  350

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             GT    LL+RTP     +LK+KSDY+Q  I K  L  +   M+EL    L  NPYGGRM+
Sbjct  351   GTPISVLLDRTPQS-RKYLKKKSDYVQASISKADLKGILNTMMELQKPALTFNPYGGRMS  409

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI  ++TPFPHRAG ++KIQY+V+WKEE   A   +++ IR ++ ++ P+VS +PR +YL
Sbjct  410   EISESETPFPHRAGNIYKIQYSVTWKEESMEAADHNLNMIRRIYDYMTPYVSNSPRGSYL  469

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS-R  232
             NYRD+D+G   +G  SYEE  ++G KYF  N++RLV+VKSRVDPDNFFR EQSIPS++ R
Sbjct  470   NYRDIDLGVNQNGNVSYEEASIWGTKYFKDNFDRLVQVKSRVDPDNFFRYEQSIPSVTNR  529

Query  231   NQTGSE  214
             N   +E
Sbjct  530   NYVMAE  535



>gb|KEH37085.1| reticuline oxidase-like protein [Medicago truncatula]
Length=562

 Score =   514 bits (1325),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 378/538 (70%), Gaps = 16/538 (3%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             + L  + L +L    F+   P  + F+ CL     N  P + +   +++  + SF S+LQ
Sbjct  1     MLLPIVVLLSLFPFGFATNSPQ-NIFIQCLVN---NSEPSNPIIESIFTQNSPSFPSILQ  56

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFNT  +PKP +I+TPLH SH+   ++C +K   ++++RSGGHDYEG+SYVS+ 
Sbjct  57    AYIRNLRFNTTKTPKPFLIITPLHVSHIQASIICGQKHNFQMKIRSGGHDYEGVSYVSNV  116

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F ILDMFNLRSI++DI      ETAW+Q+GATLGE+YYRI EKS  H F  GVCPTVGV
Sbjct  117   PFFILDMFNLRSIEIDI----NTETAWIQSGATLGEVYYRIAEKSKTHAFAAGVCPTVGV  172

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGHVSG GYGN++R++G + D+V+DA I+D KGR+LDR +MGEDLFWAI GGGG +FGV+
Sbjct  173   GGHVSGAGYGNLMRKYGTSTDNVLDAEIIDSKGRLLDRKSMGEDLFWAIRGGGGANFGVV  232

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++KIKL++VPK VT F  ++   L +N +D+V  + + A    + LFIRL+L++V    
Sbjct  233   LSYKIKLVKVPKIVTVFEVQR--TLEQNASDIVYNWQHVAPTTSNDLFIRLILEVV----  286

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             K   + +KT+R++++ LFLGDS+ L+S++N  FP LGL++QDC E SW++S+  W +   
Sbjct  287   KDAKNGAKTIRATFISLFLGDSKTLVSLMNETFPQLGLREQDCIETSWLQSVFLWDNIKI  346

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
              T  + LL R P     +LKRKSDY++ PI K  L+ +WKKM+EL    +  NPYGG+M 
Sbjct  347   DTPFKILLERQPQ-LLRYLKRKSDYVKEPISKEGLEGIWKKMIELEKGVMFFNPYGGKMD  405

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI  T+TP PHRAG L+KIQY  +W EEGE     HI+  REL+ ++ PFVS+NPRQAYL
Sbjct  406   EISPTETPLPHRAGNLWKIQYQANWNEEGEEVTFYHINVTRELYKYMTPFVSKNPRQAYL  465

Query  408   NYRDLDIGTTDHG-LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             NY+DLD+G   HG   SY +G VYG +YF  N+ RLV++K++VDP NFFRNEQSIP L
Sbjct  466   NYKDLDLGINHHGFFSSYSQGSVYGIQYFKDNFHRLVEIKTKVDPSNFFRNEQSIPVL  523



>ref|XP_002869924.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46183.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   515 bits (1326),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 384/526 (73%), Gaps = 19/526 (4%)
 Frame = -3

Query  1770  LHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHES  1591
             L C S  + +P  +  ++  V+S +N SFSSVL+AY RN RFNT S+PKP II+TP  ES
Sbjct  44    LKCFSEKTKSP--QSQITDNVFSQSNPSFSSVLRAYIRNARFNTSSTPKPTIIITPRSES  101

Query  1590  HVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGGETA  1411
             HV   V C+K L   +++RSGGHDY+G+SY+SD  F ILD+ N+R + VDIA      +A
Sbjct  102   HVSAAVTCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDLSNIRDVSVDIAS----NSA  157

Query  1410  WVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDA  1231
             W+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD+V DA
Sbjct  158   WISAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSVDYVEDA  217

Query  1230  RIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLT  1051
             +IVDV GRVLDR AMGEDLFWAI GGGGGS+GV+L +K+KL+ VP  VT FR E+Y+   
Sbjct  218   KIVDVNGRVLDRKAMGEDLFWAITGGGGGSYGVVLGYKVKLVPVPSIVTVFRVEQYMD--  275

Query  1050  RNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLL  871
                 D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V LFLG ++ ++
Sbjct  276   SGAVDMVYKWQSVGPKTDRNLFMRMLIQ---PVTR---KKVKTVRASVVALFLGRADTVV  329

Query  870   SILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFLKRKSD  697
             ++L  +FP LGL K++CSEM+W +S L W +  N T+  P+  L+R     ASF KRKSD
Sbjct  330   ALLRKEFPELGLTKENCSEMTWFQSALWWDNRVNATQEDPKVFLDRN-LDTASFGKRKSD  388

Query  696   YLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVS  517
             Y+   IP+  ++SL+KKM+ELG  GL  NPYGG+MAE+    TPFPHR   LFKIQY+V+
Sbjct  389   YVATAIPRKGIESLFKKMIELGKIGLVFNPYGGKMAEVAVNATPFPHR-NKLFKIQYSVN  447

Query  516   WKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYG  337
             WKE     ++ +++Q + L+SF+  FVS+NPR AY NYRD+DIG  DHG++SY+EG+VYG
Sbjct  448   WKENSAEIEKGYLNQAKVLYSFMTGFVSKNPRSAYFNYRDVDIGVNDHGVNSYKEGEVYG  507

Query  336   HKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCEPG  199
              KYF  N++RLVK+K+ VDP NFFRNEQSIP+L +N  G+   EPG
Sbjct  508   RKYFGENFDRLVKIKTAVDPGNFFRNEQSIPTL-KNAKGTLLPEPG  552



>ref|XP_004486487.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=543

 Score =   514 bits (1323),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 287/519 (55%), Positives = 374/519 (72%), Gaps = 23/519 (4%)
 Frame = -3

Query  1776  SFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPLH  1597
             +FL+C +  + N       S IVY   N SFS+VL  Y RN RFN  +  KP+II+T   
Sbjct  42    NFLNCFTQHTTNS------SDIVYFQTNPSFSTVLNDYIRNARFNKTTIQKPLIIITAKT  95

Query  1596  ESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDAT-FIILDMFNLRSIDVDIAGGDGG  1420
              SHV   V+C+K + ++I++RSGGHD EGISYVS+ + FI+LDMFNLR+I+VDI      
Sbjct  96    PSHVQSTVICSKSINLQIKIRSGGHDNEGISYVSNQSPFIVLDMFNLRTINVDIER----  151

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             E A++QAGAT+GELYYRI+EKS VHGFP  VCPTVGVGGHVSGGGYG M+R++GL  D++
Sbjct  152   EQAYIQAGATIGELYYRIYEKSKVHGFPASVCPTVGVGGHVSGGGYGTMLRKYGLATDNI  211

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA IVDV GR+L+R +MGED+FWAI GGGG SFGVIL++ ++L+ VP+ VT FR  K  
Sbjct  212   IDAEIVDVNGRILNRKSMGEDVFWAIRGGGGASFGVILSYTVQLVSVPEIVTVFRIGK--  269

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L  N  D+V Q+   A   D+ LF+RL LQ    P  +N   SKT+ +S V +FLG ++
Sbjct  270   TLEENATDLVVQWQQVAPTTDERLFMRLYLQ----PITSN--TSKTLSASVVAVFLGGAD  323

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRW---GSFGNGTKPEALLNRTPAGDASFLK  709
             +++ IL  +FP LGLKK+DC E+SWI S+L +    S  +G KPE LL+R     A + K
Sbjct  324   EVVEILGKEFPLLGLKKEDCLELSWINSVLWYYNDQSIKSGAKPEILLDRN-VNSAIYGK  382

Query  708   RKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQ  529
             RKSDY+Q  IPK  L+ +WKKM+ELGN   A NPYGG+MAEI S  TPFPHRAG LFK+Q
Sbjct  383   RKSDYVQKAIPKDSLELIWKKMIELGNISFAFNPYGGKMAEIASDATPFPHRAGNLFKVQ  442

Query  528   YAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEG  349
             Y V+W +  EA++  +++Q R L+SF+ P+VS NPR A+LNYRDLDIG    G +SY+EG
Sbjct  443   YYVNWMDGTEASETNYLTQSRSLYSFMTPYVSSNPRSAFLNYRDLDIGINRFGKNSYQEG  502

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             +VYG+KYF  N++RLVK+K+ VDP+NFFRNEQSIP L R
Sbjct  503   QVYGYKYFKNNFDRLVKIKTTVDPENFFRNEQSIPVLPR  541



>ref|XP_011096701.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=530

 Score =   513 bits (1321),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 291/537 (54%), Positives = 387/537 (72%), Gaps = 22/537 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             VF +F AL  +  S  +     + +F+ CL T  ++P     +S+++Y+  N+S+SSVLQ
Sbjct  8     VFSLFSALL-VSVSWATSNYTSHQAFVQCLETHDSDP--SSPISAVLYTRDNSSYSSVLQ  64

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD-  1492
              Y RN RFN  ++PKP +IVT LH SH+   ++CAK  G+++++RSGGHDYEGISY SD 
Sbjct  65    NYIRNLRFNESTTPKPRLIVTALHVSHIQAAIVCAKAHGLQMKIRSGGHDYEGISYWSDD  124

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               F ILD+FNLRSI+V I      E+AWVQ GATLGE+YYRI EKSS HGFP GVCPTVG
Sbjct  125   PNFFILDLFNLRSINVSIED----ESAWVQVGATLGEVYYRIAEKSSTHGFPAGVCPTVG  180

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
             VGGH SGGGYGNM+R++GL+VD+++DA+I+DV GR+LDR +MGEDLFWAI GGGG SFGV
Sbjct  181   VGGHFSGGGYGNMMRKYGLSVDNIIDAQIIDVDGRLLDRKSMGEDLFWAITGGGGSSFGV  240

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTAS-KIDDHLFIRLLLQIVPP  955
             +L++KIKL+RVP TVT FR  +      NF ++V +Y   A+ K+ + LFIRL L +V  
Sbjct  241   VLSYKIKLVRVPPTVTVFRVRR--TYDENFTNLVHRYQQVAADKLPEELFIRLTLDVV--  296

Query  954   PTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSF  775
                     + T R +++ LFLG S++LLS++N   P LGL + DC EMSW+ES+L W +F
Sbjct  297   --------NGTNRGTFLALFLGKSQELLSVMNESLPELGLDQTDCVEMSWVESVLYWTNF  348

Query  774   GNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGR  595
               GT  +ALL+R P    ++LKRKSDYL+ P+PK  L+ L++KM+EL    L  NPYGGR
Sbjct  349   PTGTPADALLSRVPQV-LNYLKRKSDYLKKPVPKQGLELLFRKMVELQTPMLTFNPYGGR  407

Query  594   MAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQA  415
             MAEI  +  PFPHRAG + K+QYA +W EEGE A   +++  R+L+ ++ P+VS  PR+A
Sbjct  408   MAEISPSAKPFPHRAGNIAKLQYATNWNEEGEEAANRYLNLTRKLYDYMTPYVSMAPREA  467

Query  414   YLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             +LNYRDLDIG   +G +SY EG VYG KY+  N+ RLVK+K++VDPDNFFRNEQSIP
Sbjct  468   FLNYRDLDIGINHNGRNSYLEGAVYGVKYYKDNFNRLVKIKTKVDPDNFFRNEQSIP  524



>ref|XP_004162849.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=538

 Score =   512 bits (1319),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 280/523 (54%), Positives = 375/523 (72%), Gaps = 15/523 (3%)
 Frame = -3

Query  1806  CFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSP  1627
               S   P + + LHCL     +      +S + + P N S+S VL +Y RN RF + ++P
Sbjct  17    ALSAQFPSHQTLLHCL--FDHSSPSSSPISEVTFFPDNPSYSPVLNSYIRNLRFTSPTTP  74

Query  1626  KPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSID  1447
             KP+ IVTP H SHV   VLC +   +EIR+RSGGHDY+G+SYVS + F+ILDMFNLRS+ 
Sbjct  75    KPLFIVTPTHVSHVQATVLCCRIHALEIRIRSGGHDYDGLSYVSASPFVILDMFNLRSVA  134

Query  1446  VDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIR  1267
             VDI      E+AWV +GATLGE+YY+I EKS +HGFP GVCPTVGVGGH+SG GYGN++R
Sbjct  135   VDIED----ESAWVDSGATLGEVYYKIAEKSKIHGFPAGVCPTVGVGGHLSGAGYGNLMR  190

Query  1266  RFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTV  1087
             +FG++VD+VVDA IVDV GRVLDR  MGEDLFWAI GGGG SFGVI+++K KL+ +P+TV
Sbjct  191   KFGVSVDNVVDALIVDVNGRVLDRETMGEDLFWAIRGGGGASFGVIVSWKFKLVLLPETV  250

Query  1086  TYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSY  907
             T FR EK   +     D++ ++   A  ID++LFIR++  I+P     N    KT ++ +
Sbjct  251   TVFRTEK--TIEEGVVDILHKWQEIADTIDENLFIRVV--ILP----VNXKTQKTAKAKF  302

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
             V LFLG+++KL ++++  FP LG+K +DC EMSWIES+L W ++  GT    LL R P  
Sbjct  303   VSLFLGNAQKLFALMSERFPELGIKDEDCKEMSWIESILFWSNYPIGTPLNVLLERQPNS  362

Query  726   DASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAG  547
             +  FLK+KSDY+Q PI K  L+ + +KM+EL    L  NPYGG+M++IP T+TPFPHRAG
Sbjct  363   E-KFLKKKSDYVQEPISKADLEGMMRKMIELKRPALTFNPYGGKMSQIPETETPFPHRAG  421

Query  546   VLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGL  367
               +KIQY+V+WKEEG+ A  +++ +IREL+ ++ P+VS++PR AYLNYRD+D+G    G 
Sbjct  422   NKYKIQYSVTWKEEGDEAAAKNLKKIRELYKYMTPYVSKSPRSAYLNYRDVDLGVNGIGN  481

Query  366   HSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              SY  G ++G KYF GN++RLVKVKS VDPDNFFR EQSIP +
Sbjct  482   ASYWVGSIWGRKYFKGNFDRLVKVKSMVDPDNFFRYEQSIPCV  524



>ref|NP_974580.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
 gb|AAL11614.1|AF424621_1 AT4g20830/F21C20_180 [Arabidopsis thaliana]
 emb|CAB45849.1| reticuline oxidase-like protein [Arabidopsis thaliana]
 emb|CAB79083.1| reticuline oxidase-like protein [Arabidopsis thaliana]
 gb|AAL32673.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91363.1| At4g20830/F21C20_180 [Arabidopsis thaliana]
 gb|AEE84366.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
Length=540

 Score =   512 bits (1318),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 288/518 (56%), Positives = 381/518 (74%), Gaps = 18/518 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  + +P  +  ++  V+S  N +FSSVL+AY RN RFNT S+ KP II+T
Sbjct  35    VYNSFLKCFSDKTKSP--QSQITDNVFSQTNPAFSSVLRAYIRNARFNTSSTLKPTIIIT  92

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P  ESHV   V C+K L   +++RSGGHDY+G+SY+SD  F ILDM N+R + VDIA   
Sbjct  93    PRSESHVSAAVTCSKTLNFLLKIRSGGHDYDGLSYISDKPFFILDMSNIRDVSVDIASN-  151

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+VD
Sbjct  152   ---SAWISAGATLGEVYYRIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMVRKFGLSVD  208

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +V DA+IVDV GRVLDR AMGEDLFWAI GGGGGS+GV+L +K+KL+ VP  VT FR E+
Sbjct  209   YVEDAKIVDVNGRVLDRKAMGEDLFWAITGGGGGSYGVVLGYKVKLVPVPSVVTVFRVEQ  268

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V LFLG 
Sbjct  269   YMD--SGAVDMVHKWQSVGPKTDPNLFMRMLIQ---PVTR---KKVKTVRASVVALFLGR  320

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             +++++++L+ +FP LGLKK++CSEM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  321   ADEVVALLSKEFPELGLKKENCSEMTWFQSALWWDNRLNATQVDPKVFLDRN-LDTSSFG  379

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IPK  ++SL+KKM+ELG  GL  NPYGG+MAE+     PFPHR   LFKI
Sbjct  380   KRKSDYVATAIPKKGIESLFKKMIELGKIGLVFNPYGGKMAEVAVNAKPFPHR-NKLFKI  438

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ +++Q + L+SF+  FVS+NPR +Y NYRD+DIG  DHG +SY+E
Sbjct  439   QYSVNWKENSAEIEKGYLNQAKVLYSFMTGFVSKNPRSSYFNYRDVDIGVNDHGANSYKE  498

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             G+VYG KYF  N++RLVK+K+ VDP NFFRNEQSIP+L
Sbjct  499   GEVYGRKYFGENFDRLVKIKTAVDPGNFFRNEQSIPTL  536



>ref|XP_011005328.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
 ref|XP_011005329.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
 ref|XP_011015640.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=532

 Score =   511 bits (1317),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 280/512 (55%), Positives = 365/512 (71%), Gaps = 16/512 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             D FL CL + S    P   +S  +YS  N SF S+LQA  +NRRF T ++PKP+ I+  +
Sbjct  29    DRFLQCLPSHSH---PSHPISQAIYSNTNPSFESILQALIKNRRFLTPTTPKPLAIIAAV  85

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDGG  1420
             HESHV   V+CAK  G++IR+RSGGHDYEG+SYVS   F+ILDMFNLRSID+DIA     
Sbjct  86    HESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSAVPFVILDMFNLRSIDIDIAS----  141

Query  1419  ETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDHV  1240
             ETAWVQ+GATLGELYY I  +S++HGFP GVCPTVG+GGH SGGG+G M+R++GL+VD++
Sbjct  142   ETAWVQSGATLGELYYNIGSRSNIHGFPAGVCPTVGIGGHFSGGGFGTMMRKYGLSVDNI  201

Query  1239  VDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKYL  1060
             +DA++VDV G +L+R  MGE LFWAI GGG  SFGVIL++KI L++VP TVT FR ++  
Sbjct  202   IDAQLVDVNGNILNRKIMGEHLFWAIRGGGA-SFGVILSWKISLVQVPPTVTAFRVDR--  258

Query  1059  GLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSE  880
              L     DV  ++   ASK+D  LFIR + Q+V    K +   SK +  S++GLFLG S 
Sbjct  259   TLEEGATDVFYKWQLVASKLDKDLFIRAMSQVV----KGSSEGSKRISISFIGLFLGQSG  314

Query  879   KLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRKS  700
              LLS+L+  FP LGL+++DC EM WIES++ W +  N    + LLNR     AS  K+KS
Sbjct  315   ALLSLLSKSFPELGLQQKDCKEMRWIESVVFWANLPNAASTDVLLNR--PNQASLFKKKS  372

Query  699   DYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAV  520
             D+++  IPK+ L+S+WK M+++    +  NPYGGRM EI +T TPFPHRAG LFKI+Y+ 
Sbjct  373   DFVKYVIPKNALESIWKVMIKVEPIWMQWNPYGGRMDEISATATPFPHRAGNLFKIEYST  432

Query  519   SWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVY  340
             +W +EG  A   H S +R+LH  + P+VS+ PR+A+LNYRDLDIG+       +EE KVY
Sbjct  433   TWIQEGIEATNHHTSLLRQLHDAMTPYVSKYPREAFLNYRDLDIGSNPSNQTIFEEAKVY  492

Query  339   GHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G KYF  N+ RLV VKSRVDPDNFF+NEQSIP
Sbjct  493   GSKYFKDNFPRLVTVKSRVDPDNFFKNEQSIP  524



>gb|EYU43214.1| hypothetical protein MIMGU_mgv1a026362mg [Erythranthe guttata]
Length=532

 Score =   511 bits (1316),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 277/519 (53%), Positives = 378/519 (73%), Gaps = 16/519 (3%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRF-NTGSSPKPVIIVTP  1603
             D+F  CLS   +N I  D +  I Y  +N +++++LQ Y RN RF NT ++PKP +I+TP
Sbjct  28    DNFFKCLS---SNNIGDDDLPKITYMQSNINYTNILQEYIRNGRFINTTNTPKPTLILTP  84

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
               ES V  +V CAK + + +++RSGGHDYEG+SY+  A F ILDMFNLRSI V++     
Sbjct  85    FQESQVQAIVNCAKNVNLHLKIRSGGHDYEGLSYMCKAPFAILDMFNLRSIQVNMKD---  141

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAWVQAG+TLGELY++IWE S VHGFP GVCPTVGVGGH+SGGGYG MIR++GL+VDH
Sbjct  142   -ETAWVQAGSTLGELYHKIWENSKVHGFPSGVCPTVGVGGHISGGGYGTMIRKYGLSVDH  200

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             VVDARIV   G +LDR +MGEDLFWAI GGGG SFGV+L++KI L+ VP+ VT FR  + 
Sbjct  201   VVDARIVVANGSILDRASMGEDLFWAIRGGGGASFGVVLSYKINLVPVPEIVTVFRVPR-  259

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
               L +N  D+V ++ N A ++++ LFIR+ +Q V     T  ++  T+R+S++ ++LGDS
Sbjct  260   -TLEQNAVDLVYRWQNIAPQLENELFIRVYIQTV----NTTGNSKITLRTSFIAMYLGDS  314

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             +KL+SI+N  FP LGLKK+DC EMSWI+S+L WG F +      LL+R     ++F K K
Sbjct  315   DKLVSIMNKKFPELGLKKEDCKEMSWIKSILFWGEFPDTAIESDLLSRKALVTSAF-KMK  373

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PI +  L  +++K++  GN  +A+N YGG M+E+  T+T FPHR G ++KIQY 
Sbjct  374   SDYVKTPISRGDLGRIYQKLISSGNIWMAMNAYGGMMSEVADTETAFPHRVGNIYKIQYL  433

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDH-GLHSYEEGK  346
               W E G  +D+ +I  IR  + F+ PFVS+NPR+A+LNYRD+DIG+TD+ G ++Y E +
Sbjct  434   TYWNETGPDSDKANIQSIRNFYDFMTPFVSKNPREAFLNYRDIDIGSTDNVGPNAYSEAR  493

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRN  229
             VYG KYF GN++RLV+VK++VDP NFFRNEQSIP L +N
Sbjct  494   VYGEKYFKGNFDRLVQVKTKVDPTNFFRNEQSIPVLIKN  532



>ref|XP_006305964.1| hypothetical protein CARUB_v10011221mg [Capsella rubella]
 gb|EOA38862.1| hypothetical protein CARUB_v10011221mg [Capsella rubella]
Length=534

 Score =   511 bits (1315),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 280/518 (54%), Positives = 372/518 (72%), Gaps = 16/518 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+YDSFL C S  +  P  K  +  +V   ++ASF+  L+AY RN RFNT +SPKP+I++
Sbjct  26    PIYDSFLQCFSNHTGAPPEK--LCDVVLPQSSASFTPTLRAYIRNARFNTSASPKPLIVI  83

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
                 ESHV   V+C K L  +++ RSGGHDY+G+SY+S+  F +LDM  LR I VD+A  
Sbjct  84    AARSESHVQATVICTKSLNFQLKTRSGGHDYDGVSYISNRPFFVLDMSYLRDITVDMADD  143

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
             DG  +AWV AGATLGE+YY IW+KS  HGFP G+C TVG GGH+SGGGYGNMIR++GL+V
Sbjct  144   DG--SAWVGAGATLGEVYYSIWQKSKTHGFPAGICSTVGAGGHISGGGYGNMIRKYGLSV  201

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V DA+IVDVKG VLDR +MGE+LFWAI GGGG SFGVIL+FKIKL+ VP  VT FR E
Sbjct  202   DYVTDAKIVDVKGCVLDRKSMGEELFWAIRGGGGSSFGVILSFKIKLVPVPPRVTVFRVE  261

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   L  N  D+V ++   A +    LF+RL++    P T+   + ++T+R+S V LFLG
Sbjct  262   K--TLEENALDMVHKWQFVAPETSPDLFMRLMMH---PVTR---NATQTLRASVVALFLG  313

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASF  715
                 L+S+L ++FP LGLK ++C+EM+WI+S++ W +  N T   PE LL+R P   ASF
Sbjct  314   KQSDLMSLLTTEFPELGLKPENCTEMTWIQSVMWWDNKDNATMIAPEILLDRNP-DSASF  372

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY++  I K  L  L+KK++E G  GL  NPYGGRM+E+P+T TPFPHR   LFK
Sbjct  373   LKRKSDYVETEISKDGLGFLFKKLMEAGKLGLVFNPYGGRMSEVPTTATPFPHRKR-LFK  431

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             +Q++++WK+ G  A+   + + R  +S++APFV++NPR  YLNYRDLDIG   HG +SY 
Sbjct  432   VQHSINWKDPGTEAESSFMERTRSFYSYMAPFVTKNPRHTYLNYRDLDIGINTHGPNSYR  491

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             E ++YG KYF  N++RLVKVK+ VDP NFFR+EQSIP+
Sbjct  492   EAELYGRKYFGDNFDRLVKVKTAVDPLNFFRDEQSIPT  529



>ref|XP_002523155.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39186.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=533

 Score =   510 bits (1314),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 274/515 (53%), Positives = 373/515 (72%), Gaps = 18/515 (3%)
 Frame = -3

Query  1782  YDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTP  1603
             +  FL CLS  S    P   +S  +++P N+SF+SVLQ+Y RN RF+  S+PKP+ I+  
Sbjct  26    HQDFLQCLSDNSQKSNP---ISDAIFTPNNSSFTSVLQSYVRNLRFSAPSTPKPIAIIAA  82

Query  1602  LHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGDG  1423
              H+SHV   V+C+K LG++IR+RSGGHDY+G+SYVS+  F++LDMFNLRSI+++I     
Sbjct  83    KHDSHVQAAVICSKTLGLQIRIRSGGHDYDGLSYVSEVPFVVLDMFNLRSININIT----  138

Query  1422  GETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVDH  1243
              ETAWVQAGATLGELYY I +KS+VH FP GVCP++GVGGH SGGGYGN++R++GL+VD+
Sbjct  139   DETAWVQAGATLGELYYNIADKSNVHAFPAGVCPSLGVGGHFSGGGYGNLMRKYGLSVDN  198

Query  1242  VVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEKY  1063
             +VDA+IVD KGR+LDR +MGEDLFWAI GGG  SFGVIL++KI L++VP+ VT F+  + 
Sbjct  199   IVDAQIVDAKGRILDRKSMGEDLFWAITGGGAASFGVILSWKINLVQVPEQVTVFQVVR-  257

Query  1062  LGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDS  883
               + +   D+V ++   A K+D  LFIRL+L     P    +   KTV  ++V +FLG +
Sbjct  258   -SVEQGATDLVWKWQQIADKLDHDLFIRLILT----PVNGTEPGKKTVNVTFVAMFLGGT  312

Query  882   EKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKRK  703
             ++LLS++N  FP LGL+K+DC+EM WIES + W     GT  EALLNR P   + +LKRK
Sbjct  313   KRLLSLMNESFPQLGLQKKDCTEMRWIESTVIWVGMPKGTPIEALLNR-PTNASVYLKRK  371

Query  702   SDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYA  523
             SDY++ PI K  L+S+WK M E+G   +  NPYGG+M+EI  T+TPFPHRAG LFKIQY+
Sbjct  372   SDYVKEPISKKNLESIWKIMAEVG-VSMQWNPYGGKMSEISETETPFPHRAGNLFKIQYS  430

Query  522   VSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTT-DHGLHSYEEGK  346
              +W +  +      ++  R L   + P+VS+NPR+A+LNYRD+DIG+    G  +++E  
Sbjct  431   ANWLQ--DQTTELFLNSTRTLFEAMTPYVSKNPREAFLNYRDIDIGSIGSSGNGTFQEAS  488

Query  345   VYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             VYG KYF  N++RLV+VK+ VDPDNFFR EQSIP+
Sbjct  489   VYGVKYFKDNFDRLVRVKTAVDPDNFFRYEQSIPT  523



>emb|CDX98675.1| BnaA03g44600D [Brassica napus]
Length=535

 Score =   510 bits (1314),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 290/520 (56%), Positives = 386/520 (74%), Gaps = 18/520 (3%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  +  P P+  ++  V+SP N ++SSVL+AY RN RFNT S+PKP IIVT
Sbjct  30    VYNSFLKCFSKRTKTPQPQ--IAKNVFSPTNPAYSSVLRAYIRNARFNTSSTPKPTIIVT  87

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
             P   SHV   VLC+K L    ++RSGGHDY+G+SY+SD  F +LDM N+R + VDI    
Sbjct  88    PRSYSHVSAAVLCSKPLNFVFKIRSGGHDYDGLSYISDKPFFVLDMSNIRDVSVDILSN-  146

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
                +AW+ AGATLGE+YY+IWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGLTVD
Sbjct  147   ---SAWISAGATLGEVYYKIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLTVD  203

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             H++DA+IVDV+GRVLDR AMGEDLFWAI+GGGGGS+GV+L +KI+L+ VP  VT FR E+
Sbjct  204   HLIDAKIVDVRGRVLDRKAMGEDLFWAISGGGGGSYGVVLGYKIRLVPVPPVVTVFRVEQ  263

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
             Y+       D+V ++     K D +LF+R+L+Q   P T+   +  KTVR+S V LFLG 
Sbjct  264   YMA--GGAVDMVHKWQFVGPKTDRNLFMRMLIQ---PVTR---NKVKTVRASVVALFLGK  315

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASFL  712
             ++ ++S+L  + P L LKK++C+EM+W +S L W +  N T+  P+  L+R     +SF 
Sbjct  316   ADDVVSLLRKELPELALKKENCTEMTWFQSALWWDNRVNATQTDPKVFLDRN-LDSSSFG  374

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDY+   IP++ ++SL+KKM+ELG  GL  NPYGG+MAEI    TPFPHR  +LFKI
Sbjct  375   KRKSDYVATEIPRNGIESLFKKMIELGKIGLVFNPYGGKMAEIAEDATPFPHR-NMLFKI  433

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKE     ++ ++++ +ELHSF+  FVS++PR AYLNYRD+DIG  DHG +SY+E
Sbjct  434   QYSVNWKESSPEIEKGYLNEAKELHSFMTRFVSKSPRSAYLNYRDVDIGVNDHGKNSYKE  493

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSR  232
             G+VYG  YF  N++RLVK+K++VDP NFFRNEQSIP+L R
Sbjct  494   GEVYGRMYFGKNFDRLVKIKTKVDPRNFFRNEQSIPTLPR  533



>ref|XP_007147441.1| hypothetical protein PHAVU_006G124800g [Phaseolus vulgaris]
 gb|ESW19435.1| hypothetical protein PHAVU_006G124800g [Phaseolus vulgaris]
Length=523

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 288/540 (53%), Positives = 380/540 (70%), Gaps = 29/540 (5%)
 Frame = -3

Query  1854  SPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSV  1675
              P  L+ L L ++ T   S      ++FLHCL   S +  P   ++S V++  N SFSSV
Sbjct  10    QPSMLLILVLLSIFTFSASAATSADNTFLHCLVNHSESSHP---IASAVFTANNDSFSSV  66

Query  1674  LQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS  1495
             LQA  +N             ++T LH SHV   ++CA+K  + +++RSGGHDYEG SYV+
Sbjct  67    LQAQIKN-------------LLTALHVSHVQASIICAQKHNLLMKIRSGGHDYEGASYVT  113

Query  1494  DATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptv  1315
                F +LDMF LRSI+VDI      ETAWVQAGATLGE+YYRI EKS  HGFP GVCPTV
Sbjct  114   STPFFVLDMFQLRSIEVDI----DTETAWVQAGATLGEVYYRIAEKSKTHGFPAGVCPTV  169

Query  1314  gvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFG  1135
             GVGGH+SGGGYGNM+R++GLTVD+V+DA++VDV+GR+LDR +MGEDLFWAI GGGG SFG
Sbjct  170   GVGGHISGGGYGNMMRKYGLTVDNVIDAQMVDVQGRLLDRKSMGEDLFWAITGGGGSSFG  229

Query  1134  VILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPP  955
             VI+++KIKL+RVP+T+T FR  K   L +N  D+  ++   A  ID+ LFIR +L +V  
Sbjct  230   VIISYKIKLVRVPETITVFRVTK--TLEQNAIDIAYKWQQVAPAIDNDLFIRFILDVVNS  287

Query  954   PTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSF  775
              T      +KT R+++V LFLGDS+ L+S++N  FP LGLK+ DC E SW+ S++ +   
Sbjct  288   TTNV----TKTGRATFVALFLGDSKSLVSLMNEKFPELGLKQSDCIETSWLRSVVFFADI  343

Query  774   GNGTKP-EALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
              N T+P E LL+R P     +LKRKSDY++ PI K  L+ +WKKM+EL N     NPYGG
Sbjct  344   -NITEPVEILLDRQPQ-PLIYLKRKSDYVEKPISKEGLEGIWKKMIELENAVFQFNPYGG  401

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
             RMAEIPST TPFPHRAG L+KIQY   WK+ G+     +I+  R LH ++ PFVS+NPR+
Sbjct  402   RMAEIPSTATPFPHRAGNLWKIQYKADWKQAGKEVTDHYINLTRILHEYMTPFVSKNPRE  461

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             A+ NY+DLD+G   +G ++Y EGKVYG KYF  N++RLV++K+R+DP NFFR+EQSIP+L
Sbjct  462   AFYNYKDLDLGINHNGKNNYVEGKVYGVKYFKDNFKRLVEIKTRIDPHNFFRDEQSIPTL  521



>gb|EYU19100.1| hypothetical protein MIMGU_mgv1a004305mg [Erythranthe guttata]
Length=534

 Score =   510 bits (1313),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 291/547 (53%), Positives = 391/547 (71%), Gaps = 26/547 (5%)
 Frame = -3

Query  1860  SSSPVFLVFLALCNLLT----SCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPAN  1693
             S + +F  FLA+  LL     S  S     Y+ F+ CL   S    P   +S+++Y   N
Sbjct  4     SITSIFSFFLAIFLLLVVSPSSAISSNSSSYEGFIQCLKIKSD---PSSPISAVLYDENN  60

Query  1692  ASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYE  1513
             +S+SSVL+ Y RN RFN  ++PKP +I+T  H SH+   ++CAK  G+++++RSGGHDYE
Sbjct  61    SSYSSVLETYIRNLRFNESTTPKPRLIITAKHVSHIQAAIVCAKANGMQMKIRSGGHDYE  120

Query  1512  GISYVSDA-TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp  1336
             G+SY S    F ILDMFN RS++V I      E+AWV++GA LGE+YYRI EKSS HGFP
Sbjct  121   GVSYWSAVPNFFILDMFNFRSVNVSIED----ESAWVESGALLGEIYYRIAEKSSTHGFP  176

Query  1335  ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINg  1156
              GVCPTVGVGGH SGGGYGNM+R++GL+VD++VDA+++DV G++LDR +MGEDLFWAI G
Sbjct  177   AGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQMIDVNGKLLDRKSMGEDLFWAITG  236

Query  1155  gggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTAS-KIDDHLFIR  979
             GGG SFGV+L++KIKL+ VPK VT FR  +     RN +++V +Y   A+ K+ + LF+R
Sbjct  237   GGGSSFGVVLSYKIKLVSVPKIVTVFRVRR--TYDRNLSELVYRYQQVAADKLPEELFLR  294

Query  978   LLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIE  799
             L L +V      N +N    R++++ +FLG+S++LLS++N  FP LGL + DC+EMSW+E
Sbjct  295   LTLDVV------NGTN----RATFLAMFLGNSQQLLSVMNLSFPELGLNQTDCTEMSWVE  344

Query  798   SMLRWGSFGNGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
             S+L W +F  GT   ALL+R P    ++LKRKSDYL+ PIPK  L+ L+KKM+EL    L
Sbjct  345   SVLFWTNFPAGTPVNALLSRVPQS-LTYLKRKSDYLKKPIPKQGLELLFKKMVELQTPQL  403

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPF  439
               NPYGGRMAEIPS++ PFPHRAG + K+QYA +W E+GE A   +++   EL +F+ P+
Sbjct  404   TFNPYGGRMAEIPSSEKPFPHRAGNIAKLQYATNWNEDGEEAANRYLNLTAELFAFMTPY  463

Query  438   VSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRN  259
             VS  PR+A+LNYRDLDIGT  +G +SY EG VYG KYF  N+ RLVK+K++VDP NFFRN
Sbjct  464   VSMAPREAFLNYRDLDIGTNSNGRNSYIEGAVYGVKYFKDNFNRLVKIKTKVDPRNFFRN  523

Query  258   EQSIPSL  238
             EQSIP L
Sbjct  524   EQSIPVL  530



>ref|NP_171700.1| reticuline oxidase-like family protein [Arabidopsis thaliana]
 gb|AAF76476.1|AC020622_10 Contains similarity to berberine bridge enzyme from Berberis 
stolonifera gb|AF049347 and contains a FAD binding PF|01565 
domain [Arabidopsis thaliana]
 gb|AEE27362.1| reticuline oxidase-like family protein [Arabidopsis thaliana]
Length=541

 Score =   510 bits (1313),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 286/555 (52%), Positives = 380/555 (68%), Gaps = 19/555 (3%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANAS  1687
             M  S  VFL+  +L +   +       +Y+SFL C S  +  P  K  +  +V   ++AS
Sbjct  1     MKLSCLVFLIVSSLVSSSLATAPPNTSIYESFLQCFSNQTGAPPEK--LCDVVLPQSSAS  58

Query  1686  FSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGI  1507
             F+  L+AY RN RFNT +SPKP++++    E HV   VLC K L  +++ RSGGHDY+G+
Sbjct  59    FTPTLRAYIRNARFNTSTSPKPLLVIAARSECHVQATVLCTKSLNFQLKTRSGGHDYDGV  118

Query  1506  SYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp---  1336
             SY+S+  F +LDM  LR+I VD++  D G +AWV AGATLGE+YY IW+ S  HG     
Sbjct  119   SYISNRPFFVLDMSYLRNITVDMS--DDGGSAWVGAGATLGEVYYNIWQSSKTHGTHGFP  176

Query  1335  ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINg  1156
              GVCPTVG GGH+SGGGYGNMIR++GL+VD+V DA+IVDV GR+LDR +MGEDLFWAI G
Sbjct  177   AGVCPTVGAGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGRILDRKSMGEDLFWAIGG  236

Query  1155  gggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRL  976
             GGG SFGVIL+FKIKL+ VP  VT FR EK   L  N  D+V ++   A K    LF+RL
Sbjct  237   GGGASFGVILSFKIKLVPVPPRVTVFRVEK--TLVENALDMVHKWQFVAPKTSPDLFMRL  294

Query  975   LLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIES  796
             +LQ V        + ++TVR+S V LFLG    L+S+L  +FP LGLK ++C+EM+WI+S
Sbjct  295   MLQPV------TRNTTQTVRASVVALFLGKQSDLMSLLTKEFPELGLKPENCTEMTWIQS  348

Query  795   MLRWGSFGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTG  622
             ++ W +  N T  KPE LL+R P   ASFLKRKSDY++  I K  LD L KK++E G  G
Sbjct  349   VMWWANNDNATVIKPEILLDRNP-DSASFLKRKSDYVEKEISKDGLDFLCKKLMEAGKLG  407

Query  621   LAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAP  442
             L  NPYGG+M+E+ +T TPFPHR   LFK+Q++++WK+ G   +   + + R  +S++AP
Sbjct  408   LVFNPYGGKMSEVATTATPFPHRKR-LFKVQHSMNWKDPGTDVESSFMEKTRSFYSYMAP  466

Query  441   FVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFR  262
             FV++NPR  YLNYRDLDIG   HG +SY E +VYG KYF  N++RLVKVK+ VDP+NFFR
Sbjct  467   FVTKNPRHTYLNYRDLDIGINSHGPNSYREAEVYGRKYFGENFDRLVKVKTAVDPENFFR  526

Query  261   NEQSIPSLSRNQTGS  217
             +EQSIP+L    + S
Sbjct  527   DEQSIPTLPTKPSSS  541



>ref|XP_009115056.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=530

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 277/516 (54%), Positives = 370/516 (72%), Gaps = 21/516 (4%)
 Frame = -3

Query  1779  DSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVTPL  1600
             ++F  CL+   +N  PK  +SS V    N+S+SSVL+AY RN RFNT ++PKP++I+   
Sbjct  29    ETFTQCLT---SNSDPKHPISSAVIFSGNSSYSSVLEAYIRNLRFNTSTTPKPLLIIAAT  85

Query  1599  HESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV--SDATFIILDMFNLRSIDVDIAGGD  1426
             HESHV   + C ++  +++++RSGGHDY+G+SYV  S   F +LDMFNLRS+DVD+A   
Sbjct  86    HESHVQAAITCGRRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDLA---  142

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               +TAWVQ+GA LGE+YY IWEKS    +P G+CPTVGVGGH+SGGGYGN++R++GLTVD
Sbjct  143   -SKTAWVQSGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNIMRKYGLTVD  201

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             + +DAR+VDV G +LDR  MGEDL+WAINGGGGGSFGV+LA+KI L+ VP+ VT FR  +
Sbjct  202   NTIDARMVDVNGNILDRKMMGEDLYWAINGGGGGSFGVVLAYKINLVEVPENVTVFRVSR  261

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                L +N  ++V Q+   AS + D LFIR+++ +V        S+ KTVR+S+VG+FLGD
Sbjct  262   --TLEQNATEIVHQWQQVASVLPDELFIRVVIDVVNGTV----SSKKTVRASFVGMFLGD  315

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLKR  706
             +  LLSILN   P LGL + DC+E SWI+S+L W +   GT    LL R      ++LKR
Sbjct  316   ASTLLSILNRRLPELGLVRSDCTETSWIQSVLFWTNIRVGTPETVLLQRNQT--VNYLKR  373

Query  705   KSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQY  526
             KSDY++ PI +  L+S+WKKM+EL    +A NPYGG M  +PST TPFP+RAG L+KIQY
Sbjct  374   KSDYVREPISRTGLESIWKKMIELEIPTMAFNPYGGMMGRVPSTATPFPYRAGNLWKIQY  433

Query  525   AVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG--LHSYEE  352
               +W+E  +     ++   REL+ F+ PFVS+NPRQ+Y NYRD+D+G   H   + SY E
Sbjct  434   GANWRE--DRLTNRYMELTRELYRFMTPFVSKNPRQSYFNYRDVDLGINSHDGVVRSYVE  491

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G+ YG KYF GN+ERLVK+K+RVD  NFFRNEQSIP
Sbjct  492   GERYGKKYFNGNFERLVKIKTRVDSGNFFRNEQSIP  527



>ref|XP_010479531.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=538

 Score =   510 bits (1313),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 283/519 (55%), Positives = 374/519 (72%), Gaps = 16/519 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+Y+SFL C S  +  P P +L   +V   ++AS++  L+AY RN RFNT +SPKP+I++
Sbjct  27    PIYESFLQCFSNHTGAP-PANLCD-VVLPQSSASYTPTLRAYIRNARFNTSTSPKPLIVI  84

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
                 ESHV   VLC K L  +++ RSGGHDY+G+SY+SD  F +LDM  LR+I VD++  
Sbjct  85    AARSESHVQATVLCTKSLNFQLKTRSGGHDYDGVSYISDRPFFVLDMSFLRNITVDMS--  142

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
             D G +AWV AGATLGE+YY IW+KS  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+V
Sbjct  143   DDGGSAWVGAGATLGEVYYNIWQKSKTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSV  202

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V DA+IVDV G +LDR +MGEDLFWAI GGGG SFGVIL+FKIKL+ VP  VT FR E
Sbjct  203   DYVTDAKIVDVNGCILDRKSMGEDLFWAIGGGGGSSFGVILSFKIKLVPVPPRVTVFRVE  262

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   L  N  D+V ++   A K    LF+RL++Q V        + ++T+R+S V LFLG
Sbjct  263   K--TLEENALDMVHKWQFVAPKTSPDLFMRLMMQPV------TRNTTQTLRASVVALFLG  314

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASF  715
                 L+S+L  + P LGLK ++C+EM+WI+S++ W +  N T  +PE LL+R P   ASF
Sbjct  315   QQSDLMSLLTKELPELGLKPENCTEMTWIQSVMWWANNDNATLIEPEILLDRNP-DSASF  373

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY++  I K  LD L+KKM+E G  GL  NPYGG+M+E+ +T TPFPHR   LFK
Sbjct  374   LKRKSDYVETEISKDGLDFLFKKMMEAGKLGLVFNPYGGKMSEVATTATPFPHRKR-LFK  432

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             +Q++++WK+ G  A+   + + R  +S++APFV++NPR  YLNYRDLDIG   HG +SY 
Sbjct  433   VQHSMNWKDPGTEAESSFMEKTRSFYSYMAPFVTKNPRHTYLNYRDLDIGINSHGPNSYR  492

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             E ++YG KYF  N++RLVKVK+ VDPDNFFR+EQSIP+L
Sbjct  493   EAEIYGRKYFGENFDRLVKVKTAVDPDNFFRDEQSIPTL  531



>emb|CDY34627.1| BnaC08g41860D [Brassica napus]
Length=535

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 381/544 (70%), Gaps = 24/544 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIP----MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSV  1675
             L+ L    L+++  +   P    +Y +FL C +T     +P  L + +V+    A +   
Sbjct  3     LLCLTFVFLVSTTLTTATPPDATIYQNFLQCFTT-QTRALPNTL-ADVVFPQTAAGYIPA  60

Query  1674  LQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVS  1495
             L+ Y RN RFNT +SPKP I++    E+HV   V+C K L  +++ RSGGHDYEG+SYVS
Sbjct  61    LRNYIRNARFNTTASPKPAIVIVARSEAHVQAAVVCTKTLKYQLKTRSGGHDYEGVSYVS  120

Query  1494  DATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptv  1315
             +  F +LDM + R I V+      GETAW+ AG TLGE+YYRIWEK+  HGFP GVCPTV
Sbjct  121   NLPFFLLDMSSFRDITVE------GETAWIGAGVTLGEVYYRIWEKTKTHGFPAGVCPTV  174

Query  1314  gvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFG  1135
             G GGH+SGGGYGNMIR++GL+VD+V DA+IV+V GRVLDR  MGEDLFWAINGGGG SFG
Sbjct  175   GAGGHISGGGYGNMIRKYGLSVDYVTDAKIVNVNGRVLDRKGMGEDLFWAINGGGGASFG  234

Query  1134  VILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPP  955
             VIL FKIKL+ VP TVT FR +K   L  N  D+V ++   A K D  LF+R+LLQ   P
Sbjct  235   VILGFKIKLVPVPDTVTVFRVQK--NLDENAVDMVHKWQFVAPKTDPGLFMRVLLQ---P  289

Query  954   PTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSF  775
              T+   +  +TVR+S + LFLG S ++LS+LN DFP LGLK+++C+E++WI+S+L W + 
Sbjct  290   VTR---NKMQTVRASVLALFLGKSSEVLSLLNKDFPELGLKQENCTELTWIQSVLWWDNH  346

Query  774   GNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYG  601
              N T  KPE LL R     AS+ KRKSD+++  I K  LD L KKM+E+G  GL  NPYG
Sbjct  347   DNATLVKPEVLLERN-LDTASYGKRKSDFVEKEITKEGLDYLMKKMIEVGKIGLVFNPYG  405

Query  600   GRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPR  421
             G+++E+ +T+TPFPHR   L+K+Q++++WK+ G  A+   + + +  +S++APFV++NPR
Sbjct  406   GKVSEVATTKTPFPHRKK-LYKVQHSMNWKDPGPEAETSFLEKAKSFYSYMAPFVTKNPR  464

Query  420   QAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
               YLNYRDLDIG   HG +SY EG+VYG KYF  N++RLVKVKS VDP+NFFR+EQSIP+
Sbjct  465   HTYLNYRDLDIGVNTHGPNSYREGEVYGRKYFGENFDRLVKVKSTVDPENFFRDEQSIPT  524

Query  240   LSRN  229
             L  N
Sbjct  525   LPAN  528



>ref|XP_004486493.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=566

 Score =   510 bits (1314),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 381/538 (71%), Gaps = 16/538 (3%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             + L  + L +L +S F+ T   +++F+ CL     N  P + +   +++  + SF S+LQ
Sbjct  1     MLLHIIVLLSLFSSVFA-TNSAHNNFIQCLVN---NSEPSNPIIESIFTQNSPSFPSILQ  56

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RN RFNT ++PKP +I+TPL+ SH+   ++C +K   ++++RSGGHDYEG+SYV++ 
Sbjct  57    AYIRNLRFNTSTTPKPFLIITPLYVSHIKASIICGQKHNFQMKIRSGGHDYEGVSYVAEV  116

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F +LDMFNLRSI+VDI      ETAW+Q+GATLGE+YYRI EKS +HGFP GVCPTVGV
Sbjct  117   PFFMLDMFNLRSIEVDIEN----ETAWIQSGATLGEVYYRIAEKSEIHGFPAGVCPTVGV  172

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGHVSGGGYGN++R++G ++D+V+DA+I+D KGR+LDR  MGEDLFWAI GGGG +FGV+
Sbjct  173   GGHVSGGGYGNLMRKYGTSIDNVIDAQIIDAKGRLLDREEMGEDLFWAIKGGGGANFGVV  232

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++KIKL+ VPK VT F  ++   L +N  ++V  + + A    + LFIRL+L +V    
Sbjct  233   LSYKIKLVHVPKIVTVFEVQR--TLEQNATNIVYNWQHVAPTTSNDLFIRLILDVV----  286

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             K   +  KT+R+S++ L+LGDS+ L+S++N  FP LGL + DC E SW++S+L W +   
Sbjct  287   KDAKNGMKTIRASFIALYLGDSKSLVSLMNESFPQLGLMESDCIETSWLKSVLFWDNINI  346

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
              T  E LL R P     +LKRKSDY++ PI     + +WKKM+EL    +  NPYGG+MA
Sbjct  347   DTPVEILLERQPQL-LRYLKRKSDYVKEPISIMGFEGIWKKMIELEKGVMFFNPYGGKMA  405

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI S +TP PHRAG L+KIQY  +W E GE     HI+  REL+ ++ PFVS+NPRQAYL
Sbjct  406   EISSNETPLPHRAGNLWKIQYQANWNEAGEEVTFYHINVTRELYKYMTPFVSKNPRQAYL  465

Query  408   NYRDLDIGTTDHGLH-SYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             NY+DLD+G   HG   S+ +G VYG +YF  N+ RLV++KS+VDP NFFRNEQSIP L
Sbjct  466   NYKDLDLGINQHGFFSSHSQGSVYGIQYFKDNFHRLVQIKSKVDPGNFFRNEQSIPVL  523



>dbj|BAD94511.1| hypothetical protein [Arabidopsis thaliana]
Length=532

 Score =   509 bits (1310),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 280/528 (53%), Positives = 370/528 (70%), Gaps = 19/528 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  +  P  K  +  +V   ++ASF+  L+AY RN RFNT +SPKP++++ 
Sbjct  19    IYESFLQCFSNQTGAPPEK--LCDVVLPQSSASFTPTLRAYIRNARFNTSTSPKPLLVIA  76

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
                E HV   VLC K L  +++ RSGGHDY+G+SY+S+  F +LDM  LR+I VD++  D
Sbjct  77    ARSECHVQATVLCTKSLNFQLKTRSGGHDYDGVSYISNRPFFVLDMSYLRNITVDMS--D  134

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfp---ggvcptvgvgghvsgggyGNMIRRFGL  1255
              G +AWV AGATLGE+YY IW+ S  HG      GVCPTVG GGH+SGGGYGNMIR++GL
Sbjct  135   DGGSAWVGAGATLGEVYYNIWQSSKTHGTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGL  194

Query  1254  TVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFR  1075
             +VD+V DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVIL+FKIKL+ VP  VT FR
Sbjct  195   SVDYVTDAKIVDVNGRILDRKSMGEDLFWAIGGGGGASFGVILSFKIKLVPVPPRVTVFR  254

Query  1074  AEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLF  895
              EK   L  N  D+V ++   A K    LF+RL+LQ V        + ++TVR+S V LF
Sbjct  255   VEK--TLVENALDMVHKWQFVAPKTSPDLFMRLMLQPV------TRNTTQTVRASVVALF  306

Query  894   LGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDA  721
             LG    L+S+L  +FP LGLK ++C+EM+WI+S++ W +  N T  KPE LL+R P   A
Sbjct  307   LGKQSDLMSLLTKEFPELGLKPENCTEMTWIQSVMWWANNDNATVIKPEILLDRNP-DSA  365

Query  720   SFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVL  541
             SFLKRKSDY++  I K  LD L KK++E G  GL  NPYGG+M+E+ +T TPFPHR   L
Sbjct  366   SFLKRKSDYVEKEISKDGLDFLCKKLMEAGKLGLVFNPYGGKMSEVATTATPFPHRKR-L  424

Query  540   FKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHS  361
             FK+Q++++WK+ G   +   + + R  +S++APFV++NPR  YLNYRDLDIG   HG +S
Sbjct  425   FKVQHSMNWKDPGTDVESSFMEKTRSFYSYMAPFVTKNPRHTYLNYRDLDIGINSHGPNS  484

Query  360   YEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGS  217
             Y E +VYG KYF  N++RLVKVK+ VDP+NFFR+EQSIP+L    + S
Sbjct  485   YREAEVYGRKYFGENFDRLVKVKTAVDPENFFRDEQSIPTLPTKPSSS  532



>gb|KFK42563.1| hypothetical protein AALP_AA1G011500 [Arabis alpina]
Length=535

 Score =   508 bits (1309),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 382/553 (69%), Gaps = 28/553 (5%)
 Frame = -3

Query  1866  MMSSSPVFLVFLALCNLLTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPA  1696
             M  S  +FL+F    +L       T+P   +Y+SFL C S  +      D +  +V   +
Sbjct  1     MKLSCFIFLLFFISTSL------ATVPPNSIYESFLQCFSNQTCTT--PDKLCDVVLPQS  52

Query  1695  NASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDY  1516
             +A ++  L+AY RN R+NT +SPKP+I++    ESHV   VLC K L  +++ RSGGHDY
Sbjct  53    SAIYTPTLRAYIRNSRYNTSTSPKPLIVIAARSESHVQATVLCTKSLNFQLKTRSGGHDY  112

Query  1515  EGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp  1336
             +G+SYVS+  F +LDM  LR+I VD+A  D G +AWV AGATLGE+YY IW+ S  HG  
Sbjct  113   DGLSYVSNQPFFVLDMSYLRNITVDMA--DDGGSAWVGAGATLGEVYYNIWQTSKSHGPH  170

Query  1335  ---ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWA  1165
                 GVCPTVG GGH+SGGGYGNM+R++GL+VD+V DA+IVDV GR+LDR +MGEDLFWA
Sbjct  171   GFPAGVCPTVGAGGHISGGGYGNMMRKYGLSVDYVTDAKIVDVNGRILDRKSMGEDLFWA  230

Query  1164  INggggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLF  985
             INGGGG SFGVILAFK+KL+ VP TVT FR E+   L  N  D+V ++   A K    LF
Sbjct  231   INGGGGSSFGVILAFKLKLVPVPPTVTVFRVEQ--TLEENALDMVHKWQFVAPKTSPDLF  288

Query  984   IRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSW  805
             +RL++Q V        + ++TVR+S V L+LG    L+S+L  +FP L LK ++C+EM+W
Sbjct  289   MRLMMQSV------TRNTTQTVRASVVALYLGRQTDLMSLLTKEFPELRLKTENCTEMTW  342

Query  804   IESMLRWGSFGNGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELG  631
             ++S + W +  N T  KPE +L R P   A+FLKRKSDY++  I K  LD L+KK+L  G
Sbjct  343   LQSAMWWANVENATVAKPEVMLERNP-DTANFLKRKSDYVETEISKEGLDFLFKKLLGSG  401

Query  630   NTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSF  451
                +  NPYGG+M+++P+TQTPFPHR   LFK+Q++++WK+ G  A+   + Q R  +S+
Sbjct  402   KLNIVFNPYGGKMSQVPTTQTPFPHRKR-LFKVQHSMNWKDAGTVAESSFMEQTRSFYSY  460

Query  450   LAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDN  271
             +APFV++NPR  YLNYRDLDIGT  HG +SY E +VYG KYF  N++RLVKVK+ VDP+N
Sbjct  461   MAPFVTKNPRHTYLNYRDLDIGTNSHGPNSYREAEVYGRKYFGENFDRLVKVKTAVDPEN  520

Query  270   FFRNEQSIPSLSR  232
             FFR+EQSIP+L +
Sbjct  521   FFRDEQSIPTLPK  533



>ref|XP_006413852.1| hypothetical protein EUTSA_v10024789mg [Eutrema salsugineum]
 gb|ESQ55305.1| hypothetical protein EUTSA_v10024789mg [Eutrema salsugineum]
Length=568

 Score =   509 bits (1312),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 290/519 (56%), Positives = 385/519 (74%), Gaps = 19/519 (4%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             +Y+SFL C S  + +P  +  ++  V+S ++ S+SSVL+AY RN RFNT S+ KP IIVT
Sbjct  32    VYNSFLKCFSEKTKSP--QAQIAKNVFSQSDPSYSSVLRAYIRNARFNTSSTRKPTIIVT  89

Query  1605  PLHESHVPPVVLCAKKL-GVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             P  +SHV   V+C+K L    +++RSGGHDY+G+SY+SD  F ILD+ NLR + VDIA  
Sbjct  90    PRSDSHVSAAVICSKPLKNFVLKIRSGGHDYDGLSYISDKPFFILDLSNLRDVSVDIASN  149

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                 +AW+ AGATLGE+YYRIWEKS +HGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+V
Sbjct  150   ----SAWISAGATLGEVYYRIWEKSKIHGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSV  205

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+++DA+IVDVKGR+LDR +MGEDLFWAI+GGGGGSFGV+L +K+KL+ VP  VT FR E
Sbjct  206   DNLIDAKIVDVKGRILDRKSMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPPIVTVFRVE  265

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +Y+       D+V ++ +   K D +LF+R+L+Q   P T+      KTVR+S V LFLG
Sbjct  266   QYMD--SGAVDMVHKWQSVGPKTDPNLFMRMLIQ---PVTR---KKVKTVRASVVALFLG  317

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASF  715
              +  ++S+L  +FP L LKK++C+EMSW++S L W +  N T+  P+  L+R     ASF
Sbjct  318   RANDVVSLLRKEFPELALKKENCTEMSWLQSALWWDNHVNATQTDPKVFLDRN-LDSASF  376

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
              KRKSDY+  PIP++ ++SL+KKM+ELG  GL  NPYGG+MAEI    TPFPHR   LFK
Sbjct  377   GKRKSDYVATPIPRNGIESLFKKMIELGKIGLVFNPYGGKMAEIAEDATPFPHRKK-LFK  435

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+V+WKE     ++  ++Q + LHSF+  FVS++PR AYLNYRD+DIG  DHG +SY+
Sbjct  436   IQYSVNWKESSPEIEKGFLNQAKVLHSFMTGFVSKSPRSAYLNYRDVDIGVNDHGKNSYK  495

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EG+VYG  YF  N++RLVKVK+ VDP NFFRNEQSIP+L
Sbjct  496   EGEVYGRSYFGKNFDRLVKVKTAVDPGNFFRNEQSIPTL  534



>ref|XP_010474828.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=538

 Score =   508 bits (1308),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 282/519 (54%), Positives = 375/519 (72%), Gaps = 16/519 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+Y+SFL C S  +  P P++L   +V   ++AS++  L+AY RN RFNT +SPKP+I++
Sbjct  27    PIYESFLQCFSNHTGAP-PENLCD-VVLPQSSASYTPTLRAYIRNARFNTSTSPKPLIVI  84

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
                 ESHV   VLC K L  +++ RSGGHDY+G+SY+SD  F +LDM  LR+I VD+   
Sbjct  85    AARSESHVQATVLCTKSLNFQLKTRSGGHDYDGVSYISDRPFFVLDMSFLRNITVDML--  142

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
             D G +AWV AGATLGE+YY IW+KS  HGFP GVCPTVG GGH+SGGGYGNMIR++GL+V
Sbjct  143   DDGGSAWVGAGATLGEVYYNIWQKSKTHGFPAGVCPTVGAGGHISGGGYGNMIRKYGLSV  202

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+V DA+IVDV G +LDR +MGEDLFWAI GGGG SFGVIL+FKIKL+ VP  VT FR E
Sbjct  203   DYVTDAKIVDVNGCILDRKSMGEDLFWAIGGGGGSSFGVILSFKIKLVPVPPRVTVFRVE  262

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             K   L  N  D+V ++   A K    LF+RL++Q V        + ++TVR+S V +FLG
Sbjct  263   K--TLEENALDMVHKWQFVAPKTSPDLFMRLMMQPV------TRNTTQTVRASVVAMFLG  314

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGT--KPEALLNRTPAGDASF  715
                 L+S+L+ + P LGLK ++C+EM+WI+S++ W +  N T  +PE LL+R P   ASF
Sbjct  315   QQSDLMSLLSKELPELGLKPENCTEMTWIQSVMWWANNDNATMIEPEILLDRNP-DSASF  373

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY++  I K  LD L+KKM+E G  GL  NPYGG+M+E+ +T TPFPHR   LFK
Sbjct  374   LKRKSDYVETEISKEGLDFLFKKMMEAGKLGLVFNPYGGKMSEVATTATPFPHRKR-LFK  432

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             +Q++++WK+ G  A+   + + R  +S++APFV++NPR  YLNYRDLDIG   HG +SY 
Sbjct  433   VQHSMNWKDPGTEAESSFMEKTRSFYSYMAPFVTKNPRHTYLNYRDLDIGINSHGPNSYR  492

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             E ++YG KYF  +++RLVKVK+ VDPDNFFR+EQSIP+L
Sbjct  493   EAELYGRKYFGESFDRLVKVKTAVDPDNFFRDEQSIPTL  531



>ref|XP_007211821.1| hypothetical protein PRUPE_ppa004317mg [Prunus persica]
 gb|EMJ13020.1| hypothetical protein PRUPE_ppa004317mg [Prunus persica]
Length=517

 Score =   507 bits (1306),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 276/519 (53%), Positives = 379/519 (73%), Gaps = 16/519 (3%)
 Frame = -3

Query  1788  PMYDSF-LHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVII  1612
             P  D+F L CLS  S    P   +S++ Y P N+S++S+LQ+Y RN RF T ++PKP+ I
Sbjct  6     PTQDTFFLQCLSNHSQYSSPP--ISAVTYFPNNSSYTSILQSYIRNLRFITPTTPKPLFI  63

Query  1611  VTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAG  1432
             VTP H SH+   + C+K   +++R+RSGGHDY+G+SYVS   FII+DMF+LRSI V +  
Sbjct  64    VTPTHVSHIQASIFCSKIHALQVRIRSGGHDYDGLSYVSQVPFIIVDMFSLRSISVKVED  123

Query  1431  GDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLT  1252
                 E+AWV++GATLGE+YYR+ E+S +HGFP GVCPTVGVGGH+SGGGYGNM+R++GL+
Sbjct  124   ----ESAWVESGATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLS  179

Query  1251  VDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRA  1072
             VD+++DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVI+++KIKL+ VP+ VT FR 
Sbjct  180   VDNILDAQIVDVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVPVPEIVTVFRV  239

Query  1071  EKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFL  892
             E+   L +   D+V Q+   A  I + LFIR ++       ++N    +TV++ +V LFL
Sbjct  240   ER--TLEQGATDIVHQWQYVADTIHEDLFIRAVVM------QSNKKGHQTVKAKFVALFL  291

Query  891   GDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFL  712
             G+++KL ++++   P LGLK +D  EMSWIES+L W ++  GT  + LL R P+ +  FL
Sbjct  292   GNAKKLHALMDESLPQLGLKHEDYIEMSWIESVLYWSNYPIGTSTDVLLERQPSSE-KFL  350

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             K+KSDY+Q P+ K  L+ LWKKM+EL    L  NPYGG+M EI   +TPFPHRAG ++KI
Sbjct  351   KKKSDYIQEPMSKSGLEELWKKMMELRKPVLTFNPYGGKMREISELETPFPHRAGNVYKI  410

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QY+V+WKEEG  A  +++  IR L+ F+ P+VS++PR +YLNYRD+D+GT  +G  SY E
Sbjct  411   QYSVNWKEEGVEAADKNLDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGTNGNGNASYSE  470

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
               V+G KYF GN++RLV+VK+ VDP NFF  EQSIPSL+
Sbjct  471   ASVWGTKYFKGNFDRLVQVKTAVDPGNFFSYEQSIPSLT  509



>ref|XP_010519042.1| PREDICTED: reticuline oxidase-like protein [Tarenaya hassleriana]
Length=524

 Score =   508 bits (1307),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 289/529 (55%), Positives = 375/529 (71%), Gaps = 20/529 (4%)
 Frame = -3

Query  1818  LLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNT  1639
             LL + F  T    ++F+ CL+  S+   P   +SS VY P N S+S+VL+AY RN RFNT
Sbjct  9     LLITLFISTSANSETFMQCLTAHSSASHP---ISSAVYFPGNGSYSAVLEAYIRNLRFNT  65

Query  1638  GSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV--SDATFIILDMF  1465
              S+PKP +I+   HESHV   V C ++  +++++RSGGHDY+G+SYV  S   F +LDMF
Sbjct  66    SSTPKPFLIIAAGHESHVRAAVFCGRRHNLQMKIRSGGHDYDGLSYVTYSRVPFFVLDMF  125

Query  1464  NLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsggg  1285
             NLRS+DVD+       TAWVQ GATLGE+YY IW+KS   GFP GVCPTVGVGGH+SG G
Sbjct  126   NLRSVDVDVEK----RTAWVQTGATLGEVYYNIWDKSKTLGFPAGVCPTVGVGGHISGAG  181

Query  1284  yGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLL  1105
             YGNM+R++GLTVD+VVDAR+VDV GR+LDR +MGEDLFWAI+GGGG SFGV+L++KI L+
Sbjct  182   YGNMMRKYGLTVDNVVDARMVDVNGRILDRKSMGEDLFWAISGGGGSSFGVVLSYKINLV  241

Query  1104  RVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSK  925
              VP+ VT FR  +   L +N   +V ++   A  + D LFIRL   IV     T  +  K
Sbjct  242   EVPQNVTVFRISR--TLEQNATAIVDRWQQVAPHLPDELFIRLTFDIV---NSTVTAGQK  296

Query  924   TVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALL  745
             TVR++++ LFLGDSE L+SI+N  FP LGL + DC E SWI+S+L W +   GT  E LL
Sbjct  297   TVRATFLSLFLGDSETLISIMNRRFPELGLVRSDCIETSWIQSVLFWTNIRVGTPEEVLL  356

Query  744   NRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTP  565
              R      ++LKRKSDY+  PIP+  L+SLW+KM+EL    +  NPYGGRMAEIPS+ TP
Sbjct  357   QRNQT--LTYLKRKSDYVTKPIPRTGLESLWRKMIELEIPMMTFNPYGGRMAEIPSSATP  414

Query  564   FPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIG  385
             FPHRAG L+KIQYA +W +E    DR ++   R L+ F+ PFVS+NPR+A+ NYRD+D+G
Sbjct  415   FPHRAGNLWKIQYAANWNDE-RLTDR-NMELTRRLYDFMTPFVSKNPRRAFYNYRDVDLG  472

Query  384   TTDH--GLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
                H   + SY EG+ YG KYF  N++RLVK+K++VD DNFFRNEQSIP
Sbjct  473   VNLHKGKVESYVEGQRYGIKYFAANFDRLVKIKTKVDRDNFFRNEQSIP  521



>ref|XP_002300580.2| hypothetical protein POPTR_0001s47400g [Populus trichocarpa]
 gb|EEE85385.2| hypothetical protein POPTR_0001s47400g [Populus trichocarpa]
Length=534

 Score =   508 bits (1307),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 275/528 (52%), Positives = 379/528 (72%), Gaps = 16/528 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+ ++FL CLST S    P   +S + Y P N ++ SVL +Y RN  F + ++PKP+ IV
Sbjct  23    PIQETFLQCLSTHSLTSTP---ISEVTYFPNNPNYLSVLNSYIRNLVFTSPTTPKPLFIV  79

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP H SH+   ++C+K  G+E+R+RSGGHDY+G+SYVS   FI++D+FN+RS+ VDI   
Sbjct  80    TPTHVSHIRASIICSKIHGLEVRIRSGGHDYDGLSYVSTVPFIMVDLFNMRSVSVDIED-  138

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                E+AWV++GATLGE+YYRI EKS ++G+P GVCPTVGVGGH+SGGGYGN++R+ GL+V
Sbjct  139   ---ESAWVESGATLGEVYYRIAEKSKIYGYPAGVCPTVGVGGHLSGGGYGNLMRKHGLSV  195

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D++VDA +VD  G VLDR AMGEDLFWAI GGGG SFG+I+++KIKL+RVP+ VT FR E
Sbjct  196   DNIVDAVLVDANGNVLDREAMGEDLFWAIRGGGGASFGIIVSWKIKLVRVPEVVTVFRVE  255

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +   L    +D+V Q+ + A KID+ LFIR++L    P T+       T+++ +  LFLG
Sbjct  256   R--TLEEGASDIVYQWQHVADKIDEDLFIRVVLN---PVTR---KGQVTIKAKFNALFLG  307

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLK  709
             ++++L+S+++  FP LGL   DC EMSWIES+L W ++  GT  + LL R    +  +LK
Sbjct  308   NAQRLVSLMDEQFPGLGLLSTDCKEMSWIESVLFWSNYQIGTSTDVLLERHSTKE-KYLK  366

Query  708   RKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQ  529
             RKSDY+Q PI K  L+ +WKKM++L    L  NPYGG+M+EI    TPFPHRAG ++KIQ
Sbjct  367   RKSDYVQEPISKTDLEGIWKKMIQLRKPVLTFNPYGGKMSEISELDTPFPHRAGNIYKIQ  426

Query  528   YAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEG  349
             YA SWKEEG  A   ++  IR+L+ ++ PFVS++PR +YLNYRD+D+G  + G  SYE+ 
Sbjct  427   YAASWKEEGAEAVDHNLDLIRKLYDYMTPFVSKSPRCSYLNYRDIDLGINEIGNASYEQA  486

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCE  205
               +G KYF GN++RLV+VK+ VDP NFFR EQSIPSL  + + +   E
Sbjct  487   SGWGTKYFKGNFDRLVQVKTTVDPGNFFRYEQSIPSLEASSSKNRMSE  534



>ref|NP_172642.3| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 gb|AAD30246.1|AC007296_7 Strong similarity to gb|AF049347 berberine bridge enzyme from 
Berberis stolonifera [Arabidopsis thaliana]
 gb|AEE28783.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=536

 Score =   508 bits (1307),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 282/540 (52%), Positives = 379/540 (70%), Gaps = 21/540 (4%)
 Frame = -3

Query  1842  LVFLALCNLLTSCFSGTIP---MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVL  1672
             L+   + + +++  +   P   +Y +FL C +  +  P P  L + +V     A+F+ VL
Sbjct  6     LILFLISSFISTSLAVEPPPETIYQNFLQCFTNQTKAP-PNSL-ADVVLPKTAAAFTPVL  63

Query  1671  QAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSD  1492
             +AY RN RFNT ++PKP I++    ESHV   V+C K L ++++ RSGGHDYEG+SY+S 
Sbjct  64    RAYIRNARFNTTATPKPAIVIAARSESHVQAAVICTKSLNIQLKTRSGGHDYEGVSYISH  123

Query  1491  ATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvg  1312
               F +LDM NLR+I VD A     E+AWV AGATLGE+YYRIWEK+  HGFP GVCPTVG
Sbjct  124   VPFFVLDMSNLRNITVDPAT----ESAWVGAGATLGEVYYRIWEKTKSHGFPAGVCPTVG  179

Query  1311  vgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGV  1132
              GGH+SGGGYGNMIR++GL+VD+V DA+IVDV G+VLDR  MGED+FWAINGGGG SFGV
Sbjct  180   AGGHISGGGYGNMIRKYGLSVDYVTDAKIVDVNGQVLDRKGMGEDMFWAINGGGGASFGV  239

Query  1131  ILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPP  952
             ILAFKIKL+ VP TVT FR EK   L  N  ++V ++   A K D  LF+RLLLQ V   
Sbjct  240   ILAFKIKLVPVPPTVTVFRVEK--NLVENATEMVHKWQFVAPKTDPGLFMRLLLQPV---  294

Query  951   TKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFG  772
                  +  +TVR+S V LFLGD   ++S+L  +FP LGLKK++C+EM+WI+S++ W +  
Sbjct  295   ---TRNKMQTVRASVVALFLGDQNTVMSMLTKEFPELGLKKENCTEMTWIQSVMWWANND  351

Query  771   NGT--KPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGG  598
             N T  KPE LL+R P   A+F KRKSD+++  I K  LD L+KKM+E+G  GL  NPYGG
Sbjct  352   NATQIKPEILLDRNP-DMATFGKRKSDFVEKEITKDGLDFLFKKMIEVGKIGLVFNPYGG  410

Query  597   RMAEIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQ  418
              M+ + +T+TPFPHR   L+KIQ++++WK+ G  A+   + + +  +S++APFV++NPR 
Sbjct  411   IMSTVATTKTPFPHRKK-LYKIQHSMNWKDPGTEAETSFLQKAKSFYSYMAPFVTKNPRH  469

Query  417   AYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              Y+NYRDLDIG    G +SY   +V+G  YF  N++RLVKVK+ VDP NFFR+EQSIP+L
Sbjct  470   TYINYRDLDIGVNTPGPNSYRVAEVFGRMYFGENFDRLVKVKTAVDPQNFFRDEQSIPTL  529



>ref|XP_008225665.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=553

 Score =   508 bits (1308),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 277/529 (52%), Positives = 382/529 (72%), Gaps = 16/529 (3%)
 Frame = -3

Query  1818  LLTSCFSGTIPMYDSF-LHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFN  1642
             LL    + + P  D+F L CLS  S    P   +S++ Y P N+S++S+LQ+Y RN RF 
Sbjct  32    LLHVSMAASNPTQDTFFLQCLSNHSQYSSPP--ISAVTYFPNNSSYTSILQSYIRNLRFI  89

Query  1641  TGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFN  1462
             T ++PKP+ IVTP H SH+   + C+K   +++R+RSGGHDY+G+SYVS   FII+DMF+
Sbjct  90    TPTTPKPLFIVTPTHVSHIQASIFCSKIHALQVRIRSGGHDYDGLSYVSQVPFIIVDMFS  149

Query  1461  LRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggy  1282
             LRSI V++      E+AWV++GATLGE+YYR+ E+S +HGFP GVCPTVGVGGH+SGGGY
Sbjct  150   LRSISVNVED----ESAWVESGATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGY  205

Query  1281  GNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLR  1102
             GNM+R++GL+VD+++DA+IVDV GR+LDR +MGEDLFWAI GGGG SFGVI+++KIKL+ 
Sbjct  206   GNMMRKYGLSVDNILDAQIVDVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVP  265

Query  1101  VPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKT  922
             VP+ VT FR E+   L +   D+V Q+   A  I + LFIR ++       ++N    +T
Sbjct  266   VPEIVTVFRVER--TLEQGATDIVHQWQYVADTIHEDLFIRAVVM------QSNKKGHQT  317

Query  921   VRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLN  742
             V++ +V LFLG++EKL ++++   P LGLK +D  E SWIES+L W ++  GT  + LL 
Sbjct  318   VKAKFVALFLGNAEKLHALMDESLPQLGLKHEDYIETSWIESVLYWSNYPIGTSADVLLE  377

Query  741   RTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPF  562
             R P+ +  FLK+KSDY+Q P+ K  L+ LWKKM+EL    L  NPYGG+M EI   +TPF
Sbjct  378   RQPSSE-KFLKKKSDYIQEPMSKSGLEELWKKMMELRKPVLTFNPYGGKMREISELETPF  436

Query  561   PHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGT  382
             PHRAG ++KIQY+V+WKEEG     +++  IR L+ F+ P+VS++PR +YLNYRD+D+GT
Sbjct  437   PHRAGNVYKIQYSVNWKEEGVEVADKNLDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGT  496

Query  381   TDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLS  235
               +G  SY E  V+G KYF GN++RLV+VK+ VDP NFF  EQSIPSL+
Sbjct  497   NGNGNASYSEASVWGTKYFKGNFDRLVQVKTAVDPGNFFSYEQSIPSLA  545



>ref|XP_011040559.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=530

 Score =   507 bits (1306),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 288/537 (54%), Positives = 373/537 (69%), Gaps = 21/537 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             VF V L L  L TS  S      D FL CL + S +  P   VS  +Y   N+SF   L+
Sbjct  11    VFSVLLVLVPLATSDTS-----LDRFLKCLPSHSDSSYP---VSRAIYRITNSSFEPTLR  62

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AYA+  RF T ++PKP+ I+   HESHV   V+CAK  G++IR+RSGGHDYEG+SYVS+ 
Sbjct  63    AYAKASRFLTSTTPKPLAIIAATHESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSNV  122

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F+ILD FNLRSID+D+A    G+TAW+Q+GAT GELYY I  KS+V  FP GVC T+G 
Sbjct  123   PFVILDTFNLRSIDIDVA----GKTAWIQSGATTGELYYNIANKSNVLAFPAGVCLTLGA  178

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH SGGGYG ++R+ GL++D++ DA+IVDV G++LDR +MGEDLFWAI GGGG SFGVI
Sbjct  179   GGHFSGGGYGPLMRKHGLSIDNIFDAKIVDVNGKILDRKSMGEDLFWAIRGGGGASFGVI  238

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++KI L+ VP  VT F   K   L +   DVV ++   ASK+D  LFIR++ ++V   +
Sbjct  239   LSWKISLVDVPPKVTTFTVSK--TLEQGATDVVYRWQEVASKLDKELFIRVMPRVVDGSS  296

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
              +N    KTVR S++GLFLG S KLL ++ + FP LGL+++DC+EMSW+ES L W    N
Sbjct  297   GSN----KTVRVSFIGLFLGPSCKLLPLMKNSFPELGLQQKDCNEMSWVESTLYWFGLPN  352

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             GT  E LL+R     ASF KRKSDY+Q  IPK  L+ +WK M+++    +  NPYGGRM 
Sbjct  353   GTSIETLLDR--PTRASFFKRKSDYVQKAIPKKGLEKIWKTMIKVERVWMQWNPYGGRMD  410

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWK-EEGEAADREHISQIRELHSFLAPFVSRNPRQAY  412
             EIP+T T FPHRAG LFKIQY+V W  +EG  A   +I  I +L+  + P+VS NPR+A+
Sbjct  411   EIPATATAFPHRAGNLFKIQYSVDWSDQEGIEAANHYIDLITQLYDTMTPYVSSNPREAF  470

Query  411   LNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPS  241
             LNYRD+DIG+      S+E+ KVYG+K F  N+ RLVKVKSRVDPD+FF+ EQSIP+
Sbjct  471   LNYRDVDIGSNPSNQTSFEKAKVYGNKLFKNNFIRLVKVKSRVDPDDFFKYEQSIPA  527



>ref|XP_011039847.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=534

 Score =   507 bits (1305),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 275/528 (52%), Positives = 378/528 (72%), Gaps = 16/528 (3%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+ ++FL CLST S    P   +S + Y P N ++ SVL +Y RN  F + ++PKP+ IV
Sbjct  23    PIQETFLQCLSTHSLTSTP---ISEVTYFPNNPNYLSVLNSYIRNLVFTSPTTPKPLFIV  79

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
              P H SH+   ++C+K  G+E+R+RSGGHDY+G+SYVS A FI++D+FN+RS+ VDI   
Sbjct  80    APTHVSHIRASIICSKIHGLEVRIRSGGHDYDGLSYVSTAPFIMVDLFNMRSVSVDIED-  138

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                E+AWV++GATLGE+YYRI EKS ++G+P GVCPTVGVGGH+SGGGYGN++R+ GL+V
Sbjct  139   ---ESAWVESGATLGEVYYRIAEKSKIYGYPAGVCPTVGVGGHLSGGGYGNLMRKHGLSV  195

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D++VDA +VD  G VLDR AMGEDLFWAI GGGG SFG+I+++KIKL+RVP+ VT FR E
Sbjct  196   DNIVDAVLVDANGNVLDREAMGEDLFWAIRGGGGASFGIIVSWKIKLVRVPEVVTVFRVE  255

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +   L    +D+V Q+ + A KID+ LFIR++L    P T+       T+++ +  LFLG
Sbjct  256   R--TLEEGASDIVYQWQHVADKIDEDLFIRVVLN---PVTRKGQV---TIKAKFNALFLG  307

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAGDASFLK  709
             ++++L+S+++  FP LGL   DC EMSWIES+L W ++  GT  + LL R    +  +LK
Sbjct  308   NAQRLVSLMDEQFPGLGLLSTDCKEMSWIESVLFWSNYQIGTSTDVLLERHSTKE-KYLK  366

Query  708   RKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKIQ  529
             RKSDY+Q PI K  L  +WKKM++L    L  NPYGG+M+EI    TPFPHRAG ++KIQ
Sbjct  367   RKSDYVQEPISKTDLQGIWKKMIQLQKPVLTFNPYGGKMSEISELDTPFPHRAGNIYKIQ  426

Query  528   YAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEEG  349
             YA SWKEEG  A   ++  IR+L+ ++ PFVS++PR +YLNYRD+D+G  + G  SYE+ 
Sbjct  427   YAASWKEEGAEAVGHNLDLIRKLYDYMTPFVSKSPRCSYLNYRDIDLGINEIGNASYEQA  486

Query  348   KVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSLSRNQTGSESCE  205
               +G KYF GN++RLV+VK+ VDP NFFR EQSIPSL  + + +   E
Sbjct  487   SGWGTKYFKGNFDRLVRVKTTVDPGNFFRYEQSIPSLEASSSKNRMSE  534



>emb|CDY31432.1| BnaC03g63920D [Brassica napus]
Length=531

 Score =   506 bits (1304),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 284/519 (55%), Positives = 382/519 (74%), Gaps = 21/519 (4%)
 Frame = -3

Query  1788  PMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIV  1609
             P+Y+SFL C S  +  P  ++     V+S  N S+SSVL+AY RN RFNT S+PKP +I+
Sbjct  28    PVYNSFLKCFSDKTKTPQAQN-----VFSQTNPSYSSVLRAYIRNARFNTSSTPKPTLII  82

Query  1608  TPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGG  1429
             TP   SHV   VLC+K L    ++RSGGHDY+G+SYVSD  F +LD+ NLR + V+IA  
Sbjct  83    TPRSYSHVSAAVLCSKPLNFVFKIRSGGHDYDGLSYVSDKPFFVLDLSNLRDVTVNIAD-  141

Query  1428  DGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTV  1249
                +TAW+ AGATLGE+YYRIWEKS VHGFP GVCPTVGVGGH+SGGGYGNM+R+FGL+V
Sbjct  142   ---QTAWISAGATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSV  198

Query  1248  DHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAE  1069
             D+++DA+IVDV GR+LDR +MGEDLFWAI+GGGGGSFGV+L +K+KL+ VP+ VT FR E
Sbjct  199   DNLIDAKIVDVNGRILDRKSMGEDLFWAISGGGGGSFGVVLGYKVKLVPVPRVVTVFRVE  258

Query  1068  KYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLG  889
             +++       D+V ++ +   + + +LF+R+LLQ   P T+   +  +TVR++ V LFLG
Sbjct  259   QFM--ESGAVDMVHKWQSVGPRTNRNLFLRMLLQ---PVTR---NKVQTVRATAVALFLG  310

Query  888   DSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTK--PEALLNRTPAGDASF  715
              ++ ++S+L  + P L LKK++C+EM+W +S L W +  N T+  P+  L+R     + F
Sbjct  311   RADDVVSLLRKELPELALKKENCTEMTWFQSALWWDNRLNATQIDPKVFLDRN-LDSSRF  369

Query  714   LKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFK  535
             LKRKSDY+   IP+  ++SL+KKM+ELG  GL  NPYGG+MAEI    TP PHR  +LFK
Sbjct  370   LKRKSDYVATEIPRDGIESLFKKMIELGKVGLVFNPYGGKMAEIAEDATPLPHRK-MLFK  428

Query  534   IQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYE  355
             IQY+V+W+E     ++  ++Q R LHSF+  FVS+NPR+AYLNYRD+DIG  DHG +SYE
Sbjct  429   IQYSVNWQESSPEIEKGFLNQSRVLHSFMTQFVSKNPRRAYLNYRDVDIGVNDHGTNSYE  488

Query  354   EGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
             EG+VYG  YF  N++RLVK+K+ VDP NFFRNEQSIP+L
Sbjct  489   EGEVYGRMYFGKNFDRLVKIKTAVDPGNFFRNEQSIPTL  527



>ref|XP_010460877.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=530

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 279/525 (53%), Positives = 377/525 (72%), Gaps = 21/525 (4%)
 Frame = -3

Query  1800  SGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKP  1621
             S ++   ++F+ CL++ S    PK  +S  V+   N S+SSVL+A  RN RFNT ++PKP
Sbjct  22    SSSLANSETFIQCLTSKSD---PKHPISPAVFFAGNRSYSSVLEATIRNLRFNTSNTPKP  78

Query  1620  VIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYV--SDATFIILDMFNLRSID  1447
              +I+   HE+HV   V C K+  +++++RSGGHDY+G+SYV  S   F +LDMFNLRS+D
Sbjct  79    FLIIAATHETHVQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVD  138

Query  1446  VDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIR  1267
             VD A     +TAWVQAGA LGE+YY IWEKS    +P G+CPTVGVGGH+SGGGYGNM+R
Sbjct  139   VDTAS----KTAWVQAGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMR  194

Query  1266  RFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTV  1087
             ++GLTVD+ +DAR+VDV G++L+R  MGEDL+WAINGGGGGS+GV+LA+KIKL+ VP+ V
Sbjct  195   KYGLTVDNTIDARMVDVNGKILNRKLMGEDLYWAINGGGGGSYGVVLAYKIKLVEVPENV  254

Query  1086  TYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSY  907
             T FR  +   L +N  D+V ++   A ++ D LFIR ++ +V        S+ KTVR+++
Sbjct  255   TVFRISR--TLEQNATDIVDRWQQVAPELPDELFIRTVIDVV----NGTVSSQKTVRATF  308

Query  906   VGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGNGTKPEALLNRTPAG  727
             + +FLGD+  LLSILN  FP LGL + DC+E SWI+S+L W +   G+  + LL R    
Sbjct  309   IAMFLGDTTTLLSILNRRFPELGLVRSDCTETSWIQSVLFWTNIQVGSSEKLLLERKQP-  367

Query  726   DASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAG  547
               ++LKRKSDY++ PI +  L+S+WKKM+EL    +A NPYGG MA I ST TPFP+RAG
Sbjct  368   -VNYLKRKSDYVREPISRTGLESIWKKMIELEIPTMAFNPYGGAMARISSTVTPFPYRAG  426

Query  546   VLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHG-  370
              L+KIQYA +W+E+    DR ++   REL+ F+ PFVS+NPRQ++ NYRD+D+G   H  
Sbjct  427   NLWKIQYAANWRED-RLTDR-YMELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNG  484

Query  369   -LHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIPSL  238
              ++SY EGK YG KYF GN+ERLVK+K+RVD  NFFRNEQSIP L
Sbjct  485   KINSYVEGKRYGMKYFAGNFERLVKIKTRVDSGNFFRNEQSIPVL  529



>gb|KDP34868.1| hypothetical protein JCGZ_09156 [Jatropha curcas]
Length=531

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 280/535 (52%), Positives = 371/535 (69%), Gaps = 23/535 (4%)
 Frame = -3

Query  1848  VFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQ  1669
             VF+ FL +   L S  +      D+FL+C      NP   +L+   +Y+P N+SF ++L+
Sbjct  3     VFISFLIVSFPLFSVLATV----DNFLNCFPNHVENP---NLIVEAIYTPRNSSFDNILR  55

Query  1668  AYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDA  1489
             AY RNRRF T  +PKP  IVT  HESHV   V+CAK   ++IR+RSGGHDYEG+SY+S+ 
Sbjct  56    AYIRNRRFLTSETPKPFAIVTAKHESHVQATVICAKSNDLQIRIRSGGHDYEGLSYISNV  115

Query  1488  TFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgv  1309
              F+ILDMFNLR+ID+DI      ETAWVQ GATLGELYY I  +S  H FPGGVCPTVGV
Sbjct  116   PFVILDMFNLRNIDIDIVT----ETAWVQTGATLGELYYNIANRSKFHAFPGGVCPTVGV  171

Query  1308  gghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVI  1129
             GGH +GGGYGNM+R++GLTVD+++DA +VDV G +L+R +MGEDLFWAI GGGG SFGVI
Sbjct  172   GGHFTGGGYGNMMRKYGLTVDNIIDATLVDVNGNILNRKSMGEDLFWAIRGGGGASFGVI  231

Query  1128  LAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPT  949
             L++KIKL++VP  VT FR E+   L     D+V ++   AS ID  +FIR          
Sbjct  232   LSWKIKLVQVPNIVTVFRVER--TLEEGATDIVYRWQEIASNIDKEVFIR---------A  280

Query  948   KTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGSFGN  769
             K +   +KT+++S+ GLFLG ++ L+S++N  F  LGL+++DC  +SWIES L W  F  
Sbjct  281   KLHSDQNKTIKASFFGLFLGQTKPLISLMNETFQILGLEEKDCKGVSWIESTLFWAEFPV  340

Query  768   GTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMA  589
             GT  +ALLNRT      F K +SDY+++ IPK  L+ +WK + ++ N  +  NPYGGRM+
Sbjct  341   GTSIDALLNRTSQPQVYF-KSRSDYVKSIIPKQDLEKIWKILAQVENMYVQWNPYGGRMS  399

Query  588   EIPSTQTPFPHRAGVLFKIQYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYL  409
             EI  T+TPFPHR G LFKIQY  +W EE   A + +I+  R+++  +AP+VS+NPR+A+L
Sbjct  400   EISDTETPFPHRNGYLFKIQYYTAWTEERNEASKNYINLSRKVYDAMAPYVSKNPREAFL  459

Query  408   NYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             NYRDLDIG+       +EE +VYG KYF  N+ RLV VK +VDP NFF+NEQSIP
Sbjct  460   NYRDLDIGSNPSNQTYFEEAEVYGRKYFKDNFWRLVNVKKKVDPGNFFKNEQSIP  514



>ref|XP_002299010.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa]
 gb|EEE83815.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa]
Length=530

 Score =   505 bits (1301),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 281/546 (51%), Positives = 378/546 (69%), Gaps = 23/546 (4%)
 Frame = -3

Query  1875  HDTMMSSSPVFLVFLALCNLLTSCFSGTIPMYDSFLHCLSTVSANPIPKDLVSSIVYSPA  1696
             H+  MS +    + L L   L +C +      D+FL CL + S    P   VS  VY  +
Sbjct  2     HEASMSLTLSMFLVLFLFVSLATCDTS----LDNFLQCLPSHSHPSYP---VSRAVYRRS  54

Query  1695  NASFSSVLQAYARNRRFNTGSSPKPVIIVTPLHESHVPPVVLCAKKLGVEIRVRSGGHDY  1516
             N+SF    +AYA+  RF T ++PKP+ I+  +HESHV   V+CAK  G++IR+RSGGHDY
Sbjct  55    NSSFEPTFRAYAKASRFLTSATPKPLAIIAAMHESHVQATVICAKSNGLQIRIRSGGHDY  114

Query  1515  EGISYVSDATFIILDMFNLRSIDVDIAGGDGGETAWVQAGATLGELYYRIWEKSSVHgfp  1336
             EG+SYVS+  F+ILDMFNLRSID+DI      +TAW+Q+GAT+GELYY I +KS+V  FP
Sbjct  115   EGLSYVSNVPFVILDMFNLRSIDIDIV----RKTAWIQSGATIGELYYNIAKKSNVFAFP  170

Query  1335  ggvcptvgvgghvsgggyGNMIRRFGLTVDHVVDARIVDVKGRVLDRTAMGEDLFWAINg  1156
              GVC T+G GGH+SGGGYGNM+R++GL++D++VDA++VDV G++LDR +MGEDLFWAI G
Sbjct  171   AGVCFTLGAGGHISGGGYGNMMRKYGLSIDNIVDAKLVDVNGKILDRKSMGEDLFWAIRG  230

Query  1155  gggGSFGVILAFKIKLLRVPKTVTYFRAEKYLGLTRNFNDVVSQYFNTASKIDDHLFIRL  976
              GG SFGVIL++KI L++VP  VT F   K   L     D+V ++   ASK+D  LFIR 
Sbjct  231   SGGASFGVILSWKINLVQVPPKVTTFNVAK--TLKEGATDLVYRWQEVASKLDQELFIRA  288

Query  975   LLQIVPPPTKTNDSNSKTVRSSYVGLFLGDSEKLLSILNSDFPALGLKKQDCSEMSWIES  796
               Q+V          SKT+  S++G FLG S KLL ++   FP LGL+++DC+EMSW+ES
Sbjct  289   SPQVV----NGGSGGSKTISVSFIGQFLGPSSKLLPLMKRRFPELGLQQKDCNEMSWVES  344

Query  795   MLRWGSFG-NGTKPEALLNRTPAGDASFLKRKSDYLQNPIPKHILDSLWKKMLELGNTGL  619
              L W  FG +G   + LL+R    + SF KRKSDY++N IPK  L+++WK M+++    +
Sbjct  345   TLYW--FGRSGRSLDVLLDR--PTETSFFKRKSDYVKNVIPKEGLENIWKMMIKVEPVWM  400

Query  618   AVNPYGGRMAEIPSTQTPFPHRAGVLFKIQYAVSWK-EEGEAADREHISQIRELHSFLAP  442
               NPYGGRM EIP+T TPFPHRAG LFKIQY+  W  +EG  A   HI+ +R+++  + P
Sbjct  401   QWNPYGGRMDEIPATATPFPHRAGNLFKIQYSTDWSDQEGSEATNRHINLLRQMYEAMTP  460

Query  441   FVSRNPRQAYLNYRDLDIGTTDHGLHSYEEGKVYGHKYFMGNYERLVKVKSRVDPDNFFR  262
             +VS++PR+A+LNYRD+DIG+      ++E  KVYG K F  N+ RLVKVKS+VDPDNFF+
Sbjct  461   YVSKDPREAFLNYRDIDIGSNPSNQTNFENAKVYGSKLFKDNFMRLVKVKSKVDPDNFFK  520

Query  261   NEQSIP  244
             NEQSIP
Sbjct  521   NEQSIP  526



>emb|CDP12592.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   505 bits (1300),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 276/516 (53%), Positives = 367/516 (71%), Gaps = 24/516 (5%)
 Frame = -3

Query  1785  MYDSFLHCLSTVSANPIPKDLVSSIVYSPANASFSSVLQAYARNRRFNTGSSPKPVIIVT  1606
             ++ +F+ CL   S+  I     S+++Y+P N+SF  VLQAY RN RFN  ++ KP +I+T
Sbjct  28    VHQTFVQCLQKHSSPNI-----SAVIYTPNNSSFPKVLQAYIRNLRFNESTTRKPFLILT  82

Query  1605  PLHESHVPPVVLCAKKLGVEIRVRSGGHDYEGISYVSDATFIILDMFNLRSIDVDIAGGD  1426
              L  SH+   ++CAK  G++++ RSGGHDYEG+SY+S+  F ILD+FN+RSI V+I    
Sbjct  83    ALDVSHIQAAIICAKAQGLQMKTRSGGHDYEGVSYISEVPFFILDLFNIRSISVNIEE--  140

Query  1425  GGETAWVQAGATLGELYYRIWEKSSVHgfpggvcptvgvgghvsgggyGNMIRRFGLTVD  1246
               ETAWVQ GATLGE+YYRI++KS VHGFP GVCPTVGVGGH SGGGYGNM+R++GLTVD
Sbjct  141   --ETAWVQVGATLGEVYYRIYQKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLTVD  198

Query  1245  HVVDARIVDVKGRVLDRTAMGEDLFWAINggggGSFGVILAFKIKLLRVPKTVTYFRAEK  1066
             +++DA+I+DV GR+LDR AMGEDLFWAI GGG  SFGV LA+KI L+RVP  VT F   +
Sbjct  199   NIIDAQIIDVNGRILDRAAMGEDLFWAITGGGASSFGVALAYKINLVRVPPKVTVFNVTR  258

Query  1065  YLGLTRNFNDVVSQYFNTASKIDDHLFIRLLLQIVPPPTKTNDSNSKTVRSSYVGLFLGD  886
                  +N   +V ++   A K+D+ +FIR+++++V          +KT+RS +  LFLGD
Sbjct  259   --TYEQNATYLVHRWQEVADKLDNDIFIRMIIRVV----------NKTIRSEFFTLFLGD  306

Query  885   SEKLLSILNSDFPALGLKKQDCSEMSWIESMLRWGS--FGNGTKPEALLNRTPAGDASFL  712
             S +LLS++N  FP LGL++ DC EMSW ES++ + +  F  GT    LL+R P  +   L
Sbjct  307   SARLLSLMNESFPELGLRQPDCIEMSWAESVIYYYTPPFPRGTPVHNLLSRHPP-ELKHL  365

Query  711   KRKSDYLQNPIPKHILDSLWKKMLELGNTGLAVNPYGGRMAEIPSTQTPFPHRAGVLFKI  532
             KRKSDYL+ P+P   ++ ++KKM+EL    L  NPYGGRMAEIP++  PFPHRAG + KI
Sbjct  366   KRKSDYLKKPMPIEGIEFIFKKMIELQTPVLTFNPYGGRMAEIPASAKPFPHRAGNIAKI  425

Query  531   QYAVSWKEEGEAADREHISQIRELHSFLAPFVSRNPRQAYLNYRDLDIGTTDHGLHSYEE  352
             QYA  W + G       I+  R LH ++ PFVS+ PR+A+LNYRDLDIG T +G +SY E
Sbjct  426   QYATDWDQNGVQTAEHFINLTRALHKYMTPFVSKFPREAFLNYRDLDIGITHNGKNSYAE  485

Query  351   GKVYGHKYFMGNYERLVKVKSRVDPDNFFRNEQSIP  244
             G VYG KYF  N+ RLVKVK+ VDPDNFFR+EQ+IP
Sbjct  486   GLVYGIKYFKENFNRLVKVKTAVDPDNFFRDEQTIP  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208