BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20645_g3_i1 len=601 path=[579:0-209 789:210-264 844:265-600]

Length=601
                                                                      Score     E

emb|CDP10295.1|  unnamed protein product                                341   8e-115   
emb|CDP10297.1|  unnamed protein product                                342   2e-114   
ref|XP_009794431.1|  PREDICTED: probable aldo-keto reductase 3 is...    337   3e-113   
ref|XP_009794430.1|  PREDICTED: probable aldo-keto reductase 3 is...    336   8e-113   
emb|CDP19924.1|  unnamed protein product                                338   9e-113   
emb|CDP10303.1|  unnamed protein product                                337   2e-112   
emb|CDP19923.1|  unnamed protein product                                335   3e-112   
ref|XP_009794429.1|  PREDICTED: auxin-induced protein PCNT115-lik...    336   4e-112   
ref|XP_009631780.1|  PREDICTED: auxin-induced protein PCNT115-like      336   4e-112   
emb|CDP10302.1|  unnamed protein product                                335   5e-112   
ref|XP_009631779.1|  PREDICTED: auxin-induced protein PCNT115-like      334   2e-111   
ref|XP_004248016.1|  PREDICTED: auxin-induced protein PCNT115           335   2e-111   
emb|CDP10291.1|  unnamed protein product                                333   2e-111   
emb|CDP10289.1|  unnamed protein product                                334   2e-111   
ref|XP_009784380.1|  PREDICTED: auxin-induced protein PCNT115           334   2e-111   
emb|CDP20358.1|  unnamed protein product                                339   3e-111   
emb|CDP10290.1|  unnamed protein product                                332   5e-111   
ref|XP_006358809.1|  PREDICTED: probable aldo-keto reductase 4-li...    333   6e-111   
sp|P40691.1|A115_TOBAC  RecName: Full=Auxin-induced protein PCNT115     331   9e-111   Nicotiana tabacum [American tobacco]
ref|XP_006358808.1|  PREDICTED: probable aldo-keto reductase 4-li...    332   1e-110   
ref|XP_010326945.1|  PREDICTED: auxin-induced protein PCNT115-like      332   2e-110   
gb|AAX84672.1|  aldo/keto reductase AKR                                 332   2e-110   Manihot esculenta [manioc]
ref|XP_007034103.1|  NAD(P)-linked oxidoreductase superfamily pro...    332   2e-110   
emb|CDP10299.1|  unnamed protein product                                331   2e-110   
ref|XP_003531918.1|  PREDICTED: probable aldo-keto reductase 2-li...    331   3e-110   
ref|XP_009631784.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    329   5e-110   
ref|XP_010326944.1|  PREDICTED: auxin-induced protein PCNT115-like      330   5e-110   
ref|XP_004975287.1|  PREDICTED: probable aldo-keto reductase 2-like     330   6e-110   
ref|XP_006423749.1|  hypothetical protein CICLE_v10028769mg             330   6e-110   
ref|XP_010326948.1|  PREDICTED: auxin-induced protein PCNT115-lik...    330   6e-110   
ref|XP_010326947.1|  PREDICTED: auxin-induced protein PCNT115-lik...    330   7e-110   
ref|XP_003621701.1|  Aldo/keto reductase                                330   7e-110   
ref|XP_011000038.1|  PREDICTED: probable aldo-keto reductase 2          330   1e-109   
gb|ABK95612.1|  unknown                                                 329   1e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006487489.1|  PREDICTED: probable aldo-keto reductase 2-like     329   2e-109   
ref|XP_009794432.1|  PREDICTED: auxin-induced protein PCNT115-like      329   2e-109   
emb|CAN80302.1|  hypothetical protein VITISV_011599                     328   2e-109   Vitis vinifera
emb|CDP10300.1|  unnamed protein product                                328   3e-109   
ref|XP_002321097.2|  aldo/keto reductase family protein                 328   3e-109   Populus trichocarpa [western balsam poplar]
gb|ACJ85229.1|  unknown                                                 328   4e-109   Medicago truncatula
ref|XP_002436402.1|  hypothetical protein SORBIDRAFT_10g001890          328   5e-109   Sorghum bicolor [broomcorn]
emb|CDP10298.1|  unnamed protein product                                328   5e-109   
ref|XP_007034108.1|  NAD(P)-linked oxidoreductase superfamily pro...    328   5e-109   
ref|NP_001141057.1|  putative oxidoreductase, aldo/keto reductase...    328   6e-109   Zea mays [maize]
ref|XP_007034105.1|  NAD(P)-linked oxidoreductase superfamily pro...    328   6e-109   
ref|XP_006423737.1|  hypothetical protein CICLE_v10028766mg             328   6e-109   
ref|XP_010244073.1|  PREDICTED: probable aldo-keto reductase 2          327   6e-109   
ref|XP_006358806.1|  PREDICTED: auxin-induced protein PCNT115-lik...    328   6e-109   
ref|XP_002265927.1|  PREDICTED: probable aldo-keto reductase 2          327   8e-109   Vitis vinifera
emb|CAN68994.1|  hypothetical protein VITISV_040294                     327   8e-109   Vitis vinifera
emb|CAN67592.1|  hypothetical protein VITISV_015428                     327   1e-108   Vitis vinifera
emb|CBI39431.3|  unnamed protein product                                326   1e-108   
emb|CBI39433.3|  unnamed protein product                                325   3e-108   
ref|XP_002436403.1|  hypothetical protein SORBIDRAFT_10g001900          325   4e-108   Sorghum bicolor [broomcorn]
gb|KHG15522.1|  hypothetical protein F383_16754                         325   5e-108   
ref|XP_007034107.1|  NAD(P)-linked oxidoreductase superfamily pro...    325   5e-108   
gb|KDP37896.1|  hypothetical protein JCGZ_05778                         325   6e-108   
ref|XP_004492046.1|  PREDICTED: probable aldo-keto reductase 2-like     325   7e-108   
ref|XP_006423334.1|  hypothetical protein CICLE_v10028780mg             325   9e-108   
ref|XP_007139301.1|  hypothetical protein PHAVU_008G017800g             325   1e-107   
ref|XP_006423748.1|  hypothetical protein CICLE_v10028770mg             324   1e-107   
gb|KDP37897.1|  hypothetical protein JCGZ_05779                         324   1e-107   
ref|XP_008454010.1|  PREDICTED: probable aldo-keto reductase 4          324   1e-107   
gb|KDO50054.1|  hypothetical protein CISIN_1g019368mg                   321   1e-107   
gb|EYU24276.1|  hypothetical protein MIMGU_mgv1a009306mg                324   2e-107   
ref|XP_011015381.1|  PREDICTED: probable aldo-keto reductase 2          324   2e-107   
gb|ACF85021.1|  unknown                                                 323   2e-107   Zea mays [maize]
gb|KHG21132.1|  hypothetical protein F383_07588                         323   2e-107   
ref|NP_001149335.1|  LOC100282958                                       323   3e-107   Zea mays [maize]
emb|CDP10287.1|  unnamed protein product                                322   3e-107   
ref|XP_006487529.1|  PREDICTED: probable aldo-keto reductase 2-like     331   4e-107   
ref|XP_011042752.1|  PREDICTED: probable aldo-keto reductase 2          323   4e-107   
gb|ABK22508.1|  unknown                                                 323   4e-107   Picea sitchensis
ref|XP_006487492.1|  PREDICTED: probable aldo-keto reductase 3-li...    320   4e-107   
ref|XP_004156942.1|  PREDICTED: probable aldo-keto reductase 4-like     323   4e-107   
ref|XP_004975286.1|  PREDICTED: probable aldo-keto reductase 2-like     323   6e-107   
ref|XP_007034102.1|  NAD(P)-linked oxidoreductase superfamily pro...    325   6e-107   
ref|XP_004975289.1|  PREDICTED: probable aldo-keto reductase 2-like     322   8e-107   
ref|XP_010929910.1|  PREDICTED: probable aldo-keto reductase 2          322   8e-107   
ref|XP_004152112.1|  PREDICTED: probable aldo-keto reductase 2-like     322   8e-107   
gb|KCW57707.1|  hypothetical protein EUGRSUZ_H00466                     322   9e-107   
gb|KDO50053.1|  hypothetical protein CISIN_1g019368mg                   322   1e-106   
gb|KCW57735.1|  hypothetical protein EUGRSUZ_H00487                     322   1e-106   
ref|XP_010069403.1|  PREDICTED: probable aldo-keto reductase 2          322   2e-106   
ref|XP_006358803.1|  PREDICTED: probable aldo-keto reductase 4-like     322   2e-106   
ref|XP_008222724.1|  PREDICTED: probable aldo-keto reductase 2          322   2e-106   
ref|XP_002460689.1|  hypothetical protein SORBIDRAFT_02g033230          322   2e-106   Sorghum bicolor [broomcorn]
ref|XP_010069398.1|  PREDICTED: probable aldo-keto reductase 2 is...    321   2e-106   
ref|NP_001052494.1|  Os04g0338000                                       321   3e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007222406.1|  hypothetical protein PRUPE_ppa008145mg             321   3e-106   
ref|XP_006487220.1|  PREDICTED: probable aldo-keto reductase 2-li...    321   3e-106   
ref|XP_010069386.1|  PREDICTED: probable aldo-keto reductase 2          321   3e-106   
ref|XP_006487490.1|  PREDICTED: probable aldo-keto reductase 3-li...    321   3e-106   
ref|XP_008454009.1|  PREDICTED: probable aldo-keto reductase 2          321   3e-106   
sp|A2XRZ0.1|AKR2_ORYSI  RecName: Full=Probable aldo-keto reductase 2    321   3e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_002436875.1|  hypothetical protein SORBIDRAFT_10g010420          321   3e-106   Sorghum bicolor [broomcorn]
ref|XP_009334075.1|  PREDICTED: probable aldo-keto reductase 2 is...    321   4e-106   
gb|ABR16883.1|  unknown                                                 321   4e-106   Picea sitchensis
ref|XP_006392128.1|  hypothetical protein EUTSA_v10023573mg             320   4e-106   
ref|XP_007222412.1|  hypothetical protein PRUPE_ppa008163mg             320   4e-106   
ref|NP_176268.1|  probable aldo-keto reductase 3                        320   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303002.2|  hypothetical protein POPTR_0002s23530g             320   4e-106   Populus trichocarpa [western balsam poplar]
ref|XP_002886596.1|  aldo/keto reductase family protein                 320   4e-106   
ref|XP_007222405.1|  hypothetical protein PRUPE_ppa008144mg             320   5e-106   
gb|KCW57713.1|  hypothetical protein EUGRSUZ_H004702                    318   5e-106   
ref|XP_002886601.1|  ARF-GAP domain 2                                   320   7e-106   
ref|XP_006388518.1|  hypothetical protein POPTR_0166s00200g             320   7e-106   
ref|XP_009334074.1|  PREDICTED: probable aldo-keto reductase 2 is...    320   7e-106   
ref|XP_006392133.1|  hypothetical protein EUTSA_v10023904mg             320   7e-106   
ref|XP_010553616.1|  PREDICTED: probable aldo-keto reductase 4 is...    320   8e-106   
ref|XP_010244068.1|  PREDICTED: probable aldo-keto reductase 2          320   8e-106   
ref|XP_009113189.1|  PREDICTED: probable aldo-keto reductase 4 is...    320   8e-106   
ref|XP_010473254.1|  PREDICTED: probable aldo-keto reductase 4          320   8e-106   
ref|XP_008244437.1|  PREDICTED: probable aldo-keto reductase 2          319   1e-105   
ref|XP_002266277.1|  PREDICTED: probable aldo-keto reductase 2          319   1e-105   Vitis vinifera
emb|CBI39434.3|  unnamed protein product                                318   1e-105   
ref|XP_004296671.1|  PREDICTED: probable aldo-keto reductase 2-like     319   1e-105   
ref|XP_003621684.1|  Aldo-keto reductase yakc                           319   1e-105   
ref|XP_009113187.1|  PREDICTED: probable aldo-keto reductase 4          320   2e-105   
ref|XP_010673286.1|  PREDICTED: probable aldo-keto reductase 2 is...    319   2e-105   
gb|KCW57729.1|  hypothetical protein EUGRSUZ_H004811                    316   2e-105   
ref|XP_002266027.2|  PREDICTED: probable aldo-keto reductase 4          325   2e-105   Vitis vinifera
ref|XP_010418017.1|  PREDICTED: probable aldo-keto reductase 4          318   2e-105   
gb|KFK30953.1|  hypothetical protein AALP_AA6G049000                    318   2e-105   
ref|XP_010107237.1|  hypothetical protein L484_021760                   323   2e-105   
ref|XP_010418012.1|  PREDICTED: probable aldo-keto reductase 2          318   2e-105   
ref|XP_009378167.1|  PREDICTED: probable aldo-keto reductase 2          318   2e-105   
ref|XP_006302496.1|  hypothetical protein CARUB_v10020589mg             318   3e-105   
ref|XP_010069390.1|  PREDICTED: probable aldo-keto reductase 2 is...    318   3e-105   
ref|XP_011042806.1|  PREDICTED: probable aldo-keto reductase 2          317   3e-105   
ref|XP_010069392.1|  PREDICTED: probable aldo-keto reductase 2 is...    318   3e-105   
ref|XP_006392127.1|  hypothetical protein EUTSA_v10023574mg             318   3e-105   
ref|XP_002302899.2|  hypothetical protein POPTR_0002s23510g             318   3e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010069389.1|  PREDICTED: probable aldo-keto reductase 2 is...    318   3e-105   
ref|XP_002886599.1|  aldo/keto reductase family protein                 318   3e-105   
gb|ABK21001.1|  unknown                                                 318   3e-105   Picea sitchensis
ref|XP_003575317.1|  PREDICTED: probable aldo-keto reductase 2          318   3e-105   
ref|XP_006652179.1|  PREDICTED: probable aldo-keto reductase 2-like     318   3e-105   
gb|KFK22426.1|  hypothetical protein AALP_AAs39864U000400               318   4e-105   
ref|XP_010510916.1|  PREDICTED: probable aldo-keto reductase 4          318   4e-105   
dbj|BAK02817.1|  predicted protein                                      318   4e-105   
ref|XP_010251376.1|  PREDICTED: probable aldo-keto reductase 2          318   5e-105   
ref|XP_010533925.1|  PREDICTED: probable aldo-keto reductase 4          317   6e-105   
ref|XP_002518605.1|  aldo/keto reductase, putative                      317   6e-105   Ricinus communis
gb|KHN06048.1|  Putative aldo-keto reductase 2                          317   6e-105   
ref|XP_010069393.1|  PREDICTED: probable aldo-keto reductase 2 is...    317   7e-105   
ref|XP_011073936.1|  PREDICTED: auxin-induced protein PCNT115-like      318   7e-105   
ref|XP_010040399.1|  PREDICTED: probable aldo-keto reductase 2          317   8e-105   
ref|NP_564761.1|  probable aldo-keto reductase 4                        317   9e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379247.1|  PREDICTED: probable aldo-keto reductase 2 is...    317   1e-104   
ref|XP_006392126.1|  hypothetical protein EUTSA_v10024059mg             317   1e-104   
ref|XP_010042438.1|  PREDICTED: probable aldo-keto reductase 2          317   1e-104   
ref|XP_003568949.1|  PREDICTED: probable aldo-keto reductase 2          317   1e-104   
ref|XP_008379248.1|  PREDICTED: probable aldo-keto reductase 2 is...    317   1e-104   
gb|KCW57727.1|  hypothetical protein EUGRSUZ_H00480                     317   1e-104   
ref|XP_004975288.1|  PREDICTED: probable aldo-keto reductase 3-like     317   1e-104   
ref|XP_010069396.1|  PREDICTED: probable aldo-keto reductase 2          317   1e-104   
ref|XP_009371115.1|  PREDICTED: probable aldo-keto reductase 2          317   1e-104   
gb|AFW75369.1|  LOW QUALITY PROTEIN: putative oxidoreductase, ald...    317   1e-104   
ref|NP_176267.3|  probable aldo-keto reductase 2                        317   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475965.1|  PREDICTED: probable aldo-keto reductase 1 is...    317   1e-104   
ref|XP_010069391.1|  PREDICTED: probable aldo-keto reductase 2          317   2e-104   
ref|NP_001169979.1|  uncharacterized protein LOC100383880               317   2e-104   Zea mays [maize]
ref|XP_009113191.1|  PREDICTED: probable aldo-keto reductase 4          316   2e-104   
ref|NP_564762.2|  probable aldo-keto reductase 5                        316   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510924.1|  PREDICTED: probable aldo-keto reductase 3 is...    316   2e-104   
gb|KFK30952.1|  hypothetical protein AALP_AA6G048900                    316   2e-104   
gb|EYU32745.1|  hypothetical protein MIMGU_mgv1a009439mg                316   2e-104   
ref|XP_003527298.1|  PREDICTED: probable aldo-keto reductase 2-li...    316   3e-104   
gb|ABR92332.1|  putative aldo/keto reductase 2                          316   3e-104   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010069388.1|  PREDICTED: probable aldo-keto reductase 2 is...    316   3e-104   
ref|XP_009371118.1|  PREDICTED: probable aldo-keto reductase 2          315   3e-104   
emb|CAN80303.1|  hypothetical protein VITISV_011600                     316   4e-104   Vitis vinifera
gb|KHN06049.1|  Putative aldo-keto reductase 2                          315   4e-104   
dbj|BAJ95968.1|  predicted protein                                      317   4e-104   
ref|XP_004975284.1|  PREDICTED: probable aldo-keto reductase 2-like     315   4e-104   
ref|XP_010069397.1|  PREDICTED: probable aldo-keto reductase 2 is...    315   5e-104   
ref|XP_009113193.1|  PREDICTED: probable aldo-keto reductase 3          315   6e-104   
gb|ABK22828.1|  unknown                                                 315   6e-104   Picea sitchensis
ref|XP_008380430.1|  PREDICTED: probable aldo-keto reductase 2          315   7e-104   
gb|AAF17106.1|AF057715_1  auxin-induced atb2                            314   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653275.1|  PREDICTED: probable aldo-keto reductase 3-like     314   1e-103   
ref|XP_008222728.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    314   1e-103   
ref|XP_002886597.1|  hypothetical protein ARALYDRAFT_475260             314   1e-103   
gb|KCW57720.1|  hypothetical protein EUGRSUZ_H00474                     313   1e-103   
gb|AAB84222.1|  auxin-induced protein                                   314   1e-103   Helianthus annuus
gb|ABK24562.1|  unknown                                                 314   1e-103   Picea sitchensis
ref|XP_010040397.1|  PREDICTED: probable aldo-keto reductase 2          314   2e-103   
ref|XP_003527296.1|  PREDICTED: probable aldo-keto reductase 2-li...    314   2e-103   
ref|XP_011042753.1|  PREDICTED: probable aldo-keto reductase 2          313   2e-103   
ref|XP_010069401.1|  PREDICTED: probable aldo-keto reductase 2 is...    314   2e-103   
ref|XP_010069400.1|  PREDICTED: probable aldo-keto reductase 2 is...    313   2e-103   
ref|XP_004975285.1|  PREDICTED: probable aldo-keto reductase 2-like     313   2e-103   
ref|XP_010491933.1|  PREDICTED: probable aldo-keto reductase 1 is...    311   3e-103   
ref|XP_003621699.1|  Aldo-keto reductase yakc                           318   3e-103   
ref|XP_010673287.1|  PREDICTED: probable aldo-keto reductase 4 is...    319   3e-103   
ref|XP_009113195.1|  PREDICTED: probable aldo-keto reductase 4          313   4e-103   
ref|XP_006363583.1|  PREDICTED: probable aldo-keto reductase 2-li...    310   4e-103   
ref|XP_010491924.1|  PREDICTED: probable aldo-keto reductase 1 is...    313   5e-103   
ref|XP_008357878.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    310   5e-103   
emb|CAE01600.2|  OSJNBa0008A08.8                                        312   8e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302482.1|  hypothetical protein CARUB_v10020576mg             312   8e-103   
ref|XP_010673285.1|  PREDICTED: probable aldo-keto reductase 2          312   8e-103   
ref|XP_008367679.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    312   9e-103   
ref|XP_010458446.1|  PREDICTED: LOW QUALITY PROTEIN: probable ald...    312   9e-103   
ref|XP_010673288.1|  PREDICTED: probable aldo-keto reductase 5          311   1e-102   
ref|NP_001052491.1|  Os04g0337500                                       312   1e-102   Oryza sativa Japonica Group [Japonica rice]
sp|A2XRZ6.1|AKR3_ORYSI  RecName: Full=Probable aldo-keto reductase 3    312   1e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_010089803.1|  hypothetical protein L484_022319                   311   1e-102   
gb|AAB71980.1|  Highly similar to auxin-induced protein (aldo/ket...    311   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378168.1|  PREDICTED: probable aldo-keto reductase 2          311   1e-102   
ref|XP_009401025.1|  PREDICTED: probable aldo-keto reductase 2          311   2e-102   
ref|NP_001052497.1|  Os04g0339400                                       311   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006423739.1|  hypothetical protein CICLE_v10028781mg             311   2e-102   
ref|XP_010251377.1|  PREDICTED: probable aldo-keto reductase 2          311   2e-102   
ref|XP_009602070.1|  PREDICTED: probable aldo-keto reductase 2          311   2e-102   
ref|XP_008337505.1|  PREDICTED: probable aldo-keto reductase 2          311   3e-102   
ref|XP_003575318.1|  PREDICTED: probable aldo-keto reductase 2          311   3e-102   
ref|XP_010069402.1|  PREDICTED: probable aldo-keto reductase 2          310   3e-102   
ref|NP_172551.1|  probable aldo-keto reductase 1                        310   4e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32744.1|  hypothetical protein MIMGU_mgv11b007689mg               310   4e-102   
emb|CDP10334.1|  unnamed protein product                                310   4e-102   
ref|XP_009103955.1|  PREDICTED: probable aldo-keto reductase 6          310   5e-102   
ref|XP_006423736.1|  hypothetical protein CICLE_v10028766mg             308   6e-102   
gb|ABR92331.1|  putative aldo/keto reductase 1                          310   6e-102   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006363582.1|  PREDICTED: probable aldo-keto reductase 2-li...    310   8e-102   
ref|XP_007224543.1|  hypothetical protein PRUPE_ppa024588mg             309   8e-102   
emb|CDP16012.1|  unnamed protein product                                308   8e-102   
emb|CDP19922.1|  unnamed protein product                                308   9e-102   
ref|XP_010107228.1|  hypothetical protein L484_021750                   310   1e-101   
ref|XP_011073935.1|  PREDICTED: auxin-induced protein PCNT115-like      309   1e-101   
ref|XP_008379790.1|  PREDICTED: probable aldo-keto reductase 2          306   1e-101   
ref|XP_010069399.1|  PREDICTED: probable aldo-keto reductase 2          309   1e-101   
dbj|BAD44104.1|  putative auxin-induced protein                         309   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009774032.1|  PREDICTED: probable aldo-keto reductase 2          308   2e-101   
gb|AAB71982.1|  Highly similar to auxin-induced protein (aldo/ket...    308   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511057.1|  PREDICTED: probable aldo-keto reductase 4          308   2e-101   
ref|XP_006301580.1|  hypothetical protein CARUB_v10022018mg             319   3e-101   
gb|KGN53069.1|  hypothetical protein Csa_4G015100                       307   5e-101   
ref|XP_011073932.1|  PREDICTED: auxin-induced protein PCNT115-lik...    309   6e-101   
ref|XP_008453991.1|  PREDICTED: probable aldo-keto reductase 2          307   6e-101   
gb|EPS71567.1|  hypothetical protein M569_03191                         307   7e-101   
ref|XP_006392125.1|  hypothetical protein EUTSA_v10023569mg             307   8e-101   
gb|KFK22425.1|  hypothetical protein AALP_AAs39864U000300               307   9e-101   
gb|ABN08782.1|  Aldo/keto reductase                                     303   3e-100   Medicago truncatula
ref|XP_009103926.1|  PREDICTED: probable aldo-keto reductase 6          305   3e-100   
gb|KCW57711.1|  hypothetical protein EUGRSUZ_H00469                     305   4e-100   
gb|KFK30951.1|  hypothetical protein AALP_AA6G048800                    305   4e-100   
emb|CDP09056.1|  unnamed protein product                                304   5e-100   
ref|XP_010673284.1|  PREDICTED: auxin-induced protein PCNT115-like      305   6e-100   
ref|XP_010510914.1|  PREDICTED: probable aldo-keto reductase 6          305   7e-100   
ref|XP_006358815.1|  PREDICTED: probable aldo-keto reductase 2-like     304   8e-100   
emb|CDP10305.1|  unnamed protein product                                302   8e-100   
gb|AGT17123.1|  hypothetical protein SHCRBa_116_M17_F_140               304   2e-99    
ref|NP_001185274.1|  probable aldo-keto reductase 5                     304   2e-99    
ref|XP_011042750.1|  PREDICTED: probable aldo-keto reductase 2 is...    301   3e-99    
gb|EYU32743.1|  hypothetical protein MIMGU_mgv1a018455mg                302   8e-99    
ref|XP_010418018.1|  PREDICTED: probable aldo-keto reductase 6          301   1e-98    
ref|XP_010326936.1|  PREDICTED: auxin-induced protein PCNT115-like      301   2e-98    
ref|XP_010553615.1|  PREDICTED: probable aldo-keto reductase 4 is...    302   2e-98    
gb|AFW75370.1|  putative oxidoreductase, aldo/keto reductase fami...    297   1e-97    
ref|XP_010547656.1|  PREDICTED: probable aldo-keto reductase 4          299   1e-97    
ref|XP_010510923.1|  PREDICTED: probable aldo-keto reductase 3 is...    294   5e-96    
ref|XP_010470238.1|  PREDICTED: probable aldo-keto reductase 4          294   6e-96    
ref|XP_011084158.1|  PREDICTED: auxin-induced protein PCNT115-lik...    295   1e-95    
ref|XP_002972426.1|  hypothetical protein SELMODRAFT_148322             294   1e-95    
ref|XP_002984257.1|  hypothetical protein SELMODRAFT_229003             293   1e-95    
emb|CDP10282.1|  unnamed protein product                                293   2e-95    
ref|XP_009774031.1|  PREDICTED: probable aldo-keto reductase 2          293   3e-95    
gb|AFV99150.1|  alcohol dehydrogenase                                   293   5e-95    
ref|XP_009113190.1|  PREDICTED: probable aldo-keto reductase 4 is...    291   6e-95    
gb|EMT06310.1|  Auxin-induced protein                                   292   8e-95    
gb|ADW66141.1|  auxin-induced protein PCNT115                           288   1e-94    
gb|AFV99149.1|  alcohol dehydrogenase                                   291   2e-94    
ref|XP_009113194.1|  PREDICTED: probable aldo-keto reductase 6          291   2e-94    
emb|CDP10280.1|  unnamed protein product                                291   2e-94    
gb|AFK33677.1|  unknown                                                 288   2e-94    
ref|XP_011091713.1|  PREDICTED: probable aldo-keto reductase 2          290   3e-94    
gb|AFV99148.1|  alcohol dehydrogenase                                   290   4e-94    
ref|XP_002984256.1|  hypothetical protein SELMODRAFT_271687             289   8e-94    
ref|XP_006388520.1|  hypothetical protein POPTR_0166s00210g             284   7e-93    
ref|XP_002972425.1|  hypothetical protein SELMODRAFT_270951             286   7e-93    
emb|CDP10285.1|  unnamed protein product                                286   1e-92    
emb|CDY70614.1|  BnaAnng34370D                                          286   2e-92    
ref|XP_010037371.1|  PREDICTED: probable aldo-keto reductase 2          285   3e-92    
ref|XP_002984154.1|  hypothetical protein SELMODRAFT_156405             285   4e-92    
ref|XP_002984255.1|  hypothetical protein SELMODRAFT_180766             284   5e-92    
ref|XP_002972240.1|  hypothetical protein SELMODRAFT_172677             284   8e-92    
ref|NP_176274.1|  probable aldo-keto reductase 6                        283   1e-91    
ref|XP_011084159.1|  PREDICTED: probable aldo-keto reductase 2 is...    284   2e-91    
gb|EPS71568.1|  hypothetical protein M569_03192                         283   3e-91    
gb|AAD31332.1|AC007354_5  Strong similarity to gb|X56267 auxin-in...    282   4e-91    
ref|XP_002889838.1|  aldo/keto reductase family protein                 281   5e-91    
ref|XP_002979290.1|  hypothetical protein SELMODRAFT_110508             280   5e-90    
gb|EAY93599.1|  hypothetical protein OsI_15386                          279   6e-90    
ref|XP_002512217.1|  aldo/keto reductase, putative                      278   2e-89    
gb|EAZ30266.1|  hypothetical protein OsJ_14314                          278   3e-89    
ref|XP_007147189.1|  hypothetical protein PHAVU_006G103300g             277   4e-89    
gb|KDP23655.1|  hypothetical protein JCGZ_23488                         276   1e-88    
ref|XP_002988596.1|  hypothetical protein SELMODRAFT_447377             276   3e-88    
ref|XP_003626438.1|  Aldo/keto-reductase family protein                 275   4e-88    
ref|XP_001781695.1|  predicted protein                                  274   6e-88    
gb|KHN31475.1|  Putative aldo-keto reductase 1                          275   7e-88    
ref|XP_002512216.1|  aldo/keto reductase, putative                      274   8e-88    
ref|XP_010025049.1|  PREDICTED: probable aldo-keto reductase 1 is...    273   8e-88    
gb|ABK22267.1|  unknown                                                 273   9e-88    
gb|ACN40212.1|  unknown                                                 273   9e-88    
gb|KHN16446.1|  Putative aldo-keto reductase 1                          273   2e-87    
ref|XP_010025047.1|  PREDICTED: probable aldo-keto reductase 1 is...    273   2e-87    
gb|KEH43782.1|  aldo/keto reductase family oxidoreductase               273   2e-87    
ref|XP_004494693.1|  PREDICTED: probable aldo-keto reductase 1-like     273   2e-87    
ref|XP_006838937.1|  hypothetical protein AMTR_s00002p00270390          272   3e-87    
ref|NP_001236007.1|  probable aldo-keto reductase 1                     271   4e-87    
ref|XP_002993752.1|  hypothetical protein SELMODRAFT_272338             271   9e-87    
sp|C6TBN2.1|AKR1_SOYBN  RecName: Full=Probable aldo-keto reductas...    271   9e-87    
ref|XP_003626440.1|  Aldo/keto-reductase family protein                 269   1e-86    
ref|XP_003573932.1|  PREDICTED: perakine reductase-like                 271   1e-86    
gb|KEH43781.1|  aldo/keto reductase family oxidoreductase               269   2e-86    
ref|XP_002987780.1|  hypothetical protein SELMODRAFT_183426             270   2e-86    
gb|KDP23656.1|  hypothetical protein JCGZ_23489                         270   3e-86    
gb|KHN02754.1|  Perakine reductase                                      270   3e-86    
ref|XP_006838938.1|  hypothetical protein AMTR_s00002p00270430          269   5e-86    
ref|XP_002974629.1|  hypothetical protein SELMODRAFT_267791             269   5e-86    
gb|KCW57730.1|  hypothetical protein EUGRSUZ_H00483                     268   7e-86    
gb|KHG07483.1|  putative aldo-keto reductase 1                          269   7e-86    
ref|XP_002517067.1|  aldo/keto reductase, putative                      269   8e-86    
ref|XP_003521756.1|  PREDICTED: probable aldo-keto reductase 1-li...    268   1e-85    
gb|KDO74444.1|  hypothetical protein CISIN_1g019222mg                   265   1e-85    
ref|XP_011004263.1|  PREDICTED: probable aldo-keto reductase 1          268   2e-85    
ref|XP_011004268.1|  PREDICTED: probable aldo-keto reductase 1 is...    268   3e-85    
ref|XP_002963342.1|  hypothetical protein SELMODRAFT_270369             267   3e-85    
emb|CAN77719.1|  hypothetical protein VITISV_033356                     262   3e-85    
ref|XP_003521759.1|  PREDICTED: probable aldo-keto reductase 1-li...    267   3e-85    
gb|KHN31477.1|  Putative aldo-keto reductase 1                          267   3e-85    
gb|KDO50058.1|  hypothetical protein CISIN_1g019303mg                   266   4e-85    
ref|XP_010279258.1|  PREDICTED: probable aldo-keto reductase 1          267   4e-85    
ref|NP_001242478.1|  uncharacterized protein LOC100811411               266   6e-85    
ref|XP_006577297.1|  PREDICTED: probable aldo-keto reductase 1-li...    266   9e-85    
gb|ABR18452.1|  unknown                                                 266   9e-85    
ref|XP_001773044.1|  predicted protein                                  266   1e-84    
ref|XP_002319637.2|  hypothetical protein POPTR_0013s03740g             266   1e-84    
ref|XP_007030598.1|  NAD(P)-linked oxidoreductase superfamily pro...    266   1e-84    
ref|XP_009364507.1|  PREDICTED: probable aldo-keto reductase 1          266   1e-84    
ref|XP_002988048.1|  hypothetical protein SELMODRAFT_271967             266   1e-84    
emb|CDP20356.1|  unnamed protein product                                261   2e-84    
ref|XP_008379789.1|  PREDICTED: probable aldo-keto reductase 2          265   2e-84    
ref|XP_011098847.1|  PREDICTED: perakine reductase-like                 265   2e-84    
ref|XP_006420041.1|  hypothetical protein CICLE_v10005337mg             265   2e-84    
ref|XP_008812552.1|  PREDICTED: probable aldo-keto reductase 1          265   2e-84    
ref|XP_002972888.1|  hypothetical protein SELMODRAFT_172992             265   3e-84    
ref|XP_007143317.1|  hypothetical protein PHAVU_007G062100g             265   3e-84    
ref|XP_007147190.1|  hypothetical protein PHAVU_006G103400g             265   3e-84    
ref|XP_006838939.1|  hypothetical protein AMTR_s00002p00270450          265   3e-84    
ref|XP_004496669.1|  PREDICTED: perakine reductase-like isoform X1      264   4e-84    
ref|XP_006577296.1|  PREDICTED: probable aldo-keto reductase 1-li...    266   5e-84    
ref|XP_006577295.1|  PREDICTED: probable aldo-keto reductase 1-li...    266   6e-84    
ref|XP_010025048.1|  PREDICTED: probable aldo-keto reductase 1 is...    264   6e-84    
ref|XP_006363466.1|  PREDICTED: perakine reductase-like                 264   6e-84    
ref|XP_008812550.1|  PREDICTED: perakine reductase-like isoform X2      264   8e-84    
ref|XP_006471704.1|  PREDICTED: probable aldo-keto reductase 1-like     264   9e-84    
ref|XP_008812549.1|  PREDICTED: perakine reductase-like isoform X1      263   9e-84    
ref|XP_002464591.1|  hypothetical protein SORBIDRAFT_01g021470          263   1e-83    
gb|EEE50968.1|  hypothetical protein OsJ_31541                          263   1e-83    
ref|XP_006432951.1|  hypothetical protein CICLE_v10003261mg             263   1e-83    
ref|XP_006644373.1|  PREDICTED: probable aldo-keto reductase 1-like     262   1e-83    
gb|ACF83082.1|  unknown                                                 263   1e-83    
ref|XP_006375831.1|  hypothetical protein POPTR_0013s03750g             263   2e-83    
gb|EMT17499.1|  Auxin-induced protein                                   258   2e-83    
gb|ABB47623.1|  Auxin-induced protein PCNT115, putative, expressed      263   2e-83    
ref|XP_008791134.1|  PREDICTED: perakine reductase-like                 263   2e-83    
ref|NP_001132584.1|  uncharacterized protein LOC100194055               262   2e-83    
ref|XP_008388674.1|  PREDICTED: probable aldo-keto reductase 1          262   3e-83    
ref|XP_008218254.1|  PREDICTED: probable aldo-keto reductase 1 is...    262   3e-83    
ref|XP_006432965.1|  hypothetical protein CICLE_v10001689mg             262   3e-83    
ref|XP_006662359.1|  PREDICTED: probable aldo-keto reductase 1-like     262   3e-83    
ref|XP_008218253.1|  PREDICTED: probable aldo-keto reductase 1 is...    262   3e-83    
ref|XP_008778116.1|  PREDICTED: perakine reductase-like                 262   3e-83    
ref|XP_002273776.1|  PREDICTED: probable aldo-keto reductase 1          262   3e-83    
ref|XP_002265775.1|  PREDICTED: probable aldo-keto reductase 2          257   4e-83    
ref|XP_007205476.1|  hypothetical protein PRUPE_ppa008068mg             262   4e-83    
ref|XP_008388675.1|  PREDICTED: probable aldo-keto reductase 1          262   4e-83    
ref|XP_006432954.1|  hypothetical protein CICLE_v10001653mg             262   4e-83    
gb|ABR16100.1|  unknown                                                 261   5e-83    
ref|NP_001064615.2|  Os10g0419100                                       263   5e-83    
ref|XP_002458164.1|  hypothetical protein SORBIDRAFT_03g028050          261   5e-83    
ref|XP_007205479.1|  hypothetical protein PRUPE_ppa008094mg             261   5e-83    
ref|XP_002278643.1|  PREDICTED: probable aldo-keto reductase 1          261   5e-83    
gb|KDO74441.1|  hypothetical protein CISIN_1g019222mg                   259   5e-83    
ref|XP_004488050.1|  PREDICTED: probable aldo-keto reductase 1-li...    261   5e-83    
ref|XP_002278850.1|  PREDICTED: perakine reductase                      261   5e-83    
ref|XP_004983080.1|  PREDICTED: perakine reductase-like                 261   7e-83    
gb|KDO45062.1|  hypothetical protein CISIN_1g018482mg                   261   7e-83    
sp|P49249.1|IN22_MAIZE  RecName: Full=IN2-2 protein                     260   7e-83    
ref|XP_006363463.1|  PREDICTED: perakine reductase-like                 261   7e-83    
ref|XP_002517065.1|  aldo/keto reductase, putative                      261   8e-83    
ref|XP_009364505.1|  PREDICTED: probable aldo-keto reductase 1          261   8e-83    
ref|XP_004302045.1|  PREDICTED: probable aldo-keto reductase 1-like     261   8e-83    
ref|XP_011073467.1|  PREDICTED: perakine reductase-like                 261   9e-83    
ref|XP_004302044.1|  PREDICTED: probable aldo-keto reductase 1-like     261   9e-83    
ref|XP_010917618.1|  PREDICTED: probable aldo-keto reductase 1          261   1e-82    
ref|XP_007205480.1|  hypothetical protein PRUPE_ppa008094mg             261   1e-82    
ref|XP_007030594.1|  NAD(P)-linked oxidoreductase superfamily pro...    261   1e-82    
ref|XP_006432957.1|  hypothetical protein CICLE_v10001705mg             258   1e-82    
sp|Q3L181.1|PERR_RAUSE  RecName: Full=Perakine reductase                260   2e-82    
ref|XP_002283471.1|  PREDICTED: perakine reductase                      260   2e-82    
ref|XP_004140398.1|  PREDICTED: probable aldo-keto reductase 1-like     260   2e-82    
dbj|BAJ98400.1|  predicted protein                                      259   3e-82    
ref|XP_006363464.1|  PREDICTED: perakine reductase-like isoform X1      259   3e-82    
ref|XP_008245709.1|  PREDICTED: probable aldo-keto reductase 1          259   4e-82    
ref|XP_004247608.1|  PREDICTED: perakine reductase                      259   6e-82    
gb|EMT06430.1|  Auxin-induced protein                                   257   6e-82    
gb|KHN02755.1|  Perakine reductase                                      258   7e-82    
ref|XP_006471657.1|  PREDICTED: probable aldo-keto reductase 1-like     258   7e-82    
ref|XP_011027209.1|  PREDICTED: perakine reductase-like                 258   8e-82    
ref|XP_003626443.1|  Aldo/keto-reductase family protein                 258   8e-82    
ref|XP_010659883.1|  PREDICTED: probable aldo-keto reductase 1 is...    258   9e-82    
gb|KDP40235.1|  hypothetical protein JCGZ_02233                         258   9e-82    
ref|XP_008813526.1|  PREDICTED: probable aldo-keto reductase 1          258   9e-82    
ref|XP_006432959.1|  hypothetical protein CICLE_v10001705mg             258   1e-81    
pdb|3V0T|A  Chain A, Crystal Structure Of Perakine Reductase, Fou...    258   1e-81    
emb|CBI34173.3|  unnamed protein product                                258   1e-81    
pdb|3UYI|A  Chain A, Crystal Structure Of Perakine Reductase, Fou...    258   1e-81    
gb|KCW57739.1|  hypothetical protein EUGRSUZ_H00491                     257   1e-81    
ref|XP_002512220.1|  aldo/keto reductase, putative                      258   1e-81    
ref|XP_002273839.2|  PREDICTED: probable aldo-keto reductase 1 is...    258   2e-81    
pdb|3V0U|A  Chain A, Crystal Structure Of Perakine Reductase, Fou...    258   2e-81    
ref|NP_001242349.1|  uncharacterized protein LOC100810870               258   2e-81    
ref|XP_007030593.1|  NAD(P)-linked oxidoreductase superfamily pro...    258   2e-81    
ref|NP_001043588.1|  Os01g0618100                                       258   2e-81    
gb|KGN50819.1|  hypothetical protein Csa_5G272920                       256   2e-81    
ref|XP_008796760.1|  PREDICTED: probable aldo-keto reductase 1          258   2e-81    
ref|XP_002312553.1|  hypothetical protein POPTR_0008s15810g             257   2e-81    
emb|CBI39432.3|  unnamed protein product                                253   2e-81    
ref|XP_007034873.1|  NAD(P)-linked oxidoreductase superfamily pro...    258   2e-81    
ref|XP_008388672.1|  PREDICTED: perakine reductase-like                 257   2e-81    
emb|CAN79467.1|  hypothetical protein VITISV_000848                     258   2e-81    
ref|XP_002458162.1|  hypothetical protein SORBIDRAFT_03g028020          257   3e-81    
ref|XP_004247602.1|  PREDICTED: perakine reductase                      257   3e-81    
ref|XP_006423333.1|  hypothetical protein CICLE_v10028780mg             254   3e-81    
gb|KDO45049.1|  hypothetical protein CISIN_1g020083mg                   254   3e-81    
gb|KHN16194.1|  Putative aldo-keto reductase 1                          257   3e-81    
gb|AES82659.2|  aldo/keto reductase family oxidoreductase               257   3e-81    
emb|CBI34180.3|  unnamed protein product                                258   3e-81    
ref|XP_004304746.1|  PREDICTED: probable aldo-keto reductase 1-like     257   4e-81    
ref|XP_002512215.1|  aldo/keto reductase, putative                      257   4e-81    
ref|XP_007030596.1|  NAD(P)-linked oxidoreductase superfamily pro...    256   5e-81    
ref|XP_001777885.1|  predicted protein                                  256   5e-81    
gb|KDO45063.1|  hypothetical protein CISIN_1g019173mg                   256   6e-81    
emb|CDM64158.1|  predicted oxidoreductase, aryl-alcohol dehydroge...    256   6e-81    
gb|KDO45048.1|  hypothetical protein CISIN_1g020083mg                   256   6e-81    
ref|XP_006471655.1|  PREDICTED: probable aldo-keto reductase 1-like     256   7e-81    
ref|XP_007034872.1|  NAD(P)-linked oxidoreductase superfamily pro...    256   7e-81    
ref|XP_010659885.1|  PREDICTED: perakine reductase-like                 258   7e-81    
ref|XP_008245879.1|  PREDICTED: probable aldo-keto reductase 1          256   8e-81    
ref|XP_010906466.1|  PREDICTED: perakine reductase-like                 256   1e-80    
ref|XP_009364503.1|  PREDICTED: perakine reductase-like isoform X2      256   1e-80    
emb|CBI39428.3|  unnamed protein product                                250   1e-80    
ref|XP_010107226.1|  hypothetical protein L484_021748                   251   1e-80    
ref|XP_009364502.1|  PREDICTED: perakine reductase-like isoform X1      255   1e-80    
ref|XP_010103734.1|  hypothetical protein L484_016650                   251   1e-80    
ref|XP_009364504.1|  PREDICTED: perakine reductase-like isoform X3      255   1e-80    
ref|WP_025605456.1|  aldo/keto reductase                                254   2e-80    
ref|XP_002461348.1|  hypothetical protein SORBIDRAFT_02g001350          253   2e-80    
ref|XP_008813527.1|  PREDICTED: perakine reductase-like                 255   2e-80    
ref|XP_001777860.1|  predicted protein                                  254   2e-80    
gb|EMT11911.1|  Auxin-induced protein                                   256   3e-80    
ref|XP_003569369.1|  PREDICTED: probable aldo-keto reductase 1          254   3e-80    
ref|XP_004302042.1|  PREDICTED: probable aldo-keto reductase 1-like     254   3e-80    
ref|XP_010102301.1|  putative aldo-keto reductase 1                     264   3e-80    
ref|XP_006471660.1|  PREDICTED: probable aldo-keto reductase 1-li...    253   3e-80    
ref|XP_006432953.1|  hypothetical protein CICLE_v10001273mg             256   4e-80    
ref|WP_028539888.1|  aldo/keto reductase                                254   4e-80    
ref|WP_016312616.1|  hypothetical protein                               253   4e-80    
ref|XP_008350634.1|  PREDICTED: perakine reductase-like                 254   4e-80    
ref|XP_007030597.1|  NAD(P)-linked oxidoreductase superfamily pro...    254   5e-80    
ref|XP_006577284.1|  PREDICTED: probable aldo-keto reductase 1-like     254   5e-80    
ref|XP_008460212.1|  PREDICTED: probable aldo-keto reductase 1          254   5e-80    
ref|XP_008388669.1|  PREDICTED: perakine reductase-like                 254   6e-80    
emb|CDM83419.1|  unnamed protein product                                253   7e-80    
ref|XP_009792931.1|  PREDICTED: perakine reductase-like                 253   8e-80    
ref|XP_008802541.1|  PREDICTED: perakine reductase-like                 254   8e-80    
ref|XP_006432963.1|  hypothetical protein CICLE_v10001551mg             253   9e-80    
ref|XP_006347754.1|  PREDICTED: perakine reductase-like isoform X2      251   9e-80    
gb|ACU24567.1|  unknown                                                 253   9e-80    
ref|XP_004230100.1|  PREDICTED: perakine reductase-like                 253   1e-79    
ref|XP_004488051.1|  PREDICTED: probable aldo-keto reductase 1-li...    253   1e-79    
ref|XP_004302043.1|  PREDICTED: probable aldo-keto reductase 1-like     253   1e-79    
gb|KDO45065.1|  hypothetical protein CISIN_1g019147mg                   253   1e-79    
ref|XP_008449311.1|  PREDICTED: perakine reductase-like                 253   1e-79    
ref|XP_006432950.1|  hypothetical protein CICLE_v10001713mg             253   1e-79    
ref|XP_010107715.1|  Perakine reductase                                 253   1e-79    
ref|XP_006588486.1|  PREDICTED: uncharacterized protein LOC100810...    252   1e-79    
gb|EYU30067.1|  hypothetical protein MIMGU_mgv1a009395mg                253   1e-79    
ref|NP_001242562.1|  uncharacterized protein LOC100779689               253   1e-79    
ref|XP_006432962.1|  hypothetical protein CICLE_v10001551mg             253   2e-79    
ref|XP_006487491.1|  PREDICTED: probable aldo-keto reductase 3-li...    250   2e-79    
ref|XP_004496670.1|  PREDICTED: perakine reductase-like isoform X2      252   2e-79    
ref|XP_009364509.1|  PREDICTED: probable aldo-keto reductase 1          253   2e-79    
gb|EEC71097.1|  hypothetical protein OsI_02881                          251   2e-79    
ref|XP_011032415.1|  PREDICTED: probable aldo-keto reductase 1 is...    252   2e-79    



>emb|CDP10295.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   341 bits (875),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgg--grgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +        I GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  45   LATKFALSFEDGNFIINGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  104

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+QLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  105  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQLEWSLWSRDVEEEIIPTCRELGIGI  164

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GF SSGP L+ENL+E D RK  PRFQAEN E N NLYER+N +A++KGCTPS
Sbjct  165  VAYSPLGQGFFSSGPKLIENLTEGDYRKYQPRFQAENLEHNTNLYERVNAIASRKGCTPS  224

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  225  QLALAWVHHQGNDVCPIPGTTK  246



>emb|CDP10297.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   342 bits (876),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRASCEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  86   LATKFAVNLQDGKFDVRGDPAYVRASCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVEN +E D RKN PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  206  VAYSPLGRGFFSSGPKLVENFTEGDARKNMPRFQAENLEHNKNLYEQVNGIASRKGCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  266  QLALAWVHHQGKDVCPIPGTTK  287



>ref|XP_009794431.1| PREDICTED: probable aldo-keto reductase 3 isoform X3 [Nicotiana 
sylvestris]
Length=286

 Score =   337 bits (863),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI      I    DP+YVRA+CEASLKRLDV+CIDLYYQHRIDK +PIE+TMGEL
Sbjct  27   LATKFGISSADGKIEIIGDPSYVRAACEASLKRLDVDCIDLYYQHRIDKRVPIEITMGEL  86

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  87   KKLVEEGKIKYIGLSEASATTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  146

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN E N  LYERI K+A KKGCTPS
Sbjct  147  VAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYERICKMAEKKGCTPS  206

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  207  QLALAWVHHQGNDVCPIPGTTK  228



>ref|XP_009794430.1| PREDICTED: probable aldo-keto reductase 3 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   336 bits (861),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI      I    DP+YVRA+CEASLKRLDV+CIDLYYQHRIDK +PIE+TMGEL
Sbjct  40   LATKFGISSADGKIEIIGDPSYVRAACEASLKRLDVDCIDLYYQHRIDKRVPIEITMGEL  99

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  100  KKLVEEGKIKYIGLSEASATTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  159

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN E N  LYERI K+A KKGCTPS
Sbjct  160  VAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYERICKMAEKKGCTPS  219

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  220  QLALAWVHHQGNDVCPIPGTTK  241



>emb|CDP19924.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   338 bits (866),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRASCEASLKRLDV+CIDLYYQ RID  +PIEVT+GEL
Sbjct  90   LATKFAVSFQDGKFDVRGDPAYVRASCEASLKRLDVDCIDLYYQARIDTRVPIEVTIGEL  149

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  150  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  209

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP L ENL+E D RK+ PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  210  VAYSPLGRGFFSSGPKLSENLAEGDFRKHMPRFQAENLEHNKNLYEQVNAIASRKGCTPS  269

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  270  QLALAWVHHQGNDVCPIPGTTK  291



>emb|CDP10303.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I      +    DPAYVRA CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  88   LATKFAISYQDGKVDVRGDPAYVRACCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWARDVEEEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVENL+E D RK+ PRFQAEN E N  LYER N +A++KGCTPS
Sbjct  208  VAYSPLGRGFFSSGPKLVENLAEGDCRKDMPRFQAENLEHNKKLYERANAIASRKGCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  268  QLALAWVHHQGNDVCPIPGTTK  289



>emb|CDP19923.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   335 bits (859),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  94   LATKFAVSYEDGKFDICGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTGVPIEVTIGEL  153

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+QLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  154  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQLEWSLWSRDVEEEIIPTCRELGIGI  213

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GF SSGP L+ENL+E D RK  PRFQAEN E N  LYER+N +A++KGCTPS
Sbjct  214  VAYSPLGQGFFSSGPKLIENLTEGDFRKYLPRFQAENLEHNKKLYERVNAIASRKGCTPS  273

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  274  QLALAWVHHQGNDVCPIPGTTK  295



>ref|XP_009794429.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Nicotiana 
sylvestris]
Length=356

 Score =   336 bits (862),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI      I    DP+YVRA+CEASLKRLDV+CIDLYYQHRIDK +PIE+TMGEL
Sbjct  97   LATKFGISSADGKIEIIGDPSYVRAACEASLKRLDVDCIDLYYQHRIDKRVPIEITMGEL  156

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  157  KKLVEEGKIKYIGLSEASATTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  216

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN E N  LYERI K+A KKGCTPS
Sbjct  217  VAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYERICKMAEKKGCTPS  276

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  277  QLALAWVHHQGNDVCPIPGTTK  298



>ref|XP_009631780.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana tomentosiformis]
Length=356

 Score =   336 bits (862),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI      I    DP+YVRA+CEASLKRLD++CIDLYYQHRID  +PIE+TMGEL
Sbjct  97   LATKFGISSADGKIEIIGDPSYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEITMGEL  156

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  157  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  216

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN E N  LYERI ++AAKKGCTPS
Sbjct  217  VAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYERICQMAAKKGCTPS  276

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  277  QLALAWVHHQGNDVCPIPGTTK  298



>emb|CDP10302.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   335 bits (858),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I           DPAYVRA CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  60   LATKFAISYQDGKFDVCGDPAYVRACCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  119

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIP CR+LGIGI
Sbjct  120  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPACRDLGIGI  179

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP L+ENL+E D RK  PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  180  VAYSPLGRGFFSSGPKLIENLAEGDFRKYMPRFQAENLEHNKNLYEQVNAIASRKGCTPS  239

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  240  QLALAWVHHQGNDVCPIPGTTK  261



>ref|XP_009631779.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana tomentosiformis]
Length=346

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG       I    +PAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGAIFAVGKIKVCGEPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP L+E+LS  D RK+ PRFQA+N E N  LYERI ++AAKKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLLEDLSNEDFRKHLPRFQADNLEHNKILYERICQMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_004248016.1| PREDICTED: auxin-induced protein PCNT115 [Solanum lycopersicum]
Length=351

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVR++CEASLKRLDV+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  110  NPAYVRSACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  169

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGFLSSGP L+
Sbjct  170  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLL  229

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+LS  D RK+ PRFQAEN E N  LYERI ++AAKKGCTPSQLALAW+HHQGNDVCPIP
Sbjct  230  EDLSNEDYRKHLPRFQAENLEHNKKLYERICQMAAKKGCTPSQLALAWVHHQGNDVCPIP  289

Query  590  GTTK  601
            GTTK
Sbjct  290  GTTK  293



>emb|CDP10291.1| unnamed protein product [Coffea canephora]
Length=303

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRA+CEASLKRL V+CIDLYYQHRID H+PIE+T+GEL
Sbjct  45   LATKFAVTYEDGNFNICGDPAYVRAACEASLKRLGVDCIDLYYQHRIDTHVPIEITIGEL  104

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEG+IKY+GLSEASASTIRRAH++HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  105  KKLVEEGRIKYIGLSEASASTIRRAHSVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  164

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP L+ENL+E D RK  PRFQAEN E N NLY+++N +A++KGCTPS
Sbjct  165  VAYSPLGRGFFSSGPKLIENLAEGDLRKYMPRFQAENLEHNKNLYQQVNAIASRKGCTPS  224

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  225  QLALAWVHHQGKDVCPIPGTTK  246



>emb|CDP10289.1| unnamed protein product [Coffea canephora]
Length=348

 Score =   334 bits (857),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG++         GDPAYVRA+CEASLKRL V+CIDLYYQHRID  +P+E+T+GEL
Sbjct  90   LATKFGVKIEDGKREIRGDPAYVRAACEASLKRLGVDCIDLYYQHRIDTSLPVEITIGEL  149

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAEEEIIPTCRELGIGI
Sbjct  150  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDAEEEIIPTCRELGIGI  209

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SG  +VENLSE D RKN PRF+ EN E N NLYER+N +A+KKGCTPS
Sbjct  210  VAYSPLGRGFFTSGSKVVENLSEGDIRKNLPRFRTENMEHNKNLYERVNVIASKKGCTPS  269

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  270  QLALAWVHHQGNDVCPIPGTTK  291



>ref|XP_009784380.1| PREDICTED: auxin-induced protein PCNT115 [Nicotiana sylvestris]
Length=351

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVR +CEASLKRLDV+CIDLYYQHR+D  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  110  DPAYVRGACEASLKRLDVDCIDLYYQHRVDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  169

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGFLSSGP L+
Sbjct  170  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLL  229

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E++S  D RK+ PRFQAEN E N NLYERI ++A +KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  230  EDMSNEDYRKHLPRFQAENLENNKNLYERICEMAVRKGCTPSQLALAWVHHQGNDVCPIP  289

Query  590  GTTK  601
            GTTK
Sbjct  290  GTTK  293



>emb|CDP20358.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I      +    DPAYVRA CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  247  LATKFAISYQDGKVDVRGDPAYVRACCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  306

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSE+SASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  307  KKLVEEGKIKYIGLSESSASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  366

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVEN +E DRRK  PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  367  VAYSPLGRGFFSSGPKLVENFTEGDRRKGMPRFQAENLEHNKNLYEQVNAIASRKGCTPS  426

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  427  QLALAWVHHQGKDVCPIPGTTK  448


 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I           DPAYVRA CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  88   LATKFAISYQDEKFDVRGDPAYVRACCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRK  439
            VAYSPLGRGF SSGP L+ENL+E D RK
Sbjct  208  VAYSPLGRGFFSSGPKLIENLAEGDYRK  235



>emb|CDP10290.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SLKRL V+ IDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  76   DPAYVRAACEGSLKRLGVDSIDLYYQHRIDTSLPIEVTIGELKKLVEEGKIKYIGLSEAS  135

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTI+RAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGIVAYSPLGRGF SSGP L+
Sbjct  136  ASTIKRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFSSGPTLI  195

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN SE D RKN PRFQ+EN E N N+YER+N +A+KKGCTPSQLALAW+HHQGNDVCPIP
Sbjct  196  ENFSEGDFRKNLPRFQSENMEHNKNMYERVNVIASKKGCTPSQLALAWVHHQGNDVCPIP  255

Query  590  GTTK  601
            GTTK
Sbjct  256  GTTK  259



>ref|XP_006358809.1| PREDICTED: probable aldo-keto reductase 4-like isoform X2 [Solanum 
tuberosum]
Length=346

 Score =   333 bits (853),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R + G+PAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIHFADGKREVRGEPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+L+  D RK+ PRFQ EN E N   YERI ++AAKKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKFYERICQMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>sp|P40691.1|A115_TOBAC RecName: Full=Auxin-induced protein PCNT115 [Nicotiana tabacum]
 emb|CAA39708.1| auxin-induced protein [Nicotiana tabacum]
Length=307

 Score =   331 bits (848),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLD++CIDLYYQHR+D  +PIE+T+GELKKLVEEGK+KY+GLSEAS
Sbjct  110  DPAYVRAACEASLKRLDIDCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLKYIGLSEAS  169

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGFLSSGP L+
Sbjct  170  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLL  229

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E++S  D RK  PRFQAEN E N NLYERI ++A +KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  230  EDMSNEDYRKYLPRFQAENLENNKNLYERICEMAVRKGCTPSQLALAWVHHQGNDVCPIP  289

Query  590  GTTK  601
            GTTK
Sbjct  290  GTTK  293



>ref|XP_006358808.1| PREDICTED: probable aldo-keto reductase 4-like isoform X1 [Solanum 
tuberosum]
Length=346

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R + G+PAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIHFADGKREVRGEPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+L+  D RK+ PRFQ EN E N   YERI ++AAKKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKFYERICQMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_010326945.1| PREDICTED: auxin-induced protein PCNT115-like [Solanum lycopersicum]
Length=346

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +      +    +PAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFAVSFAEGKMQVRGEPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP L+E+ S  D RK  PRFQ EN E N  LYERI ++AAKKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLLEDCSNEDFRKYLPRFQGENLEHNKKLYERICQIAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta]
Length=344

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I           DPAYVRA+CEASLKRLDV+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  85   LATKFAINLKDGKREIRGDPAYVRAACEASLKRLDVDCIDLYYQHRVDTSVPIEVTVGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE LSE D RK  PRFQ EN E N +L+ER+N++AA+K CTPS
Sbjct  205  VAYSPLGRGFFSSGPKLVETLSEGDFRKYLPRFQPENLEHNKHLFERVNEIAARKQCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_007034103.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05029.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=370

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+          GDPAYVRA+CE SLKRL V+CIDLYYQHRID  +PIEVTMGEL
Sbjct  85   LATKFGVDFTEGKREIRGDPAYVRAACEGSLKRLGVDCIDLYYQHRIDTRVPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +IIPTCRELGIG+
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIIPTCRELGIGV  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP +VE LS  D RK+ PRFQ EN E N  LYE++N++AAKKGCTPS
Sbjct  205  VAYSPLGRGFFSSGPKIVETLSNDDLRKSQPRFQPENLEHNKRLYEQVNEIAAKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  265  QLALAWVHHQGNDVCPIPGTTK  286



>emb|CDP10299.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF     G      GDP YVRA+CE SLKRL ++CIDLYYQHRID ++PIE T+GEL
Sbjct  86   LATKFAFTYEGGQFGIRGDPDYVRAACEGSLKRLGLDCIDLYYQHRIDTNVPIEATVGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVENL++ D RK  PRFQAEN E N NLYER+N +A++KGCTPS
Sbjct  206  VAYSPLGRGFFSSGPKLVENLTDDDYRKYMPRFQAENLEHNKNLYERVNAIASRKGCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  266  QLALAWVHHQGNDVCPIPGTTK  287



>ref|XP_003531918.1| PREDICTED: probable aldo-keto reductase 2-like isoformX1 [Glycine 
max]
 ref|XP_006585846.1| PREDICTED: probable aldo-keto reductase 2-like isoform X2 [Glycine 
max]
 gb|KHN15572.1| Putative aldo-keto reductase 2 [Glycine soja]
Length=342

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CE SLKRL ++CIDLYYQHRID  +PIE+T+GEL
Sbjct  83   LATKFGINVAEGKREIRGDPAYVRAACEGSLKRLGIDCIDLYYQHRIDTRVPIEITIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP L+ENL++ D R++ PRFQ EN EQN  ++ER+N++AAKKGCTPS
Sbjct  203  VAYSPLGRGFLSSGPKLLENLTQDDFRQSLPRFQPENLEQNKTIFERVNELAAKKGCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  263  QLALAWVHHQGKDVCPIPGTTK  284



>ref|XP_009631784.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like 
[Nicotiana tomentosiformis]
Length=307

 Score =   329 bits (844),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLD++CIDLYYQHR+D  +PIE+T+GELKKLVEEGK+KY+GLSEAS
Sbjct  110  DPAYVRAACEASLKRLDIDCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLKYIGLSEAS  169

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGFLSSGP L+
Sbjct  170  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLSSGPKLL  229

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E++S  D RK+ PRFQAEN E N NLYERI ++A +KGCTPSQLALAW+HHQGN VCPIP
Sbjct  230  EDMSNEDYRKHLPRFQAENLENNKNLYERICEMAVRKGCTPSQLALAWVHHQGNGVCPIP  289

Query  590  GTTK  601
            GTTK
Sbjct  290  GTTK  293



>ref|XP_010326944.1| PREDICTED: auxin-induced protein PCNT115-like [Solanum lycopersicum]
Length=349

 Score =   330 bits (847),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 175/203 (86%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFGI     G      DP YVRASCEASLKRLDV CIDLYYQHRID  +PIE+TMGE
Sbjct  88   LATKFGINASADGKIEIIGDPCYVRASCEASLKRLDVNCIDLYYQHRIDTRVPIEITMGE  147

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKY+GLSEASASTIRRAH +HP+TAVQLEWSLWSRD EEEIIPTCRELGIG
Sbjct  148  LKKLVEEGKIKYIGLSEASASTIRRAHEVHPITAVQLEWSLWSRDVEEEIIPTCRELGIG  207

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN + N  LYERI ++A KKGCTP
Sbjct  208  IVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLKHNKILYERICQMATKKGCTP  267

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+HHQGNDVCPIPGTTK
Sbjct  268  SQLALAWVHHQGNDVCPIPGTTK  290



>ref|XP_004975287.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=346

 Score =   330 bits (847),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CE SLKRL V+C+DLYYQHRID  +PIEVTMGEL
Sbjct  87   LATKFGISFADGKREIRGDPAYVRAACEGSLKRLGVDCVDLYYQHRIDNRVPIEVTMGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAEE+IIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  LV++L+E D RK+ PRFQ EN ++N  ++ER+N +AA+KGCTPS
Sbjct  207  VAYSPLGRGFLSSGTKLVDSLTEQDFRKHMPRFQPENLDKNAQIFERVNAMAARKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_006423749.1| hypothetical protein CICLE_v10028769mg [Citrus clementina]
 ref|XP_006487497.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
 gb|ESR36989.1| hypothetical protein CICLE_v10028769mg [Citrus clementina]
 gb|KDO51546.1| hypothetical protein CISIN_1g019272mg [Citrus sinensis]
Length=343

 Score =   330 bits (847),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CEASLKRLDV+ IDLYYQHRID  +PIE+T+GEL
Sbjct  84   LATKFGIINEDGQFLYRGDPAYVRAACEASLKRLDVDYIDLYYQHRIDTKVPIEITIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAE EI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDAEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP L ENLS+ D R++ PRFQAEN E N  L+ER+N++AAKKGCTPS
Sbjct  204  VAYSPLGRGFFSSGPELAENLSKDDYRQSLPRFQAENLEHNKKLFERVNEIAAKKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_010326948.1| PREDICTED: auxin-induced protein PCNT115-like isoform X2 [Solanum 
lycopersicum]
Length=346

 Score =   330 bits (847),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G   + G+P YVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIHFADGKIEVRGEPEYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+L+  D RK+ PRFQ EN E N  LYERI ++A KKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKLYERICELATKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_010326947.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Solanum 
lycopersicum]
Length=346

 Score =   330 bits (846),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G   + G+P YVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIHFADGKIEVRGEPEYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+L+  D RK+ PRFQ EN E N  LYERI ++A KKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPKLVEDLTNEDFRKHLPRFQGENLEHNKKLYERICELATKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_003621701.1| Aldo/keto reductase [Medicago truncatula]
 gb|ABN08816.1| Aldo/keto reductase [Medicago truncatula]
 gb|AES77919.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=339

 Score =   330 bits (846),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG +          DPAYVR +CEASLKRLD++CIDLYYQHRID  +PIE+T+GEL
Sbjct  83   LATKFGAKYTEGKFEICGDPAYVREACEASLKRLDIDCIDLYYQHRIDTRLPIEITIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  +VEN ++ D R+  PRFQ EN +QN  ++ER+N++AAKKGCTPS
Sbjct  203  VAYSPLGRGFFSSGTKIVENFTKDDYRQYMPRFQPENLQQNQTIFERVNELAAKKGCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQGNDVCPIPGTTK
Sbjct  263  QLALAWLHHQGNDVCPIPGTTK  284



>ref|XP_011000038.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=345

 Score =   330 bits (845),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIEVTMGEL
Sbjct  86   LATKFGINFQDGKREIRGDPAYVRAACEASLKRLQLDCIDLYYQHRIDTKVPIEVTMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+ +E D RK+ PRFQ EN + N  L+ER+N++AA+K CTPS
Sbjct  206  VAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNKQLFERVNEIAARKQCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>gb|ABK95612.1| unknown [Populus trichocarpa]
Length=345

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF    + G R I GDPAYVRA+CEASLKRL ++C+DLYYQHRID  +PIEVTMGEL
Sbjct  86   LATKFGINFQDGKREIRGDPAYVRAACEASLKRLQLDCVDLYYQHRIDTKVPIEVTMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HPVTAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQLEWSLWSRDVEEEIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+ +E D RK+ PRFQ EN + N  L+ER+N++AA+K CTPS
Sbjct  206  VAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNRQLFERVNEIAARKQCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_006487489.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
 gb|KDO50059.1| hypothetical protein CISIN_1g019303mg [Citrus sinensis]
Length=343

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE+ S+ D R+  PRFQAEN E N  L+ER+N++A +KGCTPS
Sbjct  204  VAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFERVNEIATRKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_009794432.1| PREDICTED: auxin-induced protein PCNT115-like [Nicotiana sylvestris]
Length=346

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG       I    +PAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGAIFADGKIKVCGEPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+T VQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITTVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP L+E+LS  D  K+ PRFQA+N E N  LYERI ++AAKKGCTPS
Sbjct  207  VAYSPLGRGFLSSGPELLEDLSSEDFPKHLPRFQADNLEHNKILYERICQMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>emb|CAN80302.1| hypothetical protein VITISV_011599 [Vitis vinifera]
Length=317

 Score =   328 bits (840),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL+V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  77   DPAYVRAACEASLKRLEVDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  136

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGIVAYSPLGRGFLSSG  LV
Sbjct  137  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGIVAYSPLGRGFLSSGTKLV  196

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLS  D RKN PRFQ EN   N  LYER++++A +KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  197  ENLSNNDFRKNLPRFQPENLGHNKILYERVSEIATRKGCTPSQLALAWVHHQGNDVCPIP  256

Query  590  GTTK  601
            GTTK
Sbjct  257  GTTK  260



>emb|CDP10300.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF     G      GDP YVRA+CE SLKRL ++CIDLYYQHRID ++PIEVT+GEL
Sbjct  86   LATKFAFTYEGGQFGIRGDPDYVRAACEGSLKRLGLDCIDLYYQHRIDTNVPIEVTVGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDIEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVENL++ D RK  PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  206  VAYSPLGRGFFSSGPKLVENLTDDDYRKYMPRFQAENLEHNKNLYEQVNAIASRKGCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  266  QLALAWVHHQGKDVCPIPGTTK  287



>ref|XP_002321097.2| aldo/keto reductase family protein [Populus trichocarpa]
 gb|EEE99412.2| aldo/keto reductase family protein [Populus trichocarpa]
Length=345

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 179/202 (89%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF    + G R I GDPAYVRA+CEASLKRL ++C+DLYYQHRID  +PIEVTMGEL
Sbjct  86   LATKFGINFQDGKREIRGDPAYVRAACEASLKRLQLDCVDLYYQHRIDTKVPIEVTMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HPVTAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQLEWSLWSRDVEEEIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+ +E D RK+ PRFQ EN + N  L+ER+N+++A+K CTPS
Sbjct  206  VAYSPLGRGFLSSGPKLVESFTEGDFRKHLPRFQPENLDHNRQLFERVNEISARKQCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>gb|ACJ85229.1| unknown [Medicago truncatula]
 gb|AFK47828.1| unknown [Medicago truncatula]
Length=339

 Score =   328 bits (840),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG +          DPAYVR +CEASLKRLD++CIDLYYQHRID  +PIE+T+GEL
Sbjct  83   LATKFGAKYTEGKFEICGDPAYVREACEASLKRLDIDCIDLYYQHRIDTRLPIEITIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  +VEN ++ D R+  PRFQ EN +QN  ++ER+N++AAKKGCTP 
Sbjct  203  VAYSPLGRGFFSSGTKIVENFTKDDYRQYMPRFQPENLQQNQTIFERVNELAAKKGCTPF  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQGNDVCPIPGTTK
Sbjct  263  QLALAWLHHQGNDVCPIPGTTK  284



>ref|XP_002436402.1| hypothetical protein SORBIDRAFT_10g001890 [Sorghum bicolor]
 gb|EER87769.1| hypothetical protein SORBIDRAFT_10g001890 [Sorghum bicolor]
Length=346

 Score =   328 bits (841),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +        I GDPAYVRA+CE SLKRL V+CIDLYYQHRIDK +PIEVT+GEL
Sbjct  87   LATKFAVSYADGKWEIRGDPAYVRAACEGSLKRLGVDCIDLYYQHRIDKKVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFL SG  LV++LSE D RK  PRFQ EN ++N  ++ER+N +AAK+GCTPS
Sbjct  207  VAYSPLGRGFLCSGAKLVDSLSEQDFRKYMPRFQPENIDKNTKIFERVNAMAAKRGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>emb|CDP10298.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF            GDPA+VRA CE SLKRL ++CIDLYYQ RID ++PIEVT+GE 
Sbjct  86   LATKFAFIDQDGQSGIRGDPAHVRAVCEGSLKRLGLDCIDLYYQPRIDTNVPIEVTVGEF  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+QLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQLEWSLWSRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVENL++ D RK+ PRFQAEN E N NLYER+N +A++KGCTPS
Sbjct  206  VAYSPLGRGFFSSGPKLVENLTDDDYRKHVPRFQAENLEHNKNLYERVNAIASRKGCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  266  QLALAWVHHQGNDVCPIPGTTK  287



>ref|XP_007034108.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05034.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CE SLKRL V+C+ LYYQHRID  +PIEVTMGEL
Sbjct  85   LATKFGINYSQGARQIRGDPAYVRAACEGSLKRLGVDCVYLYYQHRIDTRVPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRA+A+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  145  KKLVEEGKVKYIGLSEASASTIRRANAVHPITAVQLEWSLWARDVEEEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE LS+ D RK  PRFQ EN E N  LYER+N++AAKKGCTPS
Sbjct  205  VAYSPLGRGFLSSGPELVETLSDDDYRKFLPRFQPENLEHNKRLYERVNEIAAKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  265  QLALAWVHHQGNDVCPIPGTTK  286



>ref|NP_001141057.1| putative oxidoreductase, aldo/keto reductase family protein [Zea 
mays]
 gb|ACF85305.1| unknown [Zea mays]
 tpg|DAA48280.1| TPA: putative oxidoreductase, aldo/keto reductase family protein 
[Zea mays]
Length=346

 Score =   328 bits (840),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+          GDPAYVRA+CE S KRL V+CIDLYYQHRIDK +PIEVT+GEL
Sbjct  87   LATKFGVSFADGKREIHGDPAYVRAACEGSFKRLGVDCIDLYYQHRIDKRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAEE+IIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  LV++LSE D RK+ PRFQ EN ++N  ++ER++ +AA+KGCTPS
Sbjct  207  VAYSPLGRGFFSSGAKLVDSLSEQDFRKHMPRFQPENLDKNAQIFERVSAMAARKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_007034105.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05031.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   328 bits (840),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI    G R I GDPAYVR +CE SLKRL V+CIDLYYQHRID  +PIEVTMGEL
Sbjct  85   LATKFGIDYTEGKREIRGDPAYVRVACEGSLKRLGVDCIDLYYQHRIDTRLPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +IIPTCREL IGI
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIIPTCRELEIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP +VE LS  D RK+ PRFQ EN E N  LYER+N++AAKKGCTPS
Sbjct  205  VAYSPLGRGFLSSGPKIVETLSNDDFRKSLPRFQPENLEHNQRLYERVNEIAAKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  265  QLALAWVHHQGNDVCPIPGTTK  286



>ref|XP_006423737.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
 gb|ESR36977.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
Length=343

 Score =   328 bits (840),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAY RA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISYADGKREIRGDPAYARAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE+ S+ D R+  PRFQAEN E N  L+ER+N++A +KGCTPS
Sbjct  204  VAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFERVNEIATRKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_010244073.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=341

 Score =   327 bits (839),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCEASLKRLDV+CIDLYYQHRID  IPIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRASCEASLKRLDVDCIDLYYQHRIDTKIPIEVTMGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TA+QLEWSLW+R+ E++IIPTCRELGIGIVAYSPLGRGF SSGP +V
Sbjct  161  ASTIRRAHAVHPITALQLEWSLWAREVEKDIIPTCRELGIGIVAYSPLGRGFFSSGPKVV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN +E D R+N PRFQ EN E N ++++R+N++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  221  ENFTENDFRRNLPRFQPENLEHNKSVFDRVNEIATRKGCTPSQLALAWVHHQGSDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_006358806.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Solanum 
tuberosum]
Length=354

 Score =   328 bits (841),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIE+T+ ELKKLVEEGKIK++GLSEAS
Sbjct  112  DPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEITIRELKKLVEEGKIKHIGLSEAS  171

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAV+LEWSLWSRD EEEI+PTCRELGIGIVAYSPLGRGFLSSGP L+
Sbjct  172  ASTIRRAHAVHPITAVELEWSLWSRDVEEEIVPTCRELGIGIVAYSPLGRGFLSSGPKLL  231

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E++   D RK+ PRFQAEN EQN  LYERI ++AAKKGCTPSQLALAW+HHQGNDVCPIP
Sbjct  232  EDMENEDYRKHLPRFQAENLEQNKILYERICEMAAKKGCTPSQLALAWVHHQGNDVCPIP  291

Query  590  GTTK  601
            GTTK
Sbjct  292  GTTK  295



>ref|XP_002265927.1| PREDICTED: probable aldo-keto reductase 2 [Vitis vinifera]
Length=341

 Score =   327 bits (839),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+      R   GDPAYVRA CEASLKRL+V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  83   LATKFGVIYDDRVRDARGDPAYVRACCEASLKRLEVDCIDLYYQHRIDTRVPIEVTVGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  +VENLS+ D RK  PRFQ EN E N  LYER++++A +KGCTPS
Sbjct  203  VAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYERVSEIATRKGCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  263  QLALAWVHHQGDDVCPIPGTTK  284



>emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera]
Length=341

 Score =   327 bits (839),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL+V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRAACEASLKRLEVDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGIVAYSPLGRGF SSG  LV
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGIVAYSPLGRGFFSSGAKLV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLS  D RKN PRFQ EN   N  LYER++++A +KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  221  ENLSNNDFRKNLPRFQPENLGHNKILYERVSEIATRKGCTPSQLALAWVHHQGNDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>emb|CAN67592.1| hypothetical protein VITISV_015428 [Vitis vinifera]
Length=335

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+      R   GDPAYVRA CEASLKRL+V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  77   LATKFGVIYDDRVRDARGDPAYVRACCEASLKRLEVDCIDLYYQHRIDTRVPIEVTVGEL  136

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  137  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  196

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  +VENLS+ D RK  PRFQ EN E N  LYER++++A +KGCTPS
Sbjct  197  VAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYERVSEIATRKGCTPS  256

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  257  QLALAWVHHQGDDVCPIPGTTK  278



>emb|CBI39431.3| unnamed protein product [Vitis vinifera]
Length=318

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    R      DPAYVRA CEASLKRL+V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  60   LATKFGVIYDDRVRDARGDPAYVRACCEASLKRLEVDCIDLYYQHRIDTRVPIEVTVGEL  119

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  120  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  179

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  +VENLS+ D RK  PRFQ EN E N  LYER++++A +KGCTPS
Sbjct  180  VAYSPLGRGFLSSGAKMVENLSDNDSRKYFPRFQPENLEHNKILYERVSEIATRKGCTPS  239

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  240  QLALAWVHHQGDDVCPIPGTTK  261



>emb|CBI39433.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   325 bits (832),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL+V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  76   DPAYVRAACEASLKRLEVDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  135

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGIVAYSPLGRGF SSG  L+
Sbjct  136  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGIVAYSPLGRGFFSSGTKLI  195

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLS  D RKN PRFQ EN   N  LYER++++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  196  ENLSNNDFRKNLPRFQPENLGHNKILYERVSEIATRKGCTPSQLALAWVHHQGDDVCPIP  255

Query  590  GTTK  601
            GTTK
Sbjct  256  GTTK  259



>ref|XP_002436403.1| hypothetical protein SORBIDRAFT_10g001900 [Sorghum bicolor]
 gb|EER87770.1| hypothetical protein SORBIDRAFT_10g001900 [Sorghum bicolor]
Length=346

 Score =   325 bits (834),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+          GDPAYVRA+CE SLKRL V+CIDLYYQHRIDK +PIEVT+GEL
Sbjct  87   LATKFGLSFADGKREIRGDPAYVRAACEGSLKRLGVDCIDLYYQHRIDKKVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRD EE+IIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDVEEDIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFL SG  LV++LSE D RK+ PRFQ EN ++N  ++E +N +AAKKGCTPS
Sbjct  207  VAYSPLGRGFLCSGAKLVDSLSEQDFRKHMPRFQPENIDKNAKIFEHVNAMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>gb|KHG15522.1| hypothetical protein F383_16754 [Gossypium arboreum]
Length=343

 Score =   325 bits (834),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI    G R I GDP YVRA+CE SLKRL V+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  85   LATKFGIDYTDGKREIRGDPVYVRAACEGSLKRLGVDCIDLYYQHRVDTRVPIEVTIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +IIPTCRELGIGI
Sbjct  145  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP ++E LSE D RK  PRFQ EN E N  LYER+N++A KKGCTPS
Sbjct  205  VAYSPLGRGFFSSGPKMMETLSEGDFRKYLPRFQPENLEHNKRLYERVNEIAVKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  265  QLALAWVHHQGNDVCPIPGTTK  286



>ref|XP_007034107.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05033.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=344

 Score =   325 bits (834),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    G   I GDPAYVRA+CE SLKRL V C+DLYYQHRID  +PIEVTMGEL
Sbjct  85   LATKFGLDYTEGKNDIRGDPAYVRAACEGSLKRLGVVCVDLYYQHRIDTRVPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E  IIPTCRELGIGI
Sbjct  145  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAHIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP +VE LS  D RK+ PRFQ EN   N  LYER+N++A KKGCTPS
Sbjct  205  VAYSPLGRGFFSSGPKIVETLSNDDFRKSQPRFQPENLAHNKRLYERVNEIAVKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  265  QLALAWVHHQGNDVCPIPGTTK  286



>gb|KDP37896.1| hypothetical protein JCGZ_05778 [Jatropha curcas]
Length=344

 Score =   325 bits (833),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG   + G   + GDPAYVRASCE SLKRLDV+CIDLYY HRID  IPIEVTMGEL
Sbjct  85   LATKFGIIFKDGKVELRGDPAYVRASCEDSLKRLDVDCIDLYYHHRIDTSIPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYVGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SS PNLV+NL+E D RK  PRFQAEN E N  L ER++++AA+K CT S
Sbjct  205  VAYSPLGRGFFSSEPNLVQNLAEGDFRKVLPRFQAENLEHNKKLLERVSEIAARKQCTTS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_004492046.1| PREDICTED: probable aldo-keto reductase 2-like [Cicer arietinum]
Length=339

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP+YVR +CE+SLKRLD++CIDLYYQHRID  +PIE T+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPSYVRVACESSLKRLDIDCIDLYYQHRIDTRLPIEFTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGF SSG  +V
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFFSSGAKMV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN ++ D R++ PRFQ EN EQN  +++R+N+++ KKGCTPSQLALAWLHHQGNDVCPIP
Sbjct  221  ENFTKDDYRQHMPRFQPENLEQNQTIFDRVNELSTKKGCTPSQLALAWLHHQGNDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_006423334.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
 gb|ESR36574.1| hypothetical protein CICLE_v10028780mg [Citrus clementina]
Length=342

 Score =   325 bits (832),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLDV+CIDLYYQHRID   PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG  L 
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGSKLA  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+LSE D RK+ PRFQ  N E N  L+ER+N++AA KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  221  ESLSEGDYRKHLPRFQPGNLEHNQKLFERVNEIAANKGCTPSQLALAWVHHQGDDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_007139301.1| hypothetical protein PHAVU_008G017800g [Phaseolus vulgaris]
 gb|ESW11295.1| hypothetical protein PHAVU_008G017800g [Phaseolus vulgaris]
Length=342

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG++         GDPAYVRA+CE SLKRLD+ CIDLYYQHRID  +PIEVT+GEL
Sbjct  83   LATKFGVKLAEGKREILGDPAYVRAACEGSLKRLDINCIDLYYQHRIDTRVPIEVTIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLV EGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  143  KKLVGEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  L+ENL++ D RK  PRF+ ENAEQN  ++ER+N++A +KGCTPS
Sbjct  203  VAYSPLGRGFFSSGTKLLENLTQDDARKFMPRFKPENAEQNSIIFERVNELATRKGCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  263  QLALAWVHHQGKDVCPIPGTTK  284



>ref|XP_006423748.1| hypothetical protein CICLE_v10028770mg [Citrus clementina]
 gb|ESR36988.1| hypothetical protein CICLE_v10028770mg [Citrus clementina]
Length=343

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGIR         GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGIRYEDGQYSYCGDPAYVRATCEASLKRLDVDCIDLYYQHRIDTKVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE++++ D R   PRFQ EN E N  L+ER+N++A KKGCT S
Sbjct  204  VAYSPLGRGFLSSGPKLVESIAQDDSRHLLPRFQPENLEHNKKLFERVNELAVKKGCTRS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>gb|KDP37897.1| hypothetical protein JCGZ_05779 [Jatropha curcas]
Length=344

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF    + G R I GDPAYVRA+CE SL+RLDV+CIDLYYQHRID  IPIEVT+GEL
Sbjct  85   LATKFGISFKDGKREIRGDPAYVRAACEDSLRRLDVDCIDLYYQHRIDTSIPIEVTVGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEACASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE L E D RK  PRFQAEN E N  L+ER++++AA+K CTPS
Sbjct  205  VAYSPLGRGFFSSGPKLVETLKEDDFRKYLPRFQAENLEHNKKLFERVSEIAARKQCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_008454010.1| PREDICTED: probable aldo-keto reductase 4 [Cucumis melo]
Length=342

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I          GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFAISFADGKREIRGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP L+E L + D RK+ PRFQ EN E N  ++E+++ +A +KGCT S
Sbjct  204  VAYSPLGRGFFSSGPKLIEGLQDNDFRKHLPRFQGENLEHNKTVFEKVSAIAERKGCTSS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>gb|KDO50054.1| hypothetical protein CISIN_1g019368mg [Citrus sinensis]
Length=265

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggrgicg-DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI     G    DPAYVRA CEASLKRLD++CIDLYYQHR+D  IPIEVT+GELK
Sbjct  7    LATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELK  66

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEA A+TIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGIV
Sbjct  67   KLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIV  126

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AY PLG+GFLSSGP LVE+ S+ D RK  P+FQAEN E N  L+ER+N++A +KGCTP+Q
Sbjct  127  AYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQ  186

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LALAW+HHQG+DVCPIPGTTK
Sbjct  187  LALAWVHHQGDDVCPIPGTTK  207



>gb|EYU24276.1| hypothetical protein MIMGU_mgv1a009306mg [Erythranthe guttata]
Length=346

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRL V CIDLYYQHRID  +PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  107  DPVYVRAACEASLKRLSVSCIDLYYQHRIDTRLPIEVTMGELKKLVEEGKIKYIGLSEAS  166

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAH++HP+TAVQLEWSLWSRD E EIIPTCRELGIGIVAYSPLGRGF SSGP LV
Sbjct  167  ASTIRRAHSVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGIVAYSPLGRGFFSSGPKLV  226

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E LS+ D RK  PRFQ EN E N  L+ER++ +A +KGCTPSQ+ALAWLHHQGNDVCPIP
Sbjct  227  ETLSQGDFRKYLPRFQPENLEHNKKLFERVSDMANEKGCTPSQIALAWLHHQGNDVCPIP  286

Query  590  GTTK  601
            GTTK
Sbjct  287  GTTK  290



>ref|XP_011015381.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=343

 Score =   324 bits (830),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIE TMGEL
Sbjct  84   LATKFGVNFKDGNAEVRGDPAYVRAACEASLKRLQLDCIDLYYQHRIDTSVPIEATMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCR+LGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRDLGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+GP LVE+ SE D RK+  RF+ EN + N +L+ER+N++AA+K CTPS
Sbjct  204  VAYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFERVNEIAARKQCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQG+DVCPIPGTTK
Sbjct  264  QLALAWLHHQGDDVCPIPGTTK  285



>gb|ACF85021.1| unknown [Zea mays]
Length=319

 Score =   323 bits (827),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRA+CEASLKRL ++CIDLYYQHRIDK +PIEVT+GEL
Sbjct  60   LATKFAVSFADGKREIRGDPAYVRAACEASLKRLGIDCIDLYYQHRIDKKVPIEVTIGEL  119

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAEE+IIPTCRELGIGI
Sbjct  120  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGI  179

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF  SG  LV++LSE D RK+ PR Q EN  +N  ++E +N +AAKKGCTPS
Sbjct  180  VAYSPLGRGFFCSGAKLVDSLSEQDFRKHMPRLQPENIVKNAKIFEHVNAMAAKKGCTPS  239

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  240  QLALAWVHHQGNDVCPIPGTTK  261



>gb|KHG21132.1| hypothetical protein F383_07588 [Gossypium arboreum]
Length=343

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CE SLKRL V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  85   LATKFGIDYTDGKRDIRGDPAYVRAACEGSLKRLGVDCIDLYYQHRIDTKVPIEVTIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +IIPTCRELGIGI
Sbjct  145  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDGEADIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S GP +VE LS  D RKN PRFQ EN E N  LY+R+N++AAKKGCTPS
Sbjct  205  VAYSPLGRGFFSFGPKIVETLSNDDFRKNLPRFQPENMEHNQRLYDRVNEIAAKKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+H+QG+DVCPIPGTTK
Sbjct  265  QLALAWVHNQGDDVCPIPGTTK  286



>ref|NP_001149335.1| LOC100282958 [Zea mays]
 gb|ACG35067.1| auxin-induced protein PCNT115 [Zea mays]
Length=346

 Score =   323 bits (829),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +          GDPAYVRA+CEASLKRL ++CIDLYYQHRIDK +PIEVT+GEL
Sbjct  87   LATKFAVSFADGKREIRGDPAYVRAACEASLKRLGIDCIDLYYQHRIDKKVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAEE+IIPTCRELGIGI
Sbjct  147  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF  SG  LV++LSE D RK+ PR Q EN  +N  ++E +N +AAKKGCTPS
Sbjct  207  VAYSPLGRGFFCSGAKLVDSLSEQDFRKHMPRLQPENIVKNAKIFEHVNAMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>emb|CDP10287.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   322 bits (826),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SLKRL V+CIDLYYQHRID  +PIE+T+GELKKLVEEGKIKY+GLSEAS
Sbjct  76   DPAYVRAACEGSLKRLGVDCIDLYYQHRIDTRLPIEITIGELKKLVEEGKIKYIGLSEAS  135

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGIVAYSPLGRGF SSGP L+
Sbjct  136  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFSSGPKLM  195

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL++ D RK  PR Q EN E N +L+ER+N +A++KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  196  ENLADGDFRKFLPRLQPENVEHNKSLFERVNDIASRKGCTPSQLALAWVHHQGSDVCPIP  255

Query  590  GTTK  601
            GTTK
Sbjct  256  GTTK  259



>ref|XP_006487529.1| PREDICTED: probable aldo-keto reductase 2-like [Citrus sinensis]
Length=579

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGIR         GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  320  LATKFGIRYEDGQYSYCGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTKVPIEVTIGEL  379

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  380  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  439

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP LVE+++  D R + PRFQ EN E N  L+ER+N++A KKGCTPS
Sbjct  440  VAYSPLGRGFLSSGPKLVESIAPDDSRHHLPRFQPENLEHNKKLFERVNEIAVKKGCTPS  499

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  500  QLALAWVHHQGNDVCPIPGTTK  521


 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGIR         GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGIRYEDGQYSYCGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTKVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            K+LVEEGKIK++ LSEA ASTIRRAH IHP+T V+LEWSL SRD +EE++   RELGIGI
Sbjct  144  KRLVEEGKIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKEEVVALLRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLV  409
            VAY+ L   FLSSGP L+
Sbjct  204  VAYNLLECEFLSSGPKLI  221



>ref|XP_011042752.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=343

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIE TMGEL
Sbjct  84   LATKFGVNFKDGNAEVRGDPAYVRAACEASLKRLQLDCIDLYYQHRIDTSVPIEATMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGF S+GP LVE+ SE D RK+  RF+ EN + N +L+ER+N++AA+K CTPS
Sbjct  204  VVYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFERVNEIAARKQCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQG+DVCPIPGTTK
Sbjct  264  QLALAWLHHQGDDVCPIPGTTK  285



>gb|ABK22508.1| unknown [Picea sitchensis]
Length=348

 Score =   323 bits (828),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG R     +    DPAYVRA+CEASLKRLDVECIDLYYQHRID+ +PIEVT+GEL
Sbjct  88   LATKFGARFEDGKLEVHGDPAYVRAACEASLKRLDVECIDLYYQHRIDQKVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLS+G  L+ENL++ D RK+ PRF AEN E+N  ++ERI ++A+KK C+PS
Sbjct  208  VPYSPLGRGFLSAGAKLIENLADDDFRKDMPRFSAENLEKNKVIFERILEIASKKRCSPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDV PIPGTTK
Sbjct  268  QLALAWVHHQGNDVAPIPGTTK  289



>ref|XP_006487492.1| PREDICTED: probable aldo-keto reductase 3-like isoform X3 [Citrus 
sinensis]
Length=265

 Score =   320 bits (820),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggrgicg-DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI     G    DPAYVRA CEAS+KRLD++CIDLYYQHR+D  IPIEVT+GELK
Sbjct  7    LATKFGISFADGGKIRGDPAYVRACCEASVKRLDIDCIDLYYQHRVDTKIPIEVTIGELK  66

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEA A+TIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGIV
Sbjct  67   KLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIV  126

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AY PLG+GFLSSGP LVE+ S+ D RK  P+FQAEN E N  L+ER+N++A +KGCTP+Q
Sbjct  127  AYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQ  186

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LALAW+HHQG+DVCPIPGTTK
Sbjct  187  LALAWVHHQGDDVCPIPGTTK  207



>ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus]
 gb|KGN53050.1| hypothetical protein Csa_4G012460 [Cucumis sativus]
Length=342

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISFADGKREIRGDPAYVRAACEASLKRLDVGCIDLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE L + D RK+ PRFQ EN E N  ++E+++ +A +KGCT S
Sbjct  204  VAYSPLGRGFFSSGPKLVEGLEDNDFRKHLPRFQGENLEHNKTVFEKVSAIAERKGCTTS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_004975286.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=348

 Score =   323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  107  DPAYVRAACEGSLRRLGVSCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  166

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            A+TIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF SSG  L+
Sbjct  167  AATIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGAKLI  226

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ++LSE D RKN PRFQAEN ++N  ++ER+N++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  227  DSLSEQDIRKNMPRFQAENLDKNAQVFERVNEMARRKGCTPSQLALAWVHHQGSDVCPIP  286

Query  590  GTTK  601
            GTTK
Sbjct  287  GTTK  290



>ref|XP_007034102.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
 gb|EOY05028.1| NAD(P)-linked oxidoreductase superfamily protein [Theobroma cacao]
Length=417

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG  +  G R I GDPAYVRA+CE SLKRL V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  158  LATKFGIHLTEGQREIRGDPAYVRAACEGSLKRLGVDCIDLYYQHRIDTRVPIEVTIGEL  217

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  218  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  277

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP +VE LS  D RK  PRFQ EN + N  L+E++NK+AA+K CTPS
Sbjct  278  VAYSPLGRGFLSSGPKMVETLSNDDFRKYLPRFQPENLKHNERLFEQVNKIAARKECTPS  337

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  338  QLALAWIHHQGNDVCPIPGTTK  359



>ref|XP_004975289.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=346

 Score =   322 bits (826),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCE SLKRL V+CIDLYYQHRID  +PIE+T+GELKKLVEEGKIKY+GLSEAS
Sbjct  106  DPAYVRASCEGSLKRLGVDCIDLYYQHRIDTRVPIEITVGELKKLVEEGKIKYIGLSEAS  165

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLWSRD E EIIPTCRELGIGIVAYSPLGRGFLSSGPNLV
Sbjct  166  ASTIRRAHAVHPITAVQIEWSLWSRDVEAEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  225

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
              LS+ D RK+ PRFQ EN ++N  ++E++N +A +KGCTPSQLALAW+HHQG DVCPIP
Sbjct  226  STLSDQDFRKDLPRFQPENLKKNALIFEKVNAMAVRKGCTPSQLALAWVHHQGTDVCPIP  285

Query  590  GTTK  601
            GTTK
Sbjct  286  GTTK  289



>ref|XP_010929910.1| PREDICTED: probable aldo-keto reductase 2 [Elaeis guineensis]
Length=342

 Score =   322 bits (826),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIEVTMGEL
Sbjct  83   LATKFGISYADGKREIRGDPAYVRAACEASLKRLGIDCIDLYYQHRIDTRVPIEVTMGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  +  +LS+ D RK+ PRFQ EN EQN  ++ER+N++A +KGCTPS
Sbjct  203  VAYSPLGRGFFSAGLKMANSLSDQDFRKSMPRFQPENLEQNAVIFERVNEMAKRKGCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  263  QLALAWVHHQGSDVCPIPGTTK  284



>ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus]
Length=342

 Score =   322 bits (826),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CEASLKRLDV+CI+LYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISFADGKREIRGDPAYVRAACEASLKRLDVDCINLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE L + D RK+ PRFQ EN E N  ++E+++ +A +KGCT S
Sbjct  204  VAYSPLGRGFFSSGPKLVEGLEDNDFRKHLPRFQGENLEHNKTVFEKVSAIAERKGCTTS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>gb|KCW57707.1| hypothetical protein EUGRSUZ_H00466 [Eucalyptus grandis]
Length=347

 Score =   322 bits (826),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS G  LVENLS+ D R+  PRF+ EN   N  L++R+N++A +KGCTPS
Sbjct  207  VAYSPLGRGFLSVGSKLVENLSKDDFRQYLPRFRPENLAHNTKLFDRVNEIAQRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  267  QLALAWVHHQGDDVCPIPGTTK  288



>gb|KDO50053.1| hypothetical protein CISIN_1g019368mg [Citrus sinensis]
Length=342

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggrgic-gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI     G   GDPAYVRA CEASLKRLD++CIDLYYQHR+D  IPIEVT+GELK
Sbjct  84   LATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDCIDLYYQHRVDTKIPIEVTIGELK  143

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEA A+TIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGIV
Sbjct  144  KLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIV  203

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AY PLG+GFLSSGP LVE+ S+ D RK  P+FQAEN E N  L+ER+N++A +KGCTP+Q
Sbjct  204  AYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQ  263

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LALAW+HHQG+DVCPIPGTTK
Sbjct  264  LALAWVHHQGDDVCPIPGTTK  284



>gb|KCW57735.1| hypothetical protein EUGRSUZ_H00487 [Eucalyptus grandis]
Length=344

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+        + GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  IPIEV++GEL
Sbjct  85   LATKFGLGFTDGKWEVRGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTRIPIEVSIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E EI+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYVGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEAEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L+ENLS+ D R+N PRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  205  VAYSPLGRGFFSVGSKLLENLSKDDFRQNLPRFQPENLAHNAKLFDRVNEIAQRKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_010069403.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW57737.1| hypothetical protein EUGRSUZ_H00489 [Eucalyptus grandis]
Length=344

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+        + GDPAYVRA+CEASLKRLDV+CIDLYYQHRID  IPIEV++GEL
Sbjct  85   LATKFGLGFTDGKWEVRGDPAYVRAACEASLKRLDVDCIDLYYQHRIDTRIPIEVSIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E EI+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYVGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEAEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L+ENLS+ D R+N PRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  205  VAYSPLGRGFFSVGSKLLENLSKDDFRQNLPRFQPENLAHNAKLFDRVNEIAQRKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_006358803.1| PREDICTED: probable aldo-keto reductase 4-like [Solanum tuberosum]
Length=349

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 172/203 (85%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFGI     G      DP YVRASCEASLKRLDV CIDLYYQHRID  +PIE+TMGE
Sbjct  88   LATKFGINASADGKIEIIGDPCYVRASCEASLKRLDVNCIDLYYQHRIDTRVPIEITMGE  147

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKI+Y+GLSEAS STIRRAH +HP+TAVQLEWSLWSRD EEEIIP CRELGIG
Sbjct  148  LKKLVEEGKIRYIGLSEASGSTIRRAHEVHPITAVQLEWSLWSRDVEEEIIPICRELGIG  207

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLG+GFLSSGP L+E+LS  D RK+ PRFQAEN E N  LY+RI ++A KKGCTP
Sbjct  208  IVAYSPLGKGFLSSGPKLLEDLSNEDFRKHIPRFQAENLEHNKILYKRICQMATKKGCTP  267

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+HHQGNDV PIPGTTK
Sbjct  268  SQLALAWVHHQGNDVFPIPGTTK  290



>ref|XP_008222724.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
 ref|XP_008222725.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
Length=343

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG  +    R + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGIYLVDKKREVRGDPAYVRAAAEDSLKRLGVDSVDLYYQHRIDTTVPIEVTVGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAE EI+PTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG   V+NLS  D RK+HPRFQ+EN E N  L+ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAEFVKNLSHDDSRKDHPRFQSENVEHNKALFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>ref|XP_002460689.1| hypothetical protein SORBIDRAFT_02g033230 [Sorghum bicolor]
 gb|EER97210.1| hypothetical protein SORBIDRAFT_02g033230 [Sorghum bicolor]
Length=349

 Score =   322 bits (824),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCE SL+RL V+CIDLYYQHRID  +PIEVT+GELKKLV EGKIKY+GLSEAS
Sbjct  108  DPAYVRASCEGSLQRLGVDCIDLYYQHRIDSKVPIEVTVGELKKLVAEGKIKYIGLSEAS  167

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD E +IIPTCRELGIGIVAYSPLGRGFLSSGP LV
Sbjct  168  ASTIRRAHAVHPITAVQLEWSLWSRDVETDIIPTCRELGIGIVAYSPLGRGFLSSGPKLV  227

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            + LS+ D RK+ PRFQ EN E+N  ++E++N +AA+KGCTPSQLALAW+HHQG DVCPIP
Sbjct  228  DTLSDQDFRKDLPRFQPENMEKNAVIFEKVNAMAARKGCTPSQLALAWVHHQGPDVCPIP  287

Query  590  GTTK  601
            GTTK
Sbjct  288  GTTK  291



>ref|XP_010069398.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=347

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R + GDPAYVRA+CEASLKRL+V+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  88   LATKFGAVIGDGKREVRGDPAYVRAACEASLKRLEVDCIDLYYQHRVDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+G+SEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGMSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L+EN SE D R+  PRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  208  VAYSPLGRGFFSVGSKLLENFSEDDFRQKLPRFQPENLAHNAKLFDRVNEIAQRKGCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  268  QLALAWVHHQGNDVCPIPGTTK  289



>ref|NP_001052494.1| Os04g0338000 [Oryza sativa Japonica Group]
 sp|Q7XT99.2|AKR2_ORYSJ RecName: Full=Probable aldo-keto reductase 2 [Oryza sativa Japonica 
Group]
 emb|CAE01603.2| OSJNBa0008A08.11 [Oryza sativa Japonica Group]
 emb|CAE03308.2| OSJNBa0032I19.2 [Oryza sativa Japonica Group]
 dbj|BAF14408.1| Os04g0338000 [Oryza sativa Japonica Group]
 gb|EAZ30267.1| hypothetical protein OsJ_14315 [Oryza sativa Japonica Group]
 dbj|BAG88057.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94289.1| unnamed protein product [Oryza sativa Japonica Group]
Length=351

 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 177/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDPAYVRA+CE SL+RL V+ IDLYYQHR+DK +PIEVT+GEL
Sbjct  90   LATKFGIAFEDGKRDVRGDPAYVRAACEGSLRRLGVDSIDLYYQHRVDKKVPIEVTIGEL  149

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  150  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  209

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  LVE+LS+ D RK+ PRFQ EN E+N  ++ER+N +AA+KGCTPS
Sbjct  210  VAYSPLGRGFFSAGAKLVESLSDQDFRKHIPRFQQENLEKNAEIFERVNAMAARKGCTPS  269

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  270  QLALAWVHHQGSDVCPIPGTTK  291



>ref|XP_007222406.1| hypothetical protein PRUPE_ppa008145mg [Prunus persica]
 gb|EMJ23605.1| hypothetical protein PRUPE_ppa008145mg [Prunus persica]
Length=343

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG         + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGIHFAEKKMEVRGDPAYVRAAAEDSLKRLGVDSVDLYYQHRIDTTVPIEVTVGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG   VENLS+ D RK HPRFQ EN E N  L+ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAKFVENLSQNDSRKLHPRFQPENVEHNKTLFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>ref|XP_006487220.1| PREDICTED: probable aldo-keto reductase 2-like isoform X1 [Citrus 
sinensis]
 gb|KDO47915.1| hypothetical protein CISIN_1g018998mg [Citrus sinensis]
Length=347

 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLDV+CIDLYYQHRID   PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRAACEASLKRLDVDCIDLYYQHRIDTQTPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG  L 
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGSKLA  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+LSE D RK+ PRFQ  N E N  L+E +N++AA KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  221  ESLSEGDYRKHLPRFQPGNLEHNQKLFECVNEIAANKGCTPSQLALAWVHHQGDDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_010069386.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=346

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREIRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS G  LVENLS+ D R+  PRF+ EN   N  L++R+N++A +KGCTPS
Sbjct  207  VAYSPLGRGFLSVGSKLVENLSKDDFRQYLPRFRPENLAHNTKLFDRVNEIAQRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  267  QLALAWVHHQGDDVCPIPGTTK  288



>ref|XP_006487490.1| PREDICTED: probable aldo-keto reductase 3-like isoform X1 [Citrus 
sinensis]
Length=342

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggrgic-gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI     G   GDPAYVRA CEAS+KRLD++CIDLYYQHR+D  IPIEVT+GELK
Sbjct  84   LATKFGISFADGGKIRGDPAYVRACCEASVKRLDIDCIDLYYQHRVDTKIPIEVTIGELK  143

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEA A+TIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGIV
Sbjct  144  KLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIV  203

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AY PLG+GFLSSGP LVE+ S+ D RK  P+FQAEN E N  L+ER+N++A +KGCTP+Q
Sbjct  204  AYGPLGQGFLSSGPKLVESFSKYDFRKCMPKFQAENLEHNKKLFERVNEIAMRKGCTPAQ  263

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LALAW+HHQG+DVCPIPGTTK
Sbjct  264  LALAWVHHQGDDVCPIPGTTK  284



>ref|XP_008454009.1| PREDICTED: probable aldo-keto reductase 2 [Cucumis melo]
Length=344

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 172/203 (85%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFG      G      DPAYVRA+CEASLKRLDVECIDLYYQHRID  +P+EVT+GE
Sbjct  84   LATKFGNTFADDGKREIRGDPAYVRAACEASLKRLDVECIDLYYQHRIDTRVPVEVTIGE  143

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIG
Sbjct  144  LKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIG  203

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGF SSGP LV+ L + D RK  PRFQ EN E N  ++E+++ +A +KGCT 
Sbjct  204  IVAYSPLGRGFFSSGPKLVQALQDNDFRKELPRFQGENLEHNKTVFEKVSAMAERKGCTT  263

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+HHQG+DVCPIPGTTK
Sbjct  264  SQLALAWVHHQGDDVCPIPGTTK  286



>sp|A2XRZ0.1|AKR2_ORYSI RecName: Full=Probable aldo-keto reductase 2 [Oryza sativa Indica 
Group]
 emb|CAH66623.1| OSIGBa0115A19.4 [Oryza sativa Indica Group]
 gb|EAY93600.1| hypothetical protein OsI_15387 [Oryza sativa Indica Group]
Length=351

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 178/202 (88%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G RG+ GDPAYVRA+CE SL+RL V+ IDLYYQHR+DK +PIEVT+GEL
Sbjct  90   LATKFGIAFEDGKRGVRGDPAYVRAACEGSLRRLGVDSIDLYYQHRVDKKVPIEVTIGEL  149

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  150  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  209

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  LVE+LS+ D RK+ PRFQ EN E+N  ++ER+N +AA+KGCTPS
Sbjct  210  VAYSPLGRGFFSAGAKLVESLSDQDFRKHIPRFQQENLEKNAEIFERVNAMAARKGCTPS  269

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  270  QLALAWVHHQGSDVCPIPGTTK  291



>ref|XP_002436875.1| hypothetical protein SORBIDRAFT_10g010420 [Sorghum bicolor]
 gb|EER88242.1| hypothetical protein SORBIDRAFT_10g010420 [Sorghum bicolor]
Length=355

 Score =   321 bits (823),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    LATKFgirgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKK  181
            LATKFGI    R + GDPAYVRA+CEASL+RL V+CIDLYYQHRID  +P+EVT+GELKK
Sbjct  96   LATKFGITPELRTVRGDPAYVRAACEASLRRLGVDCIDLYYQHRIDTTVPVEVTIGELKK  155

Query  182  LVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVA  361
            LVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAE++I+PTCRELGIGIVA
Sbjct  156  LVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDAEQDIVPTCRELGIGIVA  215

Query  362  YSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQL  541
            YSPLGRGF SSG  L+ +L + D RKN PRFQ EN E+N  ++ER++++AA+KGCT SQL
Sbjct  216  YSPLGRGFFSSGAKLISDLPDDDFRKNLPRFQPENMEKNALIFERVSQMAARKGCTSSQL  275

Query  542  ALAWLHHQGNDVCPIPGTTK  601
            ALAW+HHQG+DVCPIPGTTK
Sbjct  276  ALAWVHHQGSDVCPIPGTTK  295



>ref|XP_009334075.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Pyrus x 
bretschneideri]
Length=345

 Score =   321 bits (822),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG         + GDPAYVRA+ E+SLKRL V+ IDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGLRFVENKMEVQGDPAYVRAALESSLKRLGVDSIDLYYQHRIDNSVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGI
Sbjct  147  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SG   VENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPS
Sbjct  207  VAYSPLGRGFFASGAKFVENLAHDDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>gb|ABR16883.1| unknown [Picea sitchensis]
Length=345

 Score =   321 bits (822),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+R          DPAYVRA+CEASLKRLDVECIDLYYQHRID+ +PIEVT+GEL
Sbjct  88   LATKFGVRFEDGKQEVHGDPAYVRAACEASLKRLDVECIDLYYQHRIDQKVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDGEEEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLS+G  L+ENL++ D RK+ PRF AEN E+N  ++ERI ++A+KK CTPS
Sbjct  208  VPYSPLGRGFLSAGAKLIENLADGDFRKDMPRFSAENLEKNKVIFERILEIASKKRCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+ HQGNDV PIPGTTK
Sbjct  268  QLALAWVDHQGNDVAPIPGTTK  289



>ref|XP_006392128.1| hypothetical protein EUTSA_v10023573mg [Eutrema salsugineum]
 gb|ESQ29414.1| hypothetical protein EUTSA_v10023573mg [Eutrema salsugineum]
Length=345

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCEASLKRLDVECIDLYYQHRID  +PIE+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRASCEASLKRLDVECIDLYYQHRIDTSVPIEITMGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGIVAYSPLG+GF +SGP LV
Sbjct  164  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGIVAYSPLGKGFFASGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E L + D RK  PRFQ EN + N  LYE++  ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ETLDKDDFRKRLPRFQQENLDHNKILYEKVCVMSEKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTT+
Sbjct  284  GTTR  287



>ref|XP_007222412.1| hypothetical protein PRUPE_ppa008163mg [Prunus persica]
 gb|EMJ23611.1| hypothetical protein PRUPE_ppa008163mg [Prunus persica]
Length=343

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF        R + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISFADNKREVRGDPAYVRAAIEGSLKRLGVDSVDLYYQHRIDTRVPIEVTVGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG NLVENL   D RK  PRFQAEN E N  ++ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGANLVENLPNDDFRKYLPRFQAENLEHNKTIFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>ref|NP_176268.1| probable aldo-keto reductase 3 [Arabidopsis thaliana]
 sp|O22707.1|ALKR3_ARATH RecName: Full=Probable aldo-keto reductase 3 [Arabidopsis thaliana]
 gb|AAB71981.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
 gb|AEE33720.1| NAD(P)-linked oxidoreductase superfamily protein [Arabidopsis 
thaliana]
Length=345

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  86   LATKFGISYAEGNREIKGDPAYVRAACEASLKRLDVTCIDLYYQHRIDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKL+EEGKIKY+GLSEASASTIRRAH +HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  146  KKLIEEGKIKYIGLSEASASTIRRAHTVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V+YSPLGRGF +SGP LVENL   D RK  PRFQ EN + N  LYE+++ ++ KKGCTP+
Sbjct  206  VSYSPLGRGFFASGPKLVENLDNNDFRKALPRFQQENLDHNKILYEKVSAMSEKKGCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_002303002.2| hypothetical protein POPTR_0002s23530g [Populus trichocarpa]
 gb|EEE82275.2| hypothetical protein POPTR_0002s23530g [Populus trichocarpa]
Length=343

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIE TMGEL
Sbjct  84   LATKFGVSFKDGNAEVRGDPAYVRAACEASLKRLQLDCIDLYYQHRIDTSVPIEATMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGF S+GP LVE+ SE D RK+  RF+ EN + N  L+ER+N++AA+K CT S
Sbjct  204  VVYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRQLFERVNEIAARKQCTSS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQG+DVCPIPGTTK
Sbjct  264  QLALAWLHHQGDDVCPIPGTTK  285



>ref|XP_002886596.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62855.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+T+GELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEASLKRLDVTCIDLYYQHRIDTRVPIEITLGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TA+Q+EWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF +SGPNLV
Sbjct  164  ASTIRRAHAVHPITALQIEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGPNLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL   D RK  PRFQ EN   N  L+E+++ ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENLDNNDVRKTLPRFQQENLVHNKILFEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_007222405.1| hypothetical protein PRUPE_ppa008144mg [Prunus persica]
 gb|EMJ23604.1| hypothetical protein PRUPE_ppa008144mg [Prunus persica]
Length=343

 Score =   320 bits (821),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG  +    R + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT GEL
Sbjct  84   LATKFGIYLADKKRAVRGDPAYVRAAAEDSLKRLGVDSVDLYYQHRIDTTVPIEVTAGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG   VENLS  D RK+HPRFQ EN E N  L+ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAKFVENLSHDDSRKDHPRFQPENVEHNKALFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>gb|KCW57713.1| hypothetical protein EUGRSUZ_H004702, partial [Eucalyptus grandis]
Length=300

 Score =   318 bits (816),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG  +  G R I GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIRLADGKREIQGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L EN S+ D R+ HPRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  207  VAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFQPENLAHNTKLFDRVNEIAQRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH G+D+CPIPGTTK
Sbjct  267  QLALAWVHHHGDDICPIPGTTK  288



>ref|XP_002886601.1| ARF-GAP domain 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62860.1| ARF-GAP domain 2 [Arabidopsis lyrata subsp. lyrata]
Length=346

 Score =   320 bits (820),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLD+ CIDLYYQHR+D  +PIE+TMGELKKLVEEGKI Y+GLSEAS
Sbjct  105  DPEYVRAACEASLKRLDIACIDLYYQHRVDTRVPIEITMGELKKLVEEGKINYIGLSEAS  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLWSRDAEE+IIPTCRELGIGIVAYSPLGRGFL+SGP L 
Sbjct  165  ASTIRRAHAVHPITAVQIEWSLWSRDAEEDIIPTCRELGIGIVAYSPLGRGFLASGPKLA  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL + D RK  PRFQ EN + N  L+E+++ ++AKKGC+P+QLALAW+HHQG DVCPIP
Sbjct  225  ENLEDDDFRKTLPRFQQENLDHNKILFEKVSAMSAKKGCSPAQLALAWVHHQGADVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>ref|XP_006388518.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 ref|XP_006388519.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 gb|ERP47432.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
 gb|ERP47433.1| hypothetical protein POPTR_0166s00200g [Populus trichocarpa]
Length=343

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG            DP YVRA+CEASLKRL +E IDLYYQHRID  +PIE TMGEL
Sbjct  84   LATKFGASFKDGSFEVRGDPDYVRAACEASLKRLQLESIDLYYQHRIDTSVPIEATMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE+L++ D RK  PRF+ EN E N  L+ER+N++AA+K CT S
Sbjct  204  VAYSPLGRGFFSSGPKLVESLTDGDYRKGLPRFRPENLEHNTQLFERVNEIAARKQCTSS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_009334074.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Pyrus x 
bretschneideri]
Length=358

 Score =   320 bits (821),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E+SLKRL V+ IDLYYQHRID  +PIEVT+GELKKLVEEGK+KY+GLSEAS
Sbjct  118  DPAYVRAALESSLKRLGVDSIDLYYQHRIDNSVPIEVTVGELKKLVEEGKVKYIGLSEAS  177

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGIVAYSPLGRGF +SG   V
Sbjct  178  ASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFASGAKFV  237

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  238  ENLAHDDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  297

Query  590  GTTK  601
            GTTK
Sbjct  298  GTTK  301



>ref|XP_006392133.1| hypothetical protein EUTSA_v10023904mg [Eutrema salsugineum]
 dbj|BAJ33645.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29419.1| hypothetical protein EUTSA_v10023904mg [Eutrema salsugineum]
Length=345

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCEASLKRLDVECIDLYYQHRID  +PIE+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRASCEASLKRLDVECIDLYYQHRIDTCVPIEITMGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD E++I+PTCRELGIGIVAYSPLG+GF +SGP LV
Sbjct  164  ASTIRRAHAVHPITAVQLEWSLWARDVEDDIVPTCRELGIGIVAYSPLGKGFFASGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RK  PRFQ EN + N  LYE++  ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENLNNNDFRKRLPRFQQENLDHNKILYEKVCAMSEKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTT+
Sbjct  284  GTTR  287



>ref|XP_010553616.1| PREDICTED: probable aldo-keto reductase 4 isoform X2 [Tarenaya 
hassleriana]
Length=345

 Score =   320 bits (819),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVR +CEASL+RL V+CIDLYYQHRID  +PIE+TMGEL
Sbjct  85   LATKFGISYSEGKREIKGDPAYVRFACEASLRRLGVDCIDLYYQHRIDIRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYVGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP L+E L + D RKN PRFQAEN + N  LYE++  +A KKGCTP 
Sbjct  205  VAYSPLGRGFFASGPKLLEKLEQGDFRKNLPRFQAENLDHNKVLYEKVTAMAEKKGCTPG  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+H QG+DVCPIPGTTK
Sbjct  265  QLALAWVHQQGDDVCPIPGTTK  286



>ref|XP_010244068.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=341

 Score =   320 bits (819),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SLKRL V+CIDLYYQHRID  +PIEVTMGELKKL+ EGKIKY+GLSEAS
Sbjct  101  DPAYVRAACEDSLKRLQVDCIDLYYQHRIDAQVPIEVTMGELKKLIAEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RDAE+EIIPTCRELGIGIVAYSPLGRGF SSGP +V
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDAEKEIIPTCRELGIGIVAYSPLGRGFFSSGPKVV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN  + D RK  PRFQ EN + N  ++E++N +A +KGCTPSQLALAWLHHQG+DVCPIP
Sbjct  221  ENFGDKDFRKILPRFQPENLDHNNYVFEKVNDIAVRKGCTPSQLALAWLHHQGSDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_009113189.1| PREDICTED: probable aldo-keto reductase 4 isoform X1 [Brassica 
rapa]
Length=345

 Score =   320 bits (819),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G   I GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  86   LATKFGFTYGEGNTEIKGDPAYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HPVTAVQ+EWSLWSRD EE+IIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQIEWSLWSRDVEEDIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP L+ENL + D RK  PRFQ EN + N  +YE +  ++ KKGCTP 
Sbjct  206  VAYSPLGRGFFASGPKLLENLGQNDFRKALPRFQQENVDHNKIVYENVCAMSEKKGCTPG  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_010473254.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   320 bits (819),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  85   LATKFGISYAEGKREVRGDPAYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEA AS+IRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYVGLSEACASSIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRFQ EN + N  +YE++  ++ KKGCTP+
Sbjct  205  VAYSPLGRGFFASGPKLVENLDKDDFRKALPRFQEENLDNNKIVYEKVCAISEKKGCTPA  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_008244437.1| PREDICTED: probable aldo-keto reductase 2 [Prunus mume]
Length=343

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF        R + GDPAYVRA+ E SL+RL V+ +DLYYQHRID  IPIEVT+GEL
Sbjct  84   LATKFGISFADNKREVRGDPAYVRAAIEGSLQRLGVDSVDLYYQHRIDTRIPIEVTVGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG NLVENL   D RK  PRFQAEN E N  ++ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGANLVENLPNDDFRKYLPRFQAENLEHNKTIFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>ref|XP_002266277.1| PREDICTED: probable aldo-keto reductase 2 [Vitis vinifera]
Length=341

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CE SLKRL+V+CIDLYYQHRID  +PIEVTMGEL
Sbjct  83   LATKFGVIIKDGKFEVRGDPAYVRAACEGSLKRLEVDCIDLYYQHRIDTRLPIEVTMGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAEE+IIPTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWARDAEEDIIPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS G  + ENLS  D RK  PRFQ EN E N  L+ER+ ++A +KGCT S
Sbjct  203  VAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFERVKEIATRKGCTTS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  263  QLALAWVHHQGDDVCPIPGTTK  284



>emb|CBI39434.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   318 bits (816),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CE SLKRL+V+CIDLYYQHRID  +PIEVTMGEL
Sbjct  58   LATKFGVIIKDGKFEVRGDPAYVRAACEGSLKRLEVDCIDLYYQHRIDTRLPIEVTMGEL  117

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAEE+IIPTCRELGIGI
Sbjct  118  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWARDAEEDIIPTCRELGIGI  177

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS G  + ENLS  D RK  PRFQ EN E N  L+ER+ ++A +KGCT S
Sbjct  178  VAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFERVKEIATRKGCTTS  237

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  238  QLALAWVHHQGDDVCPIPGTTK  259



>ref|XP_004296671.1| PREDICTED: probable aldo-keto reductase 2-like [Fragaria vesca 
subsp. vesca]
Length=342

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF        R + GDPAYVRA+CEASLKRL + CIDLYYQHRID  +PIEVT+GEL
Sbjct  83   LATKFGISFADNKREVRGDPAYVRAACEASLKRLGLNCIDLYYQHRIDTRLPIEVTVGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG   VENL+  D RK  PRFQ EN E N +++ER++ +A +KGCT S
Sbjct  203  VAYSPLGRGFLSSGAKFVENLANDDFRKFLPRFQGENLEHNKSIFERVSDLATRKGCTSS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  263  QLALAWVHHQGNDVCPIPGTTK  284



>ref|XP_003621684.1| Aldo-keto reductase yakc [Medicago truncatula]
 gb|ABN08808.1| Aldo/keto reductase [Medicago truncatula]
 gb|ACJ84900.1| unknown [Medicago truncatula]
 gb|AES77902.1| aldo/keto reductase family oxidoreductase [Medicago truncatula]
 gb|AES77917.2| aldo/keto reductase family oxidoreductase [Medicago truncatula]
Length=339

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+R G       GDP YVR +CE SLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  82   LATKFGVRAGDGKFEICGDPGYVREACEGSLKRLDIDCIDLYYQHRIDTRLPIEVTIGEL  141

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  142  KKLVEEGKIKYIGLSEASAATIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  201

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  L++NL + D RK+ PRFQ EN +QN  +++++N++A KKGCTP 
Sbjct  202  VAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDKVNELATKKGCTPP  261

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQGNDVCPIPGTTK
Sbjct  262  QLALAWLHHQGNDVCPIPGTTK  283



>ref|XP_009113187.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=391

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLDV+CIDLYYQHRID  +PIE+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  150  DPLYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEITMGELKKLVEEGKIKYIGLSEAS  209

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF +SGP LV
Sbjct  210  ASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGPKLV  269

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E L + D RK  PRFQ EN + N  +YE++  ++ KKGCTP QLALAW+HHQG+DVCPIP
Sbjct  270  EKLDQNDFRKTLPRFQQENLDHNKIMYEKVCAMSEKKGCTPGQLALAWVHHQGDDVCPIP  329

Query  590  GTTK  601
            GTTK
Sbjct  330  GTTK  333



>ref|XP_010673286.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=343

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI    G   I GDPAYVRA+CE SLKRLD++CIDLYYQHRID  +PIEVTMGEL
Sbjct  84   LATKFGIRYTDGKGEILGDPAYVRAACEGSLKRLDIDCIDLYYQHRIDTKVPIEVTMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSGP + EN  + D R++ PRF+ EN E N  ++ER++ +A +KGCTP+
Sbjct  204  VAYSPLGRGFLSSGPKMTENFVKEDFRQHLPRFKPENLEHNKLIFERVSAIATRKGCTPA  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>gb|KCW57729.1| hypothetical protein EUGRSUZ_H004811, partial [Eucalyptus grandis]
Length=271

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF     GG   + GDPAYVRA+CEASLKRLDV+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  12   LATKFGISFTGGKAEVRGDPAYVRAACEASLKRLDVDCIDLYYQHRVDTRVPIEVTIGEL  71

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKL+EEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E EI+PTCRELGIGI
Sbjct  72   KKLIEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEAEIVPTCRELGIGI  131

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L E+ SE D R++ PRFQ EN   N  L++++N++A +KGCTPS
Sbjct  132  VAYSPLGRGFFSVGSKLAESFSEDDFRRSIPRFQPENLAHNAKLFDQVNEIAQRKGCTPS  191

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  192  QLALAWVHHQGDDVCPIPGTTK  213



>ref|XP_002266027.2| PREDICTED: probable aldo-keto reductase 4 [Vitis vinifera]
Length=534

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL+V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRAACEASLKRLEVDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGIVAYSPLGRGF SSG  L+
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGIVAYSPLGRGFFSSGTKLI  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLS  D RKN PRFQ EN   N  LYER++++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  221  ENLSNNDFRKNLPRFQPENLGHNKILYERVSEIATRKGCTPSQLALAWVHHQGDDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284


 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +2

Query  194  GKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPL  373
            GKIKY+GLS ASASTIRRAHA+HP+T+VQLEWSLWSRD EE+I+PTCRELGIGIVAYS L
Sbjct  342  GKIKYIGLSAASASTIRRAHAVHPITSVQLEWSLWSRDVEEDIVPTCRELGIGIVAYSSL  401

Query  374  GRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAW  553
            GRGFLSSG  +VENLS+ D RKN PRFQ EN E N  LYER++++A +KGCTPSQLALAW
Sbjct  402  GRGFLSSGAKMVENLSDNDLRKNLPRFQPENLEHNKILYERVSEIATRKGCTPSQLALAW  461

Query  554  LHHQGNDVCPIPGTTK  601
            +HHQG+DVCP PGTTK
Sbjct  462  VHHQGDDVCPSPGTTK  477



>ref|XP_010418017.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDP YVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  85   LATKFGISYAEGKREVRGDPEYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEACASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRFQ EN + N  +YE++  ++ KKGCTP+
Sbjct  205  VAYSPLGRGFFASGPKLVENLDKDDFRKALPRFQEENLDNNKIVYEKVCAISEKKGCTPA  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>gb|KFK30953.1| hypothetical protein AALP_AA6G049000 [Arabis alpina]
Length=336

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVR +C ASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  77   LATKFGISFAEGKREIKGDPAYVREACMASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  136

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  137  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGI  196

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP +VENL   D RK  PRFQ EN + N  LYE++  ++ KKGCTP+
Sbjct  197  VAYSPLGRGFFASGPKIVENLDNNDIRKTLPRFQQENLDHNKTLYEKVCAMSEKKGCTPA  256

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  257  QLALAWVHHQGDDVCPIPGTTK  278



>ref|XP_010107237.1| hypothetical protein L484_021760 [Morus notabilis]
 gb|EXC14261.1| hypothetical protein L484_021760 [Morus notabilis]
Length=493

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  102  DPAYVRAACEASLKRLDIDCIDLYYQHRIDSRVPIEVTIGELKKLVEEGKIKYIGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+T VQLEWSLW+RD EEEIIPTCRELGIGIVAYSPLGRGF+SSGP +V
Sbjct  162  ASTIRRAHAVHPITVVQLEWSLWARDVEEEIIPTCRELGIGIVAYSPLGRGFMSSGPKIV  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E +S+ D RK  PRFQ EN + N  ++E++N++A++KGCTPSQLALAW++HQGNDVCPIP
Sbjct  222  EKMSDDDYRKTLPRFQPENLQHNQKIFEQVNEIASRKGCTPSQLALAWVYHQGNDVCPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>ref|XP_010418012.1| PREDICTED: probable aldo-keto reductase 2 [Camelina sativa]
Length=345

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF   I  G   I GDPAY RA+CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGFFIVEGKTEIRGDPAYARAACEASLKRLDVACIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRDAEE+IIPTCRELGIGI
Sbjct  146  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDAEEDIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFL+SGP LVEN+   D RK  PRFQ EN + N  L+E++  ++ KKGC+P+
Sbjct  206  VAYSPLGRGFLASGPKLVENMDNDDFRKTLPRFQQENLDHNKILFEKVCAMSEKKGCSPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTT+
Sbjct  266  QLALAWVHHQGDDVCPIPGTTR  287



>ref|XP_009378167.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=345

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+        + GDPAYVRA+ E+SLKRL V+ IDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGVRFAENKMEVQGDPAYVRAALESSLKRLGVDSIDLYYQHRIDTSVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGI
Sbjct  147  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG   VENL+  D RK+ PRFQ EN E N  L+ER++ +A +KGCTPS
Sbjct  207  VAYSPLGRGFFSSGAKFVENLAHDDSRKSLPRFQPENVEHNKTLFERVSDLATRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  267  QLALAWVHHQGNDVCPIPGTTK  288



>ref|XP_006302496.1| hypothetical protein CARUB_v10020589mg [Capsella rubella]
 gb|EOA35394.1| hypothetical protein CARUB_v10020589mg [Capsella rubella]
Length=344

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  85   LATKFGISYAEGKREIKGDPAYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEACASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF ++GP LVENL + D RK  PRFQ EN + N  +YE++  ++ KKGCTP+
Sbjct  205  VAYSPLGRGFFAAGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEKVCAISEKKGCTPA  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_010069390.1| PREDICTED: probable aldo-keto reductase 2 isoform X3 [Eucalyptus 
grandis]
 gb|KCW57712.1| hypothetical protein EUGRSUZ_H004702 [Eucalyptus grandis]
Length=346

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF   +  G R I GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGIRLADGKREIQGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L EN S+ D R+ HPRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  207  VAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFQPENLAHNTKLFDRVNEIAQRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH G+D+CPIPGTTK
Sbjct  267  QLALAWVHHHGDDICPIPGTTK  288



>ref|XP_011042806.1| PREDICTED: probable aldo-keto reductase 2, partial [Populus euphratica]
Length=298

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G   + GDPAYVRA+CEASLKRL +E IDLYYQHRID  +PIE TMGEL
Sbjct  39   LATKFGLSFNDGTFEVRGDPAYVRAACEASLKRLQLESIDLYYQHRIDTSVPIEATMGEL  98

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELG+GI
Sbjct  99   KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGVGI  158

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSP GRGF SSGP LVE+L++ D RK  PRF+ EN + N  L+ER+N++AA+K CT S
Sbjct  159  VAYSPPGRGFFSSGPKLVESLTDGDFRKGLPRFRPENLDHNTQLFERVNEIAARKQCTSS  218

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  219  QLALAWVHHQGDDVCPIPGTTK  240



>ref|XP_010069392.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57724.1| hypothetical protein EUGRSUZ_H00477 [Eucalyptus grandis]
Length=347

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    G R I GDPAYVRA+CEASLK LD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  88   LATKFGVRYADGKREIQGDPAYVRAACEASLKHLDIDCIDLYYQHRIDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRFQ EN   N  L++R+N+VA +KGCTPS
Sbjct  208  VAYSPLGRGFFSVGSKLVENISKDDVRQKQPRFQPENLAHNTKLFDRVNEVARRKGCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+D+CPIPGTTK
Sbjct  268  QLALAWVHHQGDDICPIPGTTK  289



>ref|XP_006392127.1| hypothetical protein EUTSA_v10023574mg [Eutrema salsugineum]
 gb|ESQ29413.1| hypothetical protein EUTSA_v10023574mg [Eutrema salsugineum]
Length=345

 Score =   318 bits (816),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLDV+ IDLYYQHRID  +PIE+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPLYVRAACEASLKRLDVKSIDLYYQHRIDTRVPIEITMGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGIVAYSPLGRGF +SGP LV
Sbjct  164  ASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL   D RK  PRFQ EN + N  LYE++  ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENLENNDFRKTLPRFQQENLDHNKILYEKVCAMSEKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_002302899.2| hypothetical protein POPTR_0002s23510g [Populus trichocarpa]
 gb|EEE82172.2| hypothetical protein POPTR_0002s23510g [Populus trichocarpa]
Length=344

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG           GDP YVRA+CEASLKRL +E IDLYYQHRID  +PIE TMGEL
Sbjct  85   LATKFGASFKDGSFEIRGDPDYVRAACEASLKRLQLESIDLYYQHRIDTSVPIEATMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE+ ++ D RK  PRFQ EN E N  L+ER+ ++AA+K CT S
Sbjct  205  VAYSPLGRGFFSSGPKLVESFTDGDYRKGLPRFQPENLEHNSQLFERVKEIAARKQCTSS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_010069389.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=346

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREVRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  207  VAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFQPENLAHNTKLFDRVNEIAQRKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH G+D+CPIPGTTK
Sbjct  267  QLALAWVHHHGDDICPIPGTTK  288



>ref|XP_002886599.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62858.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  86   LATKFGISYAEGKREIKGDPAYVRAACEASLKRLDVSCIDLYYQHRIDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEAS STIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASGSTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V+YSPLGRGF +SGP LVENL   D RK  PRFQ EN + N  LYE++  ++ KKGC+P 
Sbjct  206  VSYSPLGRGFFASGPKLVENLVNNDFRKALPRFQQENLDHNKILYEKVCAISKKKGCSPG  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>gb|ABK21001.1| unknown [Picea sitchensis]
 gb|ABK23757.1| unknown [Picea sitchensis]
Length=348

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVRASCEASLKRLDV+CIDLYYQHRID  +PIEVT+GE+
Sbjct  88   LATKFGISFADGKREIRGDPAYVRASCEASLKRLDVDCIDLYYQHRIDTRVPIEVTIGEM  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLW+RD EE IIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWTRDVEEAIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLS G  LV+NL++ D RK  PRF AEN E+N  ++ERI ++A+KKGC+PS
Sbjct  208  VPYSPLGRGFLSIGAKLVDNLADNDFRKLMPRFSAENLEKNKVIFERICEIASKKGCSPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDV PIPGTTK
Sbjct  268  QLALAWVHHQGNDVAPIPGTTK  289



>ref|XP_003575317.1| PREDICTED: probable aldo-keto reductase 2 [Brachypodium distachyon]
Length=348

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA+CE SL+RL V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  107  EPAYVRAACEGSLERLGVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKIKYIGLSEAS  166

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD E++IIPTCRELGIGIVAYSPLGRGF SSGP LV
Sbjct  167  ASTIRRAHAVHPITAVQLEWSLWSRDVEKDIIPTCRELGIGIVAYSPLGRGFFSSGPKLV  226

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E LS+ D RK+ PRFQAEN E+N  ++ER++ +A++KGCT SQLALAW+HHQG DVCPIP
Sbjct  227  ETLSDQDFRKDLPRFQAENLEKNTMIFERVSAMASRKGCTASQLALAWVHHQGRDVCPIP  286

Query  590  GTTK  601
            GTTK
Sbjct  287  GTTK  290



>ref|XP_006652179.1| PREDICTED: probable aldo-keto reductase 2-like [Oryza brachyantha]
Length=344

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 176/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CE SL+RL V+CIDLYYQHRID  +PIEVT+GEL
Sbjct  85   LATKFGISFADGKREIRGDPAYVRAACEGSLRRLGVDCIDLYYQHRIDTRLPIEVTIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  LV++LS+ D RK+ PRF+ EN E+N  ++ER+N +A +KGCTPS
Sbjct  205  VAYSPLGRGFFSSGAKLVDSLSDQDFRKHIPRFRPENLEKNAEIFERVNSMANRKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGSDVCPIPGTTK  286



>gb|KFK22426.1| hypothetical protein AALP_AAs39864U000400 [Arabis alpina]
Length=346

 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG            DPA+VR +CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  87   LATKFGNTCTDGKFEVRGDPAFVRTACEASLKRLDVPCIDLYYQHRVDTRVPIEITMGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GL EASASTIRRAHA+HP+TAVQLEWSLW+RDAEEEI+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLCEASASTIRRAHAVHPITAVQLEWSLWTRDAEEEIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAY PLGRGF ++GP LVE     D RK HPRFQ EN + N  LYE+++ ++ KKGCTP+
Sbjct  207  VAYGPLGRGFFAAGPKLVEKFGNNDSRKAHPRFQPENLDHNKILYEKVSAMSEKKGCTPA  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQG+DVCPIPGTTK
Sbjct  267  QLALAWLHHQGDDVCPIPGTTK  288



>ref|XP_010510916.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   318 bits (815),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  85   LATKFGISYAEGKREVRGDPAYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEACASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVE L + D RK  PRFQ EN + N  +YE++  ++ KKGCTP+
Sbjct  205  VAYSPLGRGFFASGPKLVEKLDKNDFRKALPRFQEENLDNNKIVYEKVCAISEKKGCTPA  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>dbj|BAK02817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 176/200 (88%), Gaps = 1/200 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKK  181
            LATKFGI         +PAYVRA+CEASL RL V+CIDLYYQHRIDK++P+E+TMGE+KK
Sbjct  87   LATKFGITVTREISG-NPAYVRAACEASLARLGVDCIDLYYQHRIDKNVPVEITMGEIKK  145

Query  182  LVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVA  361
            LV+EGK+KYVGLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVA
Sbjct  146  LVQEGKVKYVGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGIVA  205

Query  362  YSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQL  541
            YSPLGRGFLS+GP L++ + + D RKN PRFQ EN ++N  ++ER++++AA+KGCT SQL
Sbjct  206  YSPLGRGFLSTGPKLMDTVRDDDFRKNLPRFQPENLKKNAAIFERVSEMAARKGCTSSQL  265

Query  542  ALAWLHHQGNDVCPIPGTTK  601
            ALAW+HH+G DVCPIPGTTK
Sbjct  266  ALAWVHHRGTDVCPIPGTTK  285



>ref|XP_010251376.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=342

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA CEASLKRL  +CIDLYYQHR+DK +PIEVTM ELKKLVEEGKIKYVGLSEA 
Sbjct  101  DPEYVRACCEASLKRLQADCIDLYYQHRVDKRVPIEVTMEELKKLVEEGKIKYVGLSEAC  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG   V
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGKKFV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL++ D RK  PRFQ EN E N +++ER+N++AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  221  DNLADDDFRKLLPRFQPENLEHNNSIFERVNELAARKGCTPSQLALAWVHHQGNDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_010533925.1| PREDICTED: probable aldo-keto reductase 4 [Tarenaya hassleriana]
Length=340

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVR++CEASL+RL VECIDLYYQHRID  +PIE+TMGELKKLVEEGKI+YVGLSEAS
Sbjct  104  DPAYVRSACEASLRRLGVECIDLYYQHRIDTRVPIEITMGELKKLVEEGKIQYVGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+P CRELGIGIVAYSPLGRGF +SGP L+
Sbjct  164  ASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPACRELGIGIVAYSPLGRGFFASGPKLL  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E L + D RK+ PRFQAEN + N  +YE++  +A KK CTP QLALAW+HHQGNDVCPIP
Sbjct  224  EKLEQGDYRKDLPRFQAENVDHNKVMYEKVTSMAEKKQCTPGQLALAWVHHQGNDVCPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_002518605.1| aldo/keto reductase, putative [Ricinus communis]
 gb|EEF43747.1| aldo/keto reductase, putative [Ricinus communis]
Length=342

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+  + G   I GDP YVRA+CEASLKRL V+CIDLYYQHRID  IPIE+TMGEL
Sbjct  83   LATKFGVCFQDGKSEIKGDPGYVRAACEASLKRLLVDCIDLYYQHRIDTSIPIEITMGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+QLEWSLWS+D EEEI+PTCRELGIGI
Sbjct  143  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQLEWSLWSKDIEEEIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GFLS G  LVE   E D RK  P+FQ EN E N +L+ER+NK+AA+K CTPS
Sbjct  203  VAYSPLGQGFLSLGTKLVETFKEGDVRKYLPKFQPENVEHNKHLFERVNKMAARKQCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  263  QLALAWVHHQGDDVCPIPGTTK  284



>gb|KHN06048.1| Putative aldo-keto reductase 2 [Glycine soja]
Length=344

 Score =   317 bits (813),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF   I  G R   GDPA+VR SC  SLKRL ++CIDLYYQHR+D  +PIEVT+GEL
Sbjct  83   LATKFGINIAEGKREARGDPAFVRESCYGSLKRLGIDCIDLYYQHRVDTRVPIEVTIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLV+EGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  143  KKLVKEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  L+ENL++ D R+  PRFQ EN EQN  ++ERIN++AAKK CTPS
Sbjct  203  VAYSPLGRGFLSSGTKLLENLTKEDYRQRLPRFQPENLEQNKTIFERINELAAKKRCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  263  QLALAWVHHQGKDVCPIPGTTK  284



>ref|XP_010069393.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
Length=347

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 175/202 (87%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgi--rgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    G R I GDPAYVRA+CEASLK LD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  88   LATKFGVRYADGKREIQGDPAYVRAACEASLKHLDIDCIDLYYQHRIDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRFQ EN   N  L++R+N++A +KGCTPS
Sbjct  208  VAYSPLGRGFFSVGSKLVENISKDDVRQKLPRFQPENLAHNAKLFDRVNEIAQRKGCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+D+CPIPGTTK
Sbjct  268  QLALAWVHHQGDDICPIPGTTK  289



>ref|XP_011073936.1| PREDICTED: auxin-induced protein PCNT115-like [Sesamum indicum]
Length=353

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF        +    DPAYVRA+CEASLKRLDV+CIDLYY HRID  +PIEVTMGEL
Sbjct  96   LATKFAAMHKDGKMEIRGDPAYVRAACEASLKRLDVDCIDLYYVHRIDTRVPIEVTMGEL  155

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEAS STIRRAHAIHP+TAVQ EWSLWSRD EEE++P CRELGIGI
Sbjct  156  KKLVEEGKIKYIGLSEASVSTIRRAHAIHPITAVQNEWSLWSRDLEEELVPACRELGIGI  215

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLSSGP L++NLSE D RK  PRFQAEN E N  +YERI ++AA+KGCT S
Sbjct  216  VPYSPLGRGFLSSGPKLIQNLSEGDFRKIFPRFQAENLEHNKLVYERICEMAARKGCTSS  275

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DV PIPGTTK
Sbjct  276  QLALAWVHHQGDDVSPIPGTTK  297



>ref|XP_010040399.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW45246.1| hypothetical protein EUGRSUZ_L01102 [Eucalyptus grandis]
Length=344

 Score =   317 bits (813),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI   G      GDPAYVRA CEASLKRLDV+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  85   LATKFGISFTGGKAEIRGDPAYVRAGCEASLKRLDVDCIDLYYQHRVDTRVPIEVTIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKL+EEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E EI+PTCRELGIGI
Sbjct  145  KKLIEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEAEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L E+ SE D R++ PRFQ EN   N  L++++N++A +KGCTPS
Sbjct  205  VAYSPLGRGFFSVGSKLAESFSEDDFRRSLPRFQPENLAHNAKLFDQVNEIAQRKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|NP_564761.1| probable aldo-keto reductase 4 [Arabidopsis thaliana]
 sp|Q93ZN2.1|ALKR4_ARATH RecName: Full=Probable aldo-keto reductase 4 [Arabidopsis thaliana]
 gb|AAL08296.1| At1g60710/F8A5_23 [Arabidopsis thaliana]
 gb|AAM20506.1| auxin-induced protein, putative [Arabidopsis thaliana]
 gb|AAN15570.1| auxin-induced protein, putative [Arabidopsis thaliana]
 emb|CAE55217.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33722.1| probable aldo-keto reductase 4 [Arabidopsis thaliana]
Length=345

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DP YVRA+CEASLKRLD+ CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWTRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRFQ EN + N  +YE++  ++ KKGCTP 
Sbjct  206  VAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEKVCAISEKKGCTPG  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_008379247.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Malus domestica]
Length=351

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E+SLKRL V+ IDLYYQHRID  +PIEVT+ ELKKLVEEGK+KY+GLSEAS
Sbjct  111  DPAYVRAALESSLKRLGVDSIDLYYQHRIDTSVPIEVTVXELKKLVEEGKVKYIGLSEAS  170

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGIVAYSPLGRGF +SG   V
Sbjct  171  ASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFASGAKFV  230

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  231  ENLAHGDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  290

Query  590  GTTK  601
            GTTK
Sbjct  291  GTTK  294



>ref|XP_006392126.1| hypothetical protein EUTSA_v10024059mg [Eutrema salsugineum]
 gb|ESQ29412.1| hypothetical protein EUTSA_v10024059mg [Eutrema salsugineum]
Length=345

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG            DPAYVRA+CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGATYAEGKREVRGDPAYVRAACEASLKRLDVACIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCREL IGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELRIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVE L   D RK  PRFQ EN + N  LYE++  ++ KKGCTP+
Sbjct  206  VAYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYEKVCAMSEKKGCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_010042438.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=348

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFg--irgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R I GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  89   LATKFGIRFADGKREIQGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  148

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  149  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  208

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PR Q EN   N  L++R+N++A +KGCTPS
Sbjct  209  VAYSPLGRGFFSVGSKLVENISKDDVRQYLPRLQPENLAHNTKLFDRVNEIAQRKGCTPS  268

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  269  QLALAWVHHQGDDVCPIPGTTK  290



>ref|XP_003568949.1| PREDICTED: probable aldo-keto reductase 2 [Brachypodium distachyon]
Length=348

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V+CIDLYYQHRID  +PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  108  DPAYVRAACEGSLQRLGVDCIDLYYQHRIDTTVPIEVTMGELKKLVEEGKIKYIGLSEAS  167

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            A+TIRRAHAIHP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAY PLG GF SSGP LV
Sbjct  168  ATTIRRAHAIHPITAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYCPLGGGFFSSGPKLV  227

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            + LSE D RK  PRFQAEN E+N  ++E ++ +AA+KGCT SQLALAW+HHQG+DVCPIP
Sbjct  228  DTLSEQDLRKGLPRFQAENLEKNTMVFEHVSAMAARKGCTTSQLALAWVHHQGSDVCPIP  287

Query  590  GTTK  601
            GTTK
Sbjct  288  GTTK  291



>ref|XP_008379248.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Malus domestica]
Length=341

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E+SLKRL V+ IDLYYQHRID  +PIEVT+ ELKKLVEEGK+KY+GLSEAS
Sbjct  101  DPAYVRAALESSLKRLGVDSIDLYYQHRIDTSVPIEVTVXELKKLVEEGKVKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGIVAYSPLGRGF +SG   V
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFASGAKFV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  221  ENLAHGDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>gb|KCW57727.1| hypothetical protein EUGRSUZ_H00480 [Eucalyptus grandis]
Length=343

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLDV+CIDLYYQH ID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  102  DPVYVRAACEASLKRLDVDCIDLYYQHCIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+T VQLEWSLWSRD E EIIPTCRELGIGIVAYSPLGRGF S G  L+
Sbjct  162  ASTIRRAHAVHPITVVQLEWSLWSRDVEAEIIPTCRELGIGIVAYSPLGRGFFSVGSKLL  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN SE D R+  PRFQ EN   N  L++R+N++A +KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  222  ENFSEDDFRQKLPRFQPENLAHNAKLFDRVNEIAQRKGCTPSQLALAWVHHQGNDVCPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>ref|XP_004975288.1| PREDICTED: probable aldo-keto reductase 3-like [Setaria italica]
Length=345

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    LATKFgirgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKK  181
            L+TKFGI    R + GDPAYVRA+CE SL+RL VECIDLYYQHRID  +P+E T+GELKK
Sbjct  87   LSTKFGITPDLREVRGDPAYVRAACEGSLRRLSVECIDLYYQHRIDTTVPVEATIGELKK  146

Query  182  LVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVA  361
            LVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E++IIPTCRELGIGIVA
Sbjct  147  LVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEQDIIPTCRELGIGIVA  206

Query  362  YSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQL  541
            YSPLGRGF SSG  LV  L + D RKN PRFQ EN E+N  ++ER++ +AA+KGCT SQL
Sbjct  207  YSPLGRGFFSSGAKLVNELPDGDFRKNLPRFQPENLEKNALIFERVSAMAARKGCTTSQL  266

Query  542  ALAWLHHQGNDVCPIPGTTK  601
            ALAW+HHQG+DVCPIPGTTK
Sbjct  267  ALAWVHHQGSDVCPIPGTTK  286



>ref|XP_010069396.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=344

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF     GG   + GDPAYVRA+CEASLKRLDV+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  85   LATKFGISFTGGKAEVRGDPAYVRAACEASLKRLDVDCIDLYYQHRVDTRVPIEVTIGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKL+EEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E EI+PTCRELGIGI
Sbjct  145  KKLIEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEAEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L E+ SE D R++ PRFQ EN   N  L++++N++A +KGCTPS
Sbjct  205  VAYSPLGRGFFSVGSKLAESFSEDDFRRSIPRFQPENLAHNAKLFDQVNEIAQRKGCTPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_009371115.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=343

 Score =   317 bits (812),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E SLKRL ++ +DLYYQHR+D  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  102  DPAYVRAAIEGSLKRLGIDSVDLYYQHRVDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG NLV
Sbjct  162  ASTIRRAHAVHPITAVQLEWSLWARDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGANLV  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+  D RK  PRFQAEN E N  ++ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  222  DNLANDDFRKYLPRFQAENLEHNKTVFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>gb|AFW75369.1| LOW QUALITY PROTEIN: putative oxidoreductase, aldo/keto reductase 
family protein [Zea mays]
Length=345

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +          GDPAYVRA+CEASLKRL ++CIDLYYQHRIDK +PIEVT+GEL
Sbjct  87   LATKFAVSFADGKREIRGDPAYVRAACEASLKRLGIDCIDLYYQHRIDKKVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRDAEE+IIPTCRELGIGI
Sbjct  147  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF  SG  LV++LSE D RK+ PR Q EN  +N  ++E +N +AAKKGCTPS
Sbjct  207  VAYSPLGRGFFCSGAKLVDSLSEQDFRKHMPRLQPENIVKNAKIFEHVNAMAAKKGCTPS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH GNDVCPIPGTTK
Sbjct  267  QLALAWVHH-GNDVCPIPGTTK  287



>ref|NP_176267.3| probable aldo-keto reductase 2 [Arabidopsis thaliana]
 sp|Q84M96.1|ALKR2_ARATH RecName: Full=Probable aldo-keto reductase 2; AltName: Full=ARF-GAP 
domain-containing protein 2 [Arabidopsis thaliana]
 gb|AAP21270.1| At1g60680 [Arabidopsis thaliana]
 dbj|BAE99526.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33719.1| probable aldo-keto reductase 2 [Arabidopsis thaliana]
Length=346

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLD+ CIDLYYQHRID  +PIE+TM ELKKLVEEGKIKY+GLSEAS
Sbjct  105  DPEYVRAACEASLKRLDIACIDLYYQHRIDTRVPIEITMRELKKLVEEGKIKYIGLSEAS  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLWSRDAEE+IIP CRELGIGIVAYSPLGRGFL++GP L 
Sbjct  165  ASTIRRAHAVHPITAVQIEWSLWSRDAEEDIIPICRELGIGIVAYSPLGRGFLAAGPKLA  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL   D RK  PRFQ EN + N  L+E+++ +A KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  225  ENLENDDFRKTLPRFQQENVDHNKILFEKVSAMAEKKGCTPAQLALAWVHHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>ref|XP_010475965.1| PREDICTED: probable aldo-keto reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010475966.1| PREDICTED: probable aldo-keto reductase 1 isoform X2 [Camelina 
sativa]
Length=344

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL+RL V CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEASLRRLGVSCIDLYYQHRIDTTVPIEVTIGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF ++GP  +
Sbjct  164  ASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFAAGPKFI  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+   D RK  PRFQ EN + N  LYE++N +A KK CTP+QLALAW+HHQGNDVCPIP
Sbjct  224  ENMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPAQLALAWVHHQGNDVCPIP  283

Query  590  GTTK  601
            GT+K
Sbjct  284  GTSK  287



>ref|XP_010069391.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW57708.1| hypothetical protein EUGRSUZ_H00467 [Eucalyptus grandis]
Length=346

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+          GDPAYVRA+CEASL+RL ++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGVSFADGKREIRGDPAYVRAACEASLRRLHIDCIDLYYQHRIDTRVPIEVTVGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVENLS+ D R+N PRFQ EN   N  L++R+N++A +KGCT S
Sbjct  207  VAYSPLGRGFFSVGSKLVENLSKDDFRQNQPRFQPENLAHNMKLFDRVNEIAQRKGCTTS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+H+QG+DVCPIPGTTK
Sbjct  267  QLALAWVHYQGDDVCPIPGTTK  288



>ref|NP_001169979.1| uncharacterized protein LOC100383880 [Zea mays]
 gb|ACN35424.1| unknown [Zea mays]
Length=350

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V CIDLYYQHRID  +PIEVT+GELKKLV EGKIKY+GLSEAS
Sbjct  109  DPAYVRAACEGSLQRLGVGCIDLYYQHRIDNRVPIEVTVGELKKLVAEGKIKYIGLSEAS  168

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP++AVQLEWSLWSRD E +IIPTCRELGIGIVAYSPLGRGFLSSGP +V
Sbjct  169  ASTIRRAHAVHPISAVQLEWSLWSRDVEADIIPTCRELGIGIVAYSPLGRGFLSSGPTMV  228

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            + LS+ D RK  PRFQ EN E+N  ++ER+N +AA+KGCTPSQLALAW+HHQG DVCPIP
Sbjct  229  DKLSDQDFRKELPRFQPENLEKNAVIFERVNAMAARKGCTPSQLALAWVHHQGADVCPIP  288

Query  590  GTTK  601
            GTTK
Sbjct  289  GTTK  292



>ref|XP_009113191.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=344

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLDV+CIDLYYQHRID  +PIE+TMGE+KKLVEEGKIKY+GLSEAS
Sbjct  103  DPFYVRAACEASLKRLDVDCIDLYYQHRIDARVPIEITMGEMKKLVEEGKIKYIGLSEAS  162

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAH++HP+TAVQLEWSLW+RDAEEE+IPTCRELGIGIVAYSPLGRGF ++GP L+
Sbjct  163  ASTIRRAHSVHPITAVQLEWSLWTRDAEEEVIPTCRELGIGIVAYSPLGRGFFAAGPKLL  222

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+   D RK  PRFQ EN   N  LYE++  ++ KKGCTP+QLALAWLHHQG+DVCPIP
Sbjct  223  ENIENNDYRKTLPRFQPENLVHNKILYEKVCAMSEKKGCTPAQLALAWLHHQGDDVCPIP  282

Query  590  GTTK  601
            GTTK
Sbjct  283  GTTK  286



>ref|NP_564762.2| probable aldo-keto reductase 5 [Arabidopsis thaliana]
 sp|Q9ASZ9.1|ALKR5_ARATH RecName: Full=Probable aldo-keto reductase 5 [Arabidopsis thaliana]
 gb|AAK32744.1|AF361576_1 At1g60730/F8A5_24 [Arabidopsis thaliana]
 gb|AAM70571.1| At1g60730/F8A5_24 [Arabidopsis thaliana]
 gb|AEE33724.1| probable aldo-keto reductase 5 [Arabidopsis thaliana]
Length=345

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL R+DV CIDLYYQHRID  +PIE+T+GELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEASLMRVDVACIDLYYQHRIDTRVPIEITIGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TA+Q+EWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF +SGP LV
Sbjct  164  ASTIRRAHAVHPITALQIEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL   D RK  PRFQ EN + N  L+E+++ ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENLDNNDVRKTLPRFQQENLDHNKILFEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_010510924.1| PREDICTED: probable aldo-keto reductase 3 isoform X2 [Camelina 
sativa]
Length=344

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  85   LATKFGISYVEGKREIKGDPAYVRAACEASLKRLDVACIDLYYQHRVDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEACASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAY PLGRGF +SGP LVENL + D RK  PRFQ EN + N  L+E++  ++ KKGCTP 
Sbjct  205  VAYCPLGRGFFASGPKLVENLDKDDFRKALPRFQQENLDHNKILFEKVFAMSEKKGCTPG  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>gb|KFK30952.1| hypothetical protein AALP_AA6G048900 [Arabis alpina]
Length=345

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG            DPAYVR +CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGAVYAEGKREVRGDPAYVRTACEASLKRLDVSCIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELG GI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGSGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVE L   D RK  PRFQ EN + N  LYE++  ++ KKGCTP+
Sbjct  206  VAYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYEKVCAMSEKKGCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>gb|EYU32745.1| hypothetical protein MIMGU_mgv1a009439mg [Erythranthe guttata]
Length=342

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVR++CEASLKRL+V+CIDLYY HRID  +PIEVTMGELKKLVEEGKIKYVGLSEAS
Sbjct  102  EPAYVRSACEASLKRLEVDCIDLYYVHRIDTRVPIEVTMGELKKLVEEGKIKYVGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ EWSLW+RD EEEI+PTCRELGIGIV YSPLGRGFLS GP L+
Sbjct  162  ASTIRRAHAVHPITAVQNEWSLWARDVEEEIVPTCRELGIGIVPYSPLGRGFLSVGPTLI  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLSE D RK  PRFQ EN E N  +YERI+++A +KGCTPSQLALAW+HHQG+DV PIP
Sbjct  222  ENLSEDDFRKKFPRFQGENLEANKLVYERISEMAKEKGCTPSQLALAWVHHQGDDVSPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>ref|XP_003527298.1| PREDICTED: probable aldo-keto reductase 2-like isoform 1 [Glycine 
max]
Length=344

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF   I  G R   GDPA+VR SC  SLKRL ++CIDLYYQHR+D  +PIEVT+GEL
Sbjct  83   LATKFGINIAEGKREARGDPAFVRESCYGSLKRLGIDCIDLYYQHRVDTRVPIEVTIGEL  142

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLV+EGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGI
Sbjct  143  KKLVKEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGI  202

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLSSG  L+ENL++ D R+  PRFQ EN EQN  ++ERI+++AAKK CTPS
Sbjct  203  VAYSPLGRGFLSSGTKLLENLTKEDYRQRLPRFQPENLEQNKTIFERIDELAAKKRCTPS  262

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  263  QLALAWVHHQGKDVCPIPGTTK  284



>gb|ABR92332.1| putative aldo/keto reductase 2 [Salvia miltiorrhiza]
Length=342

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVR+SCE+SLKRLDV+CIDLYY HRID  +PIE+TMGEL
Sbjct  84   LATKFGIINRDGKGEVHGDPAYVRSSCESSLKRLDVDCIDLYYVHRIDTSVPIEITMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+Q EWSLWSRD EEE++P CRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQNEWSLWSRDLEEELVPACRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLS GP L++NL E D RK  PRF+AEN E N  +YE+I+++A +KGCTPS
Sbjct  204  VTYSPLGRGFLSVGPKLIQNLPEGDFRKIFPRFKAENLEANKVVYEKISEMATRKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  264  QLALAWVHHQGDDVCPIPGTTK  285



>ref|XP_010069388.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57710.1| hypothetical protein EUGRSUZ_H00469 [Eucalyptus grandis]
Length=346

 Score =   316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREVRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRF+ EN   N  L++R+N++A +KGCT S
Sbjct  207  VAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFRPENLAHNTKLFDRVNEIAQRKGCTTS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+D+CPIPGTTK
Sbjct  267  QLALAWVHHQGDDICPIPGTTK  288



>ref|XP_009371118.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=343

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E SLKRL ++ +DLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  102  DPAYVRAAIEGSLKRLGIDSVDLYYQHRIDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG N V
Sbjct  162  ASTIRRAHAVHPITAVQLEWSLWARDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGANFV  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+  D RK  PRFQAEN E N  ++ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  222  DNLANDDFRKYLPRFQAENLEHNKTVFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>emb|CAN80303.1| hypothetical protein VITISV_011600 [Vitis vinifera]
Length=353

 Score =   316 bits (809),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CE SLKRL+V+CIDLYYQHRID  +PIEVTMGEL
Sbjct  95   LATKFGVIIKDGKFEVRGDPAYVRAACEGSLKRLEVDCIDLYYQHRIDTRLPIEVTMGEL  154

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KK VEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLW+RDAEE+IIPTCRELGIGI
Sbjct  155  KKXVEEGKIKYIGLSEAFASTIRRAHAVHPITAVQLEWSLWARDAEEDIIPTCRELGIGI  214

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS G  + ENLS  D RK  PRFQ EN E N  L+ER+ ++A +KGCT S
Sbjct  215  VAYSPLGRGFLSLGAKVAENLSNDDYRKTLPRFQPENIEHNNILFERVKEIATRKGCTTS  274

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  275  QLALAWVHHQGDDVCPIPGTTK  296



>gb|KHN06049.1| Putative aldo-keto reductase 2 [Glycine soja]
Length=343

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVR +CE SLKRL ++CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRDACEGSLKRLGIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGIVAYSPLGRGFLS G  L+
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGIVAYSPLGRGFLSLGTKLL  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL++ D R+  PRFQ EN EQN  ++ R+N++AAKK CTPSQLAL+W+HHQG DVCPIP
Sbjct  221  ENLAQDDFRQTLPRFQPENLEQNKTIFARVNELAAKKRCTPSQLALSWVHHQGKDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>dbj|BAJ95968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   317 bits (813),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 176/200 (88%), Gaps = 1/200 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKK  181
            LATKFGI         +PAYVRA+CEASL RL V+CIDLYYQHRIDK++P+E+TMGE+KK
Sbjct  142  LATKFGITVTREISG-NPAYVRAACEASLARLGVDCIDLYYQHRIDKNVPVEITMGEIKK  200

Query  182  LVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVA  361
            LV+EGK+KYVGLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVA
Sbjct  201  LVQEGKVKYVGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGIVA  260

Query  362  YSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQL  541
            YSPLGRGFLS+GP L++ + + D RKN PRFQ EN ++N  ++ER++++AA+KGCT SQL
Sbjct  261  YSPLGRGFLSTGPKLMDTVRDDDFRKNLPRFQPENLKKNAAIFERVSEMAARKGCTSSQL  320

Query  542  ALAWLHHQGNDVCPIPGTTK  601
            ALAW+HH+G DVCPIPGTTK
Sbjct  321  ALAWVHHRGTDVCPIPGTTK  340



>ref|XP_004975284.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=346

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggr-gicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI  GG   + GDPAYVRA+CE SL+RL V CIDLYYQ RID  +PIEVTMGELK
Sbjct  88   LATKFGISSGGGWEVRGDPAYVRAACEGSLRRLGVGCIDLYYQLRIDTTVPIEVTMGELK  147

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEASASTIRRAH +HP++AVQLEWS+WSRD EE+IIPTCRELGIGIV
Sbjct  148  KLVEEGKIKYIGLSEASASTIRRAHGVHPISAVQLEWSIWSRDVEEDIIPTCRELGIGIV  207

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AYSPLGRGFLS G  L+++LSE D RKN PRF+ EN ++N  ++ER+N +A +KGCTPSQ
Sbjct  208  AYSPLGRGFLSGGAKLIDSLSEQDARKNFPRFRPENLDKNAQIFERVNAMATRKGCTPSQ  267

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LALAW+HHQG+DVCPIPGTTK
Sbjct  268  LALAWVHHQGSDVCPIPGTTK  288



>ref|XP_010069397.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010040396.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW45247.1| hypothetical protein EUGRSUZ_L01103 [Eucalyptus grandis]
 gb|KCW57726.1| hypothetical protein EUGRSUZ_H00479 [Eucalyptus grandis]
Length=347

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R + GDPAYVRA+CEASLKRL+V+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  88   LATKFGAVIGDGKREVRGDPAYVRAACEASLKRLEVDCIDLYYQHRVDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+G+SEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGMSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN S+ D R+  PR Q EN   N  L++R+N++A +KGCTPS
Sbjct  208  VAYSPLGRGFFSVGSKLVENFSKDDFRQYLPRLQPENLAHNAKLFDRVNEIAQRKGCTPS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  268  QLALAWVHHQGDDVCPIPGTTK  289



>ref|XP_009113193.1| PREDICTED: probable aldo-keto reductase 3 [Brassica rapa]
Length=347

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG            DPAYVR +CEASLKRLDV CIDLYYQHR+D  +PIE+TMGEL
Sbjct  87   LATKFGATYAEGKREVRGDPAYVRVACEASLKRLDVACIDLYYQHRVDTRLPIEITMGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HPVTAVQLEWSLW+RD EE+I+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQLEWSLWTRDVEEDIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V+YSPLGRGF +SGP LVE L   D RK  PRFQ EN + N  LY+++  ++ KKGCTP+
Sbjct  207  VSYSPLGRGFFASGPKLVEKLDNDDFRKTLPRFQQENLDHNKILYDKVCAMSEKKGCTPA  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  267  QLALAWVHHQGDDVCPIPGTTK  288



>gb|ABK22828.1| unknown [Picea sitchensis]
Length=349

 Score =   315 bits (807),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+        I GDP YVRA+CEASLKRLDV+CIDLYYQHRID  +PIEVT GE+
Sbjct  87   LATKFGVSFADGKPDIRGDPGYVRAACEASLKRLDVDCIDLYYQHRIDTKVPIEVTTGEM  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RDAEEEIIPTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDAEEEIIPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGFLSSG  LVENL + D RK  P+F+AEN E+N   +E+I ++A++KGC+P 
Sbjct  207  VPYSPLGRGFLSSGAKLVENLKDNDFRKALPKFRAENLERNNVTFEKICEIASRKGCSPG  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDV PIPGTTK
Sbjct  267  QLALAWIHHQGNDVSPIPGTTK  288



>ref|XP_008380430.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=339

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+ E SLKRL V  +DLYYQHR+D  +PIEVT+GE+
Sbjct  84   LATKFGISFADNKREIRGDPAYVRAAIEGSLKRLGVGSVDLYYQHRVDTRVPIEVTVGEM  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG   V+NL+  D RK  PRFQAEN E N  ++ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAKFVDNLANDDFRKYLPRFQAENLEHNKTIFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>gb|AAF17106.1|AF057715_1 auxin-induced atb2 [Arabidopsis thaliana]
Length=345

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDP YVRA+CEA  KRLD+ CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGISYAEGKREVRGDPEYVRAACEAKFKRLDIACIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWTRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRFQ EN + N  +YE++  ++ KKGCTP 
Sbjct  206  VAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQEENLDHNKIVYEKVCAISEKKGCTPG  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>ref|XP_006653275.1| PREDICTED: probable aldo-keto reductase 3-like, partial [Oryza 
brachyantha]
Length=349

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 173/200 (87%), Gaps = 0/200 (0%)
 Frame = +2

Query  2    LATKFgirgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKK  181
            LATKFGI      + GDPAYVRA+CE SL+RL V C+DLYYQHRID  +P+E+TMGELKK
Sbjct  90   LATKFGITPEMDRVRGDPAYVRAACEGSLRRLGVGCVDLYYQHRIDPTVPVEITMGELKK  149

Query  182  LVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVA  361
            LVEEGKI+Y+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRD E++I+PTCRELGIGIVA
Sbjct  150  LVEEGKIRYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDVEQDIVPTCRELGIGIVA  209

Query  362  YSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQL  541
            YSPLGRGF SSG  L++ L + D R+N PRFQ EN E+N  ++ER++ +AA+KGCTPSQL
Sbjct  210  YSPLGRGFFSSGAKLMDELPDDDFRRNLPRFQPENLEKNAAIFERVSAMAARKGCTPSQL  269

Query  542  ALAWLHHQGNDVCPIPGTTK  601
            ALAW+HH+G DVCPIPGTTK
Sbjct  270  ALAWVHHRGADVCPIPGTTK  289



>ref|XP_008222728.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2 [Prunus mume]
Length=343

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI        + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISFADNKPEVRGDPAYVRAAIEGSLKRLGVDSVDLYYQHRIDTRVPIEVTVGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKVKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  L ENL   D RK  PRFQAEN E N  ++ER++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAKLFENLPNDDVRKYLPRFQAENLEHNKTIFERVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGND CPIPGTTK
Sbjct  264  QLALAWVHHQGNDXCPIPGTTK  285



>ref|XP_002886597.1| hypothetical protein ARALYDRAFT_475260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62856.1| hypothetical protein ARALYDRAFT_475260 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DP YVRA+CEASLKRLD+ CIDLYYQHR+D  +PIE+TMGEL
Sbjct  86   LATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQHRVDTRVPIEITMGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEIIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRF  +N + N  +YE++  ++ KKGCTP+
Sbjct  206  VAYSPLGRGFFASGPKLVENLEKDDFRKALPRFLEKNLDHNKIVYEKVCAISEKKGCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  266  QLALAWVHHQGDDVCPIPGTTK  287



>gb|KCW57720.1| hypothetical protein EUGRSUZ_H00474 [Eucalyptus grandis]
Length=304

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG     G R + GDPAYVRA+CEASLKRL+V+CIDLYYQHR+D  +PIEVT+GEL
Sbjct  45   LATKFGAVIGDGKREVRGDPAYVRAACEASLKRLEVDCIDLYYQHRVDTRVPIEVTIGEL  104

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+G+SEASASTIRRAHA+HP+TAVQLEWSLWSRD E EIIPTCRELGIGI
Sbjct  105  KKLVEEGKIKYIGMSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIIPTCRELGIGI  164

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L EN S+ D R+  PR Q EN   N  L++R+N++A +KGCTPS
Sbjct  165  VAYSPLGRGFFSVGSKLAENFSKDDFRQYLPRLQPENLAHNAKLFDRVNEIAQRKGCTPS  224

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  225  QLALAWVHHQGDDVCPIPGTTK  246



>gb|AAB84222.1| auxin-induced protein [Helianthus annuus]
Length=338

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL V+CIDLYYQHRID  +PIE+TMGELK+LVEEGKIKYVGLSEAS
Sbjct  100  DPAYVRAACEASLKRLYVDCIDLYYQHRIDTRVPIEITMGELKELVEEGKIKYVGLSEAS  159

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAH++HP+TA+QLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF +SG  ++
Sbjct  160  ASTIRRAHSVHPITAIQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGSKMM  219

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E L + D R N PRFQ EN E N  LYER++++A+KKGCT SQLALAW+HHQGNDV PIP
Sbjct  220  EKLEDGDYRPNFPRFQPENLEHNKILYERVSEIASKKGCTTSQLALAWVHHQGNDVVPIP  279

Query  590  GTTK  601
            GTTK
Sbjct  280  GTTK  283



>gb|ABK24562.1| unknown [Picea sitchensis]
Length=348

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SLKRLDV+CIDLYYQHR+D  +PIEVT+GE+KKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEESLKRLDVDCIDLYYQHRVDTKVPIEVTIGEMKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHAIHP+TAVQLEWSLWSRDAEEEIIPTCRELGIGIV YSPLGRGFLSSG  L+
Sbjct  164  ASTIRRAHAIHPITAVQLEWSLWSRDAEEEIIPTCRELGIGIVPYSPLGRGFLSSGGKLL  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+L++ D RK  PRF+A+N E+N   +ERI+ +A+KKGC+P QLAL+W+HHQGNDV PIP
Sbjct  224  ESLTDSDYRKTVPRFEAKNLEKNNVAFERISDIASKKGCSPGQLALSWVHHQGNDVSPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_010040397.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=344

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKR+DV CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  103  DPMYVRAACEASLKRVDVNCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  162

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+T VQLEWSLWSRD E EIIPTCRELGIGIVAYSPLGRGF S G  L+
Sbjct  163  ASTIRRAHAVHPITVVQLEWSLWSRDVEAEIIPTCRELGIGIVAYSPLGRGFFSVGSKLL  222

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN SE D R+  PRFQ EN   N  L++R+N++A +KGCTP QLALAW+HHQG+DVCPIP
Sbjct  223  ENFSEDDFRQKLPRFQPENLAHNAKLFDRVNEIAQRKGCTPLQLALAWVHHQGDDVCPIP  282

Query  590  GTTK  601
            GTTK
Sbjct  283  GTTK  286



>ref|XP_003527296.1| PREDICTED: probable aldo-keto reductase 2-like isoform 1 [Glycine 
max]
Length=343

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVR +CE SLKRL ++CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPAYVRDACEGSLKRLGIDCIDLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGIVAYSPLGRGFLS G  L+
Sbjct  161  ASTIRRAHAVHPITAVQLEWSLWSRDVEEEIVPTCRELGIGIVAYSPLGRGFLSLGTKLL  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL++ D R+  PRFQ EN EQN  ++ R+N++AAKK CTPSQLAL+W+HHQG DVCPIP
Sbjct  221  ENLAQDDFRQTLPRFQPENLEQNKIIFARVNELAAKKRCTPSQLALSWVHHQGKDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_011042753.1| PREDICTED: probable aldo-keto reductase 2 [Populus euphratica]
Length=341

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+           DPAYVRA+CEASLKRL ++CIDLYYQHRID  +PIE TMGEL
Sbjct  84   LATKFGVNFKDGNAEVRGDPAYVRAACEASLKRLQLDCIDLYYQHRIDTSVPIEATMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSR  EEEI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRAVEEEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGF S+GP LVE+ SE D RK+  RF+ EN + N +L+ER+N++AA+K CTPS
Sbjct  204  VVYSPLGRGFFSTGPKLVESFSEGDYRKDMSRFRPENLDHNRHLFERVNEIAARKQCTPS  263

Query  536  QLALAWLHHQ--GNDVCPIPGTTK  601
            QLALAWLHH+  G+DVCPIPGTTK
Sbjct  264  QLALAWLHHRNTGDDVCPIPGTTK  287



>ref|XP_010069401.1| PREDICTED: probable aldo-keto reductase 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57719.1| hypothetical protein EUGRSUZ_H00473 [Eucalyptus grandis]
Length=346

 Score =   314 bits (804),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgi--cgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+R         GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGVRFADGKREIQGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L EN S+ D R+ HPRF+ EN   N  L++R+N++A +KGCT S
Sbjct  207  VAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFRPENLAHNTKLFDRVNEIAQRKGCTTS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH G+D+CPIPGTTK
Sbjct  267  QLALAWVHHHGDDICPIPGTTK  288



>ref|XP_010069400.1| PREDICTED: probable aldo-keto reductase 2 isoform X1 [Eucalyptus 
grandis]
Length=347

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  88   LATKFGIRFADGKREIQGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  147

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E +I+PTCRELGIGI
Sbjct  148  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEADIVPTCRELGIGI  207

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  L EN S+ D R+ HPRF+ EN   N  L++R+N++A +KGCT S
Sbjct  208  VAYSPLGRGFFSVGSKLAENFSKDDFRQYHPRFRPENLAHNTKLFDRVNEIAQRKGCTTS  267

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH G+D+CPIPGTTK
Sbjct  268  QLALAWVHHHGDDICPIPGTTK  289



>ref|XP_004975285.1| PREDICTED: probable aldo-keto reductase 2-like [Setaria italica]
Length=349

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V CIDLYYQHRID  +PIEVT+GE++KLVEEGKIKY+GLSEAS
Sbjct  108  DPAYVRAACEGSLRRLGVGCIDLYYQHRIDTRVPIEVTIGEMRKLVEEGKIKYIGLSEAS  167

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAV+LEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF SSG  L+
Sbjct  168  ASTIRRAHAVHPITAVELEWSLWTRDVEEDIIPTCRELGIGIVAYSPLGRGFFSSGAKLM  227

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ++LSE D RKN PRFQ +N ++N  ++ER++++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  228  DSLSEQDIRKNWPRFQPDNLDKNKQIFERVSEMAKRKGCTPSQLALAWVHHQGSDVCPIP  287

Query  590  GTTK  601
            GTTK
Sbjct  288  GTTK  291



>ref|XP_010491933.1| PREDICTED: probable aldo-keto reductase 1 isoform X2 [Camelina 
sativa]
Length=278

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL+RL V CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  38   DPAYVRAACEASLRRLGVSCIDLYYQHRIDTTVPIEVTIGELKKLVEEGKIKYIGLSEAS  97

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF ++GP  +
Sbjct  98   ASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFAAGPKFI  157

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+   D RK  PRFQ EN + N  LYE++N +A KK CTP+QLALAW+HHQGNDVCPIP
Sbjct  158  ENMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPAQLALAWVHHQGNDVCPIP  217

Query  590  GTTK  601
             T+K
Sbjct  218  RTSK  221



>ref|XP_003621699.1| Aldo-keto reductase yakc [Medicago truncatula]
Length=493

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+R G        DP YVR +CE SLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  82   LATKFGVRAGDGKFEICGDPGYVREACEGSLKRLDIDCIDLYYQHRIDTRLPIEVTIGEL  141

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  142  KKLVEEGKIKYIGLSEASAATIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  201

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  L++NL + D RK+ PRFQ EN +QN  +++++N++A KKGCTP 
Sbjct  202  VAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDKVNELATKKGCTPP  261

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAWLHHQGNDVCPIPGTTK
Sbjct  262  QLALAWLHHQGNDVCPIPGTTK  283


 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  194  GKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPL  373
            GKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE++IPTCRELGIGIVAYSPL
Sbjct  339  GKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDVIPTCRELGIGIVAYSPL  398

Query  374  GRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAW  553
            GRGF SSG  L++NL + D RK+ PRFQ EN +QN  +++++N++A KKGCTPSQLALAW
Sbjct  399  GRGFFSSGTKLLDNLQQDDYRKHLPRFQPENLQQNQTIFDKVNELAVKKGCTPSQLALAW  458

Query  554  LHHQGNDVCPIPGTTK  601
            LHHQGNDVCPIPGTTK
Sbjct  459  LHHQGNDVCPIPGTTK  474



>ref|XP_010673287.1| PREDICTED: probable aldo-keto reductase 4 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=538

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SLKRLDV CIDLYYQHR+D ++PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEESLKRLDVHCIDLYYQHRVDTNVPIEVTMGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TA+QLEWSLW+RD EE I+PTCRELGIGIV YSPLGRGFLSSGP LV
Sbjct  164  ASTIRRAHAVHPITAIQLEWSLWTRDVEEIIVPTCRELGIGIVTYSPLGRGFLSSGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL++ D R+  PR +AEN E N +++ER+  +A KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENLTKEDSRRFFPRLKAENIEHNAHIFERVADIATKKGCTPAQLALAWVHHQGDDVCPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287


 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +2

Query  188  EEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYS  367
            +EGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIVAYS
Sbjct  343  KEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEDIIPTCRELGIGIVAYS  402

Query  368  PLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLAL  547
            PLGRGFLSSGP + EN  + D R++ PRF+ EN E N  ++ER++ +A +KGCTP+QLAL
Sbjct  403  PLGRGFLSSGPKMTENFVKEDFRQHLPRFKPENLEHNKLIFERVSAIATRKGCTPAQLAL  462

Query  548  AWLHHQGNDVCPIPGTTK  601
            AW+HHQG+DVCPIPGTTK
Sbjct  463  AWVHHQGDDVCPIPGTTK  480



>ref|XP_009113195.1| PREDICTED: probable aldo-keto reductase 4 [Brassica rapa]
Length=345

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRLDV+CIDLYYQHRID  +PIE+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEASLKRLDVDCIDLYYQHRIDTRVPIEITMGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAV+LEWSLW+RD EE+IIPTCRELGIGIVAYSPLGRGF ++GP LV
Sbjct  164  ASTIRRAHAVHPITAVELEWSLWTRDGEEDIIPTCRELGIGIVAYSPLGRGFFAAGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E L   D RK  PRF+ EN + N  LY+++  ++ KKGCTP+QLALAW+HHQG+DVCP P
Sbjct  224  EKLDNDDFRKRLPRFKQENLDHNKILYDKVCAMSEKKGCTPAQLALAWVHHQGDDVCPSP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_006363583.1| PREDICTED: probable aldo-keto reductase 2-like isoform X2 [Solanum 
tuberosum]
Length=281

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA CEASLKRLD++CIDLYY HRID  +PIEVTMGELKKLVEEGKIKY+GLSEA 
Sbjct  41   EPAYVRACCEASLKRLDIDCIDLYYVHRIDTQLPIEVTMGELKKLVEEGKIKYIGLSEAC  100

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLW+RD EEE++PTCRELGIGIV YSPLGRGF S+G  L+
Sbjct  101  ASTIRRAHAVHPITAVQMEWSLWTRDLEEEVVPTCRELGIGIVPYSPLGRGFFSAGAKLI  160

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+L + D RKN PRF+ EN E N  ++E+IN +AA+KGCTPSQLALAW+ HQG+DVCPIP
Sbjct  161  ESLPDGDFRKNFPRFKPENFEHNKQVFEKINLMAARKGCTPSQLALAWILHQGDDVCPIP  220

Query  590  GTTK  601
            GTTK
Sbjct  221  GTTK  224



>ref|XP_010491924.1| PREDICTED: probable aldo-keto reductase 1 isoform X1 [Camelina 
sativa]
Length=345

 Score =   313 bits (801),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL+RL V CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  105  DPAYVRAACEASLRRLGVSCIDLYYQHRIDTTVPIEVTIGELKKLVEEGKIKYIGLSEAS  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF ++GP  +
Sbjct  165  ASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFAAGPKFI  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+   D RK  PRFQ EN + N  LYE++N +A KK CTP+QLALAW+HHQGNDVCPIP
Sbjct  225  ENMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPAQLALAWVHHQGNDVCPIP  284

Query  590  GTTK  601
             T+K
Sbjct  285  RTSK  288



>ref|XP_008357878.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2, partial [Malus domestica]
Length=286

 Score =   310 bits (795),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E+SLKRL V+ IDLYYQ RID  +PIEVT+GELKKLVE GK+KY+GLSEAS
Sbjct  46   DPAYVRAALESSLKRLGVDSIDLYYQXRIDTSVPIEVTVGELKKLVEXGKVKYIGLSEAS  105

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTI RAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGIVAYSPLGRGF +SG   V
Sbjct  106  ASTIXRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFTSGAKFV  165

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  166  ENLAHDDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  225

Query  590  GTTK  601
            GTTK
Sbjct  226  GTTK  229



>emb|CAE01600.2| OSJNBa0008A08.8 [Oryza sativa Japonica Group]
 emb|CAH66620.1| OSIGBa0115A19.1 [Oryza sativa Indica Group]
 gb|EEC77028.1| hypothetical protein OsI_15385 [Oryza sativa Indica Group]
Length=345

 Score =   312 bits (800),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG    G    I GDPAYVRA+CE SL+RL V+CIDLYYQHR+DK +PIEVT+GEL
Sbjct  86   LATKFGKFFAGGKPGIRGDPAYVRAACEGSLRRLGVDCIDLYYQHRVDKKVPIEVTIGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKI+Y+GL EASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  146  KKLVEEGKIRYIGLCEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GF SSG  LV++L + D RK  PRFQ  N E+N  ++ER+N++AA+KGCTPS
Sbjct  206  VAYSPLGKGFFSSGAKLVDSLPDHDFRKLIPRFQPGNIEKNAEIFERVNEMAARKGCTPS  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  266  QLALAWIHHQGRDVCPIPGTTK  287



>ref|XP_006302482.1| hypothetical protein CARUB_v10020576mg [Capsella rubella]
 gb|EOA35380.1| hypothetical protein CARUB_v10020576mg [Capsella rubella]
Length=347

 Score =   312 bits (800),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFGI     G  G   DP YVR +CEASLKRLDV CIDLYYQHRID  +PIEVTMG 
Sbjct  87   LATKFGITASEDGKFGFRGDPEYVRFACEASLKRLDVTCIDLYYQHRIDTTLPIEVTMGA  146

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRD E++IIPTCRELGIG
Sbjct  147  LKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDVEKDIIPTCRELGIG  206

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGF +SGP +VENL + D RK  PRFQ EN + N  LYE++  +A KK C+P
Sbjct  207  IVAYSPLGRGFFASGPKIVENLDQDDYRKGLPRFQQENLDNNKILYEKVQAMATKKSCSP  266

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            +QLALAW+HHQG+DVCPIPGT+K
Sbjct  267  AQLALAWVHHQGDDVCPIPGTSK  289



>ref|XP_010673285.1| PREDICTED: probable aldo-keto reductase 2 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirggg--rgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG +       + GDPAYVR +CEASLKRLDV+CIDLYYQHR+D  +PIEVTMGEL
Sbjct  80   LATKFGFKRVNGEMEVQGDPAYVREACEASLKRLDVDCIDLYYQHRVDTRVPIEVTMGEL  139

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKYVGLSEA A TIRRAHA+HP+TAVQ+EWSLW+RD EEEI+PTCRELGIGI
Sbjct  140  KKLVEEGKIKYVGLSEACAVTIRRAHAVHPITAVQMEWSLWTRDLEEEIVPTCRELGIGI  199

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S GP +VE+ +E D RKN PRF  EN E N +++ER++++AA+KGCT S
Sbjct  200  VAYSPLGRGFFSVGPKVVESFNEGDYRKNIPRFLPENLEHNKHVFERVSEMAARKGCTAS  259

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HH+G DVCPIPGT+K
Sbjct  260  QLALAWVHHRGGDVCPIPGTSK  281



>ref|XP_008367679.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
2 [Malus domestica]
Length=344

 Score =   312 bits (799),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E SLKRL ++ +DLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  103  DPAYVRAAIEGSLKRLGIDSVDLYYQHRIDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  162

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIV+YSPLGRGF SSG N+V
Sbjct  163  ASTIRRAHAVHPITAVQLEWSLWARDVEEDIIPTCRELGIGIVSYSPLGRGFFSSGANIV  222

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+  D RK  PRFQAEN E N  ++ R++  AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  223  DNLANDDFRKYLPRFQAENLEHNKTIFXRVSDXAARKGCTPSQLALAWVHHQGNDVCPIP  282

Query  590  GTTK  601
            GTTK
Sbjct  283  GTTK  286



>ref|XP_010458446.1| PREDICTED: LOW QUALITY PROTEIN: probable aldo-keto reductase 
1 [Camelina sativa]
Length=344

 Score =   312 bits (799),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL+RL V  IDLYYQHRID  +PIEVT+GELKKLVEEGKIKY GLSEAS
Sbjct  104  DPAYVRAACEASLRRLGVSSIDLYYQHRIDTTVPIEVTIGELKKLVEEGKIKYTGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF ++GP  +
Sbjct  164  ASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFAAGPKFI  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+   D RK  PRFQ EN + N  LYE++N +A KK CTP+QLALAW+HHQGNDVCPIP
Sbjct  224  ENMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPAQLALAWVHHQGNDVCPIP  283

Query  590  GTTK  601
            GT+K
Sbjct  284  GTSK  287



>ref|XP_010673288.1| PREDICTED: probable aldo-keto reductase 5 [Beta vulgaris subsp. 
vulgaris]
Length=344

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI+     I    DPAYVRA CEASLKRLDVECIDLYYQHRID  +PIEVTMGEL
Sbjct  84   LATKFGIKRVDGKIEVRGDPAYVRACCEASLKRLDVECIDLYYQHRIDTSVPIEVTMGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEAS++TIRRAHA+HP+TA+Q+EWSLWSRD EE+I+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASSATIRRAHAVHPITAIQMEWSLWSRDIEEDIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGF S GP +VE   E D RK+ PRFQ EN E N  ++ER++++AA+KGCT S
Sbjct  204  VPYSPLGRGFFSLGPKVVETYYEHDYRKDLPRFQPENLEHNKYIFERVSEMAARKGCTTS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGT K
Sbjct  264  QLALAWIHHQGGDVCPIPGTCK  285



>ref|NP_001052491.1| Os04g0337500 [Oryza sativa Japonica Group]
 sp|Q0JE32.1|AKR1_ORYSJ RecName: Full=Probable aldo-keto reductase 1 [Oryza sativa Japonica 
Group]
 sp|B8ASB2.2|AKR1_ORYSI RecName: Full=Probable aldo-keto reductase 1 [Oryza sativa Indica 
Group]
 dbj|BAF14405.1| Os04g0337500 [Oryza sativa Japonica Group]
 dbj|BAG96753.1| unnamed protein product [Oryza sativa Japonica Group]
Length=350

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 174/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG    G    I GDPAYVRA+CE SL+RL V+CIDLYYQHR+DK +PIEVT+GEL
Sbjct  91   LATKFGKFFAGGKPGIRGDPAYVRAACEGSLRRLGVDCIDLYYQHRVDKKVPIEVTIGEL  150

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKI+Y+GL EASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIGI
Sbjct  151  KKLVEEGKIRYIGLCEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIGI  210

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG+GF SSG  LV++L + D RK  PRFQ  N E+N  ++ER+N++AA+KGCTPS
Sbjct  211  VAYSPLGKGFFSSGAKLVDSLPDHDFRKLIPRFQPGNIEKNAEIFERVNEMAARKGCTPS  270

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG DVCPIPGTTK
Sbjct  271  QLALAWIHHQGRDVCPIPGTTK  292



>sp|A2XRZ6.1|AKR3_ORYSI RecName: Full=Probable aldo-keto reductase 3 [Oryza sativa Indica 
Group]
 gb|EAY93606.1| hypothetical protein OsI_15393 [Oryza sativa Indica Group]
Length=355

 Score =   312 bits (799),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V CIDLYYQHRID  +P+E+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  112  DPAYVRAACEGSLRRLGVGCIDLYYQHRIDSTVPVEITMGELKKLVEEGKIKYIGLSEAS  171

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAH +HP+TAVQ+EWSLWSRD EE+I+PTCRELGIGIVAYSPLGRGF SSG  LV
Sbjct  172  ASTIRRAHVVHPITAVQIEWSLWSRDVEEDIVPTCRELGIGIVAYSPLGRGFFSSGAKLV  231

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            + L + D RK+ PRFQ EN E+N  ++E++N +AA+KGCT SQLALAW+HHQG+DVCPIP
Sbjct  232  DELPDDDFRKSLPRFQPENLEKNAAIFEKVNAMAARKGCTSSQLALAWVHHQGSDVCPIP  291

Query  590  GTTK  601
            GTTK
Sbjct  292  GTTK  295



>ref|XP_010089803.1| hypothetical protein L484_022319 [Morus notabilis]
 gb|EXB38419.1| hypothetical protein L484_022319 [Morus notabilis]
Length=344

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 173/203 (85%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFG+R   +G      DP YVR +CEASLKRL V+CIDLYYQHRID  +PIEVT+GE
Sbjct  86   LATKFGVRFNDQGKMEVIGDPKYVREACEASLKRLGVDCIDLYYQHRIDSRLPIEVTVGE  145

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKYVGLSEASASTIRRAHA+HP+TAVQLEWSLW+RD E++IIPTCRELGIG
Sbjct  146  LKKLVEEGKIKYVGLSEASASTIRRAHAVHPITAVQLEWSLWARDVEDDIIPTCRELGIG  205

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGFLS G  LVE +S  D RKN P F+ EN E N  + +R+N++AA+KGCTP
Sbjct  206  IVAYSPLGRGFLSYGAKLVETMSNDDYRKNLPWFRPENLEHNQKIIDRLNEIAARKGCTP  265

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+HH+GNDVCPIPGTTK
Sbjct  266  SQLALAWVHHRGNDVCPIPGTTK  288



>gb|AAB71980.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
Length=340

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 163/187 (87%), Gaps = 3/187 (2%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASLKRLD+ CIDLYYQHRID  +PIE+TM ELKKLVEEGKIKY+GLSEAS
Sbjct  96   DPEYVRAACEASLKRLDIACIDLYYQHRIDTRVPIEITMRELKKLVEEGKIKYIGLSEAS  155

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLWSRDAEE+IIP CRELGIGIVAYSPLGRGFL++GP L 
Sbjct  156  ASTIRRAHAVHPITAVQIEWSLWSRDAEEDIIPICRELGIGIVAYSPLGRGFLAAGPKLA  215

Query  410  ENLSEVDRRK---NHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVC  580
            ENL   D RK     PRFQ EN + N  L+E+++ +A KKGCTP+QLALAW+HHQG+DVC
Sbjct  216  ENLENDDFRKATTTLPRFQQENVDHNKILFEKVSAMAEKKGCTPAQLALAWVHHQGDDVC  275

Query  581  PIPGTTK  601
            PIPGTTK
Sbjct  276  PIPGTTK  282



>ref|XP_009378168.1| PREDICTED: probable aldo-keto reductase 2 [Pyrus x bretschneideri]
Length=339

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+ E SLKRL V  +DLYY HR+D  +PIEVT+GE+
Sbjct  84   LATKFGISFADNKREIRGDPAYVRAAIEGSLKRLGVGSVDLYYLHRVDTRVPIEVTVGEM  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG  LV+NL+  D RK  PRFQAEN E N  ++E+++ +AA+KGCTPS
Sbjct  204  VAYSPLGRGFFSSGAKLVDNLANDDFRKYLPRFQAENLEHNKTIFEQVSDLAARKGCTPS  263

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  264  QLALAWVHHQGNDVCPIPGTTK  285



>ref|XP_009401025.1| PREDICTED: probable aldo-keto reductase 2 [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI          GDPAYVRA+CE SL+RL ++CIDLYYQHR+D  +PIEVTMGEL
Sbjct  94   LATKFGISFQDGKGEIRGDPAYVRAACEGSLQRLGIDCIDLYYQHRVDTRVPIEVTMGEL  153

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKI Y+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EE IIPTCRELGIGI
Sbjct  154  KKLVEEGKINYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEVIIPTCRELGIGI  213

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAY PLG GF SSGP +VE LSE D RK  PRFQ EN  QN  +++R++++A +KGCTPS
Sbjct  214  VAYCPLGGGFFSSGPKMVETLSEHDFRKLMPRFQPENLAQNALIFKRVSEMAKRKGCTPS  273

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  274  QLALAWVHHQGSDVCPIPGTTK  295



>ref|NP_001052497.1| Os04g0339400 [Oryza sativa Japonica Group]
 sp|Q7XQ45.2|AKR3_ORYSJ RecName: Full=Probable aldo-keto reductase 3 [Oryza sativa Japonica 
Group]
 emb|CAE03315.2| OSJNBa0032I19.9 [Oryza sativa Japonica Group]
 dbj|BAF14411.1| Os04g0339400 [Oryza sativa Japonica Group]
 emb|CAH66327.1| H0813E03.4 [Oryza sativa Indica Group]
 gb|EAZ30275.1| hypothetical protein OsJ_14323 [Oryza sativa Japonica Group]
 dbj|BAG96139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   311 bits (798),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CE SL+RL V CIDLYYQHRID  +P+E+TMGELKKLVEEGKIKY+GLSEAS
Sbjct  112  DPAYVRAACEGSLRRLGVGCIDLYYQHRIDSTVPVEITMGELKKLVEEGKIKYIGLSEAS  171

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAH +HP+TAVQ+EWSLWSRD EE+I+PTCRELGIGIVAYSPLGRGF SSG  LV
Sbjct  172  ASTIRRAHVVHPITAVQIEWSLWSRDVEEDIVPTCRELGIGIVAYSPLGRGFFSSGAKLV  231

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            + L + D RK+ PRFQ EN E+N  ++E++N +AA+KGCT SQLALAW+HHQG+DVCPIP
Sbjct  232  DELPDDDFRKSLPRFQPENLEKNAAIFEKVNAMAARKGCTSSQLALAWVHHQGSDVCPIP  291

Query  590  GTTK  601
            GTTK
Sbjct  292  GTTK  295



>ref|XP_006423739.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
 gb|ESR36979.1| hypothetical protein CICLE_v10028781mg [Citrus clementina]
Length=342

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    LATKFgirgggrgic-gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELK  178
            LATKFGI     G   GDPAYVRA CEASLKRLD++ IDLYYQHR+D  IPIEVT+GELK
Sbjct  84   LATKFGISFADGGKIRGDPAYVRACCEASLKRLDIDYIDLYYQHRVDTKIPIEVTIGELK  143

Query  179  KLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIV  358
            KLVEEGKIKY+GLSEA A+TIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGIV
Sbjct  144  KLVEEGKIKYIGLSEACAATIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGIV  203

Query  359  AYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQ  538
            AY PLG+GFLSSGP LVE+ S+ D RK  P+FQAEN E N  L+E +N++A +KGCTP+Q
Sbjct  204  AYGPLGQGFLSSGPKLVESFSKDDFRKCMPKFQAENLEHNKKLFESVNEIAMRKGCTPAQ  263

Query  539  LALAWLHHQGNDVCPIPGTTK  601
            LAL W+HHQG+DVCPIPG TK
Sbjct  264  LALGWVHHQGDDVCPIPGNTK  284



>ref|XP_010251377.1| PREDICTED: probable aldo-keto reductase 2 [Nelumbo nucifera]
Length=342

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 165/184 (90%), Gaps = 2/184 (1%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRASCEASLKR+D  CIDLYYQHRIDK +PIEVT+GELKKLV EGKIKY+GLSEAS
Sbjct  103  DPAYVRASCEASLKRID--CIDLYYQHRIDKRVPIEVTIGELKKLVGEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRR HA+HP+TAVQLEWSLW R+AE +IIPTCRELGIGIVAYSPLGRGF SSG  +V
Sbjct  161  ASTIRRPHAVHPITAVQLEWSLWEREAEADIIPTCRELGIGIVAYSPLGRGFFSSGYKVV  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLS+ D RK  PRFQ EN E N +++ER+N+++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  221  ENLSDDDFRKTLPRFQPENLEHNKHIFERVNEMSKKKGCTPAQLALAWVHHQGSDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_009602070.1| PREDICTED: probable aldo-keto reductase 2 [Nicotiana tomentosiformis]
Length=344

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA CEASLKRLD++CIDLYY HRID  +PIEVTMGELKKLVEEGKIKY+GLSE+ 
Sbjct  105  EPAYVRACCEASLKRLDIDCIDLYYIHRIDTQLPIEVTMGELKKLVEEGKIKYIGLSESC  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLW+RD EEE++PTCRELGIG+V YSPLGRGF S+G  L+
Sbjct  165  ASTIRRAHAVHPITAVQMEWSLWTRDLEEEVVPTCRELGIGVVPYSPLGRGFFSAGAKLI  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLSE D RKN PRF+ EN E N  ++E++N +AA+KGCTPSQLALAW+ HQG+DVCPIP
Sbjct  225  ENLSEDDFRKNFPRFRPENFELNKQVFEKLNLMAARKGCTPSQLALAWVLHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>ref|XP_008337505.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=343

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPA+VRA+ E SLKRL ++ +DLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  102  DPAFVRAAIEGSLKRLGIDSVDLYYQHRIDTRVPIEVTVGELKKLVEEGKIKYIGLSEAS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLW+RD EE+IIPTCRELGIGIV YSPLGRGF SSG NLV
Sbjct  162  ASTIRRAHAVHPITAVQLEWSLWARDXEEDIIPTCRELGIGIVXYSPLGRGFFSSGANLV  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+  D RK  PRFQAEN E N  ++ R++  AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  222  DNLANDDFRKYLPRFQAENLEHNKTIFXRVSDXAARKGCTPSQLALAWVHHQGNDVCPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>ref|XP_003575318.1| PREDICTED: probable aldo-keto reductase 2 [Brachypodium distachyon]
Length=348

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFG+     G      +PAYVRA+CE SL+RL V+CIDLYYQHRID  +PIEVT+GE
Sbjct  89   LATKFGVLTTADGTPEIHGEPAYVRAACEGSLQRLGVDCIDLYYQHRIDTKVPIEVTIGE  148

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD EE+I+PTCRELGIG
Sbjct  149  LKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEDIVPTCRELGIG  208

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAY PLG GF SSGP +V  LSE D RK  PRFQ EN E+N  ++ER++ +AAKKGCT 
Sbjct  209  IVAYCPLGGGFFSSGPKMVNTLSEQDFRKGLPRFQTENLEKNAMVFERVSAMAAKKGCTT  268

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+ HQG+DVCPIPGTTK
Sbjct  269  SQLALAWVLHQGSDVCPIPGTTK  291



>ref|XP_010069402.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
 gb|KCW57716.1| hypothetical protein EUGRSUZ_H004701 [Eucalyptus grandis]
Length=346

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 172/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREVRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  206

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRF+ EN   N  L++R+N++A +KGCT S
Sbjct  207  VAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFRPENLAHNTKLFDRVNEIAQRKGCTTS  266

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW++HQ +DVCPIPGTTK
Sbjct  267  QLALAWVYHQRDDVCPIPGTTK  288



>ref|NP_172551.1| probable aldo-keto reductase 1 [Arabidopsis thaliana]
 sp|Q9C5B9.1|AKR1_ARATH RecName: Full=Probable aldo-keto reductase 1 [Arabidopsis thaliana]
 gb|AAK27238.1|AF361098_1 putative auxin-induced protein [Arabidopsis thaliana]
 gb|AEE28648.1| probable aldo-keto reductase 1 [Arabidopsis thaliana]
Length=344

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 170/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    + +   GDPAYVRA+CEASL+RL V CIDLYYQHRID  +PIEVT+GEL
Sbjct  86   LATKFGLLLKDQKLGYRGDPAYVRAACEASLRRLGVSCIDLYYQHRIDTTVPIEVTIGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEACASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG GF ++GP  +E++   D RK  PRFQ EN + N  LYE++N +A KK CTP+
Sbjct  206  VAYSPLGLGFFAAGPKFIESMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGT+K
Sbjct  266  QLALAWVHHQGNDVCPIPGTSK  287



>gb|EYU32744.1| hypothetical protein MIMGU_mgv11b007689mg [Erythranthe guttata]
Length=346

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA+CEASLKRL ++CIDLYY HRID  +PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  106  EPAYVRAACEASLKRLGIDCIDLYYAHRIDTRVPIEVTMGELKKLVEEGKIKYIGLSEAS  165

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ EWSLW+RD EEEI+PTCRELGIGIV YSPLGRGFLS GP L+
Sbjct  166  ASTIRRAHAVHPITAVQNEWSLWARDVEEEIVPTCRELGIGIVPYSPLGRGFLSVGPTLI  225

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN+SE D RK  PRFQ EN E N  +Y+RI+++A  KGCTPSQLALAW+ HQG+DV PIP
Sbjct  226  ENMSESDYRKKFPRFQGENLEANKLVYQRISEMAKVKGCTPSQLALAWVQHQGDDVIPIP  285

Query  590  GTTK  601
            GTTK
Sbjct  286  GTTK  289



>emb|CDP10334.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   310 bits (795),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA CE SLKRLDVECIDL+Y HRID  +PIEVT+GE+KKLVEEGK+KY+GLSEAS
Sbjct  104  DPEYVRACCEGSLKRLDVECIDLFYAHRIDTRVPIEVTVGEMKKLVEEGKVKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQLEWSLWSRD EEEI+PTCRELGIGIV YSPLGRGF S+GP L+
Sbjct  164  ASTIRRAHAVHPITAVQLEWSLWSRDLEEEILPTCRELGIGIVPYSPLGRGFFSAGPQLL  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+E D RKN PR++ EN E+N  ++ R++++AAKKGCTP+QLALAW++HQG+DV PIP
Sbjct  224  DNLAEGDMRKNFPRWKPENLEENKKIFARVSEMAAKKGCTPAQLALAWVYHQGDDVVPIP  283

Query  590  GTTK  601
            GTTK
Sbjct  284  GTTK  287



>ref|XP_009103955.1| PREDICTED: probable aldo-keto reductase 6 [Brassica rapa]
Length=346

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKF---girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKF       G  G   DP YVR++CEASL+RL V  IDLYYQHRID  +PIEVTMGE
Sbjct  86   LATKFGIIASEDGKFGFRADPEYVRSACEASLRRLGVTSIDLYYQHRIDTTVPIEVTMGE  145

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRD EE+IIPTCRELGIG
Sbjct  146  LKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDVEEDIIPTCRELGIG  205

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGFL++GP L EN  + D RK  PRFQ EN   N  LYE++  +A KKGCTP
Sbjct  206  IVAYSPLGRGFLAAGPKLAENFEDHDYRKGLPRFQEENLNHNKILYEKVQAMATKKGCTP  265

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            +QLALAW+HHQG+DVCPIPGT+K
Sbjct  266  AQLALAWVHHQGDDVCPIPGTSK  288



>ref|XP_006423736.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
 gb|ESR36976.1| hypothetical protein CICLE_v10028766mg [Citrus clementina]
Length=278

 Score =   308 bits (788),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R I GDPAY RA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  84   LATKFGISYADGKREIRGDPAYARAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  143

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PTCRELGIGI
Sbjct  144  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPTCRELGIGI  203

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSGP LVE+ S+ D R+  PRFQAEN E N  L+ER+N++A +KGCTPS
Sbjct  204  VAYSPLGRGFFSSGPKLVESFSKEDFRQYLPRFQAENLEHNKKLFERVNEIATRKGCTPS  263

Query  536  QLALAWLHHQGNDV  577
            QLALAW+HHQG+D+
Sbjct  264  QLALAWVHHQGDDM  277



>gb|ABR92331.1| putative aldo/keto reductase 1 [Salvia miltiorrhiza]
Length=363

 Score =   310 bits (795),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 171/203 (84%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI           DPAYVR+SCE+SLKRLDV+CIDLYY HRID  +PIE+TMGEL
Sbjct  104  LATKFGIINRDGKGEVHGDPAYVRSSCESSLKRLDVDCIDLYYVHRIDTSVPIEITMGEL  163

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQ+EWSLWSRD EEE+IPTCRELGIGI
Sbjct  164  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWSRDVEEELIPTCRELGIGI  223

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNH-PRFQAENAEQNYNLYERINKVAAKKGCTP  532
            V YSPLGRGFLS GP ++EN SE D RK + PRF  EN E N  +YE+I ++A  KGC+P
Sbjct  224  VPYSPLGRGFLSVGPKMLENASEGDLRKIYFPRFHDENLESNKLIYEKICEMATSKGCSP  283

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            SQLALAW+HHQG+DVCPIPGTTK
Sbjct  284  SQLALAWVHHQGDDVCPIPGTTK  306



>ref|XP_006363582.1| PREDICTED: probable aldo-keto reductase 2-like isoform X1 [Solanum 
tuberosum]
Length=345

 Score =   310 bits (793),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA CEASLKRLD++CIDLYY HRID  +PIEVTMGELKKLVEEGKIKY+GLSEA 
Sbjct  105  EPAYVRACCEASLKRLDIDCIDLYYVHRIDTQLPIEVTMGELKKLVEEGKIKYIGLSEAC  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLW+RD EEE++PTCRELGIGIV YSPLGRGF S+G  L+
Sbjct  165  ASTIRRAHAVHPITAVQMEWSLWTRDLEEEVVPTCRELGIGIVPYSPLGRGFFSAGAKLI  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            E+L + D RKN PRF+ EN E N  ++E+IN +AA+KGCTPSQLALAW+ HQG+DVCPIP
Sbjct  225  ESLPDGDFRKNFPRFKPENFEHNKQVFEKINLMAARKGCTPSQLALAWILHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>ref|XP_007224543.1| hypothetical protein PRUPE_ppa024588mg [Prunus persica]
 gb|EMJ25742.1| hypothetical protein PRUPE_ppa024588mg [Prunus persica]
Length=334

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrg--icgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI        + GDPAYVRA+ E SLKRL V+ +DLYYQHRID  +PIEVT+GEL
Sbjct  75   LATKFGISFADNKPEVRGDPAYVRAAIEGSLKRLGVDSVDLYYQHRIDTRVPIEVTVGEL  134

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGK+KY+GLSEASASTIRRAHA+ P+TAVQLEWSLW+RD EE+IIPTCRELGIGI
Sbjct  135  KKLVEEGKVKYIGLSEASASTIRRAHAVRPITAVQLEWSLWTRDVEEDIIPTCRELGIGI  194

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF SSG    ENL   D RK  PRFQAEN E N  ++E+++ +AA+KGCTPS
Sbjct  195  VAYSPLGRGFFSSGAKFFENLPNDDFRKYLPRFQAENLEHNKTIFEQVSDLAARKGCTPS  254

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  255  QLALAWVHHQGNDVCPIPGTTK  276



>emb|CDP16012.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   308 bits (790),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA+CEASL+RLDV+ IDLYY HRID  +PIEVTMGELKKLVEEGKI+Y+GLSEAS
Sbjct  80   EPAYVRAACEASLRRLDVDYIDLYYVHRIDTRVPIEVTMGELKKLVEEGKIRYIGLSEAS  139

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
              TIRRAHA+HP+TAVQLEWSLW+RDAE+ +IPTCRELGIGIVA+SPLGRGFL+SG NLV
Sbjct  140  PDTIRRAHAVHPITAVQLEWSLWTRDAEDSVIPTCRELGIGIVAFSPLGRGFLASGRNLV  199

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL + D RK+ PRFQ EN E N   +E++N++A +KGCTPSQLALAW+HHQG+DVCPIP
Sbjct  200  QNLVDNDYRKSLPRFQPENVENNLETFEQVNEMALRKGCTPSQLALAWVHHQGDDVCPIP  259

Query  590  GTTK  601
            GTTK
Sbjct  260  GTTK  263



>emb|CDP19922.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   308 bits (789),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 166/202 (82%), Gaps = 11/202 (5%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF +           DPAYVRA CEASLKRLDV+CIDLYYQHRID  +PIEVT+GEL
Sbjct  58   LATKFAVSYEDGKFDVRGDPAYVRACCEASLKRLDVDCIDLYYQHRIDTGVPIEVTIGEL  117

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+QLEWSLW+RD EEEIIPTCR      
Sbjct  118  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQLEWSLWTRDVEEEIIPTCR------  171

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
                PLG+GF SSGP L+ENL+E D RK  PRFQAEN E N NLYE++N +A++KGCTPS
Sbjct  172  ---YPLGQGFFSSGPKLIENLTEGDFRKYSPRFQAENLEHNKNLYEQVNAIASRKGCTPS  228

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGTTK
Sbjct  229  QLALAWVHHQGNDVCPIPGTTK  250



>ref|XP_010107228.1| hypothetical protein L484_021750 [Morus notabilis]
 gb|EXC14252.1| hypothetical protein L484_021750 [Morus notabilis]
Length=369

 Score =   310 bits (794),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 168/211 (80%), Gaps = 27/211 (13%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVT----------------------  163
            DP YVRA+CEASLKRLD++CIDLYYQHR+D  +PIEVT                      
Sbjct  101  DPVYVRAACEASLKRLDLDCIDLYYQHRVDTRVPIEVTAGRDASSPGPVLDGFKHHTKIQ  160

Query  164  -----MGELKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIP  328
                 +GELKKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW RD E+EIIP
Sbjct  161  NHLTPVGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWVRDVEDEIIP  220

Query  329  TCRELGIGIVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKV  508
            TCRELGIGIVAYSPLGRGFLSSGP LVE L++ D RK  PRFQ +N E N  ++ER+N++
Sbjct  221  TCRELGIGIVAYSPLGRGFLSSGPKLVETLTDNDFRKQLPRFQGKNLEHNITIFERVNEI  280

Query  509  AAKKGCTPSQLALAWLHHQGNDVCPIPGTTK  601
            AA+KGCTP+QLALAW+HHQG+DVCPIPGTTK
Sbjct  281  AARKGCTPAQLALAWVHHQGDDVCPIPGTTK  311



>ref|XP_011073935.1| PREDICTED: auxin-induced protein PCNT115-like [Sesamum indicum]
Length=348

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA+CE SLKRLDV+CIDLYY HRID  +PIEVTMGELKKLVEEGKIKYVGLSE S
Sbjct  102  EPAYVRAACEGSLKRLDVDCIDLYYVHRIDTRVPIEVTMGELKKLVEEGKIKYVGLSEPS  161

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
             ST+RRAHA+HP+TA+Q+EWSLW+RD EEE+IP CRELGIGIV YSPLG+GFLSSGP L+
Sbjct  162  VSTLRRAHAVHPITAIQIEWSLWARDVEEELIPACRELGIGIVPYSPLGKGFLSSGPKLI  221

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL E D RK  PRFQ E+ E N  +YERI+ +AA+KGCTPSQL+LAW+HHQG+DV PIP
Sbjct  222  QNLEESDYRKVFPRFQPEHVENNKAVYERISGMAARKGCTPSQLSLAWVHHQGDDVSPIP  281

Query  590  GTTK  601
            GTTK
Sbjct  282  GTTK  285



>ref|XP_008379790.1| PREDICTED: probable aldo-keto reductase 2 [Malus domestica]
Length=276

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+ E+SLKRL V+ IDLYYQ RID  +P EVT+ ELKKLVE GK+KY+GLSEAS
Sbjct  36   DPAYVRAALESSLKRLGVDSIDLYYQXRIDTSVPXEVTVXELKKLVEXGKVKYIGLSEAS  95

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTI RAHA+HP+TAVQLEWSLWSRD E+EIIPTCRELGIGIVAYSPLGRGF  SG   V
Sbjct  96   ASTIXRAHAVHPITAVQLEWSLWSRDVEQEIIPTCRELGIGIVAYSPLGRGFFXSGAKFV  155

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL+  D RKN PRFQ EN E N  L+ER++ +AA+KGCTPSQLALAW+HHQGNDVCPIP
Sbjct  156  ENLAHXDSRKNLPRFQPENVEHNKTLFERVSDLAARKGCTPSQLALAWVHHQGNDVCPIP  215

Query  590  GTTK  601
            GTTK
Sbjct  216  GTTK  219



>ref|XP_010069399.1| PREDICTED: probable aldo-keto reductase 2 [Eucalyptus grandis]
Length=346

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            D  YVRA+CE SLKRLDV+CI+LYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  105  DQVYVRAACEDSLKRLDVDCINLYYQHRIDTRVPIEVTIGELKKLVEEGKIKYIGLSEAS  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+T VQLEWSLWSRD E EIIPTCRELGIGIVAYSPLGRGF S G  L+
Sbjct  165  ASTIRRAHAVHPITVVQLEWSLWSRDVEAEIIPTCRELGIGIVAYSPLGRGFFSVGSKLL  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            EN SE D R+  PRFQ EN   N  L++R+N++A +KGCTP QLALAW+HHQG+DVCPIP
Sbjct  225  ENFSEDDFRQKLPRFQPENLAHNAKLFDRVNEIAQRKGCTPLQLALAWVHHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>dbj|BAD44104.1| putative auxin-induced protein [Arabidopsis thaliana]
 dbj|BAD44177.1| putative auxin-induced protein [Arabidopsis thaliana]
Length=344

 Score =   309 bits (791),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/202 (72%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgic--gDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+    + +   GDPAY RA+CEASL+RL V CIDLYYQHRID  +PIEVT+GEL
Sbjct  86   LATKFGLLLKDQKLGYRGDPAYARAACEASLRRLGVSCIDLYYQHRIDTTVPIEVTIGEL  145

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEA ASTIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  146  KKLVEEGKIKYIGLSEACASTIRRAHAVHPLTAVQLEWSLWSRDVEEDIIPTCRELGIGI  205

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLG GF ++GP  +E++   D RK  PRFQ EN + N  LYE++N +A KK CTP+
Sbjct  206  VAYSPLGLGFFAAGPKFIESMDNGDYRKGLPRFQQENLDHNKILYEKVNAMAEKKSCTPA  265

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQGNDVCPIPGT+K
Sbjct  266  QLALAWVHHQGNDVCPIPGTSK  287



>ref|XP_009774032.1| PREDICTED: probable aldo-keto reductase 2 [Nicotiana sylvestris]
Length=344

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +P YVRA CEASLKRLD++CIDLYY HRID  +PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  105  EPGYVRACCEASLKRLDIDCIDLYYVHRIDTQLPIEVTMGELKKLVEEGKIKYIGLSEAS  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TAVQ+EWSLW+RD EEE++PTCR+LGIG+V YSPLGRGF S+G  L+
Sbjct  165  ASTIRRAHAVHPITAVQMEWSLWTRDLEEEVVPTCRQLGIGVVPYSPLGRGFFSAGAKLI  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENLSE D RKN PRF+ EN E N  ++E++N +AA+KGCT SQLALAW+ HQG+DVCPIP
Sbjct  225  ENLSEDDFRKNFPRFRPENFELNKQVFEKLNLMAARKGCTSSQLALAWVLHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>gb|AAB71982.1| Highly similar to auxin-induced protein (aldo/keto reductase 
family) [Arabidopsis thaliana]
Length=342

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 162/184 (88%), Gaps = 3/184 (2%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASL R+DV CIDLYYQHRID  +PIE+T+GELKKLVEEGKIKY+GLSEAS
Sbjct  104  DPAYVRAACEASLMRVDVACIDLYYQHRIDTRVPIEITIGELKKLVEEGKIKYIGLSEAS  163

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP+TA+Q+EWSLWSRD EE+IIPTCRELGIGIVAYSPLGRGF +SGP LV
Sbjct  164  ASTIRRAHAVHPITALQIEWSLWSRDVEEDIIPTCRELGIGIVAYSPLGRGFFASGPKLV  223

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL   D     PRFQ EN + N  L+E+++ ++ KKGCTP+QLALAW+HHQG+DVCPIP
Sbjct  224  ENL---DNNDTLPRFQQENLDHNKILFEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_010511057.1| PREDICTED: probable aldo-keto reductase 4 [Camelina sativa]
Length=344

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 171/202 (85%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI    G   + GDP +VRA+CEASLKRLDV  IDLYY HRID  +PIE+TMGEL
Sbjct  85   LATKFGITYGEGKIEVRGDPEHVRAACEASLKRLDVSFIDLYYSHRIDTRVPIEITMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLV+EGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEE+IPTCRELGIGI
Sbjct  145  KKLVKEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEVIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF +SGP LVENL + D RK  PRFQ EN + N  +YE++  ++  KGCTP+
Sbjct  205  VAYSPLGRGFFASGPKLVENLDKNDFRKALPRFQEENLDHNKIVYEKVCAISENKGCTPA  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  265  QLALAWVHHQGDDVCPIPGTTK  286



>ref|XP_006301580.1| hypothetical protein CARUB_v10022018mg [Capsella rubella]
 gb|EOA34478.1| hypothetical protein CARUB_v10022018mg [Capsella rubella]
Length=711

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 173/202 (86%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgir--gggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFGI      R I GDPAYVRA+CEASLKRLDV CIDLYYQHRID  +PIE+TMGEL
Sbjct  448  LATKFGISYGERKREIKGDPAYVRAACEASLKRLDVACIDLYYQHRIDTRVPIEITMGEL  507

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLW+RD EEEI+PTCRELGIGI
Sbjct  508  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWTRDVEEEIVPTCRELGIGI  567

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            V YSPLGRGF +SGP LVENL   D RK  PRFQ EN + N  LYE++  ++ KKGCTP+
Sbjct  568  VVYSPLGRGFFASGPKLVENLDNNDFRKALPRFQQENLDHNKILYEKVCAMSEKKGCTPA  627

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+DVCPIPGTTK
Sbjct  628  QLALAWVHHQGDDVCPIPGTTK  649



>gb|KGN53069.1| hypothetical protein Csa_4G015100 [Cucumis sativus]
Length=341

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVRA+CEASL+RL V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  DPTYVRAACEASLERLGVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP++AVQ+EWSLW+RD E++IIPTCRELGIGIVAYSPLGRGFLSSG   +
Sbjct  161  ASTIRRAHAVHPISAVQIEWSLWARDVEQDIIPTCRELGIGIVAYSPLGRGFLSSGATFI  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL+E D RK  PRFQ EN E N +++E+++++AA+KGCT SQLALAW+H+QG+DV PIP
Sbjct  221  QNLTEDDYRKKLPRFQPENLEHNKSIFEKVSELAARKGCTTSQLALAWVHNQGSDVVPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>ref|XP_011073932.1| PREDICTED: auxin-induced protein PCNT115-like isoform X1 [Sesamum 
indicum]
Length=382

 Score =   309 bits (791),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVR +CEASLKRLDV+CIDLYY HRID  +PIEVTMGELKKLVEEGKIKYVGLSE S
Sbjct  136  EPAYVRTACEASLKRLDVDCIDLYYAHRIDTRVPIEVTMGELKKLVEEGKIKYVGLSEPS  195

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
             ST++RAH +HP+ A+Q+EWSLW+RD EEE+IPTCRELGIGIV Y+PLG+GFLSSGP LV
Sbjct  196  VSTLKRAHTVHPIAAIQIEWSLWARDVEEELIPTCRELGIGIVPYTPLGKGFLSSGPKLV  255

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL E D RK  PRFQ EN E N  +YERI+++AA+KGCTPSQL+LAW+HHQG+DV PIP
Sbjct  256  QNLVEGDSRKVFPRFQPENFESNKVVYERISEMAARKGCTPSQLSLAWVHHQGDDVSPIP  315

Query  590  GTTK  601
            GTTK
Sbjct  316  GTTK  319



>ref|XP_008453991.1| PREDICTED: probable aldo-keto reductase 2 [Cucumis melo]
Length=341

 Score =   307 bits (787),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PAYVRA+CEASLKRL V+CIDLYYQHRID  +PIEVT+GELKKLVEEGKIKY+GLSEAS
Sbjct  101  EPAYVRAACEASLKRLGVDCIDLYYQHRIDTKVPIEVTIGELKKLVEEGKIKYIGLSEAS  160

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA+HP++AVQ+EWSLW+RD E++IIPTCRELGIGIVAYSPLGRGFLSSG   +
Sbjct  161  ASTIRRAHAVHPISAVQIEWSLWARDVEQDIIPTCRELGIGIVAYSPLGRGFLSSGATFI  220

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL++ D RK  PRFQ EN E N +++E+++++AA+KGCT SQLALAW+H+QG+DV PIP
Sbjct  221  QNLTQDDYRKKLPRFQPENLEHNNSIFEKVSELAARKGCTTSQLALAWVHNQGSDVVPIP  280

Query  590  GTTK  601
            GTTK
Sbjct  281  GTTK  284



>gb|EPS71567.1| hypothetical protein M569_03191 [Genlisea aurea]
Length=344

 Score =   307 bits (787),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF I           DP YVRASCEASLKRLDV+ IDLYY HRID  +PIEVTMGEL
Sbjct  85   LATKFSITDMLSKAEIRGDPEYVRASCEASLKRLDVDYIDLYYIHRIDTRVPIEVTMGEL  144

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TA+Q EWSLWSRD EEE+IPTCRELGIGI
Sbjct  145  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAIQNEWSLWSRDLEEELIPTCRELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGFLS+GP+L++NL E D RK  PRFQ EN E N  +YE I ++  +KGC+PS
Sbjct  205  VAYSPLGRGFLSAGPSLIQNLPEGDFRKIFPRFQGENLEHNRAVYEGICELGRRKGCSPS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            Q+ALAW+HHQG DV PIPGTTK
Sbjct  265  QIALAWVHHQGEDVSPIPGTTK  286



>ref|XP_006392125.1| hypothetical protein EUTSA_v10023569mg [Eutrema salsugineum]
 gb|ESQ29411.1| hypothetical protein EUTSA_v10023569mg [Eutrema salsugineum]
Length=346

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFGI     G  G   DP YVR++CEASL+RL V  IDLYYQHRID  +PIEVTMGE
Sbjct  86   LATKFGITASEDGKFGFRGDPEYVRSACEASLRRLGVTSIDLYYQHRIDTTVPIEVTMGE  145

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKL EEGKIKY+GLSEASASTIRRAHA+ P+TAVQ+EWSLWSRD EE+IIPTCRELGIG
Sbjct  146  LKKLTEEGKIKYIGLSEASASTIRRAHAVLPITAVQIEWSLWSRDVEEDIIPTCRELGIG  205

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGFL+SGP LVENL + D RK+ PRFQ EN + N  LYE++  +A KK CTP
Sbjct  206  IVAYSPLGRGFLASGPKLVENLDQDDYRKDLPRFQQENLDHNKILYEKVQAMATKKSCTP  265

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            +QLALAW+HH+G+DVCPIPGT+K
Sbjct  266  AQLALAWVHHRGDDVCPIPGTSK  288



>gb|KFK22425.1| hypothetical protein AALP_AAs39864U000300 [Arabis alpina]
Length=346

 Score =   307 bits (786),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP YVR+SCEASL+RL V CIDLYYQHR+D  IPIEVTMGELKKLV EGKIKY+GLSEA 
Sbjct  105  DPEYVRSSCEASLRRLGVTCIDLYYQHRVDTTIPIEVTMGELKKLVGEGKIKYIGLSEAC  164

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            ASTIRRAHA++P+TAVQLEWSLW+R+ EE+I+PTCRELGIGIVAYSPLG+GFL+SGP LV
Sbjct  165  ASTIRRAHAVYPITAVQLEWSLWTREVEEDIVPTCRELGIGIVAYSPLGKGFLASGPKLV  224

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            ENL + D RK  PR Q EN + N  LYE++  +A KKGC P+QLALAW+HHQG+DVCPIP
Sbjct  225  ENLDQDDYRKTLPRLQQENLDHNKILYEKVQAMATKKGCNPAQLALAWVHHQGDDVCPIP  284

Query  590  GTTK  601
            GTTK
Sbjct  285  GTTK  288



>gb|ABN08782.1| Aldo/keto reductase [Medicago truncatula]
Length=277

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg--DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKFG+R G        DP YVR +CE SLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  82   LATKFGVRAGDGKFEICGDPGYVREACEGSLKRLDIDCIDLYYQHRIDTRLPIEVTIGEL  141

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASA+TIRRAHA+HP+TAVQLEWSLWSRD EE+IIPTCRELGIGI
Sbjct  142  KKLVEEGKIKYIGLSEASAATIRRAHAVHPITAVQLEWSLWSRDVEEDIIPTCRELGIGI  201

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S+G  L++NL + D RK+ PRFQ EN +QN  +++++N++A KKGCTP 
Sbjct  202  VAYSPLGRGFFSTGTKLLDNLPQDDYRKHLPRFQTENLQQNQTIFDKVNELATKKGCTPP  261

Query  536  QLALAWLHHQGNDVC  580
            QLALAWLHHQGNDVC
Sbjct  262  QLALAWLHHQGNDVC  276



>ref|XP_009103926.1| PREDICTED: probable aldo-keto reductase 6 [Brassica rapa]
Length=347

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    LATKFgirgggrgicg---DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGE  172
            LATKFG+     G  G   DP YVR++CEASL+RL V CIDLYYQHRID  +PIEVTMGE
Sbjct  87   LATKFGLVTSEDGKLGFRGDPNYVRSACEASLRRLGVTCIDLYYQHRIDTTVPIEVTMGE  146

Query  173  LKKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIG  352
            LKKLVEEG+IKY+GLSEASASTIRRAHA+HP+TA+Q+EWSLWSRD EE IIPTCRELGIG
Sbjct  147  LKKLVEEGRIKYIGLSEASASTIRRAHAVHPITALQIEWSLWSRDVEEYIIPTCRELGIG  206

Query  353  IVAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTP  532
            IVAYSPLGRGFL+SG  LVENL   D RK+ PRF+ EN E N  ++E++  +A  K CTP
Sbjct  207  IVAYSPLGRGFLASGTKLVENLEHGDPRKSLPRFKEENLEHNKIVFEKVQAIATSKSCTP  266

Query  533  SQLALAWLHHQGNDVCPIPGTTK  601
            +QLALAW+HHQG+DVCPIPGTTK
Sbjct  267  AQLALAWVHHQGDDVCPIPGTTK  289



>gb|KCW57711.1| hypothetical protein EUGRSUZ_H00469 [Eucalyptus grandis]
Length=344

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 171/202 (85%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    LATKF--girgggrgicgDPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGEL  175
            LATKF      G R + GDPAYVRA+CEASLKRLD++CIDLYYQHRID  +PIEVT+GEL
Sbjct  87   LATKFGISFADGKREVRGDPAYVRAACEASLKRLDIDCIDLYYQHRIDTRVPIEVTIGEL  146

Query  176  KKLVEEGKIKYVGLSEASASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGI  355
            KKLVEEGKIKY+GLSEASASTIRRAHA+HP+TAVQLEWSLWSRD E EI+PT  ELGIGI
Sbjct  147  KKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEAEIVPT--ELGIGI  204

Query  356  VAYSPLGRGFLSSGPNLVENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPS  535
            VAYSPLGRGF S G  LVEN+S+ D R+  PRF+ EN   N  L++R+N++A +KGCT S
Sbjct  205  VAYSPLGRGFFSVGSKLVENISKDDFRQYLPRFRPENLAHNTKLFDRVNEIAQRKGCTTS  264

Query  536  QLALAWLHHQGNDVCPIPGTTK  601
            QLALAW+HHQG+D+CPIPGTTK
Sbjct  265  QLALAWVHHQGDDICPIPGTTK  286



>gb|KFK30951.1| hypothetical protein AALP_AA6G048800 [Arabis alpina]
Length=350

 Score =   305 bits (782),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DP +VR++CEASLKRL V CIDLYYQHR D ++PIEVTMGELKKLVEEGKIKY+GLSEAS
Sbjct  108  DPEHVRSACEASLKRLGVTCIDLYYQHRTDINVPIEVTMGELKKLVEEGKIKYIGLSEAS  167

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
            A TIRRAHA+HP+TA+Q+EWSLWSRD EEEIIPTCRELGIGIVAYSPLGRGFL+SGP LV
Sbjct  168  ALTIRRAHAVHPITAMQIEWSLWSRDVEEEIIPTCRELGIGIVAYSPLGRGFLASGPKLV  227

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL + D RK  PRFQ EN + N  +YE +  +A KK CTP+QLALAW+HH+G+DVCPIP
Sbjct  228  DNLDQDDYRKTLPRFQQENLDHNKIIYENVQAMATKKSCTPAQLALAWVHHRGDDVCPIP  287

Query  590  GTTK  601
            GT+K
Sbjct  288  GTSK  291



>emb|CDP09056.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   304 bits (778),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            +PA+VRA+CEASLKRLDV+ IDLYY HRID  +PIE T+GELKKLVEEGK+KY+GLSEAS
Sbjct  65   EPAFVRAACEASLKRLDVDYIDLYYVHRIDTRVPIEATVGELKKLVEEGKVKYIGLSEAS  124

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
              TIRRAHA+HP+TAVQLEWSLW+RDAEE +IPTCRELGIGIVA+ PLG GFL+SGP LV
Sbjct  125  PETIRRAHAVHPITAVQLEWSLWTRDAEESVIPTCRELGIGIVAFGPLGSGFLASGPKLV  184

Query  410  ENLS---EVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVC  580
            ENL+   + D RK +PRFQ EN + N  +YER+ ++A++KGCTPSQLALAW+HHQG+DVC
Sbjct  185  ENLNTTPDFDARKANPRFQPENVQHNLKMYERVEEMASRKGCTPSQLALAWVHHQGDDVC  244

Query  581  PIPGTTK  601
            PIPGTTK
Sbjct  245  PIPGTTK  251



>ref|XP_010673284.1| PREDICTED: auxin-induced protein PCNT115-like [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   305 bits (781),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +2

Query  50   DPAYVRASCEASLKRLDVECIDLYYQHRIDKHIPIEVTMGELKKLVEEGKIKYVGLSEAS  229
            DPAYVRA+CEASLKRL V+CIDLYYQHR+D  IPIEVTM ELKKLVEEGKIKY+GLSE S
Sbjct  110  DPAYVRAACEASLKRLGVDCIDLYYQHRVDTSIPIEVTMSELKKLVEEGKIKYIGLSEVS  169

Query  230  ASTIRRAHAIHPVTAVQLEWSLWSRDAEEEIIPTCRELGIGIVAYSPLGRGFLSSGPNLV  409
             STIRRAHA+HP+TAVQLEWS+W R+ EEEIIPTCRELGIGIVAYSPLGRGFLS G  ++
Sbjct  170  PSTIRRAHAVHPLTAVQLEWSVWCREVEEEIIPTCRELGIGIVAYSPLGRGFLSLGAKVM  229

Query  410  ENLSEVDRRKNHPRFQAENAEQNYNLYERINKVAAKKGCTPSQLALAWLHHQGNDVCPIP  589
            +NL + D RK  PR Q EN E N  L+E+++K+A+KKGCT SQLALAW+HHQG DVCPIP
Sbjct  230  DNLIDSDFRKTLPRLQPENMEHNKLLFEKMSKIASKKGCTTSQLALAWVHHQGEDVCPIP  289

Query  590  GTTK  601
            GTTK
Sbjct  290  GTTK  293



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 742397556606