BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20638_g2_i3 len=1308 path=[1600:0-772 4037:773-965 123:966-1307]

Length=1308
                                                                      Score     E

ref|XP_009769467.1|  PREDICTED: RING finger and CHY zinc finger d...    448   2e-153   
ref|XP_009587771.1|  PREDICTED: RING finger and CHY zinc finger d...    447   1e-152   
ref|XP_011079733.1|  PREDICTED: RING finger and CHY zinc finger d...    439   1e-149   
emb|CDP03541.1|  unnamed protein product                                433   3e-147   
ref|XP_010323027.1|  PREDICTED: RING finger and CHY zinc finger d...    432   4e-147   
gb|EYU46712.1|  hypothetical protein MIMGU_mgv1a011426mg                425   3e-144   
ref|XP_002268410.1|  PREDICTED: RING finger and CHY zinc finger d...    414   6e-140   Vitis vinifera
ref|XP_009378904.1|  PREDICTED: RING finger and CHY zinc finger d...    408   1e-137   
ref|XP_008375844.1|  PREDICTED: RING finger and CHY zinc finger d...    401   6e-135   
ref|XP_007200576.1|  hypothetical protein PRUPE_ppa009889mg             395   6e-133   
ref|XP_008234998.1|  PREDICTED: RING finger and CHY zinc finger d...    395   8e-133   
gb|KDP28091.1|  hypothetical protein JCGZ_13862                         394   2e-132   
ref|XP_002320362.2|  hypothetical protein POPTR_0014s12890g             394   6e-132   Populus trichocarpa [western balsam poplar]
ref|XP_011033603.1|  PREDICTED: RING finger and CHY zinc finger d...    391   4e-131   
ref|XP_009369109.1|  PREDICTED: RING finger and CHY zinc finger d...    390   7e-131   
ref|XP_007223130.1|  hypothetical protein PRUPE_ppa010024mg             387   1e-129   
ref|XP_010545043.1|  PREDICTED: RING finger and CHY zinc finger d...    387   1e-129   
ref|XP_009116965.1|  PREDICTED: RING finger and CHY zinc finger d...    386   6e-129   
ref|XP_010684478.1|  PREDICTED: RING finger and CHY zinc finger d...    386   6e-129   
ref|XP_008223109.1|  PREDICTED: RING finger and CHY zinc finger d...    385   9e-129   
emb|CDX76679.1|  BnaC08g32650D                                          385   1e-128   
ref|XP_008340838.1|  PREDICTED: RING finger and CHY zinc finger d...    384   1e-128   
ref|XP_008351219.1|  PREDICTED: RING finger and CHY zinc finger d...    386   3e-128   
ref|XP_008390730.1|  PREDICTED: RING finger and CHY zinc finger d...    383   5e-128   
ref|XP_009352220.1|  PREDICTED: RING finger and CHY zinc finger d...    383   5e-128   
ref|XP_002876698.1|  protein binding protein                            383   8e-128   
ref|NP_191856.4|  ring finger and CHY zinc finger domain-containi...    382   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007050799.1|  Zinc finger (C3HC4-type RING finger) family ...    381   4e-127   
gb|AAP21226.1|  At3g62970                                               380   7e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413215.1|  PREDICTED: RING finger and CHY zinc finger d...    381   1e-126   
ref|NP_001241502.1|  uncharacterized protein LOC100792038               380   1e-126   
ref|XP_004309689.1|  PREDICTED: RING finger and CHY zinc finger d...    379   1e-126   
ref|XP_010512695.1|  PREDICTED: RING finger and CHY zinc finger d...    380   2e-126   
ref|XP_002276039.1|  PREDICTED: RING finger and CHY zinc finger d...    378   4e-126   Vitis vinifera
ref|XP_004486052.1|  PREDICTED: RING finger and CHY zinc finger d...    378   4e-126   
gb|KFK35483.1|  hypothetical protein AALP_AA5G290200                    377   1e-125   
ref|XP_010468901.1|  PREDICTED: RING finger and CHY zinc finger d...    378   2e-125   
ref|XP_004296799.1|  PREDICTED: RING finger and CHY zinc finger d...    377   2e-125   
ref|XP_003521535.1|  PREDICTED: RING finger and CHY zinc finger d...    377   2e-125   
ref|XP_010241530.1|  PREDICTED: RING finger and CHY zinc finger d...    376   3e-125   
ref|XP_007147872.1|  hypothetical protein PHAVU_006G162000g             375   4e-125   
ref|XP_003546095.1|  PREDICTED: RING finger and CHY zinc finger d...    375   4e-125   
ref|XP_007154233.1|  hypothetical protein PHAVU_003G101500g             375   8e-125   
ref|XP_006419635.1|  hypothetical protein CICLE_v10005640mg             374   2e-124   
ref|XP_006291570.1|  hypothetical protein CARUB_v10017724mg             375   2e-124   
emb|CDO98906.1|  unnamed protein product                                374   2e-124   
ref|XP_002312758.2|  zinc finger family protein                         374   2e-124   Populus trichocarpa [western balsam poplar]
ref|XP_006402321.1|  hypothetical protein EUTSA_v10006143mg             374   2e-124   
ref|NP_001239836.1|  uncharacterized protein LOC100812839               373   4e-124   
gb|KDO75131.1|  hypothetical protein CISIN_1g024406mg                   373   4e-124   
gb|AGS43128.1|  hypothetical protein                                    373   4e-124   
ref|XP_010036870.1|  PREDICTED: RING finger and CHY zinc finger d...    373   5e-124   
gb|AFK36462.1|  unknown                                                 372   2e-123   
ref|XP_003593984.1|  RING finger and CHY zinc finger domain-conta...    371   2e-123   
ref|XP_009803952.1|  PREDICTED: RING finger and CHY zinc finger d...    371   2e-123   
ref|XP_004136056.1|  PREDICTED: RING finger and CHY zinc finger d...    371   3e-123   
gb|KDP40017.1|  hypothetical protein JCGZ_02015                         370   4e-123   
gb|KDO75130.1|  hypothetical protein CISIN_1g024406mg                   370   7e-123   
gb|EYU43903.1|  hypothetical protein MIMGU_mgv1a011840mg                369   1e-122   
gb|AFK47591.1|  unknown                                                 369   2e-122   
ref|XP_010524760.1|  PREDICTED: RING finger and CHY zinc finger d...    369   2e-122   
ref|XP_002871827.1|  zinc finger family protein                         368   3e-122   
ref|XP_006356694.1|  PREDICTED: RING finger and CHY zinc finger d...    368   4e-122   
ref|XP_011090912.1|  PREDICTED: RING finger and CHY zinc finger d...    368   4e-122   
ref|XP_003542919.1|  PREDICTED: RING finger and CHY zinc finger d...    368   5e-122   
ref|XP_007035496.1|  CHY-type/CTCHY-type/RING-type Zinc finger pr...    366   1e-121   
ref|XP_009791778.1|  PREDICTED: RING finger and CHY zinc finger d...    366   2e-121   
ref|XP_006342775.1|  PREDICTED: RING finger and CHY zinc finger d...    366   3e-121   
ref|XP_002516875.1|  zinc finger protein, putative                      365   4e-121   Ricinus communis
ref|XP_010454118.1|  PREDICTED: RING finger and CHY zinc finger d...    365   6e-121   
ref|XP_004241068.1|  PREDICTED: RING finger and CHY zinc finger d...    365   6e-121   
ref|XP_006400417.1|  hypothetical protein EUTSA_v10014400mg             365   8e-121   
ref|XP_010941801.1|  PREDICTED: RING finger and CHY zinc finger d...    365   9e-121   
ref|XP_004229216.1|  PREDICTED: RING finger and CHY zinc finger d...    364   1e-120   
ref|XP_009592576.1|  PREDICTED: RING finger and CHY zinc finger d...    364   1e-120   
ref|XP_004134192.1|  PREDICTED: RING finger and CHY zinc finger d...    364   1e-120   
ref|XP_010649778.1|  PREDICTED: RING finger and CHY zinc finger d...    363   2e-120   
ref|XP_010069986.1|  PREDICTED: RING finger and CHY zinc finger d...    364   2e-120   
ref|XP_010420645.1|  PREDICTED: RING finger and CHY zinc finger d...    363   2e-120   
ref|NP_197366.1|  MYB30-Interacting E3 ligase1                          363   3e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92593.1|  BnaA10g16320D                                          363   5e-120   
ref|XP_009120952.1|  PREDICTED: RING finger and CHY zinc finger d...    362   6e-120   
ref|XP_008438813.1|  PREDICTED: RING finger and CHY zinc finger d...    362   6e-120   
emb|CDY13909.1|  BnaC09g39170D                                          362   7e-120   
ref|XP_010492886.1|  PREDICTED: RING finger and CHY zinc finger d...    362   7e-120   
emb|CAB87742.1|  putative protein                                       362   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288468.1|  hypothetical protein CARUB_v10001726mg             361   2e-119   
ref|XP_010666396.1|  PREDICTED: RING finger and CHY zinc finger d...    361   2e-119   
gb|AEX97080.1|  zinc-finger protein                                     361   2e-119   
ref|XP_011013258.1|  PREDICTED: RING finger and CHY zinc finger d...    361   3e-119   
gb|KHN28232.1|  RING finger and CHY zinc finger domain-containing...    360   4e-119   
ref|XP_009131683.1|  PREDICTED: RING finger and CHY zinc finger d...    360   4e-119   
ref|XP_009405425.1|  PREDICTED: RING finger and CHY zinc finger d...    360   7e-119   
gb|KHN03386.1|  RING finger and CHY zinc finger domain-containing...    359   1e-118   
gb|KCW58537.1|  hypothetical protein EUGRSUZ_H01203                     360   1e-118   
gb|AFK43278.1|  unknown                                                 358   2e-118   
ref|XP_010558492.1|  PREDICTED: RING finger and CHY zinc finger d...    358   2e-118   
emb|CDX70831.1|  BnaC03g09150D                                          358   2e-118   
ref|XP_006600216.1|  PREDICTED: uncharacterized protein LOC100812...    358   3e-118   
ref|XP_009791774.1|  PREDICTED: RING finger and CHY zinc finger d...    358   3e-118   
ref|XP_006855440.1|  hypothetical protein AMTR_s00057p00167230          358   4e-118   
ref|XP_009126278.1|  PREDICTED: RING finger and CHY zinc finger d...    357   1e-117   
ref|XP_011013257.1|  PREDICTED: RING finger and CHY zinc finger d...    356   2e-117   
ref|XP_010321192.1|  PREDICTED: RING finger and CHY zinc finger d...    356   4e-117   
ref|XP_006352808.1|  PREDICTED: RING finger and CHY zinc finger d...    352   2e-116   
ref|XP_010069985.1|  PREDICTED: RING finger and CHY zinc finger d...    355   2e-116   
ref|XP_008804577.1|  PREDICTED: RING finger and CHY zinc finger d...    352   9e-116   
ref|XP_002442253.1|  hypothetical protein SORBIDRAFT_08g017080          352   1e-115   Sorghum bicolor [broomcorn]
ref|XP_009592577.1|  PREDICTED: RING finger and CHY zinc finger d...    351   2e-115   
ref|XP_007223129.1|  hypothetical protein PRUPE_ppa010024mg             349   4e-115   
gb|KDO75132.1|  hypothetical protein CISIN_1g024406mg                   348   1e-114   
ref|XP_008796207.1|  PREDICTED: RING finger and CHY zinc finger d...    348   1e-114   
ref|XP_006664079.1|  PREDICTED: RING finger and CHY zinc finger d...    349   3e-114   
ref|NP_001066941.1|  Os12g0538500                                       348   4e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938706.1|  PREDICTED: RING finger and CHY zinc finger d...    347   5e-114   
ref|XP_003575752.1|  PREDICTED: RING finger and CHY zinc finger d...    348   7e-114   
ref|XP_010558491.1|  PREDICTED: RING finger and CHY zinc finger d...    347   1e-113   
ref|XP_009791777.1|  PREDICTED: RING finger and CHY zinc finger d...    346   2e-113   
ref|XP_004962843.1|  PREDICTED: RING finger and CHY zinc finger d...    346   5e-113   
ref|NP_001149168.1|  RING finger and CHY zinc finger domain-conta...    343   7e-112   Zea mays [maize]
emb|CDY02605.1|  BnaC02g08300D                                          341   8e-112   
ref|XP_009378905.1|  PREDICTED: RING finger and CHY zinc finger d...    340   2e-111   
ref|XP_009414189.1|  PREDICTED: RING finger and CHY zinc finger d...    340   3e-111   
ref|XP_006419637.1|  hypothetical protein CICLE_v10005640mg             332   1e-108   
gb|KCW84421.1|  hypothetical protein EUGRSUZ_B01270                     332   1e-108   
gb|EPS67024.1|  hypothetical protein M569_07750                         333   2e-108   
gb|KDO75133.1|  hypothetical protein CISIN_1g024406mg                   332   2e-108   
gb|KCW84422.1|  hypothetical protein EUGRSUZ_B01270                     333   2e-108   
ref|XP_008804578.1|  PREDICTED: RING finger and CHY zinc finger d...    331   1e-107   
ref|XP_010524761.1|  PREDICTED: RING finger and CHY zinc finger d...    329   2e-107   
gb|ADE76339.1|  unknown                                                 330   5e-107   
ref|XP_011033604.1|  PREDICTED: RING finger and CHY zinc finger d...    327   2e-106   
ref|XP_007050802.1|  Zinc finger (C3HC4-type RING finger) family ...    322   7e-105   
ref|XP_007223131.1|  hypothetical protein PRUPE_ppa010024mg             321   2e-104   
gb|KDO75135.1|  hypothetical protein CISIN_1g024406mg                   320   5e-104   
gb|KDO75134.1|  hypothetical protein CISIN_1g024406mg                   317   5e-103   
gb|KFK26102.1|  hypothetical protein AALP_AA8G203200                    317   2e-102   
gb|KDO75136.1|  hypothetical protein CISIN_1g024406mg                   316   2e-102   
ref|XP_010048087.1|  PREDICTED: RING finger and CHY zinc finger d...    319   3e-102   
ref|XP_010241800.1|  PREDICTED: RING finger and CHY zinc finger d...    317   7e-102   
gb|KDP34238.1|  hypothetical protein JCGZ_07809                         319   1e-101   
ref|XP_002520677.1|  zinc finger protein, putative                      317   1e-101   Ricinus communis
gb|KHG16470.1|  Rchy1                                                   317   2e-101   
ref|XP_007223304.1|  hypothetical protein PRUPE_ppa009486mg             315   3e-101   
ref|XP_008393999.1|  PREDICTED: RING finger and CHY zinc finger d...    314   9e-101   
emb|CBI20950.3|  unnamed protein product                                313   2e-100   
ref|XP_002284652.1|  PREDICTED: RING finger and CHY zinc finger d...    314   2e-100   Vitis vinifera
ref|XP_010098324.1|  RING finger and CHY zinc finger domain-conta...    311   3e-100   
ref|XP_009348444.1|  PREDICTED: RING finger and CHY zinc finger d...    312   5e-100   
gb|ACN43326.1|  zinc-finger transcription factor                        313   6e-100   Ananas comosus
ref|XP_004291409.1|  PREDICTED: RING finger and CHY zinc finger d...    311   8e-100   
ref|XP_008219836.1|  PREDICTED: RING finger and CHY zinc finger d...    311   1e-99    
ref|XP_010541642.1|  PREDICTED: RING finger and CHY zinc finger d...    311   1e-99    
ref|XP_010649779.1|  PREDICTED: RING finger and CHY zinc finger d...    308   1e-99    
ref|XP_008808866.1|  PREDICTED: RING finger and CHY zinc finger d...    312   1e-99    
ref|XP_003636900.1|  RING finger and CHY zinc finger domain-conta...    311   1e-99    
ref|XP_004136332.1|  PREDICTED: RING finger and CHY zinc finger d...    311   2e-99    
gb|KDP43965.1|  hypothetical protein JCGZ_05432                         310   3e-99    
ref|XP_002309580.1|  zinc finger family protein                         310   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002314304.1|  zinc finger family protein                         310   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008466355.1|  PREDICTED: RING finger and CHY zinc finger d...    311   4e-99    
ref|XP_006450583.1|  hypothetical protein CICLE_v10008946mg             311   4e-99    
ref|XP_011019697.1|  PREDICTED: RING finger and CHY zinc finger d...    310   4e-99    
ref|XP_009349743.1|  PREDICTED: RING finger and CHY zinc finger d...    310   5e-99    
ref|XP_006419634.1|  hypothetical protein CICLE_v10005640mg             307   6e-99    
ref|XP_007035497.1|  CHY-type/CTCHY-type/RING-type Zinc finger pr...    307   6e-99    
ref|XP_009377374.1|  PREDICTED: RING finger and CHY zinc finger d...    309   7e-99    
ref|XP_011018804.1|  PREDICTED: RING finger and CHY zinc finger d...    308   1e-98    
ref|XP_010249808.1|  PREDICTED: RING finger and CHY zinc finger d...    310   2e-98    
ref|XP_006844347.1|  hypothetical protein AMTR_s00142p00031670          310   2e-98    
ref|XP_010421413.1|  PREDICTED: RING finger and CHY zinc finger d...    309   2e-98    
ref|XP_002274709.1|  PREDICTED: RING finger and CHY zinc finger d...    308   3e-98    Vitis vinifera
ref|XP_011032318.1|  PREDICTED: RING finger and CHY zinc finger d...    308   3e-98    
ref|XP_011032319.1|  PREDICTED: RING finger and CHY zinc finger d...    308   3e-98    
gb|EEE55306.1|  hypothetical protein OsJ_03270                          308   3e-98    Oryza sativa Japonica Group [Japonica rice]
gb|AAS87371.1|  zinc finger protein                                     308   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|NP_197938.2|  CHY and CTCHY and RING-type zinc finger protein       308   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001044081.1|  Os01g0719100                                       308   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010049052.1|  PREDICTED: RING finger and CHY zinc finger d...    308   4e-98    
ref|XP_007016889.1|  PGPD14 isoform 1                                   307   5e-98    
ref|XP_007013714.1|  CHY-type/CTCHY-type/RING-type Zinc finger pr...    308   6e-98    
ref|XP_009803954.1|  PREDICTED: RING finger and CHY zinc finger d...    304   6e-98    
ref|XP_006394808.1|  hypothetical protein EUTSA_v10004654mg             307   1e-97    
ref|XP_006476171.1|  PREDICTED: RING finger and CHY zinc finger d...    307   1e-97    
ref|XP_009377050.1|  PREDICTED: RING finger and CHY zinc finger d...    306   1e-97    
ref|XP_006381379.1|  hypothetical protein POPTR_0006s12360g             305   1e-97    
gb|KCW84420.1|  hypothetical protein EUGRSUZ_B01270                     303   1e-97    
ref|XP_004143281.1|  PREDICTED: RING finger and CHY zinc finger d...    306   1e-97    
gb|KEH24054.1|  CHY and CTCHY and RING-type zinc finger protein         306   2e-97    
ref|XP_008241382.1|  PREDICTED: RING finger and CHY zinc finger d...    306   2e-97    
ref|XP_004498614.1|  PREDICTED: RING finger and CHY zinc finger d...    306   2e-97    
ref|XP_010098810.1|  RING finger and CHY zinc finger domain-conta...    306   4e-97    
ref|XP_009616325.1|  PREDICTED: RING finger and CHY zinc finger d...    306   4e-97    
ref|XP_010917209.1|  PREDICTED: RING finger and CHY zinc finger d...    305   4e-97    
ref|XP_002965961.1|  hypothetical protein SELMODRAFT_230701             304   7e-97    
ref|NP_001050105.1|  Os03g0348900                                       303   9e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088795.1|  PREDICTED: RING finger and CHY zinc finger d...    304   1e-96    
ref|XP_007202397.1|  hypothetical protein PRUPE_ppa009440mg             304   1e-96    
ref|XP_004246608.1|  PREDICTED: RING finger and CHY zinc finger d...    303   1e-96    
ref|XP_006424450.1|  hypothetical protein CICLE_v10028942mg             304   1e-96    
ref|XP_008466354.1|  PREDICTED: RING finger and CHY zinc finger d...    304   1e-96    
ref|XP_010454896.1|  PREDICTED: RING finger and CHY zinc finger d...    304   1e-96    
ref|XP_006356627.1|  PREDICTED: RING finger and CHY zinc finger d...    304   2e-96    
ref|XP_009776916.1|  PREDICTED: RING finger and CHY zinc finger d...    304   2e-96    
ref|XP_002962819.1|  hypothetical protein SELMODRAFT_78412              303   2e-96    
ref|XP_010031414.1|  PREDICTED: RING finger and CHY zinc finger d...    302   2e-96    
emb|CDY54900.1|  BnaC02g48590D                                          303   2e-96    
ref|XP_001783611.1|  predicted protein                                  304   2e-96    
gb|KDO79670.1|  hypothetical protein CISIN_1g021012mg                   304   2e-96    
ref|XP_010670776.1|  PREDICTED: RING finger and CHY zinc finger d...    303   2e-96    
emb|CDM83539.1|  unnamed protein product                                303   3e-96    
ref|XP_008451651.1|  PREDICTED: RING finger and CHY zinc finger d...    303   3e-96    
ref|XP_002872173.1|  zinc finger family protein                         303   4e-96    
gb|AAD02556.1|  PGPD14                                                  302   4e-96    Petunia x hybrida [garden petunia]
ref|XP_008462499.1|  PREDICTED: RING finger and CHY zinc finger d...    302   4e-96    
ref|XP_010493817.1|  PREDICTED: RING finger and CHY zinc finger d...    303   5e-96    
ref|XP_006644631.1|  PREDICTED: RING finger and CHY zinc finger d...    303   5e-96    
gb|EYU41597.1|  hypothetical protein MIMGU_mgv1a011316mg                302   5e-96    
ref|XP_010541308.1|  PREDICTED: RING finger and CHY zinc finger d...    302   6e-96    
emb|CDP15288.1|  unnamed protein product                                301   6e-96    
ref|NP_001146901.1|  RING finger and CHY zinc finger domain-conta...    302   7e-96    Zea mays [maize]
gb|KHG29610.1|  RING finger and CHY zinc finger domain-containing 1     301   8e-96    
ref|XP_009385607.1|  PREDICTED: RING finger and CHY zinc finger d...    302   8e-96    
ref|XP_006488004.1|  PREDICTED: RING finger and CHY zinc finger d...    301   1e-95    
ref|XP_003569693.1|  PREDICTED: RING finger and CHY zinc finger d...    301   1e-95    
ref|XP_008807700.1|  PREDICTED: RING finger and CHY zinc finger d...    300   1e-95    
ref|XP_008661955.1|  PREDICTED: RING finger and CHY zinc finger d...    300   1e-95    
gb|KDO79675.1|  hypothetical protein CISIN_1g021012mg                   299   1e-95    
ref|XP_006288312.1|  hypothetical protein CARUB_v10001557mg             301   1e-95    
ref|XP_004501268.1|  PREDICTED: RING finger and CHY zinc finger d...    300   2e-95    
ref|XP_006354387.1|  PREDICTED: RING finger and CHY zinc finger d...    300   3e-95    
ref|XP_006650078.1|  PREDICTED: uncharacterized RING finger prote...    299   3e-95    
ref|XP_002268149.1|  PREDICTED: RING finger and CHY zinc finger d...    300   3e-95    Vitis vinifera
gb|EMS60697.1|  RING finger and CHY zinc finger domain-containing...    300   3e-95    
ref|XP_004969767.1|  PREDICTED: RING finger and CHY zinc finger d...    300   4e-95    
ref|XP_011081857.1|  PREDICTED: RING finger and CHY zinc finger d...    301   4e-95    
emb|CDP07032.1|  unnamed protein product                                300   4e-95    
gb|KHG03356.1|  RING finger and CHY zinc finger domain-containing 1     300   4e-95    
ref|NP_001190396.1|  CHY and CTCHY and RING-type zinc finger protein    300   5e-95    
gb|KDO79668.1|  hypothetical protein CISIN_1g021012mg                   300   5e-95    
gb|KDP29187.1|  hypothetical protein JCGZ_16576                         299   6e-95    
ref|XP_006601111.1|  PREDICTED: RING finger and CHY zinc finger d...    300   7e-95    
ref|XP_003603490.1|  RING finger and CHY zinc finger domain-conta...    300   8e-95    
gb|KHN12074.1|  RING finger and CHY zinc finger domain-containing...    299   1e-94    
ref|XP_006354386.1|  PREDICTED: RING finger and CHY zinc finger d...    300   1e-94    
gb|ACG32069.1|  RING finger and CHY zinc finger domain-containing...    299   1e-94    Zea mays [maize]
ref|XP_007161277.1|  hypothetical protein PHAVU_001G056800g             299   1e-94    
ref|XP_010031413.1|  PREDICTED: RING finger and CHY zinc finger d...    299   1e-94    
ref|XP_010918917.1|  PREDICTED: RING finger and CHY zinc finger d...    297   2e-94    
ref|XP_009775005.1|  PREDICTED: RING finger and CHY zinc finger d...    298   2e-94    
ref|XP_009622097.1|  PREDICTED: RING finger and CHY zinc finger d...    297   2e-94    
ref|XP_009129952.1|  PREDICTED: RING finger and CHY zinc finger d...    298   4e-94    
ref|XP_011088380.1|  PREDICTED: RING finger and CHY zinc finger d...    299   4e-94    
ref|XP_008777184.1|  PREDICTED: RING finger and CHY zinc finger d...    298   5e-94    
ref|XP_003544629.1|  PREDICTED: RING finger and CHY zinc finger d...    298   5e-94    
ref|XP_007137091.1|  hypothetical protein PHAVU_009G099000g             297   5e-94    
ref|XP_011094586.1|  PREDICTED: RING finger and CHY zinc finger d...    297   5e-94    
ref|XP_004245246.1|  PREDICTED: RING finger and CHY zinc finger d...    297   6e-94    
ref|XP_010918914.1|  PREDICTED: RING finger and CHY zinc finger d...    298   6e-94    
ref|XP_010689159.1|  PREDICTED: RING finger and CHY zinc finger d...    296   6e-94    
ref|XP_010918915.1|  PREDICTED: RING finger and CHY zinc finger d...    298   6e-94    
gb|EEC71394.1|  hypothetical protein OsI_03534                          297   8e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_010232246.1|  PREDICTED: RING finger and CHY zinc finger d...    296   8e-94    
ref|XP_001779631.1|  predicted protein                                  296   9e-94    
ref|XP_009411360.1|  PREDICTED: RING finger and CHY zinc finger d...    295   1e-93    
gb|KHN16479.1|  RING finger and CHY zinc finger domain-containing...    296   1e-93    
ref|XP_007050800.1|  Zinc finger (C3HC4-type RING finger) family ...    293   1e-93    
ref|NP_001276312.1|  RING finger and CHY zinc finger domain-conta...    296   1e-93    
ref|XP_009767317.1|  PREDICTED: RING finger and CHY zinc finger d...    295   1e-93    
gb|EYU38573.1|  hypothetical protein MIMGU_mgv1a011310mg                295   1e-93    
ref|XP_004982968.1|  PREDICTED: RING finger and CHY zinc finger d...    295   1e-93    
ref|XP_007027465.1|  PGPD14 isoform 1                                   295   2e-93    
ref|XP_004145767.1|  PREDICTED: RING finger and CHY zinc finger d...    296   2e-93    
ref|XP_011077302.1|  PREDICTED: RING finger and CHY zinc finger d...    295   2e-93    
ref|XP_010421416.1|  PREDICTED: RING finger and CHY zinc finger d...    295   4e-93    
ref|XP_004501269.1|  PREDICTED: RING finger and CHY zinc finger d...    294   5e-93    
ref|XP_004166307.1|  PREDICTED: RING finger and CHY zinc finger d...    294   7e-93    
ref|XP_004984391.1|  PREDICTED: RING finger and CHY zinc finger d...    293   7e-93    
gb|ACU23480.1|  unknown                                                 293   1e-92    Glycine max [soybeans]
ref|XP_003538164.1|  PREDICTED: RING finger and CHY zinc finger d...    293   1e-92    
ref|XP_008465416.1|  PREDICTED: RING finger and CHY zinc finger d...    294   1e-92    
ref|XP_001760889.1|  predicted protein                                  291   2e-92    
ref|XP_003603492.1|  RING finger and CHY zinc finger domain-conta...    293   2e-92    
ref|NP_001190397.1|  CHY and CTCHY and RING-type zinc finger protein    293   2e-92    
ref|XP_002464531.1|  hypothetical protein SORBIDRAFT_01g020210          291   3e-92    
ref|XP_008801218.1|  PREDICTED: RING finger and CHY zinc finger d...    291   5e-92    
ref|XP_004304477.1|  PREDICTED: RING finger and CHY zinc finger d...    291   6e-92    
ref|XP_002519457.1|  zinc finger protein, putative                      291   6e-92    
gb|AFK44622.1|  unknown                                                 291   7e-92    
gb|ABF93958.1|  CHY zinc finger family protein, expressed               290   1e-91    
ref|NP_001140779.1|  uncharacterized LOC100272854                       289   1e-91    
ref|XP_010933180.1|  PREDICTED: RING finger and CHY zinc finger d...    290   1e-91    
gb|AES88531.2|  RING finger and CHY zinc finger protein                 290   2e-91    
ref|XP_001761915.1|  predicted protein                                  289   2e-91    
ref|NP_001131624.1|  LOC100192978                                       289   2e-91    
gb|AAM65683.1|  PGPD14 protein                                          289   2e-91    
ref|XP_002465277.1|  hypothetical protein SORBIDRAFT_01g035440          288   3e-91    
ref|XP_003557917.1|  PREDICTED: RING finger and CHY zinc finger d...    289   3e-91    
ref|NP_197683.1|  ring finger and CHY zinc finger domain-containi...    290   3e-91    
dbj|BAJ84835.1|  predicted protein                                      288   3e-91    
ref|XP_006581390.1|  PREDICTED: RING finger and CHY zinc finger d...    290   3e-91    
ref|XP_010454570.1|  PREDICTED: RING finger and CHY zinc finger d...    290   4e-91    
ref|XP_010421090.1|  PREDICTED: RING finger and CHY zinc finger d...    290   4e-91    
ref|XP_010454898.1|  PREDICTED: RING finger and CHY zinc finger d...    290   4e-91    
ref|XP_010493400.1|  PREDICTED: RING finger and CHY zinc finger d...    289   7e-91    
ref|XP_006649394.1|  PREDICTED: RING finger and CHY zinc finger d...    288   9e-91    
ref|XP_006400801.1|  hypothetical protein EUTSA_v10014246mg             288   1e-90    
ref|XP_009131897.1|  PREDICTED: RING finger and CHY zinc finger d...    288   1e-90    
gb|ACY95279.1|  unknown                                                 287   2e-90    
gb|KFK27611.1|  hypothetical protein AALP_AA8G406100                    288   2e-90    
ref|XP_008645250.1|  PREDICTED: LOC100192978 isoform X2                 287   2e-90    
emb|CDX71021.1|  BnaC03g11050D                                          287   3e-90    
ref|XP_002523718.1|  zinc finger protein, putative                      286   3e-90    
ref|XP_004506073.1|  PREDICTED: RING finger and CHY zinc finger d...    286   5e-90    
ref|XP_004984393.1|  PREDICTED: RING finger and CHY zinc finger d...    285   5e-90    
ref|XP_003558822.1|  PREDICTED: RING finger and CHY zinc finger d...    285   6e-90    
ref|XP_002468512.1|  hypothetical protein SORBIDRAFT_01g047160          285   7e-90    
ref|XP_001772470.1|  predicted protein                                  285   8e-90    
ref|XP_002872024.1|  zinc finger family protein                         285   2e-89    
ref|XP_006661828.1|  PREDICTED: RING finger and CHY zinc finger d...    284   2e-89    
ref|XP_006288362.1|  hypothetical protein CARUB_v10001610mg             285   3e-89    
ref|XP_003606334.1|  RING finger and CHY zinc finger domain-conta...    285   3e-89    
ref|XP_008676639.1|  PREDICTED: uncharacterized protein LOC100192...    283   3e-89    
dbj|BAJ99419.1|  predicted protein                                      283   4e-89    
ref|XP_005650411.1|  PGPD14 protein                                     283   5e-89    
ref|XP_009775008.1|  PREDICTED: RING finger and CHY zinc finger d...    284   5e-89    
gb|KDO79669.1|  hypothetical protein CISIN_1g021012mg                   284   6e-89    
emb|CDY50333.1|  BnaA10g13660D                                          283   8e-89    
ref|XP_009120622.1|  PREDICTED: RING finger and CHY zinc finger d...    283   2e-88    
tpg|DAA43349.1|  TPA: putative RING zinc finger domain superfamil...    286   2e-88    
tpg|DAA43347.1|  TPA: putative RING zinc finger domain superfamil...    287   2e-88    
ref|XP_010232248.1|  PREDICTED: RING finger and CHY zinc finger d...    282   2e-88    
ref|XP_010918916.1|  PREDICTED: RING finger and CHY zinc finger d...    283   2e-88    
gb|KCW80218.1|  hypothetical protein EUGRSUZ_C01569                     282   3e-88    
emb|CDP18436.1|  unnamed protein product                                283   4e-88    
ref|XP_004985726.1|  PREDICTED: RING finger and CHY zinc finger d...    279   1e-87    
gb|EEC67089.1|  hypothetical protein OsI_33881                          278   3e-87    
ref|XP_008465417.1|  PREDICTED: RING finger and CHY zinc finger d...    278   9e-87    
ref|XP_003574001.1|  PREDICTED: RING finger and CHY zinc finger d...    277   1e-86    
ref|XP_001703786.1|  predicted protein                                  276   1e-86    
ref|NP_001078621.1|  CHY and CTCHY and RING-type zinc finger protein    278   2e-86    
ref|XP_002949777.1|  hypothetical protein VOLCADRAFT_59540              276   3e-86    
ref|NP_001064757.1|  Os10g0456800                                       276   4e-86    
ref|XP_004982969.1|  PREDICTED: RING finger and CHY zinc finger d...    275   6e-86    
ref|XP_008645215.1|  PREDICTED: LOC100192978 isoform X1                 275   9e-86    
ref|XP_003520663.1|  PREDICTED: RING finger and CHY zinc finger d...    276   1e-85    
ref|XP_006577039.1|  PREDICTED: RING finger and CHY zinc finger d...    275   2e-85    
gb|ADA85908.1|  CHY-type zinc finger protein                            275   2e-85    
gb|ACG31879.1|  RING finger and CHY zinc finger domain-containing...    274   4e-85    
gb|KCW81513.1|  hypothetical protein EUGRSUZ_C02874                     275   6e-85    
gb|EFW45356.2|  CHY zinc finger family protein                          276   1e-84    
ref|XP_006288311.1|  hypothetical protein CARUB_v10001557mg             271   3e-84    
ref|XP_004506074.1|  PREDICTED: RING finger and CHY zinc finger d...    270   3e-84    
ref|XP_010229220.1|  PREDICTED: RING finger and CHY zinc finger d...    271   3e-84    
ref|XP_008667057.1|  PREDICTED: uncharacterized LOC100272854 isof...    271   6e-84    
gb|EEC74516.1|  hypothetical protein OsI_10008                          276   6e-84    
gb|KDO79671.1|  hypothetical protein CISIN_1g021012mg                   271   1e-83    
ref|XP_004985724.1|  PREDICTED: RING finger and CHY zinc finger d...    270   1e-83    
ref|XP_006424449.1|  hypothetical protein CICLE_v10028942mg             268   2e-83    
ref|XP_009592578.1|  PREDICTED: RING finger and CHY zinc finger d...    266   2e-83    
gb|ADK63411.1|  C3HC4 type zinc finger protein                          265   4e-83    
ref|XP_005849374.1|  hypothetical protein CHLNCDRAFT_21534              267   1e-82    
ref|XP_011088461.1|  PREDICTED: RING finger and CHY zinc finger d...    268   1e-82    
emb|CDY26969.1|  BnaC09g36140D                                          268   2e-82    
gb|KCW50711.1|  hypothetical protein EUGRSUZ_J00388                     264   3e-82    
ref|XP_011088221.1|  PREDICTED: RING finger and CHY zinc finger d...    268   3e-82    
gb|KCW50712.1|  hypothetical protein EUGRSUZ_J00388                     261   3e-81    
gb|KFG48265.1|  CHY zinc finger domain-containing protein               267   3e-81    
gb|KFG50865.1|  CHY zinc finger domain-containing protein               267   3e-81    
ref|XP_002367955.1|  zinc finger (CHY type) protein, putative           267   3e-81    
ref|XP_009622100.1|  PREDICTED: RING finger and CHY zinc finger d...    261   5e-81    
gb|KFH03173.1|  CHY zinc finger domain-containing protein               266   6e-81    
ref|XP_009767321.1|  PREDICTED: RING finger and CHY zinc finger d...    260   9e-81    
gb|EPR64154.1|  CHY zinc finger domain-containing protein               268   1e-80    
ref|XP_007016892.1|  PGPD14 isoform 4                                   261   1e-80    
ref|XP_008357490.1|  PREDICTED: RING finger and CHY zinc finger d...    263   4e-80    
ref|XP_006424448.1|  hypothetical protein CICLE_v10028942mg             258   1e-79    
gb|KHG04557.1|  RING finger and CHY zinc finger domain-containing 1     257   1e-79    
gb|KDD73818.1|  hypothetical protein H632_c1816p1                       262   1e-79    
emb|CDJ63925.1|  zinc finger (CHY type) protein, putative               264   2e-79    
emb|CDJ38348.1|  zinc finger (CHY type) protein, putative               263   2e-79    
gb|EPT29023.1|  CHY zinc finger domain-containing protein               267   6e-79    
gb|EMT33866.1|  RING finger and CHY zinc finger domain-containing...    256   8e-79    
ref|XP_007132335.1|  hypothetical protein PHAVU_011G086000g             256   4e-78    
ref|XP_010095496.1|  RING finger and CHY zinc finger domain-conta...    256   5e-78    
ref|XP_004364201.1|  CHY zinc finger family protein                     257   2e-77    
gb|AEA86318.1|  RING finger and CHY zinc finger domain-containing...    248   3e-77    
gb|ELU11950.1|  hypothetical protein CAPTEDRAFT_144246                  252   6e-77    
ref|XP_007027467.1|  PGPD14 isoform 3                                   251   7e-77    
ref|XP_002516599.1|  zinc finger protein, putative                      258   7e-77    
gb|KEH29953.1|  RING finger and CHY zinc finger protein                 248   5e-76    
gb|ABF95920.1|  CHY zinc finger family protein, expressed               246   9e-76    
gb|ABF93959.1|  CHY zinc finger family protein, expressed               248   6e-75    
ref|XP_006825159.1|  PREDICTED: RING finger and CHY zinc finger d...    247   9e-75    
ref|XP_006419636.1|  hypothetical protein CICLE_v10005640mg             243   2e-74    
ref|XP_004985727.1|  PREDICTED: RING finger and CHY zinc finger d...    244   2e-74    
gb|AAP54090.2|  CHY zinc finger family protein, expressed               242   3e-73    
gb|KEH39802.1|  CHY and CTCHY and RING-type zinc finger protein         239   8e-73    
ref|XP_006601113.1|  PREDICTED: RING finger and CHY zinc finger d...    238   3e-72    
ref|XP_001622661.1|  predicted protein                                  240   1e-71    
ref|XP_006624591.1|  PREDICTED: RING finger and CHY zinc finger d...    236   6e-71    
ref|XP_006624590.1|  PREDICTED: RING finger and CHY zinc finger d...    236   7e-71    
ref|XP_004924232.1|  PREDICTED: RING finger and CHY zinc finger d...    238   8e-71    
ref|XP_392132.1|  PREDICTED: RING finger and CHY zinc finger doma...    236   1e-70    
ref|XP_006569663.1|  PREDICTED: RING finger and CHY zinc finger d...    236   1e-70    
ref|XP_006569662.1|  PREDICTED: RING finger and CHY zinc finger d...    236   1e-70    
gb|KFG55506.1|  CHY zinc finger domain-containing protein               234   2e-70    
ref|XP_003491672.1|  PREDICTED: RING finger and CHY zinc finger d...    235   3e-70    
ref|XP_003396298.1|  PREDICTED: RING finger and CHY zinc finger d...    234   5e-70    
ref|XP_010670778.1|  PREDICTED: RING finger and CHY zinc finger d...    233   8e-70    
ref|XP_006837934.1|  hypothetical protein AMTR_s00102p00024480          231   9e-70    
gb|AAH78283.1|  Ring finger and CHY zinc finger domain containing 1     233   1e-69    
gb|EFN63072.1|  RING finger and CHY zinc finger domain-containing...    236   1e-69    
ref|NP_001088749.1|  ring finger and CHY zinc finger domain conta...    232   1e-69    
emb|CDJ59424.1|  zinc finger (CHY type) protein, putative               238   1e-69    
gb|AAH23138.1|  Ring finger and CHY zinc finger domain containing 1     232   2e-69    
ref|XP_005485711.1|  PREDICTED: RING finger and CHY zinc finger d...    232   2e-69    
ref|NP_001011487.1|  ring finger and CHY zinc finger domain conta...    231   3e-69    
ref|XP_003706619.1|  PREDICTED: RING finger and CHY zinc finger d...    232   3e-69    
ref|XP_001600072.2|  PREDICTED: RING finger and CHY zinc finger d...    233   3e-69    
ref|NP_997765.1|  RING finger and CHY zinc finger domain-containi...    232   3e-69    
ref|XP_009061709.1|  hypothetical protein LOTGIDRAFT_194257             231   3e-69    
gb|EHJ74327.1|  putative vitellogenin                                   234   3e-69    
ref|XP_003511665.1|  PREDICTED: RING finger and CHY zinc finger d...    231   4e-69    
gb|ERE89217.1|  RING finger and CHY zinc finger domain-containing...    231   9e-69    
gb|EZA54153.1|  RING finger and CHY zinc finger domain-containing...    233   1e-68    
ref|XP_010340906.1|  PREDICTED: RING finger and CHY zinc finger d...    230   1e-68    
ref|XP_010875196.1|  PREDICTED: RING finger and CHY zinc finger d...    231   1e-68    
ref|XP_005068209.1|  PREDICTED: RING finger and CHY zinc finger d...    230   1e-68    
ref|XP_002193688.1|  PREDICTED: RING finger and CHY zinc finger d...    230   1e-68    
ref|XP_010519926.1|  PREDICTED: LOW QUALITY PROTEIN: RING finger ...    231   1e-68    
ref|XP_010375428.1|  PREDICTED: RING finger and CHY zinc finger d...    230   1e-68    
gb|EPS66014.1|  hypothetical protein M569_08763                         227   2e-68    
gb|KDR12931.1|  RING finger and CHY zinc finger domain-containing...    230   2e-68    
ref|XP_006627322.1|  PREDICTED: RING finger and CHY zinc finger d...    229   2e-68    
gb|AAK96896.1|AF255666_1  CHIMP                                         229   2e-68    
ref|NP_080833.1|  RING finger and CHY zinc finger domain-containi...    229   2e-68    
ref|NP_056251.2|  RING finger and CHY zinc finger domain-containi...    229   2e-68    
gb|AAH47393.1|  Ring finger and CHY zinc finger domain containing 1     229   2e-68    
emb|CDQ64575.1|  unnamed protein product                                229   3e-68    
ref|XP_004703259.1|  PREDICTED: RING finger and CHY zinc finger d...    229   3e-68    
ref|XP_008635642.1|  PREDICTED: RING finger and CHY zinc finger d...    229   3e-68    
gb|KFO61974.1|  RING finger and CHY zinc finger domain-containing...    229   3e-68    
ref|XP_006993567.1|  PREDICTED: RING finger and CHY zinc finger d...    229   3e-68    
ref|NP_001048953.1|  Os03g0145900                                       228   3e-68    
ref|XP_008559363.1|  PREDICTED: RING finger and CHY zinc finger d...    230   4e-68    
gb|KEH24055.1|  CHY and CTCHY and RING-type zinc finger protein         227   4e-68    
gb|AAK96899.1|AF276959_1  CH-rich interacting match of PLAG1            229   5e-68    
ref|XP_009096731.1|  PREDICTED: RING finger and CHY zinc finger d...    229   5e-68    
gb|EFX90003.1|  hypothetical protein DAPPUDRAFT_190026                  229   5e-68    
ref|NP_001007619.1|  RING finger and CHY zinc finger domain-conta...    229   5e-68    
emb|CAG02458.1|  unnamed protein product                                228   6e-68    
ref|NP_001074357.1|  RING finger and CHY zinc finger domain-conta...    228   6e-68    
ref|XP_008565530.1|  PREDICTED: RING finger and CHY zinc finger d...    228   8e-68    
ref|XP_006142996.1|  PREDICTED: RING finger and CHY zinc finger d...    228   8e-68    
ref|XP_517222.1|  PREDICTED: RING finger and CHY zinc finger doma...    228   9e-68    
dbj|BAI46763.1|  ring finger and CHY zinc finger domain containing 1    228   1e-67    
ref|XP_004506076.1|  PREDICTED: RING finger and CHY zinc finger d...    227   1e-67    
ref|XP_005802188.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_008415913.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_002717057.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
dbj|BAD92309.1|  RING finger and CHY zinc finger domain containin...    228   1e-67    
gb|KHN18686.1|  RING finger and CHY zinc finger domain-containing...    229   1e-67    
ref|XP_002745761.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_005359543.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_007890078.1|  PREDICTED: RING finger and CHY zinc finger d...    227   1e-67    
ref|XP_002131327.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_006994501.1|  PREDICTED: RING finger and CHY zinc finger d...    228   1e-67    
ref|XP_004681266.1|  PREDICTED: RING finger and CHY zinc finger d...    227   2e-67    
ref|XP_005333288.1|  PREDICTED: RING finger and CHY zinc finger d...    227   2e-67    
emb|CDW75431.1|  ring finger and chy zinc finger domain-containin...    227   2e-67    
ref|XP_006176389.1|  PREDICTED: RING finger and CHY zinc finger d...    227   2e-67    
ref|XP_008841712.1|  PREDICTED: RING finger and CHY zinc finger d...    227   3e-67    
ref|XP_006198312.1|  PREDICTED: RING finger and CHY zinc finger d...    227   3e-67    
ref|XP_006907712.1|  PREDICTED: RING finger and CHY zinc finger d...    226   3e-67    
ref|XP_005532225.1|  PREDICTED: RING finger and CHY zinc finger d...    226   3e-67    
ref|XP_006898515.1|  PREDICTED: RING finger and CHY zinc finger d...    226   4e-67    
ref|XP_006059715.1|  PREDICTED: RING finger and CHY zinc finger d...    226   4e-67    
ref|XP_007564804.1|  PREDICTED: RING finger and CHY zinc finger d...    227   4e-67    
ref|XP_004629306.1|  PREDICTED: RING finger and CHY zinc finger d...    229   4e-67    
ref|XP_004383201.1|  PREDICTED: RING finger and CHY zinc finger d...    226   4e-67    
ref|XP_974078.2|  PREDICTED: RING finger and CHY zinc finger doma...    227   5e-67    
emb|CDH55706.1|  chy and ring finger domain-containing protein          231   6e-67    
ref|XP_004506075.1|  PREDICTED: RING finger and CHY zinc finger d...    225   7e-67    
ref|NP_001090959.1|  Pirh2                                              226   7e-67    
ref|XP_001375494.1|  PREDICTED: RING finger and CHY zinc finger d...    226   7e-67    
gb|EFA06902.1|  hypothetical protein TcasGA2_TC009851                   227   7e-67    
ref|XP_003414198.1|  PREDICTED: LOW QUALITY PROTEIN: RING finger ...    226   7e-67    
ref|XP_004617925.1|  PREDICTED: RING finger and CHY zinc finger d...    225   8e-67    
ref|XP_855781.3|  PREDICTED: RING finger and CHY zinc finger doma...    225   8e-67    
ref|XP_008991419.1|  PREDICTED: RING finger and CHY zinc finger d...    226   9e-67    
ref|XP_006871626.1|  PREDICTED: RING finger and CHY zinc finger d...    225   1e-66    
emb|CDI76202.1|  zinc finger (CHY type) protein, putative               231   1e-66    
ref|XP_004430894.1|  PREDICTED: RING finger and CHY zinc finger d...    225   1e-66    
ref|XP_005143071.1|  PREDICTED: RING finger and CHY zinc finger d...    224   1e-66    
ref|XP_008067236.1|  PREDICTED: RING finger and CHY zinc finger d...    225   1e-66    
ref|XP_008141897.1|  PREDICTED: RING finger and CHY zinc finger d...    225   1e-66    
ref|XP_006754633.1|  PREDICTED: RING finger and CHY zinc finger d...    225   1e-66    
ref|NP_001077223.1|  RING finger and CHY zinc finger domain-conta...    225   1e-66    
ref|XP_011063610.1|  PREDICTED: RING finger and CHY zinc finger d...    229   1e-66    



>ref|XP_009769467.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Nicotiana sylvestris]
Length=287

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 211/275 (77%), Positives = 237/275 (86%), Gaps = 3/275 (1%)
 Frame = -2

Query  1202  NMEVGDVTPTGVQLDDQT---VSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNE  1032
             N  V    P   + DD      S EDFGKML GCEHYRRRCK+RAPCCNEIFTCRHCHN+
Sbjct  6     NFVVNQPPPAPAEQDDHNDNNSSREDFGKMLHGCEHYRRRCKLRAPCCNEIFTCRHCHND  65

Query  1031  AKSGLSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTT  852
             AKS LS+PKERHELVR DVKQ++CAVC+TEQQVAGIC  CG+KFG+Y+CEICR YDDDTT
Sbjct  66    AKSALSNPKERHELVRHDVKQIVCAVCDTEQQVAGICSKCGIKFGEYYCEICRFYDDDTT  125

Query  851   KDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESL  672
             K Q+HC++CGICR+GGRENFFHC+KCGSCYSV LRDNHLCVENSMK++CPICYEFLF+S+
Sbjct  126   KGQFHCDDCGICRVGGRENFFHCRKCGSCYSVDLRDNHLCVENSMKNHCPICYEFLFDSV  185

Query  671   KSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY  492
             K T IMKCGHTMHM+CY +M+ QNQYRCPICSKSVLNMSRTWE L+ EI+ T MPEEY Y
Sbjct  186   KGTAIMKCGHTMHMECYTDMIQQNQYRCPICSKSVLNMSRTWERLDLEIEATAMPEEYRY  245

Query  491   EVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             EVPILCNDCN T  A FHILGHKCKHC+SYNTRM+
Sbjct  246   EVPILCNDCNCTGRAFFHILGHKCKHCNSYNTRMI  280



>ref|XP_009587771.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Nicotiana tomentosiformis]
Length=287

 Score =   447 bits (1149),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/275 (77%), Positives = 237/275 (86%), Gaps = 3/275 (1%)
 Frame = -2

Query  1202  NMEVGDVTPTGVQLDDQ---TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNE  1032
             N  V    P   + DD      S EDFGKML+GCEHYRRRCK+RAPCCNEIFTCRHCHN+
Sbjct  6     NFVVNQPPPAPAEQDDHDDNNSSREDFGKMLYGCEHYRRRCKLRAPCCNEIFTCRHCHND  65

Query  1031  AKSGLSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTT  852
             AKS LS+PKERHELVR DVKQV+CAVC+TEQQVAGIC  C +KFG+Y+CEICR YDDDTT
Sbjct  66    AKSALSNPKERHELVRHDVKQVVCAVCDTEQQVAGICSKCDIKFGEYYCEICRFYDDDTT  125

Query  851   KDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESL  672
             K Q+HC++CGICR+GGRENFFHC+KCGSCYSV L DNHLCVENSMK++CPICYEFLF+S+
Sbjct  126   KGQFHCDDCGICRVGGRENFFHCRKCGSCYSVDLCDNHLCVENSMKNHCPICYEFLFDSV  185

Query  671   KSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY  492
             K T IMKCGHTMHM+CY EM+HQNQYRCPICSKSVLNMS TWE L+ EI+ T MPEEY Y
Sbjct  186   KGTTIMKCGHTMHMECYTEMIHQNQYRCPICSKSVLNMSGTWERLDLEIEATAMPEEYRY  245

Query  491   EVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             EVPILCNDCN+T  A FHILGHKCKHC+SYNTRM+
Sbjct  246   EVPILCNDCNSTGRAFFHILGHKCKHCNSYNTRMI  280



>ref|XP_011079733.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Sesamum indicum]
Length=282

 Score =   439 bits (1128),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 204/270 (76%), Positives = 235/270 (87%), Gaps = 1/270 (0%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSD  1011
              DV  T  + DD T S +DFGK+L+GCEHYRRRCKIRAPCCN+IFTCRHCHNEA S LS+
Sbjct  8     ADVGRTQNRDDDNT-SRQDFGKLLYGCEHYRRRCKIRAPCCNQIFTCRHCHNEATSALSN  66

Query  1010  PKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCN  831
             PKERHE+VR DVKQV+CAVC TEQQV+ IC NC VKFG+YFC+IC+ YDDD TK+Q+HCN
Sbjct  67    PKERHEIVRHDVKQVVCAVCGTEQQVSNICSNCRVKFGEYFCDICKFYDDDITKEQFHCN  126

Query  830   ECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMK  651
             +CGICR+GGRENFFHC KCGSCYS+GLRDNHLCVE+SMKS+CPICYEFLF+S K T I+K
Sbjct  127   DCGICRVGGRENFFHCPKCGSCYSIGLRDNHLCVEDSMKSHCPICYEFLFDSTKQTTILK  186

Query  650   CGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCN  471
             CGHTMH++CY EM  QNQYRCPICSKSVLNMSRTWE L++EI+ T MPEEY YEV ILCN
Sbjct  187   CGHTMHVECYEEMFSQNQYRCPICSKSVLNMSRTWERLDQEIEATAMPEEYRYEVQILCN  246

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             DCNN S A FHI GHKC+HC+SYNTR++ +
Sbjct  247   DCNNRSKAFFHIFGHKCQHCNSYNTRVITS  276



>emb|CDP03541.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   433 bits (1113),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 201/283 (71%), Positives = 235/283 (83%), Gaps = 1/283 (0%)
 Frame = -2

Query  1235  QDNTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIF  1056
             +DN   P L    +         +  DQ  + ED+GK L+GCEHYRRRCK+R PCCN++F
Sbjct  5     EDNIPIPSLVDQPQENQEAAGDGESTDQP-NREDYGKTLYGCEHYRRRCKLRTPCCNQVF  63

Query  1055  TCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEIC  876
             TCRHCHNEA S LS+P+ERHELVR+DVKQVICAVCN EQ+V+G+C NCGVKFG+YFC IC
Sbjct  64    TCRHCHNEAMSVLSNPQERHELVRQDVKQVICAVCNIEQEVSGLCSNCGVKFGEYFCHIC  123

Query  875   RLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPIC  696
             R YDDDTTK Q+HC++CGICR+GGREN+FHC KCGSCYS+ LRDNH CVENSMK++CPIC
Sbjct  124   RFYDDDTTKKQFHCHDCGICRVGGRENYFHCPKCGSCYSIDLRDNHSCVENSMKNHCPIC  183

Query  695   YEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTT  516
             YEFLF+S+K T IMKCGHTMHMDCY EM+ Q+QYRCPICSKSV NMSRTWE L+ EI+ T
Sbjct  184   YEFLFDSIKGTTIMKCGHTMHMDCYSEMISQSQYRCPICSKSVFNMSRTWERLDLEIEAT  243

Query  515   VMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
              MPEEY YEV ILCNDCNNT  A+FHI GHKC+HC+SYNTRM+
Sbjct  244   AMPEEYRYEVSILCNDCNNTGKALFHIFGHKCRHCNSYNTRMI  286



>ref|XP_010323027.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Solanum lycopersicum]
Length=280

 Score =   432 bits (1111),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 203/272 (75%), Positives = 235/272 (86%), Gaps = 5/272 (2%)
 Frame = -2

Query  1202  NMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKS  1023
             N  V    P   +LD Q     D GK+L+GC+HYRRRCK+RAPCCNEIFTCRHCHNEAK+
Sbjct  7     NFVVDQPPPPEEELDRQ-----DVGKLLYGCDHYRRRCKLRAPCCNEIFTCRHCHNEAKN  61

Query  1022  GLSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQ  843
              L++PKERHELVR +VKQV+CAVC+TEQQVA IC  CGVKFG+Y+CEICR YDD+ TK Q
Sbjct  62    ALTNPKERHELVRHNVKQVVCAVCDTEQQVAEICSECGVKFGEYYCEICRFYDDNRTKGQ  121

Query  842   YHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKST  663
             +HC++CGICR+GGRENFFHC+KCGSCYSV LRDNHLCVENSMK++CPICYEFLF+S+K T
Sbjct  122   FHCDDCGICRVGGRENFFHCKKCGSCYSVELRDNHLCVENSMKNHCPICYEFLFDSVKGT  181

Query  662   MIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVP  483
              IMKCGHTMHM+C+ EM+HQNQYRCPICSKSVLNMS TW+ L+ EI+ T MPEEY YEVP
Sbjct  182   TIMKCGHTMHMECHTEMIHQNQYRCPICSKSVLNMSGTWQRLDMEIEATAMPEEYRYEVP  241

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             ILCNDCN+T  A FHILGHKCKHC+SYNTRM+
Sbjct  242   ILCNDCNSTGKAFFHILGHKCKHCNSYNTRMI  273



>gb|EYU46712.1| hypothetical protein MIMGU_mgv1a011426mg [Erythranthe guttata]
Length=282

 Score =   425 bits (1092),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 194/260 (75%), Positives = 228/260 (88%), Gaps = 0/260 (0%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRR  981
             D   V  EDFGKML GCEHYRRRCKIRAPCC+++FTCRHCHNEA S LSDPK+RHE+VR+
Sbjct  17    DLNNVPREDFGKMLHGCEHYRRRCKIRAPCCDQVFTCRHCHNEATSALSDPKQRHEVVRQ  76

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             DV+QV+CAVCNTEQQV+ +C NCG+KFG+YFC IC+ YDDD TK+Q+HCN+C ICR+GGR
Sbjct  77    DVEQVVCAVCNTEQQVSNLCSNCGIKFGEYFCGICKFYDDDITKEQFHCNDCSICRVGGR  136

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             ENFFHC KCGSCYSVGLR+NHLCVE+SMKS+CPICYEFLF+S K T I+KCGHTMH++CY
Sbjct  137   ENFFHCPKCGSCYSVGLRNNHLCVEDSMKSHCPICYEFLFDSTKQTTILKCGHTMHVECY  196

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIF  441
              EM +QNQYRCPICSKSVLNM+RTWE L+ EI+ T MPEEY YEV ILCNDCN +S A F
Sbjct  197   EEMFNQNQYRCPICSKSVLNMARTWERLDVEIEATAMPEEYRYEVQILCNDCNKSSKASF  256

Query  440   HILGHKCKHCSSYNTRMVKA  381
             HI GHKC+ C+SYNTR++ +
Sbjct  257   HIFGHKCQLCNSYNTRVITS  276



>ref|XP_002268410.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 emb|CBI32260.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   414 bits (1063),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 189/263 (72%), Positives = 225/263 (86%), Gaps = 0/263 (0%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++ D  T   EDFGKM +GCEHY+RRCKIRAPCCN+IF CRHCHNEA + LSDPK+RHE+
Sbjct  1     MEEDTATERKEDFGKMQYGCEHYKRRCKIRAPCCNKIFPCRHCHNEAMTSLSDPKDRHEI  60

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
             VR D+KQVIC+VCN EQQVA +C NCGV  G+YFC+IC+ YDDDT K Q+HC+ECGICR+
Sbjct  61    VRHDIKQVICSVCNEEQQVARVCSNCGVNMGEYFCDICKFYDDDTEKQQFHCDECGICRV  120

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGRE FFHCQKCGSCYSV LRDNHLCVENSM+S+CPIC+E+LFES+KST IMKCGHTMH+
Sbjct  121   GGREKFFHCQKCGSCYSVDLRDNHLCVENSMRSHCPICFEYLFESVKSTTIMKCGHTMHV  180

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTST  450
             +CY EM +QNQYRCPICSKS+++MSR+WE+L+ EI+ T MPEEY +EV ILCNDCN T  
Sbjct  181   ECYIEMANQNQYRCPICSKSMIDMSRSWELLDWEIRATAMPEEYSHEVWILCNDCNKTCK  240

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
               +HILGHKC  C+SYNTR + A
Sbjct  241   VFYHILGHKCSSCNSYNTRKIAA  263



>ref|XP_009378904.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Pyrus x bretschneideri]
Length=272

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVK  972
             T++ +DFGKM +GC+HYRRRCKIRAPCC++IF CRHCHNEA S LS+PK+RHELVR DVK
Sbjct  11    TLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEAASSLSNPKDRHELVRHDVK  70

Query  971   QVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENF  792
             QV+C+VCNTEQQVA +C NCGV  G+Y+C+IC+ +DDDT K Q+HCNECGICR+GG ENF
Sbjct  71    QVVCSVCNTEQQVAQLCSNCGVNMGEYYCDICKFFDDDTHKGQFHCNECGICRVGGSENF  130

Query  791   FHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREM  612
             FHCQKCGSCY+V LRDNHLCVE+SMK++CP+CYE+LF+S+K T IMKCGHTMH DC+ EM
Sbjct  131   FHCQKCGSCYAVALRDNHLCVEDSMKNHCPVCYEYLFDSVKVTNIMKCGHTMHSDCFIEM  190

Query  611   VHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHIL  432
              +QNQYRCPICSK+VL+M  TW +L+ EI+ T MPEEY YEV ILCNDCN TS A FHI 
Sbjct  191   QNQNQYRCPICSKAVLDMGNTWNLLDAEIEATAMPEEYQYEVSILCNDCNTTSKAPFHIF  250

Query  431   GHKCKHCSSYNTRMV  387
             GHKC +C+SYNTR++
Sbjct  251   GHKCGNCNSYNTRVI  265



>ref|XP_008375844.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
Length=272

 Score =   401 bits (1030),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVK  972
             T++ +DFGKM +GC+HYRRRCKIRAPCC++IF CRHCHNEA S L++PK+RHELVR DVK
Sbjct  11    TLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEAASSLNNPKDRHELVRHDVK  70

Query  971   QVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENF  792
             QV+C+VCNTEQQVA +C NCGV  G+Y+C+IC+ +DD+T K Q+HCNECGICR+GG ENF
Sbjct  71    QVVCSVCNTEQQVAQLCSNCGVNMGEYYCDICKFFDDETHKGQFHCNECGICRVGGSENF  130

Query  791   FHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREM  612
             FHCQKCGSCY+VGLRDNHLCVE+SMK++CP+CYE+LF+S+K T IMKCGHTMH DC+ EM
Sbjct  131   FHCQKCGSCYAVGLRDNHLCVEDSMKNHCPVCYEYLFDSVKVTNIMKCGHTMHSDCFIEM  190

Query  611   VHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHIL  432
              +QNQYRCPICSK+VL M   W +L+ EI+ T MP EY YEV ILCNDCN TS A FHI 
Sbjct  191   QNQNQYRCPICSKTVLEMGHMWNLLDAEIEATAMPAEYQYEVSILCNDCNTTSNAPFHIF  250

Query  431   GHKCKHCSSYNTRMV  387
             GHKC +C SYNTR++
Sbjct  251   GHKCGNCHSYNTRVI  265



>ref|XP_007200576.1| hypothetical protein PRUPE_ppa009889mg [Prunus persica]
 gb|EMJ01775.1| hypothetical protein PRUPE_ppa009889mg [Prunus persica]
Length=273

 Score =   395 bits (1016),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 217/257 (84%), Gaps = 0/257 (0%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVK  972
             T S +DFGK+ +GC+HYRRRCKIRAPCC++IF CRHCHNEA S LS+PK+RHELVR+DVK
Sbjct  13    TKSRQDFGKLDYGCDHYRRRCKIRAPCCDQIFPCRHCHNEAASSLSNPKDRHELVRQDVK  72

Query  971   QVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENF  792
             QV+C+VCNTEQQVA +C NCGV  G+Y+C+IC+ YDDD +K Q+HCNECGICR+GGR++F
Sbjct  73    QVVCSVCNTEQQVAQLCSNCGVNMGEYYCDICKFYDDDISKQQFHCNECGICRVGGRDHF  132

Query  791   FHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREM  612
             FHCQKCGSCY V LRDNHLCVENSMK++CP+CYE+LF+S+K T IMKCGHTMH +C+ EM
Sbjct  133   FHCQKCGSCYVVELRDNHLCVENSMKNHCPVCYEYLFDSVKGTTIMKCGHTMHSECFIEM  192

Query  611   VHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHIL  432
               Q QYRCPICSK++ +M   W +L+++I+ T MPEEY YEV ILCNDCN TS A FHI 
Sbjct  193   QRQTQYRCPICSKTIRDMDSIWRLLDDDIEATAMPEEYQYEVSILCNDCNTTSNAPFHIF  252

Query  431   GHKCKHCSSYNTRMVKA  381
             G KC +C SYNTR + A
Sbjct  253   GLKCSNCDSYNTRRISA  269



>ref|XP_008234998.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
Length=273

 Score =   395 bits (1016),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 179/257 (70%), Positives = 217/257 (84%), Gaps = 0/257 (0%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVK  972
             T S  DFGK+ +GC+HYRRRCKIRAPCC++IF CRHCHNEA S LS+PK+RHELVR+DVK
Sbjct  13    TKSRRDFGKLDYGCDHYRRRCKIRAPCCDQIFPCRHCHNEAASSLSNPKDRHELVRQDVK  72

Query  971   QVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENF  792
             QV+C+VCNTEQQVA +C NCGV  G+Y+C+IC+ YDDD +K Q+HCNECGICR+GGR+ F
Sbjct  73    QVVCSVCNTEQQVAQLCSNCGVNMGEYYCDICKFYDDDISKRQFHCNECGICRVGGRDKF  132

Query  791   FHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREM  612
             FHCQKCGSCY V LRDNHLCVENSMK++CP+CYE+LF+S++ T IMKCGHTMH +C+ EM
Sbjct  133   FHCQKCGSCYVVELRDNHLCVENSMKNHCPVCYEYLFDSVQGTSIMKCGHTMHSECFIEM  192

Query  611   VHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHIL  432
             + QNQYRCPICSK+V +M   W +L+ +I+ T MPEEY YEV ILCNDCN TS A FHI 
Sbjct  193   LGQNQYRCPICSKTVHDMDSIWRLLDADIEATAMPEEYQYEVSILCNDCNTTSNAPFHIF  252

Query  431   GHKCKHCSSYNTRMVKA  381
             G KC++C SYNTR + A
Sbjct  253   GLKCRNCDSYNTRRISA  269



>gb|KDP28091.1| hypothetical protein JCGZ_13862 [Jatropha curcas]
Length=269

 Score =   394 bits (1013),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 212/252 (84%), Gaps = 0/252 (0%)
 Frame = -2

Query  1142  GEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVI  963
             GED GK+ FGCEHYRRRCKIRAPCC EIFTCRHCHNEA S LS+PK+RHE+VR D+KQVI
Sbjct  12    GEDIGKLEFGCEHYRRRCKIRAPCCQEIFTCRHCHNEATSALSNPKDRHEIVRHDIKQVI  71

Query  962   CAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHC  783
             C++CNTEQQVA +C  CGVK G+YFC+ C+ YDDDTTK Q+HC  CGICR+GGR+ FFHC
Sbjct  72    CSLCNTEQQVAQVCTKCGVKMGEYFCDTCKFYDDDTTKGQFHCEGCGICRVGGRDKFFHC  131

Query  782   QKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQ  603
             +KCGSCY V LR+NHLC+ENSMK+YCP+CYE+LF+S+K   ++KCGHTMHMDC+++M  Q
Sbjct  132   EKCGSCYQVELRENHLCLENSMKNYCPVCYEYLFDSVKGAAVLKCGHTMHMDCFKQMAEQ  191

Query  602   NQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHK  423
             NQYRCPICSK+V+++S  W  L++EI+   MPEEY YEV ILCNDCN TS   FHI+G K
Sbjct  192   NQYRCPICSKTVMDVSHYWRTLDQEIEAIQMPEEYQYEVSILCNDCNETSKTAFHIVGLK  251

Query  422   CKHCSSYNTRMV  387
             C  C+SYNTR +
Sbjct  252   CSQCNSYNTRRI  263



>ref|XP_002320362.2| hypothetical protein POPTR_0014s12890g [Populus trichocarpa]
 gb|EEE98677.2| hypothetical protein POPTR_0014s12890g [Populus trichocarpa]
Length=276

 Score =   394 bits (1011),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 218/256 (85%), Gaps = 3/256 (1%)
 Frame = -2

Query  1139  EDFGKM--LFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQV  966
             +D  K+  L+GCEHYRRRCKIRAPCCN+IF+CRHCHNEA S LS+PK+RHE+VR D+KQV
Sbjct  18    QDTAKLEHLYGCEHYRRRCKIRAPCCNQIFSCRHCHNEATSSLSNPKDRHEIVRTDIKQV  77

Query  965   ICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFH  786
             IC+VCNTEQ+VA +C  CGVK G+YFC+IC+ YDDDT+K Q+HC+ CGICR+GGRENFFH
Sbjct  78    ICSVCNTEQEVAQVCNKCGVKMGEYFCDICKFYDDDTSKQQFHCDSCGICRLGGRENFFH  137

Query  785   CQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVH  606
             C+KCGSCY++ +RDNH CVENSMK+YCP+CYE+LF+S+K   +MKCGHTMHMDC+REM  
Sbjct  138   CEKCGSCYAIDMRDNHSCVENSMKNYCPVCYEYLFDSVKQATVMKCGHTMHMDCFREMAK  197

Query  605   QNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILG  429
             Q QYRCPICSK+V++ S  W++L+EEI+   MPE+Y YE V ILCNDCN+TS   FH++G
Sbjct  198   QQQYRCPICSKTVIDTSHYWKMLDEEIEAVQMPEQYQYEVVSILCNDCNSTSKVAFHVVG  257

Query  428   HKCKHCSSYNTRMVKA  381
             HKCK C+SYNTR +  
Sbjct  258   HKCKQCASYNTRRIAG  273



>ref|XP_011033603.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Populus euphratica]
Length=275

 Score =   391 bits (1005),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 208/246 (85%), Gaps = 0/246 (0%)
 Frame = -2

Query  1118  FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQ  939
             +GCEHYRRRCKIRAPCCN+IF+CRHCHNEA S LS+PK+RHE+VR D+KQVIC+VCNTEQ
Sbjct  27    YGCEHYRRRCKIRAPCCNQIFSCRHCHNEATSSLSNPKDRHEIVRHDIKQVICSVCNTEQ  86

Query  938   QVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYS  759
             +VA +C  CGVK G+YFC+IC+ YDDDT+K Q+HC+ CGICR+GGRENFFHC+KCGSCY 
Sbjct  87    EVAQVCKKCGVKMGEYFCDICKFYDDDTSKQQFHCDSCGICRLGGRENFFHCEKCGSCYV  146

Query  758   VGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPIC  579
             + + DNH CVENSMK+YCP+CYE+LF+S+K   +MKCGHTMHMDC+ EM  Q QYRCPIC
Sbjct  147   IDMSDNHSCVENSMKNYCPVCYEYLFDSVKQATVMKCGHTMHMDCFHEMAKQQQYRCPIC  206

Query  578   SKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYN  399
             SK+V+N S  W++L+EEI+   MPE Y YEV ILCNDCN+TS   FH+ GHKCK C+SYN
Sbjct  207   SKTVMNTSEYWKMLDEEIEAVQMPEPYQYEVSILCNDCNSTSKVAFHVAGHKCKQCASYN  266

Query  398   TRMVKA  381
             TR +  
Sbjct  267   TRRIAG  272



>ref|XP_009369109.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=267

 Score =   390 bits (1003),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 220/251 (88%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCEIC+ YDDDTTK+Q+HCN+CGICRIGGR+ F+HC+K
Sbjct  70    VCDTEQPVAKVCTNCGVSMGEYFCEICKFYDDDTTKEQFHCNDCGICRIGGRDKFYHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTAVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMV  387
              HC+SYNTR +
Sbjct  250   NHCNSYNTRTI  260



>ref|XP_007223130.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
 gb|EMJ24329.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
Length=267

 Score =   387 bits (994),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 216/253 (85%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCEIC+ YDDDT K Q+HCN+CGICRIGGRENF+HC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCEICKFYDDDTDKGQFHCNDCGICRIGGRENFYHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW  ++EEI+ T MPE+Y Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSKSVIDMSRTWRRIDEEIEATAMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR +  
Sbjct  250   NHCKSYNTRTIAP  262



>ref|XP_010545043.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Tarenaya hassleriana]
Length=276

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 219/262 (84%), Gaps = 0/262 (0%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRR  981
             D  +  G+D+GK  +GCEHY+RRC+IRAPCCN+IF CRHCHN+A + L DPKERHELVR+
Sbjct  6     DSNSPRGKDYGKFEYGCEHYKRRCEIRAPCCNQIFPCRHCHNDAANSLPDPKERHELVRQ  65

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             +V+QVICA+C+TEQ+VA +C NCGV  G+YFC IC+ +DDDT+K Q+HC++CGICR+GGR
Sbjct  66    NVRQVICAICHTEQEVAQVCSNCGVNMGEYFCGICKFFDDDTSKGQFHCDDCGICRVGGR  125

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             +NFFHCQ CG+CYS+ L + H CVENS K+YCP+CYE+LF+S+K   +MKCGHTMHMDC+
Sbjct  126   DNFFHCQNCGACYSMSLHNTHSCVENSTKNYCPVCYEYLFDSVKVAHVMKCGHTMHMDCF  185

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIF  441
             ++M+ + QYRCPICSKS+L+MS TW++L+ EI TT MP +Y +EVPILCNDCN  S  +F
Sbjct  186   KQMLERQQYRCPICSKSMLDMSSTWQMLDLEISTTQMPGDYRFEVPILCNDCNQRSRVMF  245

Query  440   HILGHKCKHCSSYNTRMVKADR  375
             HILGHKC+HC SYNTR +   +
Sbjct  246   HILGHKCEHCGSYNTRRISTPQ  267



>ref|XP_009116965.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Brassica rapa]
 ref|XP_009116966.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Brassica rapa]
 emb|CDY11467.1| BnaA09g40330D [Brassica napus]
Length=293

 Score =   386 bits (992),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 218/268 (81%), Gaps = 0/268 (0%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             +  D       DFG+  FGCEHY+RRCKIRAPCCN IF CRHCHN+A + L DPKERH+L
Sbjct  12    MDTDSAIPRDRDFGRSQFGCEHYKRRCKIRAPCCNLIFPCRHCHNDAANALPDPKERHDL  71

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
             VR++VKQVIC+VC  EQ+VA +C NCGV  G+YFC IC+ +DD+T+K+Q+HC++CGICR+
Sbjct  72    VRQNVKQVICSVCEAEQEVAQVCSNCGVCMGEYFCNICKFFDDETSKEQFHCDDCGICRV  131

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGR+NFFHCQ CG+CYS+GLRDNH C+EN+ K+ CP+CYEFLF+S+K+  +M+CGHTMHM
Sbjct  132   GGRDNFFHCQSCGACYSMGLRDNHSCIENATKNSCPVCYEFLFDSVKAAHVMRCGHTMHM  191

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTST  450
              C+++M+ + QYRCPIC KS+++MS +W++L+ EI+ T MP EY YE+ ILCNDCN +S 
Sbjct  192   GCFKQMITEQQYRCPICYKSMMDMSSSWQLLDAEIRATEMPSEYNYEIEILCNDCNKSSK  251

Query  449   AIFHILGHKCKHCSSYNTRMVKADRQ*P  366
             A+FHILGHKC HC SYNTR + A +  P
Sbjct  252   AMFHILGHKCAHCGSYNTRRISAPQDPP  279



>ref|XP_010684478.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   386 bits (991),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 211/252 (84%), Gaps = 0/252 (0%)
 Frame = -2

Query  1139  EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVIC  960
             EDFGK  FGC+HY+RRC+IRAPCCN +FTCRHCHNEA   LS+ KE+HELVRRD+KQVIC
Sbjct  21    EDFGKSQFGCDHYKRRCRIRAPCCNRVFTCRHCHNEAMCSLSNLKEQHELVRRDIKQVIC  80

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             AVC+TEQ VA +C  CG+  G+YFCE+CR YDD+T K Q+HCN+CGICR+GGRENFFHC 
Sbjct  81    AVCDTEQPVAKVCSGCGIVMGEYFCEVCRFYDDETEKKQFHCNDCGICRVGGRENFFHCA  140

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
             KCGSCYS+ L DNH CV++SMK++CPICYE+LFES+K+T +M+CGHT+H  CY +MV+QN
Sbjct  141   KCGSCYSMSLHDNHECVQDSMKNFCPICYEYLFESIKATQVMRCGHTIHTGCYVDMVNQN  200

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKC  420
             QYRCPICSKS L+MS  WE L+EEI  T+MP+EY YEV ILCNDC+ TS   FHI GHKC
Sbjct  201   QYRCPICSKSTLDMSSDWEKLDEEIGATIMPDEYRYEVLILCNDCSGTSRVKFHIFGHKC  260

Query  419   KHCSSYNTRMVK  384
               C SYNTR+ +
Sbjct  261   SQCHSYNTRVTE  272



>ref|XP_008223109.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
Length=267

 Score =   385 bits (988),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCEIC+ YDDDT K Q+HCN+CGICRIGGRE F+HC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCEICKFYDDDTDKGQFHCNDCGICRIGGREKFYHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW  ++EEI+ T MPE+Y Y +V ILCNDCN+T+   FH++G KC
Sbjct  190   YCCPICSKSVIDMSRTWRRIDEEIEATAMPEDYRYKKVWILCNDCNDTTEVYFHVIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR +  
Sbjct  250   NHCKSYNTRTIAP  262



>emb|CDX76679.1| BnaC08g32650D [Brassica napus]
Length=284

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 167/268 (62%), Positives = 217/268 (81%), Gaps = 0/268 (0%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             +  D       DFG+  FGCEHY+RRCKIRAPCCN IF CRHCHN+A + L+DPKERH+L
Sbjct  12    MDTDSAIPRDRDFGRSQFGCEHYKRRCKIRAPCCNLIFPCRHCHNDAANALTDPKERHDL  71

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
             VR++VKQVIC+VC  EQ+VA +C NCGV  G+YFC IC+ +DD+T+K Q+HC++CGICR+
Sbjct  72    VRQNVKQVICSVCEAEQEVAQVCSNCGVCMGEYFCNICKFFDDETSKQQFHCDDCGICRV  131

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGR+NFFHCQ CG+CYS+GLRDNH C+EN+ K+ CP+CYEFLF+S+K+  +M+CGHTMHM
Sbjct  132   GGRDNFFHCQSCGACYSMGLRDNHSCIENATKNSCPVCYEFLFDSVKAAHVMRCGHTMHM  191

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTST  450
              C+ +M+ + QYRCPIC KS+++MS +W++L+ EI+ T MP EY YE+ ILCNDCN +S 
Sbjct  192   GCFEQMISEQQYRCPICYKSMMDMSSSWQLLDAEIRATKMPSEYNYEIEILCNDCNKSSK  251

Query  449   AIFHILGHKCKHCSSYNTRMVKADRQ*P  366
             A+FHILGHKC HC SYNTR + A +  P
Sbjct  252   AMFHILGHKCAHCGSYNTRRISAPQDPP  279



>ref|XP_008340838.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Malus domestica]
Length=267

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 217/253 (86%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI  CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIHPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCG   G+YFC+IC+ YDDDTTK+Q+HCN+CGICRIGGR+ FFHC+K
Sbjct  70    VCDTEQPVAKVCTNCGXSMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGGRDKFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS+ LRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSIRLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHRECYNEMMQRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSKSVIDMSRTWQRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC+SYNTR +  
Sbjct  250   NHCNSYNTRTIAP  262



>ref|XP_008351219.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
Length=333

 Score =   386 bits (991),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 219/251 (87%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             +FGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    EFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFC+IC+ YDDDTTK+Q+HCN+CGICRIGGR+ F HC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGGRDKFXHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS GLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSNGLRDNHLCVENSMRHHCPICYEFLFDSLKETTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+ A FHI+G KC
Sbjct  190   YCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEAYFHIIGQKC  249

Query  419   KHCSSYNTRMV  387
              HC+SYNTR +
Sbjct  250   NHCNSYNTRTI  260



>ref|XP_008390730.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
Length=267

 Score =   383 bits (984),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 219/251 (87%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             +FGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    EFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFC+IC+ YDDDTTK+Q+HCN+CGICRIGGR+ F HC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGGRDKFXHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS GLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSNGLRDNHLCVENSMRHHCPICYEFLFDSLKETTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+ A FHI+G KC
Sbjct  190   YCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEAYFHIIGQKC  249

Query  419   KHCSSYNTRMV  387
              HC+SYNTR +
Sbjct  250   NHCNSYNTRTI  260



>ref|XP_009352220.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
 ref|XP_009345795.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
 ref|XP_009345809.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=267

 Score =   383 bits (983),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 176/253 (70%), Positives = 218/253 (86%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPSDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFC+IC+ YDDDTTK+Q+HCN+CGICRIGGR+ F+HC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGGRDRFYHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS GLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSNGLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y   +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRCKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC+SYNTR +  
Sbjct  250   NHCNSYNTRTIAP  262



>ref|XP_002876698.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52957.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=286

 Score =   383 bits (984),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 165/258 (64%), Positives = 215/258 (83%), Gaps = 0/258 (0%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRR  981
             D      +DFGK  FGCEHY+RRCKI+APCCN IF CRHCHN+A + LSDPKERH+LVR+
Sbjct  18    DSSIPRDKDFGKFQFGCEHYKRRCKIKAPCCNLIFPCRHCHNDAANSLSDPKERHDLVRQ  77

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             +VKQV+C++C TEQ+VA +C NCGV  G YFC+IC+ +DDDT+K+Q+HC++CGICR+GGR
Sbjct  78    NVKQVVCSICQTEQEVAQVCSNCGVNMGAYFCDICKFFDDDTSKEQFHCDDCGICRVGGR  137

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             + FFHCQ CG+CY++GLRD H C+ENS K+ CP+CYE+LF+S+K+  +MKCGHTMH+DC+
Sbjct  138   DKFFHCQNCGACYAMGLRDKHSCIENSTKNSCPVCYEYLFDSVKAAHVMKCGHTMHIDCF  197

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIF  441
              +M+++NQYRCPICSKS+L+MS +W++L+ EI  T MP EY ++V ILCNDCN  S A+F
Sbjct  198   EQMINENQYRCPICSKSMLDMSHSWQLLDLEISATEMPVEYNFKVSILCNDCNKGSKAMF  257

Query  440   HILGHKCKHCSSYNTRMV  387
             HILGHKC  C SYNTR +
Sbjct  258   HILGHKCGDCGSYNTRRI  275



>ref|NP_191856.4| ring finger and CHY zinc finger domain-containing protein 1  
[Arabidopsis thaliana]
 gb|AEE80418.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis 
thaliana]
Length=287

 Score =   382 bits (982),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 164/268 (61%), Positives = 214/268 (80%), Gaps = 0/268 (0%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSD  1011
              D        D      +DFGK  FGCEHY+RRCKIRAPCCN IF+CRHCHN++ + L D
Sbjct  9     SDSMEAAAAADSSIPRDKDFGKFQFGCEHYKRRCKIRAPCCNLIFSCRHCHNDSANSLPD  68

Query  1010  PKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCN  831
             PKERH+LVR++VKQV+C++C TEQ+VA +C NCGV  G+YFC+IC+ +DDD +K+Q+HC+
Sbjct  69    PKERHDLVRQNVKQVVCSICQTEQEVAKVCSNCGVNMGEYFCDICKFFDDDISKEQFHCD  128

Query  830   ECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMK  651
             +CGICR+GGR+ FFHCQ CG+CY +GLRD H C+ENS K+ CP+CYE+LF+S+K+  +MK
Sbjct  129   DCGICRVGGRDKFFHCQNCGACYGMGLRDKHSCIENSTKNSCPVCYEYLFDSVKAAHVMK  188

Query  650   CGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCN  471
             CGHTMHMDC+ +M+++NQYRCPIC+KS+++MS +W +L+ EI  T MP EY +EV ILCN
Sbjct  189   CGHTMHMDCFEQMINENQYRCPICAKSMVDMSPSWHLLDFEISATEMPVEYKFEVSILCN  248

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             DCN  S A+FHILGHKC  C SYNTR +
Sbjct  249   DCNKGSKAMFHILGHKCSDCGSYNTRRI  276



>ref|XP_007050799.1| Zinc finger (C3HC4-type RING finger) family protein isoform 1 
[Theobroma cacao]
 gb|EOX94956.1| Zinc finger (C3HC4-type RING finger) family protein isoform 1 
[Theobroma cacao]
Length=273

 Score =   381 bits (978),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 211/252 (84%), Gaps = 0/252 (0%)
 Frame = -2

Query  1142  GEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVI  963
              +DFG +  GCEHY+RRCKIRAPCCN+IF CRHCHNEA + +S+PK+ H+LVR+DVKQVI
Sbjct  12    SKDFGNLEHGCEHYKRRCKIRAPCCNKIFPCRHCHNEAANSVSNPKDHHDLVRQDVKQVI  71

Query  962   CAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHC  783
             C++CNTEQ+VA +C NC V  G+YFC IC+ YDDDTTK+Q+HCN+CGICR+GGR+N+FHC
Sbjct  72    CSICNTEQEVAQVCCNCRVNMGEYFCNICKFYDDDTTKEQFHCNDCGICRVGGRDNYFHC  131

Query  782   QKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQ  603
             QKCGSCY V L DNHLCVENSMK+ CPICYE+LF+S+KST I+ CGHTMHMDC+ +M  Q
Sbjct  132   QKCGSCYMVNLHDNHLCVENSMKTDCPICYEYLFDSVKSTRILNCGHTMHMDCFSQMTMQ  191

Query  602   NQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHK  423
             NQYRCPIC K+VL+M+  WE+L+ +I  T MP EY +EV ILCNDCN+ S   FHILG K
Sbjct  192   NQYRCPICCKAVLDMTAFWEVLDLDIDATSMPAEYQFEVSILCNDCNSKSIVQFHILGLK  251

Query  422   CKHCSSYNTRMV  387
             C+ C+SYNTR +
Sbjct  252   CRRCNSYNTRRI  263



>gb|AAP21226.1| At3g62970 [Arabidopsis thaliana]
Length=276

 Score =   380 bits (977),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 163/263 (62%), Positives = 213/263 (81%), Gaps = 0/263 (0%)
 Frame = -2

Query  1175  TGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERH  996
                  D      +DFGK  FGCEHY+RRCKIRAPCCN IF+CRHCHN++ + L DPKERH
Sbjct  3     AAAAADSSIPRDKDFGKFQFGCEHYKRRCKIRAPCCNLIFSCRHCHNDSANSLPDPKERH  62

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             +LVR++VKQV+C++C TEQ+VA +C NCGV  G+YFC+IC+ +DDD +K+Q+HC++CGIC
Sbjct  63    DLVRQNVKQVVCSICQTEQEVAKVCSNCGVNMGEYFCDICKFFDDDISKEQFHCDDCGIC  122

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R+GGR+ FFHCQ CG+CY +GLRD H C+ENS K+ CP+CYE+LF+S+K+  +MKCGHTM
Sbjct  123   RVGGRDKFFHCQNCGACYGMGLRDKHSCIENSTKNSCPVCYEYLFDSVKAAHVMKCGHTM  182

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNT  456
             HMDC+ +M+++NQYRCPIC+KS+++MS +W +L+ EI  T MP EY +EV ILCNDCN  
Sbjct  183   HMDCFEQMINENQYRCPICAKSMVDMSPSWHLLDFEISATEMPVEYKFEVSILCNDCNKG  242

Query  455   STAIFHILGHKCKHCSSYNTRMV  387
             S A+FHILGHKC  C SYNTR +
Sbjct  243   SKAMFHILGHKCSDCGSYNTRRI  265



>ref|XP_010413215.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=294

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = -2

Query  1139  EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVIC  960
             +DFGK  FGCEHY+RRCKIRAPCCN IF CRHCHNE+ + L DPKERH+LVR++VKQV+C
Sbjct  28    KDFGKFQFGCEHYKRRCKIRAPCCNLIFPCRHCHNESANSLPDPKERHDLVRQNVKQVVC  87

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++C TEQ+V+ +C NCGV  G+YFC IC+ +DDDT+K+Q+HC +CGICR+GGR+ FFHCQ
Sbjct  88    SICQTEQEVSQLCSNCGVSMGEYFCNICKFFDDDTSKEQFHCADCGICRVGGRDKFFHCQ  147

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
              CG+CYSVGLRD H C+ENS K+ CP+C E+LF+S+K+  +M CGHTMHMDC+  M++ N
Sbjct  148   NCGACYSVGLRDKHSCIENSTKNSCPVCCEYLFDSVKAAHVMSCGHTMHMDCFSGMINNN  207

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKC  420
             QYRCPICSKS+++MS +W++L+ EI TT MP EY +EV ILCNDCN  S A+FHILGHKC
Sbjct  208   QYRCPICSKSMVDMSTSWQLLDLEISTTEMPVEYKFEVAILCNDCNKGSQAMFHILGHKC  267

Query  419   KHCSSYNTRMVKADR  375
              HC SYNTR +   +
Sbjct  268   GHCGSYNTRRISTPQ  282



>ref|NP_001241502.1| uncharacterized protein LOC100792038 [Glycine max]
 gb|ACU23903.1| unknown [Glycine max]
 gb|KHN02999.1| RING finger and CHY zinc finger domain-containing protein 1 [Glycine 
soja]
Length=267

 Score =   380 bits (975),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 217/251 (86%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC HYRRRC+IRAPCCNEI++CRHCHN+A S L +P +RHELVR+DVKQV+C+
Sbjct  10    DFGKMGYGCNHYRRRCRIRAPCCNEIYSCRHCHNDAASLLKNPFDRHELVRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGVK G+YFC IC+ +DDD  K+Q+HC++CGICR+GGR+NFFHC+K
Sbjct  70    VCDTEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGGRDNFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCY++GLRDNHLCVENSM+ +CPICYE+LF+SLK T++MKCGHTMH +CY EM+  ++
Sbjct  130   CGSCYAIGLRDNHLCVENSMRHHCPICYEYLFDSLKDTIVMKCGHTMHHECYVEMIKNDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y   +V ILCNDCN+T+   FHILG KC
Sbjct  190   YCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRNRKVWILCNDCNDTTEVYFHILGQKC  249

Query  419   KHCSSYNTRMV  387
              HC SYNTR V
Sbjct  250   GHCRSYNTRAV  260



>ref|XP_004309689.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Fragaria vesca subsp. vesca]
Length=268

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 210/263 (80%), Gaps = 0/263 (0%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRR  981
             D       +F K   GC+HYRRRCKIRAPCC++IF CRHCHNEA S LS+PK+RHE+VR+
Sbjct  5     DSPAQKPPNFEKFAHGCDHYRRRCKIRAPCCDQIFGCRHCHNEATSSLSNPKDRHEIVRQ  64

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             DVKQV+C++C+TEQ+VA +C NCGV+ G+Y+C+IC+ +DDDT K+Q+HCNECGICR+GGR
Sbjct  65    DVKQVVCSICDTEQEVAQLCANCGVQMGEYYCDICKFFDDDTMKEQFHCNECGICRVGGR  124

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             +NFFHCQKCGSCY V LR NH C+ENSMKS CP+CYE+LF+S+K T IM CGHTMHMDC+
Sbjct  125   DNFFHCQKCGSCYGVDLRGNHNCIENSMKSQCPVCYEYLFDSVKRTQIMNCGHTMHMDCF  184

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIF  441
               M  QNQ RCP+CSK+++NMS  W +L+ EI TT MPEEY YEV ILCNDC  T    F
Sbjct  185   IGMQSQNQSRCPLCSKTMVNMSGYWSLLDAEIATTPMPEEYLYEVTILCNDCVETCNVFF  244

Query  440   HILGHKCKHCSSYNTRMVKADRQ  372
             HILG+KC HC S+NT  V   RQ
Sbjct  245   HILGNKCTHCGSFNTLRVSGGRQ  267



>ref|XP_010512695.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=293

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 170/267 (64%), Positives = 215/267 (81%), Gaps = 2/267 (1%)
 Frame = -2

Query  1139  EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVIC  960
             +DFGK  FGCEHY+RRCKIRAPCCN IF CRHCHNE+ + L DPKERH+LVR++V QV+C
Sbjct  27    KDFGKFQFGCEHYKRRCKIRAPCCNLIFPCRHCHNESANSLPDPKERHDLVRQNVIQVVC  86

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++C TEQ+VA  C NCGV  G+YFC IC+ +DDDT+K+Q+HC++CGICR+GGR+ FFHCQ
Sbjct  87    SICETEQEVAQFCSNCGVSMGEYFCNICKFFDDDTSKEQFHCDDCGICRVGGRDKFFHCQ  146

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
              CG+CYSVGLRD H C+ENS K+ CP+C E+LF+S+K+  +M CGHTMHMDC+  M++ N
Sbjct  147   NCGACYSVGLRDKHSCIENSTKNSCPVCCEYLFDSVKAAHVMSCGHTMHMDCFSGMINNN  206

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKC  420
             QYRCPICSKS+++MS +W+IL+ EI TT MP EY +EV ILCNDCN  S A+FHILGHKC
Sbjct  207   QYRCPICSKSMVDMSTSWQILDLEISTTEMPVEYKFEVSILCNDCNKGSKAMFHILGHKC  266

Query  419   KHCSSYNTRMVKADRQ*PFYVD--HQN  345
              HC SYNTR +   +     +D  H+N
Sbjct  267   GHCGSYNTRRISTPQDPVLEIDSNHEN  293



>ref|XP_002276039.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Vitis vinifera]
 emb|CBI26105.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 213/253 (84%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM FGC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR DVKQVICA
Sbjct  10    DFGKMGFGCKHYRRRCRIRAPCCNEIFPCRHCHNEATSMLRNPFDRHELVRHDVKQVICA  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCE+C+ YDDDTTK Q+HC++CGICR+GGR+ FFHC+K
Sbjct  70    VCDTEQPVAQVCTNCGVNMGEYFCEVCKFYDDDTTKGQFHCDDCGICRVGGRDKFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CG CYSVGLRDNH CVENSM+ +CPICYE+LF+SLK T +M CGHTMH +CY EMV  ++
Sbjct  130   CGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCGHTMHCECYNEMVSHDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV +M+RTW+ ++EEI+ T+MPE+Y + +V ILCNDCN+T+   +HI+G KC
Sbjct  190   YCCPICSKSVRDMTRTWKRIDEEIEATIMPEDYQHKKVWILCNDCNDTTEVFYHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR+V  
Sbjct  250   SHCKSYNTRIVAP  262



>ref|XP_004486052.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cicer arietinum]
Length=267

 Score =   378 bits (971),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/262 (66%), Positives = 218/262 (83%), Gaps = 1/262 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D  +   DFGKM +GC+HYRRRC+IRAPCCNE+++CRHCHNEA S L +P +RHELVR
Sbjct  1     MEDSLIERLDFGKMGYGCKHYRRRCRIRAPCCNEVYSCRHCHNEATSMLKNPCDRHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              DV+QV+C+VC+TEQ VA +C NCGV+ G+YFC IC+ +DDDT K Q+HC++CGICR+GG
Sbjct  61    EDVEQVVCSVCDTEQPVAQVCTNCGVRMGEYFCSICKFFDDDTGKQQFHCDDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
              EN+FHC+KCGSCYSV LRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +C
Sbjct  121   SENYFHCKKCGSCYSVALRDNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTA  447
             Y EMV + +Y CPICSKSV++MS TW+ ++EEI+ TVMP +Y   +V ILCNDCN+T+  
Sbjct  181   YHEMVKRGKYCCPICSKSVIDMSTTWKSIDEEIEATVMPADYRNRKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+GHKC HCSSYNTR +  
Sbjct  241   NFHIIGHKCGHCSSYNTRAIAP  262



>gb|KFK35483.1| hypothetical protein AALP_AA5G290200 [Arabis alpina]
Length=275

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 208/252 (83%), Gaps = 0/252 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DF +  FGCEHY+RRCKIRAPCCN IF+CRHCHNEA + L DPKERH+L+R +V QV+C+
Sbjct  15    DFARFQFGCEHYKRRCKIRAPCCNLIFSCRHCHNEASNSLPDPKERHDLIRENVNQVVCS  74

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             +C TEQ+VA +C NCGV  G+YFC+IC+ +DDDT+K+Q+HC++CGICR+GGR+NFFHCQ 
Sbjct  75    ICETEQEVAQVCSNCGVCMGEYFCDICKFFDDDTSKEQFHCDDCGICRVGGRDNFFHCQS  134

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CG+CY+ GLRD H C+ENS K+ CP+CYE+LF+S+++  +MKCGHTMHMDC++EM+++ Q
Sbjct  135   CGACYATGLRDKHSCIENSTKNSCPVCYEYLFDSVRAAHVMKCGHTMHMDCFQEMINKQQ  194

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCK  417
              RCP+CSKS ++MS  W++L+EEI  T MP E   EV ILCNDCN  S A+FHILGHKC 
Sbjct  195   NRCPLCSKSTMDMSSWWQVLDEEINATEMPAELKVEVAILCNDCNKRSDAMFHILGHKCT  254

Query  416   HCSSYNTRMVKA  381
             HC SYNTR V  
Sbjct  255   HCGSYNTRRVST  266



>ref|XP_010468901.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=293

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 209/255 (82%), Gaps = 0/255 (0%)
 Frame = -2

Query  1139  EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVIC  960
             +DFGK LFGCEHY+RRCK RAPCCN IF CRHCHNE+ + L DPKERH+LVR++VKQV+C
Sbjct  27    KDFGKFLFGCEHYKRRCKSRAPCCNLIFPCRHCHNESANSLPDPKERHDLVRQNVKQVVC  86

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++C TEQ+V+  C NCGV  GDYFC IC+ +DDDT+K+Q+HC +CGICR+GG + FFHCQ
Sbjct  87    SICQTEQEVSQFCSNCGVSMGDYFCNICKFFDDDTSKEQFHCADCGICRVGGLDKFFHCQ  146

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
              CG+CYSVGLRD H C+ENS K+ CP+C E+LF+S+K+  +M CGHTMHMDC+  M++ N
Sbjct  147   NCGACYSVGLRDKHSCIENSTKNSCPVCCEYLFDSVKAAHVMSCGHTMHMDCFSGMINNN  206

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKC  420
             QYRCPICSKS+++MS +W++L+ EI TT MP EY +EV ILCNDCN  S A+FHILGHKC
Sbjct  207   QYRCPICSKSMVDMSTSWQLLDLEISTTEMPVEYKFEVSILCNDCNKGSKAMFHILGHKC  266

Query  419   KHCSSYNTRMVKADR  375
              HC SYNTR +   +
Sbjct  267   GHCGSYNTRRISTPQ  281



>ref|XP_004296799.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Fragaria vesca subsp. vesca]
Length=267

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 213/252 (85%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRHDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA  C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICRIGGRENF+HC+KC
Sbjct  71    CDTEQPVARDCTNCGVSMGEYFCDICKFYDDDTEKGQFHCDDCGICRIGGRENFYHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+ L DNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSISLLDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRNKKVWILCNDCNDTTEVFFHIIGQKCN  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR +  
Sbjct  251   HCKSYNTRTIAP  262



>ref|XP_003521535.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Glycine max]
Length=271

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/264 (65%), Positives = 214/264 (81%), Gaps = 1/264 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++  T   EDFGK+ +GCEHY+RRCKIRAPCCN+IF CRHCHN+A +  S+P +RHELVR
Sbjct  1     MEPATEKREDFGKLQYGCEHYKRRCKIRAPCCNQIFPCRHCHNDAANSSSNPADRHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
             RDVKQVIC+VC+TEQ+VA +C +CGV  G+Y+CEIC+ YDDDT K Q+HC+ECGICR+GG
Sbjct  61    RDVKQVICSVCDTEQEVAKVCSSCGVNMGEYYCEICKFYDDDTDKGQFHCDECGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             R+ FFHC+KC +CYSV +++NH CVENSMKS+CPIC E+ F+S+K + I+KCGHTMHM+C
Sbjct  121   RDKFFHCKKCCACYSVSVQNNHSCVENSMKSFCPICLEYQFDSIKGSTILKCGHTMHMEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAI  444
             YREM  QNQYRCPIC K+++N    WE L+ EI+   MPEEY +EV ILCNDCN+TST  
Sbjct  181   YREMATQNQYRCPICLKTIVN-DMNWEYLDREIEGVHMPEEYKFEVSILCNDCNSTSTVS  239

Query  443   FHILGHKCKHCSSYNTRMVKADRQ  372
             FHI GHKC  C SYNTR +   +Q
Sbjct  240   FHIFGHKCLQCGSYNTRRISKPKQ  263



>ref|XP_010241530.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
Length=267

 Score =   376 bits (966),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 173/262 (66%), Positives = 215/262 (82%), Gaps = 1/262 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D      DFGKM +GCEHYRRRCKIRAPCCNEIF CRHCHNEA S L +PK+ HELVR
Sbjct  1     MEDFANQRLDFGKMGYGCEHYRRRCKIRAPCCNEIFPCRHCHNEATSMLKNPKDCHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
             +D++QV+C+VC+TEQQVA +C NCGV  G+YFCE+C+ YDDDT+K Q+HC++CGICR+GG
Sbjct  61    QDLQQVVCSVCDTEQQVAQVCSNCGVNMGEYFCEVCKFYDDDTSKGQFHCDDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             R+ FFHC+KCGSCY   L  NHLCVENSM+ +CPICYE+LF+SLK T ++KCGHTMHMDC
Sbjct  121   RDKFFHCKKCGSCYGTSLHGNHLCVENSMRHHCPICYEYLFDSLKETTVLKCGHTMHMDC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTA  447
               EM+  +QY CPICSKSV +MSR W  ++EEI  T+MPE+Y + +V ILCNDCN+T+  
Sbjct  181   LHEMMKHDQYCCPICSKSVEDMSRVWRKIDEEIAATIMPEDYRHKKVWILCNDCNDTTET  240

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+GHKC HC+SYNTRM+  
Sbjct  241   FFHIIGHKCCHCNSYNTRMISP  262



>ref|XP_007147872.1| hypothetical protein PHAVU_006G162000g [Phaseolus vulgaris]
 gb|ESW19866.1| hypothetical protein PHAVU_006G162000g [Phaseolus vulgaris]
Length=267

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 215/253 (85%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNE+++CRHCHNEA S LS P +RHELVR+DV+ V+C+
Sbjct  10    DFGKMGYGCKHYRRRCRIRAPCCNELYSCRHCHNEATSMLSKPLDRHELVRQDVEHVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV+ G+YFC IC+ +DD+T K Q+HC++CGICR+GGRENFFHC K
Sbjct  70    VCDTEQPVAQVCTNCGVRLGEYFCSICKFFDDETGKQQFHCDDCGICRVGGRENFFHCNK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS  LRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++ 
Sbjct  130   CGSCYSTTLRDNHLCVENSMRHHCPICYEYLFDSLKDTAVMKCGHTMHSECYHEMIKRDN  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+S+++MSRTW+ ++EEI+ TVMPE+Y   +V ILCNDCN+T+   FHI+GHKC
Sbjct  190   YCCPICSRSIIDMSRTWKRIDEEIEATVMPEDYQNRKVWILCNDCNDTTEVYFHIIGHKC  249

Query  419   KHCSSYNTRMVKA  381
              HC+SYNTR +  
Sbjct  250   GHCNSYNTRSIAP  262



>ref|XP_003546095.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Glycine max]
 gb|KHN33123.1| RING finger and CHY zinc finger domain-containing protein 1 [Glycine 
soja]
Length=267

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 214/253 (85%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNE++ CRHCHNEA S LS+P +RHEL+R+DV+ V+C 
Sbjct  10    DFGKMGYGCKHYRRRCRIRAPCCNELYFCRHCHNEATSMLSNPFDRHELIRQDVQHVVCT  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV+ G+YFC IC+ +DDDT K Q+HC++CGICRIGGREN+FHC K
Sbjct  70    VCDTEQPVAQVCTNCGVRMGEYFCSICKFFDDDTGKQQFHCDDCGICRIGGRENYFHCNK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS  LRDNH+CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSTSLRDNHMCVENSMRHHCPICYEYLFDSLKDTAVMKCGHTMHSECYLEMLKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSR W+ ++EEI+ TVMP++Y Y +V ILCNDCN+T+   FH+LG KC
Sbjct  190   YCCPICSKSVMDMSRAWKRIDEEIEATVMPDDYRYRKVWILCNDCNDTTEVYFHVLGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HCSSYNTR +  
Sbjct  250   GHCSSYNTRAIAP  262



>ref|XP_007154233.1| hypothetical protein PHAVU_003G101500g [Phaseolus vulgaris]
 gb|ESW26227.1| hypothetical protein PHAVU_003G101500g [Phaseolus vulgaris]
Length=267

 Score =   375 bits (962),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 215/251 (86%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGK  +GC+HYRRRC+IRAPCCNEI++CRHCHNE  S   +  +RHELVR+DVKQV+C+
Sbjct  10    DFGKTEYGCKHYRRRCRIRAPCCNEIYSCRHCHNEEASLSKNSFDRHELVRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGVK G+YFC IC+ +DDD  K Q+HC++CGICR+GGRENFFHC+K
Sbjct  70    VCDTEQSVAQVCTNCGVKMGEYFCNICKFFDDDAEKQQFHCDDCGICRVGGRENFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCY+VGLRDNHLCVENSM+ +CPICYE+LF+SLK T++MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYAVGLRDNHLCVENSMRHHCPICYEYLFDSLKDTVVMKCGHTMHQECYHEMIERDR  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS  W+ ++EEI+ ++MPE+Y Y +V ILCNDCN+T+   FHILGHKC
Sbjct  190   YCCPICSKSVVDMSSVWKRIDEEIEASIMPEDYRYRKVWILCNDCNDTTEVNFHILGHKC  249

Query  419   KHCSSYNTRMV  387
              HC+SYNTR +
Sbjct  250   GHCNSYNTRSI  260



>ref|XP_006419635.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
 ref|XP_006489126.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Citrus sinensis]
 gb|ESR32875.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
Length=267

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 214/250 (86%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRCKIRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCKIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y + +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCS  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCKSYNTRSI  260



>ref|XP_006291570.1| hypothetical protein CARUB_v10017724mg, partial [Capsella rubella]
 gb|EOA24468.1| hypothetical protein CARUB_v10017724mg, partial [Capsella rubella]
Length=301

 Score =   375 bits (963),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 211/272 (78%), Gaps = 2/272 (1%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTV--SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL  1017
               + P  ++  D +     +DFGK  FGCEHYRRRC IRAPCCN IF CRHCHNE  + L
Sbjct  21    ASLRPDSIETCDSSTFPKDKDFGKFQFGCEHYRRRCTIRAPCCNLIFPCRHCHNETANSL  80

Query  1016  SDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYH  837
              DPKERH+LVR++VKQV+C++C TEQ+VA  C NCGV  GDYFC++C+ +DDDT+K Q+H
Sbjct  81    PDPKERHDLVRKNVKQVVCSICQTEQEVAQFCSNCGVCMGDYFCDLCKFFDDDTSKKQFH  140

Query  836   CNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMI  657
             C++CGICR+GGR+ FFHCQ CG+CYS  LRD H C+ENS K+ CP+CYE+LF+S+K   +
Sbjct  141   CDDCGICRVGGRDKFFHCQNCGACYSTDLRDKHSCIENSTKNSCPVCYEYLFDSVKVAHV  200

Query  656   MKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPIL  477
             + CGHTMHMDC+  M++ NQYRCPICSKS+++MS +W++L+ EI  T MP EY +EV IL
Sbjct  201   LSCGHTMHMDCFNPMINNNQYRCPICSKSMVDMSSSWQLLDLEISLTKMPVEYNFEVAIL  260

Query  476   CNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             CNDCN  S  +FHILGHKC+HC SYNTR +  
Sbjct  261   CNDCNKGSKVMFHILGHKCEHCGSYNTRQIST  292



>emb|CDO98906.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 213/253 (84%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNE+F CRHCHNE+ S L +  +RHE++R DVKQVIC+
Sbjct  10    DFGKMGYGCKHYRRRCKIRAPCCNEVFDCRHCHNESTSMLRNVFDRHEVIRYDVKQVICS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV+ G+YFCE+C+ YDDD  K Q+HC++CGICR+GGRENFFHC K
Sbjct  70    VCDTEQPVAQVCTNCGVRMGEYFCEVCKFYDDDVDKGQFHCDDCGICRVGGRENFFHCNK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+  ++
Sbjct  130   CGSCYSVGLRDNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYHEMIEHDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+S+++MSR W+ ++EEI+ TVMPE+Y + +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSRSIIDMSRIWKRIDEEIEETVMPEDYRHRKVWILCNDCNDTTEVFFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR +  
Sbjct  250   SHCRSYNTRTIAP  262



>ref|XP_002312758.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE90125.2| zinc finger family protein [Populus trichocarpa]
Length=269

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 218/264 (83%), Gaps = 3/264 (1%)
 Frame = -2

Query  1163  LDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++   VS E  DFGKM +GC+HYRRRC+IRAPCCNEIFTCRHCHNEA + L +  +RHEL
Sbjct  1     MESTPVSNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEATNMLKNFCDRHEL  60

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQVICAVC+TEQ VA +C NCGV  G+YFCEIC+ +DDDT K Q+HC++CGICR+
Sbjct  61    NRYDVKQVICAVCDTEQPVAQVCTNCGVNMGEYFCEICKFFDDDTAKGQFHCDDCGICRV  120

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGREN+FHC+KCGSCY+  L DNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH 
Sbjct  121   GGRENYFHCKKCGSCYATSLLDNHLCVENSMRHHCPICYEYLFDSLKETTVMKCGHTMHG  180

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTS  453
             +CY EM+ +++Y CPICSKS+++MS+TWE ++EEI+ TVMPE+Y + +V ILCNDCN+T+
Sbjct  181   ECYDEMIKRDKYCCPICSKSIIDMSKTWERIDEEIEATVMPEDYSHRKVWILCNDCNDTT  240

Query  452   TAIFHILGHKCKHCSSYNTRMVKA  381
                FHI+G KC HC SYNTR +  
Sbjct  241   EVYFHIIGQKCSHCKSYNTRTIAP  264



>ref|XP_006402321.1| hypothetical protein EUTSA_v10006143mg [Eutrema salsugineum]
 gb|ESQ43774.1| hypothetical protein EUTSA_v10006143mg [Eutrema salsugineum]
Length=285

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 210/260 (81%), Gaps = 0/260 (0%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRR  981
             D      +DFG+  FGCEHY+RRCKIRAPCCN IF CRHCHN+A + LSDPK+RH+LVR+
Sbjct  17    DSTFPKDKDFGRFQFGCEHYQRRCKIRAPCCNLIFPCRHCHNDAANSLSDPKQRHDLVRQ  76

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             +VKQVIC++C TEQ+VA +C NCGV  G+YFC+IC+ +DDDT+K+Q+HC++CGICR+GGR
Sbjct  77    NVKQVICSICQTEQEVAQVCSNCGVSMGEYFCDICKFFDDDTSKEQFHCDDCGICRVGGR  136

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             +NF+HCQ CG+CY+  L D H C+ENS K+ CP+CYE+LF+S+K   +M CGHTMHMDC+
Sbjct  137   DNFYHCQTCGACYAKDLHDKHSCIENSTKNSCPVCYEYLFDSVKIARVMSCGHTMHMDCF  196

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIF  441
             ++M+ + QYRCPIC KS++ MS +W++L++EI  T MP EY +EV ILCNDCN  S  +F
Sbjct  197   KQMIKEQQYRCPICYKSMMEMSSSWQLLDDEISATEMPVEYRFEVTILCNDCNKRSNTMF  256

Query  440   HILGHKCKHCSSYNTRMVKA  381
             HILGHKC HC SYNTR +  
Sbjct  257   HILGHKCGHCGSYNTRRIST  276



>ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycine max]
 gb|ACU18576.1| unknown [Glycine max]
Length=267

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 214/250 (86%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGK+ +GC HYRRRC+IRAPCCNEI++CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKIGYGCNHYRRRCRIRAPCCNEIYSCRHCHNEAASLLKNPFDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGVK G+YFC IC+ +DDD  K+Q+HC++CGICR+GGR+NFFHC+KC
Sbjct  71    CDTEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGGRDNFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+VGL DNHLCVENSM+ +CPICYE+LF+SLK  ++MKCGHTMH +CY EM+  ++Y
Sbjct  131   GSCYAVGLHDNHLCVENSMRHHCPICYEYLFDSLKDVIVMKCGHTMHHECYLEMIKNDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MS+TW+ ++EEI+ TVMP++Y   +V ILCNDCN+T+   FHILG KC 
Sbjct  191   CCPICSKSVIDMSKTWKRIDEEIEATVMPQDYRNRKVWILCNDCNDTTEVYFHILGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR V
Sbjct  251   HCRSYNTRTV  260



>gb|KDO75131.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=267

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 214/252 (85%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y + +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCS  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR +  
Sbjct  251   HCKSYNTRSIAP  262



>gb|AGS43128.1| hypothetical protein, partial [Zea mays]
Length=267

 Score =   373 bits (957),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 172/251 (69%), Positives = 209/251 (83%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM  GC+HYRRRC+IRAPCCNEI++CRHCHNEA S L +  +RHELVR+DVKQV+C+
Sbjct  10    DFGKMEHGCKHYRRRCRIRAPCCNEIYSCRHCHNEATSMLKNHSDRHELVRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ  A +C NCGVK G+YFC+IC  +DDD  K Q+HC++CGICR+GGRENFFHC+K
Sbjct  70    VCDTEQPAAQVCTNCGVKMGEYFCDICVFFDDDAEKQQFHCDDCGICRVGGRENFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNH+CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++ 
Sbjct  130   CGSCYSVGLRDNHICVENSMRHHCPICYEYLFDSLKDTAVMKCGHTMHSECYHEMIKRDN  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKS+ +MS  W+  +EEI+ TVMPE Y Y +V ILCNDCNNT+   FHILG KC
Sbjct  190   YCCPICSKSIADMSMMWKRTDEEIEATVMPEVYRYRKVWILCNDCNNTTEVYFHILGQKC  249

Query  419   KHCSSYNTRMV  387
              HC SYNTR +
Sbjct  250   GHCRSYNTRAI  260



>ref|XP_010036870.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Eucalyptus grandis]
 gb|KCW84419.1| hypothetical protein EUGRSUZ_B01270 [Eucalyptus grandis]
Length=267

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 215/251 (86%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNEIF CRHCHNEA S L +P +RHEL+R+DVKQV+C+
Sbjct  10    DFGKMGYGCQHYRRRCKIRAPCCNEIFPCRHCHNEAASMLRNPFDRHELIRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ V  +C NCGV+ G+YFC+IC+ YDDDT K Q+HC++CGICR+GGR+NFFHC+K
Sbjct  70    VCDTEQPVDQVCTNCGVRMGEYFCKICKFYDDDTEKGQFHCDDCGICRVGGRKNFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS+GL+DNH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSIGLKDNHSCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYGEMLKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+SV++MSRTW+ ++EEI+ T MPE+Y   +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSRSVIDMSRTWKRMDEEIEATQMPEDYRNKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMV  387
              HC SYNTR +
Sbjct  250   SHCESYNTRAI  260



>gb|AFK36462.1| unknown [Lotus japonicus]
Length=267

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 171/251 (68%), Positives = 208/251 (83%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM  GC+HYRRRC+IRAPCCNEI++CRHCHNEA S L +  +RHELVR+DVKQV+C+
Sbjct  10    DFGKMEHGCKHYRRRCRIRAPCCNEIYSCRHCHNEATSMLKNHSDRHELVRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ  A +C NCGVK G+YFC+IC  +DDD  K Q+HC++CGICR+GGRENFFHC+K
Sbjct  70    VCDTEQPAAQVCTNCGVKMGEYFCDICVFFDDDAEKQQFHCDDCGICRVGGRENFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNH+CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++ 
Sbjct  130   CGSCYSVGLRDNHICVENSMRHHCPICYEYLFDSLKDTAVMKCGHTMHSECYHEMIKRDN  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKS+ +MS  W+  +EEI+ TVMPE Y Y +V ILCNDCNNT+   FHI G KC
Sbjct  190   YCCPICSKSIADMSMMWKRTDEEIEATVMPEVYRYRKVWILCNDCNNTTEVYFHIFGQKC  249

Query  419   KHCSSYNTRMV  387
              HC SYNTR +
Sbjct  250   GHCRSYNTRAI  260



>ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago 
truncatula]
 gb|AES64235.1| CHY and CTCHY and RING-type zinc finger protein [Medicago truncatula]
Length=267

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 217/260 (83%), Gaps = 1/260 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++   +   DFGKM +GC+HYRRRC+IRAPCCNE+++CRHCHNEA S L +P + HELVR
Sbjct  1     MEASAIERLDFGKMGYGCKHYRRRCRIRAPCCNEVYSCRHCHNEATSMLKNPFDHHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              DV+QV+C+VC+TEQ VA +C NCGV+ G+Y+C++C+ +DDDT K Q+HC +CGICR+GG
Sbjct  61    NDVEQVVCSVCDTEQPVAQVCTNCGVRMGEYYCDLCKFFDDDTGKQQFHCEDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
              EN+FHC+KCGSCYSV LRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +C
Sbjct  121   SENYFHCKKCGSCYSVALRDNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTA  447
             Y EM+ +++Y CPICSKSV++MS  W+ ++EEI+ TVMP++Y   +V ILCNDCN+T+  
Sbjct  181   YHEMIKRDKYCCPICSKSVIDMSTAWKRIDEEIEATVMPDDYRNRKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMV  387
              FHI+GHKC HCSSYNTR +
Sbjct  241   SFHIIGHKCGHCSSYNTRAI  260



>ref|XP_009803952.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 212/253 (84%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNE+F CRHCHNEA S L    +RHELVR+DV QVIC+
Sbjct  10    DFGKMGYGCKHYRRRCKIRAPCCNEVFDCRHCHNEATSMLRIIFDRHELVRQDVTQVICS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GGRENFFHC+K
Sbjct  70    VCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDIDKGQFHCDDCGICRVGGRENFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSV LR+NH CVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSVSLRNNHSCVENSMRHHCPICYEFLFDSLKDTSVMKCGHTMHAECYHEMIKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+S+++MS+ W+ ++EEI+ T+MPE+  Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSRSIIDMSKAWKRMDEEIEETIMPEDLRYKKVWILCNDCNDTTEVFFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
             +HC SYNTRM+  
Sbjct  250   RHCQSYNTRMISP  262



>ref|XP_004136056.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 ref|XP_004160533.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 gb|KGN44881.1| hypothetical protein Csa_7G394010 [Cucumis sativus]
Length=271

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = -2

Query  1154  QTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDV  975
             Q+   +DFGK+ +GCEHYRRRCKIRAPCC+ IFTCRHCHNEA + LS+PK+RHELVR+D+
Sbjct  10    QSGLKQDFGKLQYGCEHYRRRCKIRAPCCDRIFTCRHCHNEAMTSLSNPKDRHELVRQDI  69

Query  974   KQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGREN  795
             +QV+C +CNTEQ+VA +C  C V  G+YFC+IC+ YDD+T K Q+HC+ CGICR+GGREN
Sbjct  70    RQVVCLICNTEQEVAKVCRKCNVNMGEYFCDICKFYDDNTEKKQFHCDACGICRVGGREN  129

Query  794   FFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYRE  615
             FFHC++CGSCYS  LRDNH CVENSMKSYCPIC+EFLF+S+K T +M CGHT+H +C+ E
Sbjct  130   FFHCERCGSCYSTPLRDNHKCVENSMKSYCPICWEFLFDSIKDTTVMPCGHTIHWECFSE  189

Query  614   MVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHI  435
             M   NQYRCPIC K+V++MS +W +L+ EI+ T MPEEY +EV + CNDC++ S   FHI
Sbjct  190   MESMNQYRCPICLKTVVDMSASWALLKMEIECTPMPEEYSHEVSVHCNDCSHISKVRFHI  249

Query  434   LGHKCKHCSSYNT-RMVKADRQ  372
             LGHKC  C+S+NT R     RQ
Sbjct  250   LGHKCSQCNSFNTWRTSSGGRQ  271



>gb|KDP40017.1| hypothetical protein JCGZ_02015 [Jatropha curcas]
Length=269

 Score =   370 bits (951),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 169/251 (67%), Positives = 212/251 (84%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC IRAPCCNEIF+CRHCHNEA S L +  +RHEL R DVKQVIC+
Sbjct  12    DFGKMGYGCKHYRRRCMIRAPCCNEIFSCRHCHNEAASMLKNISDRHELNRHDVKQVICS  71

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFC +C+ YDDDT K Q+HC++CGICRIGGREN+FHC+K
Sbjct  72    VCDTEQPVAQVCTNCGVNMGEYFCGLCKFYDDDTDKGQFHCDDCGICRIGGRENYFHCKK  131

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCY++ LR NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+++++
Sbjct  132   CGSCYAISLRGNHSCVENSMRHHCPICYEYLFDSLKDTSVMKCGHTMHFECYVEMINRDK  191

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+TW+ ++EEI+ T+MPE+Y Y +V ILCNDCN+T+   FHI+G KC
Sbjct  192   YCCPICSKSVIDMSKTWKRIDEEIEATIMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKC  251

Query  419   KHCSSYNTRMV  387
              HC SYNTR +
Sbjct  252   THCKSYNTRTI  262



>gb|KDO75130.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=268

 Score =   370 bits (949),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 214/253 (85%), Gaps = 2/253 (1%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQ-NQ  597
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ + N+
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDNR  190

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y + +V ILCNDCN+T+   FHI+G KC
Sbjct  191   YCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKC  250

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR +  
Sbjct  251   SHCKSYNTRSIAP  263



>gb|EYU43903.1| hypothetical protein MIMGU_mgv1a011840mg [Erythranthe guttata]
Length=269

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 210/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRCK+RAPCCNE++ CRHCHNE+ S   +  +RH+LVR DVK VIC+V
Sbjct  13    FGKMGFGCKHYRRRCKVRAPCCNEVYDCRHCHNESVSTWRNIHDRHDLVRSDVKNVICSV  72

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC +C+ YDDD  K Q+HC++CGICR GGRENFFHC+KC
Sbjct  73    CDTEQPVARVCTNCGVNMGEYFCAVCKFYDDDIDKGQFHCDDCGICRTGGRENFFHCKKC  132

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+GLR+NHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY E++ + +Y
Sbjct  133   GSCYSIGLRNNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYHELIKREKY  192

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKS+++MSRTW+ ++EEI++TVMPEEY Y +V ILCNDCN+T+   FHI+G KC 
Sbjct  193   CCPICSKSIMDMSRTWKRIDEEIESTVMPEEYRYKKVWILCNDCNDTTEVYFHIIGQKCS  252

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  253   HCESYNTRTI  262



>gb|AFK47591.1| unknown [Medicago truncatula]
Length=267

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 216/260 (83%), Gaps = 1/260 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++   +   DFGKM +GC+HYRRRC+IRAPCCNE+++CRHCHNEA S L +P + HELVR
Sbjct  1     MEASAIERLDFGKMGYGCKHYRRRCRIRAPCCNEVYSCRHCHNEATSMLKNPFDHHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              DV+QV+C+VC+TEQ VA +C NCGV+ G+Y+C++C+ +DDDT K Q+HC +CGICR+GG
Sbjct  61    NDVEQVVCSVCDTEQPVAQVCTNCGVRMGEYYCDLCKFFDDDTGKQQFHCEDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
              EN+FHC+KCGSCYSV LRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +C
Sbjct  121   SENYFHCKKCGSCYSVALRDNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTA  447
             Y EM+ +++Y CPICS SV++MS  W+ ++EEI+ TVMP++Y   +V ILCNDCN+T+  
Sbjct  181   YHEMIKRDKYCCPICSMSVIDMSTAWKRIDEEIEATVMPDDYRNRKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMV  387
              FHI+GHKC HCSSYNTR +
Sbjct  241   SFHIIGHKCGHCSSYNTRAI  260



>ref|XP_010524760.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Tarenaya hassleriana]
Length=267

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 214/250 (86%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRCKIRAPCCNE+++CRHCHNEA S LS+  +RHE+VR+DVKQVIC+V
Sbjct  11    FGKMGFGCKHYRRRCKIRAPCCNEVYSCRHCHNEATSTLSNIYDRHEIVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCSNCGVSMGEYFCKICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+ LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY+EM+ ++++
Sbjct  131   GSCYSISLRNNHQCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYQEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKS+++MS+TW+ ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G +C 
Sbjct  191   CCPICSKSMIDMSKTWQRMDEEIEATAMPPDYRDKKVWILCNDCNDTTEVYFHIIGQRCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_002871827.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48086.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score =   368 bits (945),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 212/250 (85%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HY+RRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC IC+ YDDDT K Q+HC+ECGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAEVCSNCGVNMGEYFCNICKFYDDDTEKQQFHCDECGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+VGLR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH++CY EM+ ++++
Sbjct  131   GSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHLECYNEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_006356694.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Solanum tuberosum]
Length=267

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 212/252 (84%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GCEHYRRRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR DVKQVIC+V
Sbjct  11    FGKMGYGCEHYRRRCRIRAPCCNEVFDCRHCHNEATSLLRNIYDRHELVRHDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFCE+C+ YDDDT K+Q+HC++CGICR+GGR+NFFHC+KC
Sbjct  71    CDTEQPVAHVCTNCGVNMGEYFCEVCKFYDDDTDKEQFHCDDCGICRVGGRQNFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++ 
Sbjct  131   GSCYSVNLRNNHSCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHTECYHEMIKRDKC  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKS+++MSR W  ++EEI+ T+MPE+    +V ILCNDCN+T+   FHI+G KC+
Sbjct  191   CCPICSKSIIDMSRVWRRMDEEIEETIMPEDLRDKKVWILCNDCNDTTEVSFHIIGQKCR  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTRM+ +
Sbjct  251   HCESYNTRMIAS  262



>ref|XP_011090912.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Sesamum indicum]
Length=269

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 215/262 (82%), Gaps = 1/262 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D +     FGKM +GC+HYRRRC+IRAPCCNE++ CRHCHNEA S L +  +RHELVR
Sbjct  3     MEDHSNDRLTFGKMGYGCKHYRRRCRIRAPCCNEVYDCRHCHNEAVSTLRNIYDRHELVR  62

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              +VKQVIC+VC+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGG
Sbjct  63    YEVKQVICSVCDTEQPVARVCTNCGVNMGEYFCDICKFYDDDIDKGQFHCDDCGICRIGG  122

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             R+NFFHC+KCGSCYSV LRDNHLCVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +C
Sbjct  123   RDNFFHCKKCGSCYSVSLRDNHLCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCEC  182

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTA  447
             Y E++ + +Y CPICS+S+++MSRTW+ ++EEI+ TVMP+EY   +V ILCNDCN+T+  
Sbjct  183   YHELIKREKYCCPICSRSIMDMSRTWKRIDEEIEATVMPDEYRNKKVWILCNDCNDTTEV  242

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+G KC HC SYNTR +  
Sbjct  243   YFHIIGQKCGHCESYNTRTIAP  264



>ref|XP_003542919.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Glycine max]
 gb|KHN47296.1| RING finger and CHY zinc finger domain-containing protein 1 [Glycine 
soja]
Length=267

 Score =   368 bits (944),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/260 (65%), Positives = 215/260 (83%), Gaps = 1/260 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++   +   DFGKM +GC+HYRRRC+IRAPCCNE++ CRHCHNEA S LS+P +RHELVR
Sbjct  1     MEGSVLERLDFGKMGYGCKHYRRRCRIRAPCCNELYFCRHCHNEATSMLSNPFDRHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
             +DV+ V+C+VC+TEQ VA +C NCGV+ G+YFC IC+ +DDDT K Q+HC++CGICR+GG
Sbjct  61    QDVQHVVCSVCDTEQPVAQVCTNCGVRMGEYFCNICKFFDDDTGKKQFHCDDCGICRLGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             REN+ HC KCG CYS  LRDNHLCVENSM+ +CPICYE+LF+SLK   +MKCGHTMH +C
Sbjct  121   RENYSHCSKCGCCYSNTLRDNHLCVENSMRHHCPICYEYLFDSLKDIAVMKCGHTMHSEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTA  447
             Y EM+ +++Y CPICSKSV++MSR W+ ++EEI+ TVMP++Y Y +V ILCNDCN+T+  
Sbjct  181   YLEMLKRDKYCCPICSKSVMDMSRAWKRIDEEIEATVMPDDYRYRKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMV  387
              FHILG KC HCSSYNTR +
Sbjct  241   YFHILGQKCGHCSSYNTRAI  260



>ref|XP_007035496.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
 gb|EOY06422.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
Length=260

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = -2

Query  1112  CEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQV  933
             C+HYRRRC+IRAPCCNE+F+CRHCHNEA S L +P +RH+LVR+DVKQVIC+VC+TEQ V
Sbjct  11    CQHYRRRCEIRAPCCNEVFSCRHCHNEAASMLRNPFDRHDLVRQDVKQVICSVCDTEQPV  70

Query  932   AGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVG  753
             A +C NCGV  G+YFCEIC+ +DDDT K Q+HC++CGICR+GGRENFFHC+KCGSCYS+ 
Sbjct  71    AKLCSNCGVNMGEYFCEICKFFDDDTEKGQFHCHDCGICRVGGRENFFHCKKCGSCYSIA  130

Query  752   LRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSK  573
             LRDNH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++Y CPICSK
Sbjct  131   LRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYHEMIKRDKYCCPICSK  190

Query  572   SVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCKHCSSYNT  396
             SV++MSR W+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+   FHI+G KC HC SYNT
Sbjct  191   SVIDMSRIWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNT  250

Query  395   RMV  387
             R +
Sbjct  251   RTI  253



>ref|XP_009791778.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X3 [Nicotiana sylvestris]
Length=267

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D      DFGKM +GC+HYRRRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR
Sbjct  1     MEDSCNERLDFGKMGYGCKHYRRRCRIRAPCCNEVFDCRHCHNEATSSLHNVFDRHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              DVKQVIC+VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GG
Sbjct  61    YDVKQVICSVCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDLDKGQFHCDDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             RENFFHC +CGSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T ++KCGHTMH +C
Sbjct  121   RENFFHCSRCGSCYSVSLRNNHSCVENSMRHHCPICYEYLFDSLKDTTVLKCGHTMHTEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTA  447
             Y EM+ +++  CPICS+S+++MSR W  ++EEI+ T+MPE   Y +V ILCNDCN+T+  
Sbjct  181   YHEMIKRDKCCCPICSRSIIDMSRAWRRMDEEIEETIMPENLRYKKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+G KC+HC SYNTRM+  
Sbjct  241   FFHIIGQKCRHCESYNTRMIAP  262



>ref|XP_006342775.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Solanum tuberosum]
Length=267

 Score =   366 bits (939),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 209/253 (83%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNE+F CRHCHNEA S L    +RHELVR+DV QVIC+
Sbjct  10    DFGKMGYGCKHYRRRCKIRAPCCNEVFDCRHCHNEATSMLRKIFDRHELVRQDVTQVICS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GGRENFFHC K
Sbjct  70    VCDTEQPVAHVCTNCGVNMGEYFCEVCKFYDDDIDKGQFHCDDCGICRVGGRENFFHCNK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             C SCYSV LR+NH CVE+SM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CDSCYSVSLRNNHSCVEDSMRHHCPICYEFLFDSLKDTTVMKCGHTMHTECYHEMIKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+S L+M++ W+ ++EEI+ T+MPE+  Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSRSTLDMTKAWKRMDEEIEETIMPEDLRYKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
             +HC SYNTRM+  
Sbjct  250   RHCQSYNTRMIAP  262



>ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF45489.1| zinc finger protein, putative [Ricinus communis]
Length=269

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 213/262 (81%), Gaps = 1/262 (0%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++   Q+    DFGKM +GCEHYRRRC+IRAPCCNEIF CRHCHNE+ S L +  +RHE+
Sbjct  1     MEATTQSCGRLDFGKMGYGCEHYRRRCRIRAPCCNEIFWCRHCHNESASTLKNLCDRHEI  60

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQVIC+VC+TEQ VA +C NCGV  G+YFC +C+ +DDDT K Q+HC++CGICR+
Sbjct  61    NRFDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCGVCKFFDDDTDKGQFHCDDCGICRV  120

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGREN+FHC KCGSCY++ L  NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH 
Sbjct  121   GGRENYFHCSKCGSCYAISLLGNHSCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHF  180

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTS  453
             +CY EM+ +++Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y Y +V ILCNDCN+T+
Sbjct  181   ECYNEMIERDKYCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRYKKVWILCNDCNDTT  240

Query  452   TAIFHILGHKCKHCSSYNTRMV  387
                FHI+G KC HC SYNTR +
Sbjct  241   EVYFHIIGQKCSHCKSYNTRTI  262



>ref|XP_010454118.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=267

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 210/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC HYRRRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCHHYRRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ  A +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPAAQVCSNCGVNMGEYFCDICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++GLR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAIGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHQECYHEMLKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_004241068.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Solanum lycopersicum]
Length=267

 Score =   365 bits (937),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 210/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GCEHYRRRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR DVKQVIC+V
Sbjct  11    FGKMGYGCEHYRRRCRIRAPCCNEVFDCRHCHNEATSLLRNIYDRHELVRHDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFCE+C+ YDDDT K+Q+HC++CGICR+GG +NFFHC+KC
Sbjct  71    CDTEQPVAHVCTNCGVNMGEYFCEVCKFYDDDTEKEQFHCDDCGICRVGGHQNFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++ 
Sbjct  131   GSCYSVNLRNNHSCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHTECYHEMIKRDKC  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MSR W  ++EEI+ T+MPE     +V ILCNDCN+T+   FHI+G KC+
Sbjct  191   CCPICSKSVIDMSRVWRRMDEEIEETIMPEGLRDKKVWILCNDCNDTTEVFFHIIGQKCR  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTRM+ +
Sbjct  251   HCESYNTRMIAS  262



>ref|XP_006400417.1| hypothetical protein EUTSA_v10014400mg [Eutrema salsugineum]
 gb|ESQ41870.1| hypothetical protein EUTSA_v10014400mg [Eutrema salsugineum]
Length=267

 Score =   365 bits (936),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 209/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGCEHYRRRC IRAPCCNE+F CRHCHNE+ S L +  +RHELVR+DVKQVIC V
Sbjct  11    FGKMGFGCEHYRRRCLIRAPCCNEVFACRHCHNESTSTLRNIYDRHELVRQDVKQVICLV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGVK G+YFC IC+ YDD+T K Q+HC++CGICRIGGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCSNCGVKMGEYFCNICKFYDDNTEKQQFHCDDCGICRIGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++GLR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAIGLRNNHRCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW  ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWLRMDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_010941801.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Elaeis guineensis]
 ref|XP_010941802.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Elaeis guineensis]
 ref|XP_010941803.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Elaeis guineensis]
Length=287

 Score =   365 bits (937),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 211/285 (74%), Gaps = 9/285 (3%)
 Frame = -2

Query  1226  TTTPPLAMNMEVGDVTPTGVQLDDQTVSGED---FGKMLFGCEHYRRRCKIRAPCCNEIF  1056
             T    +  +  V D T T    D  + + +    FGKM FGC HYRRRCKIRAPCCNEIF
Sbjct  3     TAASVVTDSSTVTDSTVTDSSTDADSSAADSRLGFGKMEFGCMHYRRRCKIRAPCCNEIF  62

Query  1055  TCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEIC  876
              CRHCHNE+ SGL      HEL RRDV++VIC VC+TEQ VA +C NCGV  G+YFC++C
Sbjct  63    YCRHCHNESNSGL------HELCRRDVQRVICLVCDTEQPVAQVCSNCGVNMGEYFCDVC  116

Query  875   RLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPIC  696
             + YDDD  K Q+HCN+CGICR+GG+ENFFHCQKCGSCYS GLRD H CVE+SM+ +CPIC
Sbjct  117   KFYDDDLGKGQFHCNDCGICRVGGKENFFHCQKCGSCYSDGLRDKHSCVEHSMRRHCPIC  176

Query  695   YEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTT  516
             YE+LF+SLK T ++KCGHT+H +CY EM+   +Y CPICSKSV +MS+ W  L+EEI  T
Sbjct  177   YEYLFDSLKETRVLKCGHTIHEECYDEMLEHARYTCPICSKSVCDMSKYWRQLDEEIAAT  236

Query  515   VMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             +MPE+Y Y+V ILCNDCN  S   FHI+GHKC HC+SYNTR    
Sbjct  237   IMPEDYRYKVWILCNDCNKVSEVFFHIVGHKCGHCNSYNTRTTSP  281



>ref|XP_004229216.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Solanum lycopersicum]
Length=267

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 209/253 (83%), Gaps = 1/253 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNE++ CRHCHNEA S L    +RHELVR+DV QVIC+
Sbjct  10    DFGKMGYGCKHYRRRCKIRAPCCNEVYDCRHCHNEATSMLRKIFDRHELVRQDVTQVICS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GGRENFFHC K
Sbjct  70    VCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDIDKGQFHCDDCGICRVGGRENFFHCNK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             C SCYSV LR+NH CVE+SM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CDSCYSVSLRNNHSCVEDSMRHHCPICYEFLFDSLKDTTVMKCGHTMHTECYHEMIKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICS+S L+M++ W+ ++EEI+ T+MPE+  Y +V ILCNDCN+T+   FHI+G KC
Sbjct  190   YCCPICSRSTLDMTKAWKRMDEEIEETIMPEDLRYKKVWILCNDCNDTTEVYFHIIGQKC  249

Query  419   KHCSSYNTRMVKA  381
             +HC SYNTRM+  
Sbjct  250   RHCQSYNTRMIAP  262



>ref|XP_009592576.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana tomentosiformis]
Length=266

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/262 (63%), Positives = 212/262 (81%), Gaps = 1/262 (0%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D      DFGKM +GC+HYRRRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR
Sbjct  1     MEDSCNERLDFGKMGYGCKHYRRRCRIRAPCCNEVFDCRHCHNEATSSLHNVFDRHELVR  60

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              DVKQVIC+VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GG
Sbjct  61    NDVKQVICSVCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDLDKGQFHCDDCGICRVGG  120

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
              ENFFHC +CGSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T ++KCGHTMH +C
Sbjct  121   NENFFHCNRCGSCYSVSLRNNHSCVENSMRHHCPICYEYLFDSLKDTTVLKCGHTMHTEC  180

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTA  447
             Y EM+ +++  CPICS+S+++MSR W  ++EEI+ T+MP++  Y +V ILCNDCN+T+  
Sbjct  181   YHEMIKRDKCCCPICSRSIIDMSRAWRRMDEEIEETIMPDDLRYKKVWILCNDCNDTTEV  240

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+G KC+HC SYNTRM+  
Sbjct  241   FFHIIGQKCRHCESYNTRMIAP  262



>ref|XP_004134192.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 ref|XP_004159819.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 gb|KGN57076.1| hypothetical protein Csa_3G151540 [Cucumis sativus]
Length=271

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/262 (65%), Positives = 212/262 (81%), Gaps = 5/262 (2%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             V  DD+     DFGKM +GC+HYRRRCKIRAPCCNEI+ CRHCHNEA S +S   +RHEL
Sbjct  7     VSADDRL----DFGKMGYGCQHYRRRCKIRAPCCNEIYPCRHCHNEATSVMSRLSDRHEL  62

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQV+CAVC+TEQ VA +C NCGV  G+YFCEIC+ YDDD  K Q+HC +CGICR+
Sbjct  63    NRFDVKQVVCAVCDTEQPVARVCTNCGVNMGEYFCEICKFYDDDIEKGQFHCEDCGICRV  122

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             G RE +FHC+KCGSCY V LRDNH C+ENSM+ +CPICYE+LF++LK   +MKCGHTMH+
Sbjct  123   GSREKYFHCKKCGSCYHVNLRDNHSCIENSMQHHCPICYEYLFDTLKDVSVMKCGHTMHL  182

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTS  453
             +CY EM+++++Y CPICSKSV++MS+ W+ L+EEI+ TVMPEEY + +V ILCNDCN+T+
Sbjct  183   ECYSEMINRDKYCCPICSKSVVDMSKAWKQLDEEIEATVMPEEYRHKKVWILCNDCNDTT  242

Query  452   TAIFHILGHKCKHCSSYNTRMV  387
                FHI+G KC HC SYNTR +
Sbjct  243   EVYFHIIGQKCCHCQSYNTRAI  264



>ref|XP_010649778.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Vitis vinifera]
Length=260

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 168/245 (69%), Positives = 206/245 (84%), Gaps = 1/245 (0%)
 Frame = -2

Query  1112  CEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQV  933
             C+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR DVKQVICAVC+TEQ V
Sbjct  11    CKHYRRRCRIRAPCCNEIFPCRHCHNEATSMLRNPFDRHELVRHDVKQVICAVCDTEQPV  70

Query  932   AGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVG  753
             A +C NCGV  G+YFCE+C+ YDDDTTK Q+HC++CGICR+GGR+ FFHC+KCG CYSVG
Sbjct  71    AQVCTNCGVNMGEYFCEVCKFYDDDTTKGQFHCDDCGICRVGGRDKFFHCKKCGCCYSVG  130

Query  752   LRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSK  573
             LRDNH CVENSM+ +CPICYE+LF+SLK T +M CGHTMH +CY EMV  ++Y CPICSK
Sbjct  131   LRDNHSCVENSMRHHCPICYEYLFDSLKDTTVMVCGHTMHCECYNEMVSHDKYCCPICSK  190

Query  572   SVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCKHCSSYNT  396
             SV +M+RTW+ ++EEI+ T+MPE+Y + +V ILCNDCN+T+   +HI+G KC HC SYNT
Sbjct  191   SVRDMTRTWKRIDEEIEATIMPEDYQHKKVWILCNDCNDTTEVFYHIIGQKCSHCKSYNT  250

Query  395   RMVKA  381
             R+V  
Sbjct  251   RIVAP  255



>ref|XP_010069986.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Eucalyptus grandis]
 gb|KCW58536.1| hypothetical protein EUGRSUZ_H01203 [Eucalyptus grandis]
Length=285

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 198/252 (79%), Gaps = 0/252 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DF K+  GCEHYRRRCKIRAPCC+ +F CRHCHNE  S LS+ K+ HELVR DVK+V+C+
Sbjct  15    DFAKLEHGCEHYRRRCKIRAPCCDRVFPCRHCHNEFTSSLSNLKDHHELVRHDVKRVVCS  74

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ+ A +C  CGV  G+YFC  C+ YDD T K+Q+HC ECGICR+GGRENFFHC K
Sbjct  75    VCDTEQEAAQVCSKCGVNMGEYFCGTCKFYDDQTEKEQFHCEECGICRVGGRENFFHCPK  134

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCY + LRDNH+CVENSMKS+CP+CYE+LF+S+K T I+KCGHT+HMDC +EM  QNQ
Sbjct  135   CGSCYVMSLRDNHVCVENSMKSHCPVCYEYLFDSMKGTTILKCGHTIHMDCVKEMADQNQ  194

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCK  417
             YRCPICSK+ +  S  W +L+ EI  TVMP+EY Y+V ILCNDCN T    FHI G KC 
Sbjct  195   YRCPICSKTFMEKSDDWRMLDAEIAATVMPKEYQYKVTILCNDCNKTGHVPFHIFGLKCS  254

Query  416   HCSSYNTRMVKA  381
              C SYNTR + A
Sbjct  255   ECCSYNTRRISA  266



>ref|XP_010420645.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=267

 Score =   363 bits (933),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 210/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC HYRRRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCHHYRRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ  A +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPAAQLCSNCGVNMGEYFCDICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++ LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY+EM+ ++++
Sbjct  131   GSCYAISLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHQECYQEMLKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR +  
Sbjct  251   HCRSYNTRAISP  262



>ref|NP_197366.1| MYB30-Interacting E3 ligase1 [Arabidopsis thaliana]
 gb|AAL36416.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20011.1| unknown protein [Arabidopsis thaliana]
 gb|AED92594.1| RING-finger and CHY zinc finger domain-containing protein 1 [Arabidopsis 
thaliana]
Length=267

 Score =   363 bits (932),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 210/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HY+RRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ  A +C NCGV  G+YFC IC  YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+VGLR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH++CY EM+ ++++
Sbjct  131   GSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVECYNEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVHFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>emb|CDX92593.1| BnaA10g16320D [Brassica napus]
Length=267

 Score =   363 bits (931),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 211/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG M FGC+HY RRC+IRAPCCNE+F CRHCHNE+ S L +  +RHELVR+DVKQVIC+V
Sbjct  11    FGVMAFGCDHYNRRCQIRAPCCNEVFPCRHCHNESTSTLRNISDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDD+T K+Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDNTAKEQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++GLR+NH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAIGLRNNHRCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHFECYHEMLKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRMDEEIEATSMPSDYRDKKVWILCNDCNDTTEVNFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_009120952.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Brassica rapa]
Length=267

 Score =   362 bits (930),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 212/250 (85%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG M FGC+HY RRC+IRAPCCNE+F+CRHCHNE+ S L +  +RHELVR+DVKQVIC+V
Sbjct  11    FGVMAFGCDHYNRRCQIRAPCCNEVFSCRHCHNESTSTLRNIYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDD+T K+Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDNTAKEQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++GLR+NH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAIGLRNNHRCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHFECYHEMLKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRMDEEIEATSMPSDYRDKKVWILCNDCNDTTEVNFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_008438813.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Cucumis melo]
Length=271

 Score =   362 bits (930),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/262 (65%), Positives = 211/262 (81%), Gaps = 5/262 (2%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             V  DD+     DFGKM +GC+HYRRRCKIRAPCCNEI+ CRHCHNEA S +S   +RHEL
Sbjct  7     VSADDRL----DFGKMGYGCQHYRRRCKIRAPCCNEIYPCRHCHNEATSVMSRLSDRHEL  62

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQV+CAVC+TEQ VA +C NCGV  G+YFCEIC+ +DDD  K Q+HC +CGICR+
Sbjct  63    NRFDVKQVVCAVCDTEQPVARVCTNCGVNMGEYFCEICKFFDDDIEKGQFHCEDCGICRV  122

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             G RE +FHC+KCGSCY V LRDNH C+ENSM+ +CPICYE+LF++LK   +MKCGHTMH+
Sbjct  123   GSREKYFHCKKCGSCYHVNLRDNHSCIENSMQHHCPICYEYLFDTLKDVSVMKCGHTMHL  182

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTS  453
             +CY EM+ +++Y CPICSKSV++MS+ W+ L+EEI+ TVMPEEY + +V ILCNDCN+T+
Sbjct  183   ECYSEMISRDKYCCPICSKSVVDMSKAWKQLDEEIEATVMPEEYRHKKVWILCNDCNDTT  242

Query  452   TAIFHILGHKCKHCSSYNTRMV  387
                FHI+G KC HC SYNTR +
Sbjct  243   EVYFHIIGQKCCHCQSYNTRAI  264



>emb|CDY13909.1| BnaC09g39170D [Brassica napus]
Length=267

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 211/250 (84%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG M FGC+HY RRC+IRAPCCNE+F CRHCHNE+ S L +  +RHELVR+DVKQVIC+V
Sbjct  11    FGVMAFGCDHYNRRCQIRAPCCNEVFPCRHCHNESTSTLRNIYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDD+T K+Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDNTAKEQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++GLR+NH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAIGLRNNHRCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHFECYHEMLKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRMDEEIEATSMPSDYRDKKVWILCNDCNDTTEVNFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR V
Sbjct  251   HCRSYNTRAV  260



>ref|XP_010492886.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=267

 Score =   362 bits (929),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 208/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC HYRRRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCHHYRRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ    +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC KC
Sbjct  71    CDTEQPATQLCSNCGVNMGEYFCDICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCNKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++ LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY+EM+ +++Y
Sbjct  131   GSCYAIALRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHQECYQEMLKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVNFHIIGQKCG  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR +  
Sbjct  251   HCRSYNTRAISP  262



>emb|CAB87742.1| putative protein [Arabidopsis thaliana]
Length=274

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 207/268 (77%), Gaps = 13/268 (5%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSD  1011
              D        D      +DFGK  FGCEHY+RRCKIRAPCCN IF+CRHCHN++ + L D
Sbjct  9     SDSMEAAAAADSSIPRDKDFGKFQFGCEHYKRRCKIRAPCCNLIFSCRHCHNDSANSLPD  68

Query  1010  PKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCN  831
             PKERH+LVR++VKQV+C++C TEQ+VA +C NCGV  G+YFC+IC+ +DDD +K+Q+HC+
Sbjct  69    PKERHDLVRQNVKQVVCSICQTEQEVAKVCSNCGVNMGEYFCDICKFFDDDISKEQFHCD  128

Query  830   ECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMK  651
             +CGICR+GGR+ FFHCQ CG+CY +GLRD H C+ENS K+ CP+CYE+LF+S+K+  +MK
Sbjct  129   DCGICRVGGRDKFFHCQNCGACYGMGLRDKHSCIENSTKNSCPVCYEYLFDSVKAAHVMK  188

Query  650   CGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCN  471
             CGHTMHMDC+ +M+++NQYRCPIC+KS+++MS +W +L+             +EV ILCN
Sbjct  189   CGHTMHMDCFEQMINENQYRCPICAKSMVDMSPSWHLLD-------------FEVSILCN  235

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             DCN  S A+FHILGHKC  C SYNTR +
Sbjct  236   DCNKGSKAMFHILGHKCSDCGSYNTRRI  263



>ref|XP_006288468.1| hypothetical protein CARUB_v10001726mg [Capsella rubella]
 gb|EOA21366.1| hypothetical protein CARUB_v10001726mg [Capsella rubella]
Length=267

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 208/250 (83%), Gaps = 1/250 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC HYRRRC+IRAPCCNE+F CRHCHN++ S L +  +RH+LVR+DVKQVIC+V
Sbjct  11    FGKMGFGCHHYRRRCQIRAPCCNEVFDCRHCHNDSTSTLRNIYDRHDLVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ  A +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQLAAQVCSNCGVNMGEYFCDICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+  LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYATSLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHQECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ L+EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  251   HCRSYNTRAI  260



>ref|XP_010666396.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Beta vulgaris subsp. vulgaris]
Length=266

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/252 (66%), Positives = 208/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG+M FGC+HYRRRC IRAPCCNEIF CRHCHNEA S L +P +RHEL R DVKQV+CAV
Sbjct  11    FGRMGFGCQHYRRRCLIRAPCCNEIFPCRHCHNEATSMLRNPMDRHELNRCDVKQVVCAV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ V  +C NCGV  G+YFCEIC+ YDDD  K Q+HC++CGICR+GGRENFFHC++C
Sbjct  71    CDTEQPVGRVCTNCGVNMGEYFCEICKFYDDDIDKMQFHCDDCGICRVGGRENFFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYSV LR+NH+C+ENSM+ +CPICYE+LF+SLK T +++CGHTMH +C  EM+ +++Y
Sbjct  131   GSCYSVALRNNHMCIENSMRHHCPICYEYLFDSLKDTTVLRCGHTMHYECCHEMMKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MS TW+ L+EEI+ T MPE++   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSKSVIDMSTTWKRLDEEIEATTMPEDFRNKKVWILCNDCNDTTEVYFHIIGQKCS  250

Query  416   HCSSYNTRMVKA  381
             HCSSYNTR +  
Sbjct  251   HCSSYNTRQIAP  262



>gb|AEX97080.1| zinc-finger protein [Malus domestica]
Length=267

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 208/251 (83%), Gaps = 1/251 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             +FGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S LS+P +RHELVR DVKQV+C+
Sbjct  10    EFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEATSMLSNPFDRHELVRYDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFC+IC+ YDDDTTK+Q+HCN+CGICRIGGR+ FFHC+K
Sbjct  70    VCDTEQPVARVCTNCGVSMGEYFCDICKFYDDDTTKEQFHCNDCGICRIGGRDKFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS GLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSNGLRDNHLCVENSMRHHCPICYEFLFDSLKETTVMKCGHTMHCECYNEMMKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MS+T EI+ +  + T MP +Y    V IL N  NNT    +HI+G KC
Sbjct  190   YCCPICSKSVIDMSKTLEIINKGNKATGMPADYRLKNVWILGNGKNNTFEVFYHIIGQKC  249

Query  419   KHCSSYNTRMV  387
              HC SYNTR+V
Sbjct  250   SHCKSYNTRIV  260



>ref|XP_011013258.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Populus euphratica]
Length=269

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 216/262 (82%), Gaps = 3/262 (1%)
 Frame = -2

Query  1163  LDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++   VS E  DFGKM +GC+HYRRRC+IRAPCCNEIFTCRHCHNEA + L +  +RHE+
Sbjct  1     MESTPVSNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEATNMLKNFCDRHEI  60

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQVICAVC+TEQ VA +C NCGV  G+YFC+IC+ +DDDT K  +HC++CGICR+
Sbjct  61    NRYDVKQVICAVCDTEQPVAQVCTNCGVTMGEYFCKICKFFDDDTAKGLFHCDDCGICRV  120

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GGREN++HC+KCGSCY+  L DNHLCVENSM  +CPICYE+LF+SLK T +MKCGHTMH 
Sbjct  121   GGRENYYHCKKCGSCYATSLLDNHLCVENSMCHHCPICYEYLFDSLKETNVMKCGHTMHG  180

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTS  453
             +CY EM+ +++Y CPICSKS+++MS+TW+ ++EEI+ TVMPE+Y + +V ILC+DCN+T+
Sbjct  181   ECYDEMIKRDKYCCPICSKSIIDMSKTWKRIDEEIEATVMPEDYSHRKVWILCDDCNDTT  240

Query  452   TAIFHILGHKCKHCSSYNTRMV  387
                FHI+G KC HC SYNTR +
Sbjct  241   EVYFHIVGQKCSHCKSYNTRTI  262



>gb|KHN28232.1| RING finger and CHY zinc finger domain-containing protein 1, 
partial [Glycine soja]
Length=276

 Score =   360 bits (925),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 203/247 (82%), Gaps = 1/247 (0%)
 Frame = -2

Query  1112  CEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQV  933
             CEHY+RRCKIRAPCCN+IF CRHCHN+A +  S+P +RHELVRRDVKQVIC+VC+TEQ+V
Sbjct  23    CEHYKRRCKIRAPCCNQIFPCRHCHNDAANSSSNPADRHELVRRDVKQVICSVCDTEQEV  82

Query  932   AGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVG  753
             A +C +CGV  G+Y+CEIC+ YDDDT K Q+HC+ECGICR+GGR+ FFHC+KC +CYSV 
Sbjct  83    AKVCSSCGVNMGEYYCEICKFYDDDTDKGQFHCDECGICRVGGRDKFFHCKKCCACYSVS  142

Query  752   LRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSK  573
             +++NH CVENSMKS+CPIC E+ F+S+K + I+KCGHTMHM+CYREM  QNQYRCPIC K
Sbjct  143   VQNNHSCVENSMKSFCPICLEYQFDSIKGSTILKCGHTMHMECYREMATQNQYRCPICLK  202

Query  572   SVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTR  393
             +++N    WE L+ EI+   MPEEY +EV ILCNDCN+TST  FHI GHKC  C SYNTR
Sbjct  203   TIVN-DMNWEYLDREIEGVHMPEEYKFEVSILCNDCNSTSTVSFHIFGHKCLQCGSYNTR  261

Query  392   MVKADRQ  372
              +   +Q
Sbjct  262   RISKPKQ  268



>ref|XP_009131683.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Brassica rapa]
 emb|CDX88926.1| BnaA03g07230D [Brassica napus]
Length=267

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 209/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRC+IRAPCCNEIF CRHCHNE  S L +  +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGFGCQHYRRRCQIRAPCCNEIFDCRHCHNEFTSTLRNIYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC IC+ YDD+T K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCSNCGVNMGEYFCNICKFYDDNTEKQQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+ GLR+NH CVE+SM+ +CPIC+E+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYATGLRNNHRCVEDSMRHHCPICFEYLFDSLKETTVMKCGHTMHCECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++EEI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRMDEEIEATSMPSDYHDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR V  
Sbjct  251   HCRSYNTRAVAP  262



>ref|XP_009405425.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=264

 Score =   360 bits (923),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 199/250 (80%), Gaps = 7/250 (3%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRCKIRAPCCNEIF CRHCHNE+ S      +RHEL R+DV++VIC +
Sbjct  12    FGKMEFGCKHYRRRCKIRAPCCNEIFYCRHCHNESTS------DRHELCRQDVQKVICLI  65

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ VA +C NCGV  GDYFC +C+ YDDD  K QYHCN+CGICR+GG ENFFHC+KC
Sbjct  66    CNTEQPVAQVCSNCGVSMGDYFCNVCKFYDDDLKKGQYHCNDCGICRVGGSENFFHCKKC  125

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV-HQNQ  597
             GSCYS  LRD H CVENSM+  CPICYE+LF+SLK T ++KCGHT+H +C+ EM+ H  +
Sbjct  126   GSCYSTELRDKHFCVENSMRHNCPICYEYLFDSLKDTSVLKCGHTIHFECFDEMLKHAQR  185

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCK  417
             Y CP+CSKSV +MS+ W  L+EEI  T+MPE+Y Y+V ILCNDCNN S   FHI+GHKC 
Sbjct  186   YSCPVCSKSVCDMSKYWRKLDEEIAATIMPEDYRYKVWILCNDCNNVSEVFFHIVGHKCS  245

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  246   HCLSYNTRTI  255



>gb|KHN03386.1| RING finger and CHY zinc finger domain-containing protein 1 [Glycine 
soja]
Length=262

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 209/248 (84%), Gaps = 1/248 (0%)
 Frame = -2

Query  1127  KMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCN  948
             ++ FG   Y RRC+IRAPCCNEI++CRHCHNEA S L +P +RHELVR+DVKQVIC+VC+
Sbjct  8     RLHFGKIGYGRRCRIRAPCCNEIYSCRHCHNEAASLLKNPFDRHELVRQDVKQVICSVCD  67

Query  947   TEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGS  768
             TEQ VA +C NCGVK G+YFC IC+ +DDD  K+Q+HC++CGICR+GGR+NFFHC+KCGS
Sbjct  68    TEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGGRDNFFHCKKCGS  127

Query  767   CYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRC  588
             CY+VGL DNHLCVENSM+ +CPICYE+LF+SLK  ++MKCGHTMH +CY EM+  ++Y C
Sbjct  128   CYAVGLHDNHLCVENSMRHHCPICYEYLFDSLKDVIVMKCGHTMHHECYLEMIKNDKYCC  187

Query  587   PICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCKHC  411
             PICSKSV++MS+TW+ ++EEI+ TVMPE+Y   +V ILCNDCN+T+   FHILG KC HC
Sbjct  188   PICSKSVIDMSKTWKRIDEEIEATVMPEDYRNRKVWILCNDCNDTTEVYFHILGQKCGHC  247

Query  410   SSYNTRMV  387
              SYNTR V
Sbjct  248   RSYNTRTV  255



>gb|KCW58537.1| hypothetical protein EUGRSUZ_H01203 [Eucalyptus grandis]
Length=285

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 196/252 (78%), Gaps = 0/252 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DF K+  GCEHYRRRCKIRAPCC+ +F CRHCHNE  S LS+ K+ HELVR DVK+V+C+
Sbjct  15    DFAKLEHGCEHYRRRCKIRAPCCDRVFPCRHCHNEFTSSLSNLKDHHELVRHDVKRVVCS  74

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ+ A +C  CGV  G+YFC  C+ YDD T K+Q+HC ECGICR+GGRENFFHC  
Sbjct  75    VCDTEQEAAQVCSKCGVNMGEYFCGTCKFYDDQTEKEQFHCEECGICRVGGRENFFHCPN  134

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
              GSCY + LRDNH+CVENSMKS+CP+CYE+LF+S+K T I+KCGHT+HMDC +EM  QNQ
Sbjct  135   AGSCYVMSLRDNHVCVENSMKSHCPVCYEYLFDSMKGTTILKCGHTIHMDCVKEMADQNQ  194

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCK  417
             YRCPICSK+ +  S  W +L+ EI  TVMP+EY Y+V ILCNDCN T    FHI G KC 
Sbjct  195   YRCPICSKTFMEKSDDWRMLDAEIAATVMPKEYQYKVTILCNDCNKTGHVPFHIFGLKCS  254

Query  416   HCSSYNTRMVKA  381
              C SYNTR + A
Sbjct  255   ECCSYNTRRISA  266



>gb|AFK43278.1| unknown [Lotus japonicus]
Length=247

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1124  MLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNT  945
             M +GC HY+RRC+IRAPCCN+IF CRHCH++A S  SDPK+ HELVR DVKQVIC+VC+T
Sbjct  1     MHYGCRHYKRRCRIRAPCCNQIFHCRHCHSDAMSSSSDPKDHHELVRSDVKQVICSVCDT  60

Query  944   EQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSC  765
             EQ+VA +C NC V  G+Y+CEIC+ YDDDT K Q+HC+ECGICR+GGR NFFHC KCGSC
Sbjct  61    EQEVAKVCSNCCVNMGEYYCEICKFYDDDTDKGQFHCDECGICRVGGRHNFFHCNKCGSC  120

Query  764   YSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCP  585
             YSV L++NHLCVENSMKS CP    +LF+S KST IM+CGHTMH +C+ EMV QNQYRCP
Sbjct  121   YSVVLQNNHLCVENSMKSSCP----YLFDSTKSTTIMRCGHTMHTECFTEMVTQNQYRCP  176

Query  584   ICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSS  405
             IC K++ +MS+TW +L+ E+    MP EY YEVPILCNDCN+TS+  FHI G KC+ C S
Sbjct  177   ICLKTIADMSQTWALLDWEVGAIPMPNEYHYEVPILCNDCNSTSSISFHISGLKCRQCGS  236

Query  404   YNTRMVKADRQ  372
             YNTR V    Q
Sbjct  237   YNTRRVSTPEQ  247



>ref|XP_010558492.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Tarenaya hassleriana]
Length=267

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 208/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRC+IRAPCCNE+++CRHCHNEA   LS+    HE+VR+DVKQVIC+V
Sbjct  11    FGKMGFGCKHYRRRCRIRAPCCNEVYSCRHCHNEAMGSLSNTYSHHEIVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA IC NCGV  G+YFC+ C+ YDDD  K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAHICSNCGVNMGEYFCKTCKFYDDDMEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+ LR+NH CVENSM+ +CPIC+E+LF+SLK T++MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYSISLRNNHRCVENSMRHHCPICFEYLFDSLKDTIVMKCGHTMHCECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++M++TW+ L+EEI  T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMAKTWQRLDEEIDATAMPPDYRDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR +  
Sbjct  251   HCRSYNTRAISP  262



>emb|CDX70831.1| BnaC03g09150D [Brassica napus]
Length=267

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 208/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRC+IRAPCCNEIF CRHCHNE  S L +  +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGFGCQHYRRRCQIRAPCCNEIFDCRHCHNEFTSTLRNIYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC IC+ YDD+T K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCSNCGVNMGEYFCNICKFYDDNTEKQQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY+ GLR+NH CVE+SM+ +CPIC+E+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYATGLRNNHRCVEDSMRHHCPICFEYLFDSLKETTVMKCGHTMHCECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++ EI+ T MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  191   CCPICSRSVIDMSKTWQRMDAEIEATSMPSDYHDKKVWILCNDCNDTTEVYFHIIGQKCG  250

Query  416   HCSSYNTRMVKA  381
             HC SYNTR V  
Sbjct  251   HCRSYNTRAVAP  262



>ref|XP_006600216.1| PREDICTED: uncharacterized protein LOC100812839 isoform X1 [Glycine 
max]
Length=262

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/248 (67%), Positives = 209/248 (84%), Gaps = 1/248 (0%)
 Frame = -2

Query  1127  KMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCN  948
             ++ FG   Y RRC+IRAPCCNEI++CRHCHNEA S L +P +RHELVR+DVKQVIC+VC+
Sbjct  8     RLHFGKIGYGRRCRIRAPCCNEIYSCRHCHNEAASLLKNPFDRHELVRQDVKQVICSVCD  67

Query  947   TEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGS  768
             TEQ VA +C NCGVK G+YFC IC+ +DDD  K+Q+HC++CGICR+GGR+NFFHC+KCGS
Sbjct  68    TEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGGRDNFFHCKKCGS  127

Query  767   CYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRC  588
             CY+VGL DNHLCVENSM+ +CPICYE+LF+SLK  ++MKCGHTMH +CY EM+  ++Y C
Sbjct  128   CYAVGLHDNHLCVENSMRHHCPICYEYLFDSLKDVIVMKCGHTMHHECYLEMIKNDKYCC  187

Query  587   PICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCKHC  411
             PICSKSV++MS+TW+ ++EEI+ TVMP++Y   +V ILCNDCN+T+   FHILG KC HC
Sbjct  188   PICSKSVIDMSKTWKRIDEEIEATVMPQDYRNRKVWILCNDCNDTTEVYFHILGQKCGHC  247

Query  410   SSYNTRMV  387
              SYNTR V
Sbjct  248   RSYNTRTV  255



>ref|XP_009791774.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009791775.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009791776.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
Length=278

 Score =   358 bits (920),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/273 (61%), Positives = 213/273 (78%), Gaps = 12/273 (4%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEA-----------KSGL  1017
             ++D      DFGKM +GC+HYRRRC+IRAPCCNE+F CRHCHNEA           +S L
Sbjct  1     MEDSCNERLDFGKMGYGCKHYRRRCRIRAPCCNEVFDCRHCHNEATFVTFALCLFHQSSL  60

Query  1016  SDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYH  837
              +  +RHELVR DVKQVIC+VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+H
Sbjct  61    HNVFDRHELVRYDVKQVICSVCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDLDKGQFH  120

Query  836   CNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMI  657
             C++CGICR+GGRENFFHC +CGSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T +
Sbjct  121   CDDCGICRVGGRENFFHCSRCGSCYSVSLRNNHSCVENSMRHHCPICYEYLFDSLKDTTV  180

Query  656   MKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPI  480
             +KCGHTMH +CY EM+ +++  CPICS+S+++MSR W  ++EEI+ T+MPE   Y +V I
Sbjct  181   LKCGHTMHTECYHEMIKRDKCCCPICSRSIIDMSRAWRRMDEEIEETIMPENLRYKKVWI  240

Query  479   LCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             LCNDCN+T+   FHI+G KC+HC SYNTRM+  
Sbjct  241   LCNDCNDTTEVFFHIIGQKCRHCESYNTRMIAP  273



>ref|XP_006855440.1| hypothetical protein AMTR_s00057p00167230 [Amborella trichopoda]
 gb|ERN16907.1| hypothetical protein AMTR_s00057p00167230 [Amborella trichopoda]
Length=268

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 206/256 (80%), Gaps = 1/256 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             D  K  +GC+HY+RRCKIRAPCCNE+F CRHCHNEAKS +S P ERH+L R DV+QVIC 
Sbjct  13    DSEKSEYGCKHYKRRCKIRAPCCNEVFPCRHCHNEAKSLVSSPSERHDLCRHDVRQVICL  72

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             +C+TEQ+V+ IC NCG+K G+YFC +C+ YDDDT+K Q+HC+ECGICR+GGRE +FHC+K
Sbjct  73    ICDTEQEVSPICTNCGIKMGEYFCAVCKFYDDDTSKGQFHCDECGICRVGGREEYFHCKK  132

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSV LR+NH+CVENSM+ +C +CYE+LF+SLK T ++KCGHTMH +C  EM   NQ
Sbjct  133   CGSCYSVKLRNNHVCVENSMRHHCSVCYEYLFDSLKDTTVLKCGHTMHFECLMEMKEHNQ  192

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPIC KSV +M++ W+ +++EI  T+MPE+Y Y +V ILCNDC+ T+  +FHI+G KC
Sbjct  193   YSCPICFKSVCDMTKVWQKIDDEIAATIMPEDYRYKKVWILCNDCSETTEVMFHIIGQKC  252

Query  419   KHCSSYNTRMVKADRQ  372
              HC SYNTR +    Q
Sbjct  253   GHCESYNTRTIAPPMQ  268



>ref|XP_009126278.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Brassica rapa]
 emb|CDY47180.1| BnaAnng08500D [Brassica napus]
Length=268

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 208/252 (83%), Gaps = 1/252 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG M FGCEHYRRRC+IRAPCCNE+F+CRHCHNE  S L +  +RHELVR+DVKQVIC+V
Sbjct  12    FGIMGFGCEHYRRRCQIRAPCCNEVFSCRHCHNETTSTLRNIYDRHELVRQDVKQVICSV  71

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC IC+ YDD+  K+Q+HC++CGICR+GGRENFFHC+KC
Sbjct  72    CDTEQPVAQVCSNCGVNMGEYFCNICKFYDDNIEKEQFHCDDCGICRVGGRENFFHCKKC  131

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY +GLR+NH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  132   GSCYGIGLRNNHRCVEDSMRHHCPICYEYLFDSLKETTVMKCGHTMHCECYHEMLKRDKF  191

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICS+SV++MS+TW+ ++EE++   MP +Y   +V ILCNDCN+T+   FHI+G KC 
Sbjct  192   CCPICSRSVIDMSKTWQRMDEEVEAISMPSDYRDKKVWILCNDCNDTTQVYFHIIGQKCG  251

Query  416   HCSSYNTRMVKA  381
             HC SYNTR V  
Sbjct  252   HCRSYNTRAVAP  263



>ref|XP_011013257.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Populus euphratica]
Length=270

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 216/263 (82%), Gaps = 4/263 (2%)
 Frame = -2

Query  1163  LDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++   VS E  DFGKM +GC+HYRRRC+IRAPCCNEIFTCRHCHNEA + L +  +RHE+
Sbjct  1     MESTPVSNERLDFGKMGYGCQHYRRRCQIRAPCCNEIFTCRHCHNEATNMLKNFCDRHEI  60

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R DVKQVICAVC+TEQ VA +C NCGV  G+YFC+IC+ +DDDT K  +HC++CGICR+
Sbjct  61    NRYDVKQVICAVCDTEQPVAQVCTNCGVTMGEYFCKICKFFDDDTAKGLFHCDDCGICRV  120

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYE-FLFESLKSTMIMKCGHTMH  633
             GGREN++HC+KCGSCY+  L DNHLCVENSM  +CPICYE +LF+SLK T +MKCGHTMH
Sbjct  121   GGRENYYHCKKCGSCYATSLLDNHLCVENSMCHHCPICYEVYLFDSLKETNVMKCGHTMH  180

Query  632   MDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNT  456
              +CY EM+ +++Y CPICSKS+++MS+TW+ ++EEI+ TVMPE+Y + +V ILC+DCN+T
Sbjct  181   GECYDEMIKRDKYCCPICSKSIIDMSKTWKRIDEEIEATVMPEDYSHRKVWILCDDCNDT  240

Query  455   STAIFHILGHKCKHCSSYNTRMV  387
             +   FHI+G KC HC SYNTR +
Sbjct  241   TEVYFHIVGQKCSHCKSYNTRTI  263



>ref|XP_010321192.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Solanum lycopersicum]
Length=285

 Score =   356 bits (913),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 167/271 (62%), Positives = 210/271 (77%), Gaps = 19/271 (7%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNE++ CRHCHNEA S L    +RHELVR+DV QVIC+
Sbjct  10    DFGKMGYGCKHYRRRCKIRAPCCNEVYDCRHCHNEATSMLRKIFDRHELVRQDVTQVICS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTT------------------KDQYHCN  831
             VC+TEQ VA +C NCGV  G+YFCE+C+ YDDDT                   K Q+HC+
Sbjct  70    VCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDTLLAITFPKCLFWTRPLQIDKGQFHCD  129

Query  830   ECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMK  651
             +CGICR+GGRENFFHC KC SCYSV LR+NH CVE+SM+ +CPICYEFLF+SLK T +MK
Sbjct  130   DCGICRVGGRENFFHCNKCDSCYSVSLRNNHSCVEDSMRHHCPICYEFLFDSLKDTTVMK  189

Query  650   CGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILC  474
             CGHTMH +CY EM+ +++Y CPICS+S L+M++ W+ ++EEI+ T+MPE+  Y +V ILC
Sbjct  190   CGHTMHTECYHEMIKRDKYCCPICSRSTLDMTKAWKRMDEEIEETIMPEDLRYKKVWILC  249

Query  473   NDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             NDCN+T+   FHI+G KC+HC SYNTRM+  
Sbjct  250   NDCNDTTEVYFHIIGQKCRHCQSYNTRMIAP  280



>ref|XP_006352808.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Solanum tuberosum]
Length=229

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRD  978
             ++ +  +D GK+L+GC+HYRRRCK+RAPCCNEIFTCRHCHNEAK+ L++PKERHELVR +
Sbjct  19    EEELDRQDVGKLLYGCDHYRRRCKLRAPCCNEIFTCRHCHNEAKNALTNPKERHELVRHN  78

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             VKQV+CAVC+TEQQVA IC  CGVKFG+Y+CEICR YDD+ TK Q+HC++CGICR+GGRE
Sbjct  79    VKQVVCAVCDTEQQVAEICSECGVKFGEYYCEICRFYDDNRTKGQFHCDDCGICRVGGRE  138

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             NFFHC+KCGSCYSV LRDNHLCVENSMK++CPICYEFLF+S+K T IMKCGHTMHM+C+ 
Sbjct  139   NFFHCKKCGSCYSVELRDNHLCVENSMKNHCPICYEFLFDSVKGTTIMKCGHTMHMECHT  198

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEI  525
             EM+HQNQYRCPICSKSVLNMS TW+ L+ E+
Sbjct  199   EMIHQNQYRCPICSKSVLNMSGTWQRLDMEV  229



>ref|XP_010069985.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Eucalyptus grandis]
 gb|KCW58535.1| hypothetical protein EUGRSUZ_H01203 [Eucalyptus grandis]
Length=298

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 198/265 (75%), Gaps = 13/265 (5%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DF K+  GCEHYRRRCKIRAPCC+ +F CRHCHNE  S LS+ K+ HELVR DVK+V+C+
Sbjct  15    DFAKLEHGCEHYRRRCKIRAPCCDRVFPCRHCHNEFTSSLSNLKDHHELVRHDVKRVVCS  74

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD-------------TTKDQYHCNECGIC  816
             VC+TEQ+ A +C  CGV  G+YFC  C+ YDD              T K+Q+HC ECGIC
Sbjct  75    VCDTEQEAAQVCSKCGVNMGEYFCGTCKFYDDQVRRICVFYVQFLQTEKEQFHCEECGIC  134

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R+GGRENFFHC KCGSCY + LRDNH+CVENSMKS+CP+CYE+LF+S+K T I+KCGHT+
Sbjct  135   RVGGRENFFHCPKCGSCYVMSLRDNHVCVENSMKSHCPVCYEYLFDSMKGTTILKCGHTI  194

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNT  456
             HMDC +EM  QNQYRCPICSK+ +  S  W +L+ EI  TVMP+EY Y+V ILCNDCN T
Sbjct  195   HMDCVKEMADQNQYRCPICSKTFMEKSDDWRMLDAEIAATVMPKEYQYKVTILCNDCNKT  254

Query  455   STAIFHILGHKCKHCSSYNTRMVKA  381
                 FHI G KC  C SYNTR + A
Sbjct  255   GHVPFHIFGLKCSECCSYNTRRISA  279



>ref|XP_008804577.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Phoenix dactylifera]
Length=274

 Score =   352 bits (903),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 203/278 (73%), Gaps = 9/278 (3%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSG  1020
             ME      T     D  +    FGK  FGC HYRRRCKIRAPCCNEIF+CR CHNE+ S 
Sbjct  1     METAASAGTDSSAADSRLG---FGKKEFGCRHYRRRCKIRAPCCNEIFSCRLCHNESDSV  57

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L      HEL R+DV++VIC VC+TEQ VA +C NCGV  G+YFC++C+ YDDD  K Q+
Sbjct  58    L------HELCRQDVQRVICLVCDTEQPVAQVCSNCGVNMGEYFCDVCKFYDDDVDKGQF  111

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HCN+CG+CR+GG+ENF+HCQKCGSCYSV LRD H CVENSM+S+CPICYE+LF+SLK T 
Sbjct  112   HCNDCGMCRVGGKENFYHCQKCGSCYSVVLRDKHRCVENSMRSHCPICYEYLFDSLKETR  171

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPI  480
             ++ CGHT+H +C+ EM+   QY CPICSKSV +MS+ W+ L+EEI  T+MPE+Y Y+V I
Sbjct  172   VLNCGHTIHRECFEEMLEHAQYSCPICSKSVCDMSKYWKKLDEEIAATIMPEDYRYKVWI  231

Query  479   LCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKADRQ*P  366
             LCNDCN  S   FHI+G KC HC SYNTR        P
Sbjct  232   LCNDCNEASEVFFHIIGRKCSHCGSYNTRSTSPPAMPP  269



>ref|XP_002442253.1| hypothetical protein SORBIDRAFT_08g017080 [Sorghum bicolor]
 gb|EES16091.1| hypothetical protein SORBIDRAFT_08g017080 [Sorghum bicolor]
Length=292

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 159/267 (60%), Positives = 203/267 (76%), Gaps = 4/267 (1%)
 Frame = -2

Query  1193  VGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS  1014
             +GD      +  +      D GKM  GCEHYRRRCKI APCCN++F CRHCHNEA +   
Sbjct  7     LGDNDVVAARDGEAVDHRRDVGKMEHGCEHYRRRCKIVAPCCNQVFPCRHCHNEATAS--  64

Query  1013  DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHC  834
                +RH +VR+DVK+V+C +C TEQ V+ +C++CGV  G+YFC+IC+ YDDD  K QYHC
Sbjct  65    --GDRHTIVRQDVKKVVCLLCETEQPVSQVCISCGVNMGEYFCDICKFYDDDIGKGQYHC  122

Query  833   NECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIM  654
             N+CGICR+GG+E FFHC KCGSCYSV LRDNH CVENSM+  CPICYE+LF+SL+ T ++
Sbjct  123   NDCGICRVGGKEKFFHCVKCGSCYSVELRDNHRCVENSMRQNCPICYEYLFDSLQGTRVL  182

Query  653   KCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILC  474
              CGHTMH+ C+ EMV  N+Y CPICSK+ L+M+R WE+L++EI+ T+MP  Y Y++ +LC
Sbjct  183   NCGHTMHLTCFEEMVEHNKYTCPICSKTALDMTRHWEMLDQEIEATIMPPVYRYKIWVLC  242

Query  473   NDCNNTSTAIFHILGHKCKHCSSYNTR  393
             NDCN  S   FH++GHKC HCSSYNTR
Sbjct  243   NDCNKVSEVNFHVIGHKCSHCSSYNTR  269



>ref|XP_009592577.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Nicotiana tomentosiformis]
Length=266

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 202/245 (82%), Gaps = 1/245 (0%)
 Frame = -2

Query  1112  CEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQV  933
             C+HYRRRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR DVKQVIC+VC+TEQ V
Sbjct  18    CKHYRRRCRIRAPCCNEVFDCRHCHNEATSSLHNVFDRHELVRNDVKQVICSVCDTEQPV  77

Query  932   AGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVG  753
             A +C NCGV  G+YFCE+C+ YDDD  K Q+HC++CGICR+GG ENFFHC +CGSCYSV 
Sbjct  78    ARVCTNCGVNMGEYFCEVCKFYDDDLDKGQFHCDDCGICRVGGNENFFHCNRCGSCYSVS  137

Query  752   LRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSK  573
             LR+NH CVENSM+ +CPICYE+LF+SLK T ++KCGHTMH +CY EM+ +++  CPICS+
Sbjct  138   LRNNHSCVENSMRHHCPICYEYLFDSLKDTTVLKCGHTMHTECYHEMIKRDKCCCPICSR  197

Query  572   SVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCKHCSSYNT  396
             S+++MSR W  ++EEI+ T+MP++  Y +V ILCNDCN+T+   FHI+G KC+HC SYNT
Sbjct  198   SIIDMSRAWRRMDEEIEETIMPDDLRYKKVWILCNDCNDTTEVFFHIIGQKCRHCESYNT  257

Query  395   RMVKA  381
             RM+  
Sbjct  258   RMIAP  262



>ref|XP_007223129.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
 gb|EMJ24328.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
Length=248

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 200/253 (79%), Gaps = 20/253 (8%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRC+IRAPCCNEI+ CRHCHNEA                    V+C+
Sbjct  10    DFGKMGYGCKHYRRRCQIRAPCCNEIYPCRHCHNEA-------------------TVVCS  50

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA +C NCGV  G+YFCEIC+ YDDDT K Q+HCN+CGICRIGGRENF+HC+K
Sbjct  51    VCDTEQPVARVCTNCGVSMGEYFCEICKFYDDDTDKGQFHCNDCGICRIGGRENFYHCKK  110

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYSVGLRDNHLCVENSM+ +CPICYEFLF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  111   CGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTTVMKCGHTMHCECYNEMMKRDK  170

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW  ++EEI+ T MPE+Y Y +V ILCNDCN+T+   FHI+G KC
Sbjct  171   YCCPICSKSVIDMSRTWRRIDEEIEATAMPEDYRYKKVWILCNDCNDTTEVYFHIIGQKC  230

Query  419   KHCSSYNTRMVKA  381
              HC SYNTR +  
Sbjct  231   NHCKSYNTRTIAP  243



>gb|KDO75132.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=256

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/250 (65%), Positives = 204/250 (82%), Gaps = 12/250 (5%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQV    
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQV----  66

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
                    A +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  67    -------AQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  119

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  120   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  179

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y + +V ILCNDCN+T+   FHI+G KC 
Sbjct  180   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCS  239

Query  416   HCSSYNTRMV  387
             HC SYNTR +
Sbjct  240   HCKSYNTRSI  249



>ref|XP_008796207.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Phoenix dactylifera]
 ref|XP_008796208.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Phoenix dactylifera]
Length=262

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/250 (65%), Positives = 196/250 (78%), Gaps = 7/250 (3%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC HYRRRCKIRAPCCNEIF CR CHNE+       K+RHE+ R DV++VIC +
Sbjct  12    FGKMGYGCNHYRRRCKIRAPCCNEIFPCRLCHNES------TKDRHEICRHDVQRVICVI  65

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G YFC +C+ YDDD  K QYHCNECGICRIGG+ENFFHCQKC
Sbjct  66    CDTEQAVAQVCSNCGVNMGQYFCGVCKFYDDDIEKRQYHCNECGICRIGGKENFFHCQKC  125

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+ LRD H+CVENSM+  C ICYE+LF+SLK T ++KCGHTMH  C+ EM+  ++Y
Sbjct  126   GSCYSIDLRDKHVCVENSMRHNCSICYEYLFDSLKVTTVLKCGHTMHSQCFHEMLKHDKY  185

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSK+V +MSR W  L+EE + TVMPE Y F +V ILCNDCN+T+   FH++G KC 
Sbjct  186   SCPICSKTVADMSRAWRKLDEETEATVMPENYRFKKVWILCNDCNDTTEVFFHVIGQKCS  245

Query  416   HCSSYNTRMV  387
             HC SYNTR+V
Sbjct  246   HCDSYNTRVV  255



>ref|XP_006664079.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Oryza brachyantha]
Length=288

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 200/252 (79%), Gaps = 4/252 (2%)
 Frame = -2

Query  1148  VSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQ  969
             V   D GKM  GCEHYRRRCKI APCCNE+F CRHCHNEA +      +RH + R+DV++
Sbjct  17    VPLRDVGKMEHGCEHYRRRCKIVAPCCNEVFPCRHCHNEATAS----GDRHTICRQDVEK  72

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             V+C +C+T+Q V+ +C++CGV  G+YFC++C+ YDDDT K Q+HC +CGICR+GG+EN+F
Sbjct  73    VVCLLCDTKQPVSQVCISCGVNMGEYFCDVCKFYDDDTEKGQFHCYDCGICRVGGKENYF  132

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC KCGSCY+V LRDNH CVENSM+  CPICYE+LF+SLK T ++ CGHTMHMDC+ EMV
Sbjct  133   HCTKCGSCYAVALRDNHHCVENSMRQNCPICYEYLFDSLKGTRVLDCGHTMHMDCFSEMV  192

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILG  429
             H N+Y CPICSK+ L+M+  W +L++EI+ T+MP  Y Y+V +LCNDCN  S   FH++G
Sbjct  193   HHNKYTCPICSKTALDMTHHWALLDQEIEATIMPPVYRYKVWVLCNDCNKVSEVNFHVIG  252

Query  428   HKCKHCSSYNTR  393
             HKC HC+SYNTR
Sbjct  253   HKCSHCNSYNTR  264



>ref|NP_001066941.1| Os12g0538500 [Oryza sativa Japonica Group]
 gb|ABA99335.2| CHY zinc finger family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29960.1| Os12g0538500 [Oryza sativa Japonica Group]
 dbj|BAG86959.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53352.1| hypothetical protein OsJ_36374 [Oryza sativa Japonica Group]
Length=292

 Score =   348 bits (894),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 199/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRD  978
             D  V   D GKM  GCEHYRRRCKI APCC E+F CRHCHN+A +      +RH + R+D
Sbjct  18    DAVVPLRDVGKMEHGCEHYRRRCKIVAPCCGEVFACRHCHNDATAS----GDRHTICRQD  73

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             V++V+C +C+TEQ V+ +C+NCGV  G+YFC++C+ YDDDT K Q+HC +CGICR+GG+E
Sbjct  74    VEKVVCLLCDTEQPVSQVCINCGVNMGEYFCDVCKFYDDDTEKGQFHCYDCGICRVGGKE  133

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             N+FHC KCGSCY+V LRDNH CVENSM+  CPICYE+LF+SLK T ++ CGHTMHM+C+ 
Sbjct  134   NYFHCAKCGSCYAVALRDNHQCVENSMRQNCPICYEYLFDSLKGTRVLDCGHTMHMECFS  193

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFH  438
             EMV  N+Y CPICSK+ L+M+  W +L++EI+ T+MP  Y Y+V +LCNDCN  S   FH
Sbjct  194   EMVEHNKYTCPICSKTALDMTHHWALLDQEIEATIMPPVYRYKVWVLCNDCNKVSEVDFH  253

Query  437   ILGHKCKHCSSYNTR  393
             ++GHKC HC+SYNTR
Sbjct  254   VIGHKCSHCNSYNTR  268



>ref|XP_010938706.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Elaeis guineensis]
 ref|XP_010938707.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Elaeis guineensis]
Length=263

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/251 (64%), Positives = 200/251 (80%), Gaps = 7/251 (3%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             +FG+M +GC+HYRRRCKIRAPCCNEIF CRHCHNE+ +      +RHE+ R DV++VIC 
Sbjct  12    EFGRMGYGCKHYRRRCKIRAPCCNEIFPCRHCHNESTN------DRHEICRHDVQRVICV  65

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             +C+TEQ VA +C NCGV  G YFC +C+ YDDD  K QYHCN+CGICR+GG+ENFFHCQK
Sbjct  66    ICDTEQPVAQVCSNCGVNMGQYFCGVCKFYDDDIEKRQYHCNDCGICRVGGKENFFHCQK  125

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS+ LRD H CVENSM+ +C ICYE+LF+SLK T ++ CGHTMH  C  EM+  ++
Sbjct  126   CGSCYSIDLRDKHACVENSMRHHCSICYEYLFDSLKETTVLNCGHTMHSHCLHEMIKHDK  185

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCNDCNNTSTAIFHILGHKC  420
             Y CPICSKSV++MSRTW  L+EEI+ T+MPE Y + +V ILCNDCN+T+   FH++G KC
Sbjct  186   YSCPICSKSVIDMSRTWRKLDEEIEATLMPENYRHKKVWILCNDCNDTTEVFFHVIGRKC  245

Query  419   KHCSSYNTRMV  387
              HC SYNTR+V
Sbjct  246   GHCQSYNTRVV  256



>ref|XP_003575752.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Brachypodium distachyon]
Length=297

 Score =   348 bits (893),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 200/248 (81%), Gaps = 4/248 (2%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             D GKM  GCEHYRRRCKI APCCN++F+CRHCH+EA + L D   RH + R+DV +VIC 
Sbjct  29    DVGKMEHGCEHYRRRCKIVAPCCNQVFSCRHCHDEA-TALGD---RHNISRQDVAKVICV  84

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             +C+T+Q V+ +C++CGV  G+YFC+IC+ YDD+T K QYHC+ CGICR+GGR+N+FHC K
Sbjct  85    LCDTKQPVSQVCISCGVNMGEYFCDICKFYDDETVKGQYHCHACGICRVGGRDNYFHCAK  144

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCY+V LRDNH CVE+SM+  CPICYE+LF+SLK T ++ CGHTMHMDC+ EMV  N+
Sbjct  145   CGSCYAVSLRDNHQCVEDSMRQNCPICYEYLFDSLKGTRVLDCGHTMHMDCFAEMVDHNK  204

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCK  417
             Y CPICSK+ L+M+  W++L+ EI+ T+MP+ Y Y+V +LCNDCN  S   FH++GHKC 
Sbjct  205   YTCPICSKTALDMTLHWDMLDREIEATLMPQVYRYKVWVLCNDCNQVSKVGFHVIGHKCG  264

Query  416   HCSSYNTR  393
             HCSSYNTR
Sbjct  265   HCSSYNTR  272



>ref|XP_010558491.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Tarenaya hassleriana]
Length=282

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 203/248 (82%), Gaps = 1/248 (0%)
 Frame = -2

Query  1121  LFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTE  942
             L  C+HYRRRC+IRAPCCNE+++CRHCHNEA   LS+    HE+VR+DVKQVIC+VC+TE
Sbjct  30    LSRCKHYRRRCRIRAPCCNEVYSCRHCHNEAMGSLSNTYSHHEIVRQDVKQVICSVCDTE  89

Query  941   QQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCY  762
             Q VA IC NCGV  G+YFC+ C+ YDDD  K Q+HC++CGICR+GGRENFFHC+KCGSCY
Sbjct  90    QPVAHICSNCGVNMGEYFCKTCKFYDDDMEKGQFHCDDCGICRVGGRENFFHCKKCGSCY  149

Query  761   SVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPI  582
             S+ LR+NH CVENSM+ +CPIC+E+LF+SLK T++MKCGHTMH +CY EM+ ++++ CPI
Sbjct  150   SISLRNNHRCVENSMRHHCPICFEYLFDSLKDTIVMKCGHTMHCECYHEMIKRDKFCCPI  209

Query  581   CSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCKHCSS  405
             CS+SV++M++TW+ L+EEI  T MP +Y   +V ILCNDCN+T+   FHI+G KC HC S
Sbjct  210   CSRSVIDMAKTWQRLDEEIDATAMPPDYRDKKVWILCNDCNDTTEVYFHIIGQKCGHCRS  269

Query  404   YNTRMVKA  381
             YNTR +  
Sbjct  270   YNTRAISP  277



>ref|XP_009791777.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Nicotiana sylvestris]
Length=278

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 209/273 (77%), Gaps = 17/273 (6%)
 Frame = -2

Query  1148  VSGEDFGKMLFG-----CEHYRRRCKIRAPCCNEIFTCRHCHNEA-----------KSGL  1017
             ++G    K + G     C+HYRRRC+IRAPCCNE+F CRHCHNEA           +S L
Sbjct  1     MNGLILAKWVMGTKNKICKHYRRRCRIRAPCCNEVFDCRHCHNEATFVTFALCLFHQSSL  60

Query  1016  SDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYH  837
              +  +RHELVR DVKQVIC+VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+H
Sbjct  61    HNVFDRHELVRYDVKQVICSVCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDLDKGQFH  120

Query  836   CNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMI  657
             C++CGICR+GGRENFFHC +CGSCYSV LR+NH CVENSM+ +CPICYE+LF+SLK T +
Sbjct  121   CDDCGICRVGGRENFFHCSRCGSCYSVSLRNNHSCVENSMRHHCPICYEYLFDSLKDTTV  180

Query  656   MKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPI  480
             +KCGHTMH +CY EM+ +++  CPICS+S+++MSR W  ++EEI+ T+MPE   Y +V I
Sbjct  181   LKCGHTMHTECYHEMIKRDKCCCPICSRSIIDMSRAWRRMDEEIEETIMPENLRYKKVWI  240

Query  479   LCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             LCNDCN+T+   FHI+G KC+HC SYNTRM+  
Sbjct  241   LCNDCNDTTEVFFHIIGQKCRHCESYNTRMIAP  273



>ref|XP_004962843.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Setaria italica]
Length=294

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 198/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRD  978
             D  V   + GKM  GCEHYRRRCKI APCC ++F CRHCHNEA        +RH + R+D
Sbjct  21    DGEVDLRNVGKMEHGCEHYRRRCKIVAPCCKQVFPCRHCHNEATVS----GDRHTVCRQD  76

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             +++V+C +C+TEQ V+  C++CG   G+YFC+IC+ YDDDT K QYHCN+CGICR+GG+E
Sbjct  77    IEKVVCLLCDTEQPVSQACVSCGANMGEYFCDICKFYDDDTEKGQYHCNDCGICRVGGKE  136

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             NFFHC KCGSCYSV LRDNH CVENSM+  CPICYE+LF+SL+ T ++ CGHTMHM+C+ 
Sbjct  137   NFFHCVKCGSCYSVALRDNHQCVENSMRQNCPICYEYLFDSLQGTRVLNCGHTMHMECFT  196

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFH  438
             +MV  N+Y CPICSK+ L+MS  WE+L++EI+ T+MP  Y Y++ +LCNDCN  S   FH
Sbjct  197   DMVKHNKYTCPICSKTALDMSHHWEMLDQEIEATIMPPVYRYKIWVLCNDCNKVSEVNFH  256

Query  437   ILGHKCKHCSSYNTR  393
             ++GHKC HC+SYNTR
Sbjct  257   VIGHKCSHCNSYNTR  271



>ref|NP_001149168.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea 
mays]
 gb|ACF85160.1| unknown [Zea mays]
 gb|ACG34439.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea 
mays]
 gb|AFW56525.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=293

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 198/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRD  978
             D  V   D GKM  GCEHYRRRCKI APCCN++F CRHCHNEA +      +RH + R+D
Sbjct  20    DGEVDRRDVGKMKHGCEHYRRRCKIVAPCCNQVFPCRHCHNEATAS----GDRHTICRQD  75

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             V++V+C +C T+Q V+ +C++CGV  G+YFC+IC+ YDDDT K QYHC +CGICR+GG+E
Sbjct  76    VEKVVCLLCETKQPVSQVCISCGVNMGEYFCDICKFYDDDTDKGQYHCIDCGICRVGGKE  135

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             NFFHC KCGSCYSV LRDNH CVENSM+  CPICYE+LF+SL+ T ++ CGHTMH+ C+ 
Sbjct  136   NFFHCVKCGSCYSVILRDNHQCVENSMRQNCPICYEYLFDSLQGTRVLNCGHTMHLTCFE  195

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFH  438
             EMV  N+Y CPICSK+ L+++  WE+L++EI+ T+MP  Y Y++ +LCNDCN  S   FH
Sbjct  196   EMVAHNKYTCPICSKTALDLTHHWEMLDQEIEATIMPLVYRYKIWVLCNDCNKVSEVNFH  255

Query  437   ILGHKCKHCSSYNTR  393
             ++GHKC HC SYNTR
Sbjct  256   VIGHKCSHCRSYNTR  270



>emb|CDY02605.1| BnaC02g08300D [Brassica napus]
Length=262

 Score =   341 bits (875),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 205/262 (78%), Gaps = 6/262 (2%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVR  984
             ++D       FG M FG     RRC+IRAPCCNE+F CRHCHNEA S L +  +RHELVR
Sbjct  1     MEDSPNDRLHFGIMGFG-----RRCQIRAPCCNEVFPCRHCHNEATSTLRNIYDRHELVR  55

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
             +DVK VIC+VC+TEQ VA +C NCGV  G+YFC IC+ YDD+T K+Q+HC++CGICR+GG
Sbjct  56    QDVKHVICSVCDTEQPVAQVCSNCGVNMGEYFCNICKFYDDNTEKEQFHCDDCGICRVGG  115

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             RENFFHC+KCGSCY +GLR+NH CVE+SM+ +CPICYE+LF+SLK   +MKCGHTMH DC
Sbjct  116   RENFFHCKKCGSCYGIGLRNNHRCVEDSMRHHCPICYEYLFDSLKEATVMKCGHTMHCDC  175

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTA  447
             Y EM+ ++++ CPICS+SV++MS+TW+ ++EE++   MP +Y   +V ILCNDCN+T+  
Sbjct  176   YHEMLKRDKFCCPICSRSVIDMSKTWQRMDEEVEAIPMPSDYRDKKVWILCNDCNDTTQV  235

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+G KC HC SYNTR V  
Sbjct  236   YFHIIGQKCGHCRSYNTRAVAP  257



>ref|XP_009378905.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Pyrus x bretschneideri]
Length=238

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 191/227 (84%), Gaps = 1/227 (0%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVK  972
             T++ +DFGKM +GC+HYRRRCKIRAPCC++IF CRHCHNEA S LS+PK+RHELVR DVK
Sbjct  11    TLTRQDFGKMEYGCDHYRRRCKIRAPCCDQIFPCRHCHNEAASSLSNPKDRHELVRHDVK  70

Query  971   QVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENF  792
             QV+C+VCNTEQQVA +C NCGV  G+Y+C+IC+ +DDDT K Q+HCNECGICR+GG ENF
Sbjct  71    QVVCSVCNTEQQVAQLCSNCGVNMGEYYCDICKFFDDDTHKGQFHCNECGICRVGGSENF  130

Query  791   FHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREM  612
             FHCQKCGSCY+V LRDNHLCVE+SMK++CP+CYE+LF+S+K T IMKCGHTMH DC+ EM
Sbjct  131   FHCQKCGSCYAVALRDNHLCVEDSMKNHCPVCYEYLFDSVKVTNIMKCGHTMHSDCFIEM  190

Query  611   VHQNQYRCPICSKSVLNMSRTWEILEEEIQT-TVMPEEYFYEVPILC  474
              +QNQYRCPICSK+VL+M  TW +L+ E Q  + + E     VP  C
Sbjct  191   QNQNQYRCPICSKAVLDMGNTWNLLDAEKQVMSPIRESSTGTVPCPC  237



>ref|XP_009414189.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 196/252 (78%), Gaps = 7/252 (3%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HY+RRCKIRAPCCNEIF CRHCHNE+       K+RHE+ R DV+ VIC V
Sbjct  12    FGKMGYGCKHYKRRCKIRAPCCNEIFCCRHCHNES------TKDRHEICRFDVQTVICVV  65

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+ EQ VA +C NCGV  G+YFC +CR YDDD  K  YHC +CGICR+GGRENFFHCQKC
Sbjct  66    CDAEQPVAQVCSNCGVNMGEYFCVVCRFYDDDVDKGHYHCEDCGICRVGGRENFFHCQKC  125

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS GL + H CVENSM+ +C ICYE+LF+SLK T ++KCGHTMH DC  EM++ ++Y
Sbjct  126   GSCYSFGLLNKHSCVENSMRHHCSICYEYLFDSLKETTVLKCGHTMHSDCLSEMLNHDKY  185

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV++MS+ W  ++EEI+ T MPE+Y   +V ILCNDCN+T+   +HI+G KC 
Sbjct  186   CCPICSKSVIDMSKIWRKMDEEIEETAMPEDYRTRKVWILCNDCNDTTEVFYHIIGQKCS  245

Query  416   HCSSYNTRMVKA  381
             HC SYNTRM+  
Sbjct  246   HCQSYNTRMISP  257



>ref|XP_006419637.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
 gb|ESR32877.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
Length=233

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRCKIRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCKIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDY  222



>gb|KCW84421.1| hypothetical protein EUGRSUZ_B01270 [Eucalyptus grandis]
Length=235

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNEIF CRHCHNEA S L +P +RHEL+R+DVKQV+C+
Sbjct  10    DFGKMGYGCQHYRRRCKIRAPCCNEIFPCRHCHNEAASMLRNPFDRHELIRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ V  +C NCGV+ G+YFC+IC+ YDDDT K Q+HC++CGICR+GGR+NFFHC+K
Sbjct  70    VCDTEQPVDQVCTNCGVRMGEYFCKICKFYDDDTEKGQFHCDDCGICRVGGRKNFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS+GL+DNH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSIGLKDNHSCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYGEMLKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             Y CPICS+SV++MSRTW+ ++EEI+ T MPE+Y
Sbjct  190   YCCPICSRSVIDMSRTWKRMDEEIEATQMPEDY  222



>gb|EPS67024.1| hypothetical protein M569_07750 [Genlisea aurea]
Length=276

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 205/269 (76%), Gaps = 12/269 (4%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVRRDVKQVICA  957
             FGKM +GC+HYRRRC+IRAPCCNE++ CRHCHNEA + +  +  +RHEL+R DVKQVIC+
Sbjct  13    FGKMGYGCKHYRRRCRIRAPCCNEVYDCRHCHNEAAANMFLNVYDRHELIRCDVKQVICS  72

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ VA  C NCGV  G+YFC IC+ YDDD  K Q+HC++CGICR+GGR+NFFHC K
Sbjct  73    VCDTEQPVARTCSNCGVNMGEYFCSICKFYDDDIDKGQFHCDDCGICRVGGRQNFFHCMK  132

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CG CYS+ L+ NH+CVENSMK +CPICYE+LF+SL+ TM+MKCGHTMH +CY E++++ +
Sbjct  133   CGCCYSISLQQNHVCVENSMKHHCPICYEYLFDSLRDTMVMKCGHTMHSECYAELINREK  192

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY------EVPILCNDCNNTSTAIFHI  435
             YRCPICSKS++++SR  + L+EE+   +   +Y Y      +V ILCNDCN+T+   F I
Sbjct  193   YRCPICSKSIMDLSRIRKSLDEELAVLLDEYDYIYSSSSSTKVWILCNDCNDTTHVFFDI  252

Query  434   LGHKCKHCSSYNTRMVKADRQ*PFYVDHQ  348
             +G KC HC SYNT  V      P  + HQ
Sbjct  253   MGRKCGHCESYNTTNVA-----PPVLPHQ  276



>gb|KDO75133.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=233

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
              CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEIEATVMPEDY  222



>gb|KCW84422.1| hypothetical protein EUGRSUZ_B01270 [Eucalyptus grandis]
Length=271

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 147/213 (69%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICA  957
             DFGKM +GC+HYRRRCKIRAPCCNEIF CRHCHNEA S L +P +RHEL+R+DVKQV+C+
Sbjct  10    DFGKMGYGCQHYRRRCKIRAPCCNEIFPCRHCHNEAASMLRNPFDRHELIRQDVKQVVCS  69

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             VC+TEQ V  +C NCGV+ G+YFC+IC+ YDDDT K Q+HC++CGICR+GGR+NFFHC+K
Sbjct  70    VCDTEQPVDQVCTNCGVRMGEYFCKICKFYDDDTEKGQFHCDDCGICRVGGRKNFFHCKK  129

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CGSCYS+GL+DNH CVE+SM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ +++
Sbjct  130   CGSCYSIGLKDNHSCVEDSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYGEMLKRDK  189

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             Y CPICS+SV++MSRTW+ ++EEI+ T MPE+Y
Sbjct  190   YCCPICSRSVIDMSRTWKRMDEEIEATQMPEDY  222



>ref|XP_008804578.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Phoenix dactylifera]
Length=263

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/278 (58%), Positives = 194/278 (70%), Gaps = 20/278 (7%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSG  1020
             ME      T     D  +    FGK  FGC HYRRRCKIRAPCCNEIF+CR CHNE+ S 
Sbjct  1     METAASAGTDSSAADSRLG---FGKKEFGCRHYRRRCKIRAPCCNEIFSCRLCHNESDSV  57

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L      HEL R+DV           Q+VA +C NCGV  G+YFC++C+ YDDD  K Q+
Sbjct  58    L------HELCRQDV-----------QRVAQVCSNCGVNMGEYFCDVCKFYDDDVDKGQF  100

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HCN+CG+CR+GG+ENF+HCQKCGSCYSV LRD H CVENSM+S+CPICYE+LF+SLK T 
Sbjct  101   HCNDCGMCRVGGKENFYHCQKCGSCYSVVLRDKHRCVENSMRSHCPICYEYLFDSLKETR  160

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPI  480
             ++ CGHT+H +C+ EM+   QY CPICSKSV +MS+ W+ L+EEI  T+MPE+Y Y+V I
Sbjct  161   VLNCGHTIHRECFEEMLEHAQYSCPICSKSVCDMSKYWKKLDEEIAATIMPEDYRYKVWI  220

Query  479   LCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKADRQ*P  366
             LCNDCN  S   FHI+G KC HC SYNTR        P
Sbjct  221   LCNDCNEASEVFFHIIGRKCSHCGSYNTRSTSPPAMPP  258



>ref|XP_010524761.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Tarenaya hassleriana]
Length=227

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM FGC+HYRRRCKIRAPCCNE+++CRHCHNEA S LS+  +RHE+VR+DVKQVIC+V
Sbjct  11    FGKMGFGCKHYRRRCKIRAPCCNEVYSCRHCHNEATSTLSNIYDRHEIVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDDT K Q+HC++CGICR+GGRENFFHC+KC
Sbjct  71    CDTEQPVAQVCSNCGVSMGEYFCKICKFYDDDTEKGQFHCDDCGICRVGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS+ LR+NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY+EM+ ++++
Sbjct  131   GSCYSISLRNNHQCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYQEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
              CPICSKS+++MS+TW+ ++EEI+ T MP +Y
Sbjct  191   CCPICSKSMIDMSKTWQRMDEEIEATAMPPDY  222



>gb|ADE76339.1| unknown [Picea sitchensis]
Length=273

 Score =   330 bits (845),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 192/254 (76%), Gaps = 1/254 (0%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVC  951
             GKM  GC+HYRRRC+IRAPCCNEI+ CRHCHNEA S L DPK+RHEL R  V++VIC++C
Sbjct  20    GKMEHGCDHYRRRCRIRAPCCNEIYDCRHCHNEAMSHLKDPKQRHELPRYKVERVICSLC  79

Query  950   NTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCG  771
             +TEQ V  +C NCGVK G+YFC  C+ +DDD +K QYHC++CGICR+GGR+NFFHCQKCG
Sbjct  80    DTEQNVNQVCENCGVKMGEYFCSKCKFFDDDISKKQYHCDDCGICRVGGRDNFFHCQKCG  139

Query  770   SCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYR  591
              CY+VGL+  H CVENSM+  CP+C+E+LF+SLK   +++CGHTMH DC  EM   +QY 
Sbjct  140   CCYTVGLQKAHSCVENSMRHNCPVCFEYLFDSLKPIAVLRCGHTMHGDCLSEMQMHSQYS  199

Query  590   CPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKH  414
             CP+CSKSV +MS  WE L++EI  T MP +Y  + V ILCNDC+  S   FHI+  KC  
Sbjct  200   CPMCSKSVCDMSLIWEQLDQEIAATPMPNDYQDKMVWILCNDCDTFSEVQFHIVAQKCLK  259

Query  413   CSSYNTRMVKADRQ  372
             C SYNTR  +   Q
Sbjct  260   CKSYNTRQTRGPGQ  273



>ref|XP_011033604.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Populus euphratica]
Length=244

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -2

Query  1118  FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQ  939
             +GCEHYRRRCKIRAPCCN+IF+CRHCHNEA S LS+PK+RHE+VR D+KQVIC+VCNTEQ
Sbjct  27    YGCEHYRRRCKIRAPCCNQIFSCRHCHNEATSSLSNPKDRHEIVRHDIKQVICSVCNTEQ  86

Query  938   QVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYS  759
             +VA +C  CGVK G+YFC+IC+ YDDDT+K Q+HC+ CGICR+GGRENFFHC+KCGSCY 
Sbjct  87    EVAQVCKKCGVKMGEYFCDICKFYDDDTSKQQFHCDSCGICRLGGRENFFHCEKCGSCYV  146

Query  758   VGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPIC  579
             + + DNH CVENSMK+YCP+CYE+LF+S+K   +MKCGHTMHMDC+ EM  Q QYRCPIC
Sbjct  147   IDMSDNHSCVENSMKNYCPVCYEYLFDSVKQATVMKCGHTMHMDCFHEMAKQQQYRCPIC  206

Query  578   SKSVLNMSRTWEILEEEI  525
             SK+V+N S  W++L+EE+
Sbjct  207   SKTVMNTSEYWKMLDEEV  224



>ref|XP_007050802.1| Zinc finger (C3HC4-type RING finger) family protein isoform 4 
[Theobroma cacao]
 gb|EOX94959.1| Zinc finger (C3HC4-type RING finger) family protein isoform 4 
[Theobroma cacao]
Length=217

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 178/206 (86%), Gaps = 0/206 (0%)
 Frame = -2

Query  1142  GEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVI  963
              +DFG +  GCEHY+RRCKIRAPCCN+IF CRHCHNEA + +S+PK+ H+LVR+DVKQVI
Sbjct  12    SKDFGNLEHGCEHYKRRCKIRAPCCNKIFPCRHCHNEAANSVSNPKDHHDLVRQDVKQVI  71

Query  962   CAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHC  783
             C++CNTEQ+VA +C NC V  G+YFC IC+ YDDDTTK+Q+HCN+CGICR+GGR+N+FHC
Sbjct  72    CSICNTEQEVAQVCCNCRVNMGEYFCNICKFYDDDTTKEQFHCNDCGICRVGGRDNYFHC  131

Query  782   QKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQ  603
             QKCGSCY V L DNHLCVENSMK+ CPICYE+LF+S+KST I+ CGHTMHMDC+ +M  Q
Sbjct  132   QKCGSCYMVNLHDNHLCVENSMKTDCPICYEYLFDSVKSTRILNCGHTMHMDCFSQMTMQ  191

Query  602   NQYRCPICSKSVLNMSRTWEILEEEI  525
             NQYRCPIC K+VL+M+  WE+L+ ++
Sbjct  192   NQYRCPICCKAVLDMTAFWEVLDLDV  217



>ref|XP_007223131.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
 gb|EMJ24330.1| hypothetical protein PRUPE_ppa010024mg [Prunus persica]
Length=220

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             LS+P +RHELVR DVKQV+C+VC+TEQ VA +C NCGV  G+YFCEIC+ YDDDT K Q+
Sbjct  2     LSNPFDRHELVRYDVKQVVCSVCDTEQPVARVCTNCGVSMGEYFCEICKFYDDDTDKGQF  61

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HCN+CGICRIGGRENF+HC+KCGSCYSVGLRDNHLCVENSM+ +CPICYEFLF+SLK T 
Sbjct  62    HCNDCGICRIGGRENFYHCKKCGSCYSVGLRDNHLCVENSMRHHCPICYEFLFDSLKDTT  121

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVP  483
             +MKCGHTMH +CY EM+ +++Y CPICSKSV++MSRTW  ++EEI+ T MPE+Y Y +V 
Sbjct  122   VMKCGHTMHCECYNEMMKRDKYCCPICSKSVIDMSRTWRRIDEEIEATAMPEDYRYKKVW  181

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDCN+T+   FHI+G KC HC SYNTR +  
Sbjct  182   ILCNDCNDTTEVYFHIIGQKCNHCKSYNTRTIAP  215



>gb|KDO75135.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=224

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 183/213 (86%), Gaps = 0/213 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF  495
              CPICSKSV++MSRTW+ ++EE+ +++    +F
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEMNSSIFFPSFF  223



>gb|KDO75134.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=226

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQ  522
              CPICSKSV++MSRTW+ ++EE+Q
Sbjct  191   CCPICSKSVIDMSRTWKRIDEELQ  214



>gb|KFK26102.1| hypothetical protein AALP_AA8G203200 [Arabis alpina]
Length=235

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FG M FGCEHYRRRC+IRAPCCNE+F CRHCHNE+ S L +  +RH+LVR+DVKQVIC V
Sbjct  11    FGVMGFGCEHYRRRCQIRAPCCNEVFACRHCHNESTSTLRNIYDRHDLVRQDVKQVICLV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ    +C NCGV  G+YFC IC+ YDD+T K Q+HC++CGICRIGGRENFFHC+KC
Sbjct  71    CDTEQPATQVCSNCGVNMGEYFCNICKFYDDNTEKQQFHCDDCGICRIGGRENFFHCKKC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCY++ LR NH CVENSM+ +CPICYE+LF+SLK T +MKCGHTMH +CY EM+ ++++
Sbjct  131   GSCYAITLRGNHQCVENSMRHHCPICYEYLFDSLKDTTVMKCGHTMHCECYHEMIKRDKF  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
              CPICS+SV++MS+TW+ ++EEI++T MP +Y
Sbjct  191   CCPICSRSVIDMSKTWQRMDEEIESTAMPSDY  222



>gb|KDO75136.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=221

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 178/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAV  954
             FGKM +GC+HYRRRC+IRAPCCNEIF CRHCHNEA S L +P +RHELVR+DVKQVIC+V
Sbjct  11    FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVICSV  70

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+HC++CGICRIGGREN+FHC++C
Sbjct  71    CDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRC  130

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             GSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T +MKCGHTMH +CY EM+ +++Y
Sbjct  131   GSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKY  190

Query  593   RCPICSKSVLNMSRTWEILEEEIQ  522
              CPICSKSV++MSRTW+ ++EE+ 
Sbjct  191   CCPICSKSVIDMSRTWKRIDEEVS  214



>ref|XP_010048087.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Eucalyptus grandis]
 gb|KCW80215.1| hypothetical protein EUGRSUZ_C01569 [Eucalyptus grandis]
 gb|KCW80216.1| hypothetical protein EUGRSUZ_C01569 [Eucalyptus grandis]
 gb|KCW80217.1| hypothetical protein EUGRSUZ_C01569 [Eucalyptus grandis]
Length=313

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 194/274 (71%), Gaps = 9/274 (3%)
 Frame = -2

Query  1175  TGVQLDDQTVSGE-------DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL  1017
              G Q+  +T  G+       + G M +GC HYRRRC+IRAPCCNEIF CRHCHN+AK+ +
Sbjct  40    NGEQMPIETSKGDASATKLLESGHMQYGCPHYRRRCRIRAPCCNEIFDCRHCHNDAKNNI  99

Query  1016  S-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             + + K+RHEL R  V+QV+C++C TEQ+V  +C+NCGV  G YFC  C+L+DDDT+K QY
Sbjct  100   NVNQKQRHELPRHQVQQVVCSLCGTEQEVRQVCINCGVCMGKYFCGTCKLFDDDTSKKQY  159

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HCN CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CP+C+EFLF+S     
Sbjct  160   HCNGCGICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPVCFEFLFDSRNDVT  219

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VP  483
             ++ CGHT+H  C +EM   +QY CPICSKSV +MS+ WE  + EI  T MPE Y  + V 
Sbjct  220   VLPCGHTIHKTCLKEMREHHQYACPICSKSVCDMSKVWEKFDTEIAATPMPEPYQNKMVW  279

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDC  TS   FH++  KC HC SYNTR  + 
Sbjct  280   ILCNDCGKTSEVQFHVVAQKCAHCKSYNTRQTRG  313



>ref|XP_010241800.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
 ref|XP_010241802.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
 ref|XP_010241803.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
Length=290

 Score =   317 bits (812),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 193/261 (74%), Gaps = 4/261 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRR  981
             D+++    FG   FGC HYRRRCKIRAPCCNEIF CRHCHNEAK+ +  DP +RHE+ R 
Sbjct  18    DESLMELGFGD--FGCTHYRRRCKIRAPCCNEIFDCRHCHNEAKNSIDVDPLDRHEIPRH  75

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             +VK+VIC++C TEQ V   C+NCGV  G YFCE C+ +DDD +K QYHC ECGICR GG+
Sbjct  76    EVKKVICSLCGTEQDVQQKCINCGVCMGKYFCEKCKFFDDDVSKHQYHCEECGICRTGGQ  135

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             ENFFHC KCG CYS+ L+D+H CVE +M   CPIC+E++F+S K   ++ CGHT+H+DC 
Sbjct  136   ENFFHCSKCGCCYSILLKDSHRCVERAMHHNCPICFEYIFDSTKDITVLPCGHTIHLDCL  195

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAI  444
              +M    Q+ CP+CS+S+ NMS+ WE+L++EI +T MPE Y  + V ILCNDC ++S   
Sbjct  196   NQMKQHLQFSCPVCSRSICNMSKVWEMLDQEIASTPMPEIYQNKMVWILCNDCGSSSNVN  255

Query  443   FHILGHKCKHCSSYNTRMVKA  381
             FHI+ HKC  C SYNT+ ++ 
Sbjct  256   FHIVAHKCLSCKSYNTKQIRG  276



>gb|KDP34238.1| hypothetical protein JCGZ_07809 [Jatropha curcas]
Length=369

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/269 (58%), Positives = 193/269 (72%), Gaps = 2/269 (1%)
 Frame = -2

Query  1181  TPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPK  1005
             T T    D +T+   D G M +GC+HYRRRC+IRAPCCNEIF CRHCHNEAK+ ++ D K
Sbjct  101   TATKESSDMKTLEILDKGCMKYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAKNNINVDQK  160

Query  1004  ERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNEC  825
              RH+L RR+V+QVIC++C TEQQV   C+NCGV  G YFCE C+L DDDT+K QYHC+ C
Sbjct  161   LRHDLPRREVRQVICSLCGTEQQVQQFCVNCGVCMGRYFCETCKLLDDDTSKKQYHCDGC  220

Query  824   GICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCG  645
             GICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CP+C+EFLFES     ++ CG
Sbjct  221   GICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPVCFEFLFESRYDVTVLPCG  280

Query  644   HTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCND  468
             HT+H  C +EM    QY CP+CSKSV +MS+ WE  + EI  T MPE +  + V ILCND
Sbjct  281   HTIHQKCLKEMREHYQYACPLCSKSVCDMSKVWEKFDIEIAATPMPEPFQNKMVWILCND  340

Query  467   CNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             C  TS   +HI+  KC +C SYNTR  K 
Sbjct  341   CGKTSQVQYHIVAQKCLNCKSYNTRQTKG  369



>ref|XP_002520677.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF41639.1| zinc finger protein, putative [Ricinus communis]
Length=298

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQV  966
             S +D G+  +GC+HYRRRCKIRAPCC +IF+CRHCHNEA + +S PK+RHE+VR D++QV
Sbjct  16    SIQDTGRPEYGCDHYRRRCKIRAPCCQQIFSCRHCHNEATNAMSKPKDRHEIVRHDIQQV  75

Query  965   ICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFH  786
             IC++CN EQQVA +C NCGVK G+YFC IC+ YDDDTTK Q+HC  CGICR+GG++ FFH
Sbjct  76    ICSLCNFEQQVAQVCTNCGVKMGEYFCNICKFYDDDTTKGQFHCEGCGICRVGGQDKFFH  135

Query  785   CQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVH  606
             C+KCGSCY V LR+NH CVENSMK+ CP+CYE+LF+S+K   +M+CGHTMH DC++EM  
Sbjct  136   CEKCGSCYQVELRNNHSCVENSMKNCCPVCYEYLFDSVKGATVMRCGHTMHADCFQEMAK  195

Query  605   QNQYRCPICSKSVLNMSRTWEILEEE  528
             QNQYRCPICSK+VL M R W +L++E
Sbjct  196   QNQYRCPICSKTVLEMGRYWRMLDQE  221



>gb|KHG16470.1| Rchy1 [Gossypium arboreum]
Length=315

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 192/272 (71%), Gaps = 8/272 (3%)
 Frame = -2

Query  1172  GVQLDDQTVSGE------DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-  1014
             G+ +D Q  +G       D G M +GC HYRRRC+IRAPCC EIF CRHCHNEAK+ ++ 
Sbjct  44    GICVDKQESNGAEATELLDKGFMEYGCPHYRRRCRIRAPCCGEIFDCRHCHNEAKNNINV  103

Query  1013  DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHC  834
             D K RH+L RR + +VIC++C TEQ+   +C+NCGV  G YFC  C+L+DDDT+K QYHC
Sbjct  104   DQKLRHDLPRRQISKVICSLCGTEQEAQQVCINCGVCMGKYFCNTCKLFDDDTSKRQYHC  163

Query  833   NECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIM  654
             + CGICRIGG+ENFFHC KCG CYS+ L+++H CVE +M   CPIC+EFLFES +   I+
Sbjct  164   DGCGICRIGGQENFFHCHKCGCCYSILLKNSHPCVEGAMHHDCPICFEFLFESRQDVTIL  223

Query  653   KCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPIL  477
              CGHT+H +C +EM    QY CP+CSKSV +MS+ WE  +EEI    MPEEY  + V IL
Sbjct  224   PCGHTIHTNCLKEMRDHFQYACPLCSKSVCDMSKVWEKFDEEIAAAPMPEEYHNKIVSIL  283

Query  476   CNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             CNDC   S   FH+L  KC +C SYNTR  + 
Sbjct  284   CNDCGTKSLVRFHVLAQKCPNCKSYNTRQTRG  315



>ref|XP_007223304.1| hypothetical protein PRUPE_ppa009486mg [Prunus persica]
 gb|EMJ24503.1| hypothetical protein PRUPE_ppa009486mg [Prunus persica]
Length=290

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/279 (55%), Positives = 195/279 (70%), Gaps = 4/279 (1%)
 Frame = -2

Query  1205  MNMEVGDVTPTGVQLDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNE  1032
             +N+       + V+  D   + E  + G M +GC HYRRRC+IRAPCCNEIF CRHCHNE
Sbjct  12    LNLSCMLTVESKVESRDTGKATELLERGHMEYGCSHYRRRCRIRAPCCNEIFDCRHCHNE  71

Query  1031  AKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDT  855
             AK+ ++ D K RH++ R  VKQVIC++C TEQ+V  +C+NCGV  G YFC  C+L+DDDT
Sbjct  72    AKNNINVDQKHRHDIPRHQVKQVICSLCGTEQEVGQVCVNCGVCMGKYFCGTCKLFDDDT  131

Query  854   TKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFES  675
             +K QYHCN CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CP+C+EFLFES
Sbjct  132   SKRQYHCNGCGICRIGGRENFFHCYKCGCCYSIMLKNSHPCVEGAMHHDCPVCFEFLFES  191

Query  674   LKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF  495
                  +M CGHT+H DC +EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y 
Sbjct  192   TNDVTVMLCGHTIHKDCLKEMREHYQYACPLCSKSVCDMSKVWEKYDMEIAATPMPEPYK  251

Query  494   YE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              + V ILCNDC  +S   +H++  KC +C SYNTR  + 
Sbjct  252   NKLVWILCNDCGKSSQVQYHVVAQKCLNCKSYNTRQTRG  290



>ref|XP_008393999.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
 ref|XP_008394000.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
 ref|XP_008394001.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
 ref|XP_008394002.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Malus domestica]
Length=293

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/252 (59%), Positives = 184/252 (73%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNEAK+ +S D K RH++ R  VKQVIC++
Sbjct  42    GYMQYGCSHYRRRCRIRAPCCNEIFDCRHCHNEAKNDISIDQKXRHDIPRHQVKQVICSL  101

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ+V  +C+NCGV  G YFCE C+L+DDD +K QYHCN CGICRIGGRENFFHC KC
Sbjct  102   CNTEQEVQQVCINCGVCMGKYFCETCKLFDDDVSKKQYHCNGCGICRIGGRENFFHCDKC  161

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ ++++H CVE +M   CP+C+EFLFE+     +M CGHT+H +C  EM    QY
Sbjct  162   GCCYSMLMKNSHPCVEGAMHHDCPVCFEFLFETRDDVTVMPCGHTIHKNCLNEMRDHYQY  221

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILCNDC   S   +H++  KC 
Sbjct  222   ACPLCSKSVCDMSKVWEKYDMEIAATPMPEPYQNKLVSILCNDCGKXSQVQYHVMARKCP  281

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  282   NCKSYNTRQTRG  293



>emb|CBI20950.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 184/252 (73%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNEAK+ +  D  +RH++ R  V+QVIC++
Sbjct  43    GYMQYGCPHYRRRCRIRAPCCNEIFDCRHCHNEAKNSIKVDKAQRHDIPRHQVQQVICSL  102

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ+V  +C+NCGV  G YFCE C+L+DDDT+K QYHCN CGICRIGGRENFFHC KC
Sbjct  103   CNTEQEVRQVCINCGVCMGKYFCETCKLFDDDTSKKQYHCNGCGICRIGGRENFFHCYKC  162

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
               CYSV L+++H CVE +M   CP+C+E+LFES     +M CGHT+H +C +EM    QY
Sbjct  163   RCCYSVLLKNSHPCVEGAMHHDCPVCFEYLFESTDDVTVMPCGHTIHQNCLKEMREHLQY  222

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE  + EI    MPE Y  + V ILCNDC  TS   FH+L  KC 
Sbjct  223   ACPLCSKSVCDMSKVWEKFDMEIAAIPMPEPYQNKMVWILCNDCGKTSKVHFHVLAQKCL  282

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  283   NCKSYNTRQTRG  294



>ref|XP_002284652.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010648581.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010648582.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010648583.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 emb|CAN68688.1| hypothetical protein VITISV_029477 [Vitis vinifera]
Length=315

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 184/252 (73%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNEAK+ +  D  +RH++ R  V+QVIC++
Sbjct  64    GYMQYGCPHYRRRCRIRAPCCNEIFDCRHCHNEAKNSIKVDKAQRHDIPRHQVQQVICSL  123

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ+V  +C+NCGV  G YFCE C+L+DDDT+K QYHCN CGICRIGGRENFFHC KC
Sbjct  124   CNTEQEVRQVCINCGVCMGKYFCETCKLFDDDTSKKQYHCNGCGICRIGGRENFFHCYKC  183

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
               CYSV L+++H CVE +M   CP+C+E+LFES     +M CGHT+H +C +EM    QY
Sbjct  184   RCCYSVLLKNSHPCVEGAMHHDCPVCFEYLFESTDDVTVMPCGHTIHQNCLKEMREHLQY  243

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE  + EI    MPE Y  + V ILCNDC  TS   FH+L  KC 
Sbjct  244   ACPLCSKSVCDMSKVWEKFDMEIAAIPMPEPYQNKMVWILCNDCGKTSKVHFHVLAQKCL  303

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  304   NCKSYNTRQTRG  315



>ref|XP_010098324.1| RING finger and CHY zinc finger domain-containing protein 1 [Morus 
notabilis]
 gb|EXB74828.1| RING finger and CHY zinc finger domain-containing protein 1 [Morus 
notabilis]
Length=261

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L +P +RHELVR DVKQV+C+VC+TEQ VA +C NCGV  G+YFC+IC+ +DDD  K Q+
Sbjct  43    LRNPFDRHELVRYDVKQVVCSVCDTEQPVAKVCTNCGVNMGEYFCDICKFFDDDIEKGQF  102

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HC++CGICR+GGRENFFHCQKCGSCYS+ LRDNHLCVENSM+ +CPICYE+LF+SLK T 
Sbjct  103   HCDDCGICRVGGRENFFHCQKCGSCYSIVLRDNHLCVENSMRHHCPICYEYLFDSLKDTT  162

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVP  483
             +MKCGHTMH +CY EM+ +++Y CPICSKSV++MS+TW+ ++EEI+ TVMPE+Y   +V 
Sbjct  163   VMKCGHTMHCECYNEMIKRDKYCCPICSKSVIDMSKTWKRIDEEIEQTVMPEDYHSRKVW  222

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDCN+T+   FHI+G KC+HC SYNTR +  
Sbjct  223   ILCNDCNDTTEVYFHIIGQKCRHCKSYNTRTIAP  256



>ref|XP_009348444.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=293

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 184/252 (73%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCC EIF CRHCHNEAK+ +S D K RH++ R  VKQVIC++
Sbjct  42    GYMQYGCSHYRRRCRIRAPCCKEIFDCRHCHNEAKNDISVDQKHRHDVPRHQVKQVICSL  101

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ+V  +C+NCGV  G YFCE C+L+DDD +K QYHCN CGICRIGGRENFFHC KC
Sbjct  102   CNTEQEVQQVCINCGVCMGKYFCETCKLFDDDVSKKQYHCNGCGICRIGGRENFFHCDKC  161

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CP+C+EFLFE+     +M CGHT+H +C + M    QY
Sbjct  162   GCCYSMLLKNSHPCVEGAMHHDCPVCFEFLFETRDDVTVMPCGHTIHKNCLKGMRDHYQY  221

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILCNDC  +S   +H++  KC 
Sbjct  222   ACPLCSKSVCDMSKVWEKYDMEIAATPMPEPYQNKLVSILCNDCGKSSQVQYHVVARKCP  281

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  282   NCKSYNTRQTRG  293



>gb|ACN43326.1| zinc-finger transcription factor [Ananas comosus]
Length=305

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 197/283 (70%), Gaps = 3/283 (1%)
 Frame = -2

Query  1232  DNTTTPPLAMNMEVGDVTP-TGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIF  1056
             +N T  P ++  +  D T      L+       D G M +GC HYRRRC+IRAPCCNEIF
Sbjct  21    ENKTQAPCSILAKQNDTTAEVANGLNSFGRERLDEGLMQYGCSHYRRRCRIRAPCCNEIF  80

Query  1055  TCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEI  879
              CRHCHNEAK+ ++ D ++RH++ R+ ++QVIC++C TEQ+V  +C+NCGV  G YFC  
Sbjct  81    DCRHCHNEAKNSINVDRRKRHDMPRQQLQQVICSLCGTEQEVRQVCINCGVCMGKYFCAT  140

Query  878   CRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPI  699
             C+L+DDD +K QYHCN CGICRIGGRENFFHC +CG CYS  L+++H CVE +M   CP+
Sbjct  141   CKLFDDDVSKQQYHCNGCGICRIGGRENFFHCYRCGCCYSTILKNSHACVEGAMHHDCPV  200

Query  698   CYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQT  519
             C+E+LFES     ++ CGHT+H+ C +EM    QY CP+CSKSV +MS+ WE L+ EI  
Sbjct  201   CFEYLFESRYDVSVLPCGHTIHVHCLKEMREHLQYACPLCSKSVCDMSKVWEKLDMEIAA  260

Query  518   TVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTR  393
             T MPE +  + V ILCNDC  TS   FH++  KC+ C SYNTR
Sbjct  261   TPMPESFQNKMVRILCNDCGATSQVQFHVVAQKCQKCKSYNTR  303



>ref|XP_004291409.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Fragaria vesca subsp. vesca]
Length=288

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 183/254 (72%), Gaps = 2/254 (1%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVIC  960
             D G   FGC HYRRRC+IRAPCCNEI  CRHCHNEAK+ ++ DPK RH++ R  VK VIC
Sbjct  35    DRGLGDFGCSHYRRRCRIRAPCCNEIVDCRHCHNEAKNNINVDPKLRHDIPRHQVKHVIC  94

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++CNTEQ+V  +C+NCGV  G YFCE C+L+DDD +K QYHC+ CGICRIGG +NFFHC 
Sbjct  95    SLCNTEQEVQQVCVNCGVCMGKYFCETCKLFDDDISKRQYHCHGCGICRIGGADNFFHCN  154

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
             KCG CYS+ L+++H CVE +M   CP+C+EFLF+S     +M CGHT+H  C +EM    
Sbjct  155   KCGCCYSILLKNSHPCVEGAMHHDCPVCFEFLFDSRNDVTVMPCGHTIHKHCLKEMRDHM  214

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHK  423
             QY CP+CSKSV +MS+ WE  + EI  T MPE Y  + VPILCNDC  +S   FHI+  K
Sbjct  215   QYACPLCSKSVCDMSKVWEKYDMEIAATPMPEPYQNKLVPILCNDCGKSSEVQFHIVAQK  274

Query  422   CKHCSSYNTRMVKA  381
             C  C SYNTR  + 
Sbjct  275   CSSCKSYNTRQTRG  288



>ref|XP_008219836.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
 ref|XP_008219837.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
 ref|XP_008219838.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
Length=290

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/284 (54%), Positives = 193/284 (68%), Gaps = 11/284 (4%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGEDFGK---------MLFGCEHYRRRCKIRAPCCNEIFTCR  1047
             ME   +  + +   D  V   D GK         M +GC HYRRRC+IRAPCCNEIF CR
Sbjct  7     MEDAHLNLSCMLTVDSKVESRDTGKATELLERGHMEYGCPHYRRRCRIRAPCCNEIFDCR  66

Query  1046  HCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRL  870
             HCHNEAK+ ++ D K RH++ R  VK+VIC++C  EQ+V  +C+NCGV  G YFC  C+L
Sbjct  67    HCHNEAKNNINVDQKHRHDIPRHQVKEVICSLCGAEQEVGQVCVNCGVCMGKYFCGTCKL  126

Query  869   YDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYE  690
             +DDDT+K QYHCN CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CP+C+E
Sbjct  127   FDDDTSKRQYHCNGCGICRIGGRENFFHCYKCGCCYSIMLKNSHPCVEGAMHHDCPVCFE  186

Query  689   FLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVM  510
             FLFES     +M CGHT+H DC +EM    QY CP+CSKSV +MS+ WE  + EI  T M
Sbjct  187   FLFESTNDVTVMLCGHTIHKDCLKEMREHYQYACPLCSKSVCDMSKVWEKYDMEIAATPM  246

Query  509   PEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             PE Y  + V ILCNDC  +S   +H++  KC +C SYNTR  + 
Sbjct  247   PEPYKNKLVWILCNDCGKSSQVQYHVVAQKCLNCKSYNTRQTRG  290



>ref|XP_010541642.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Tarenaya hassleriana]
Length=287

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 185/262 (71%), Gaps = 2/262 (1%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVR  984
             D++     D G M  GC HYRRRC+IRAPCCNEIF C HCHNEAK+ ++ D K RH++ R
Sbjct  26    DNERNEALDRGLMEHGCPHYRRRCRIRAPCCNEIFGCHHCHNEAKNNMNVDQKLRHDIPR  85

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
               VKQVIC +C TEQ+V   C+NCGV  G YFCE+C+L+DDDT+K QYHCN CGICRIGG
Sbjct  86    HQVKQVICILCGTEQEVGQFCVNCGVCMGKYFCEVCKLFDDDTSKKQYHCNGCGICRIGG  145

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             RENFFHC KCG C+S+ L+++H CVE +M   CPIC+E+LFES K   ++ CGHT+H  C
Sbjct  146   RENFFHCYKCGCCFSILLKNSHPCVEGAMHHDCPICFEYLFESRKDVTVLPCGHTIHQKC  205

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTA  447
               EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILCNDC   S  
Sbjct  206   LEEMREHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYQNKMVRILCNDCGKKSQV  265

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              +H++  KC +C SYNTR  + 
Sbjct  266   QYHVVAQKCPNCKSYNTRQTRG  287



>ref|XP_010649779.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X3 [Vitis vinifera]
Length=220

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L +P +RHELVR DVKQVICAVC+TEQ VA +C NCGV  G+YFCE+C+ YDDDTTK Q+
Sbjct  2     LRNPFDRHELVRHDVKQVICAVCDTEQPVAQVCTNCGVNMGEYFCEVCKFYDDDTTKGQF  61

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HC++CGICR+GGR+ FFHC+KCG CYSVGLRDNH CVENSM+ +CPICYE+LF+SLK T 
Sbjct  62    HCDDCGICRVGGRDKFFHCKKCGCCYSVGLRDNHSCVENSMRHHCPICYEYLFDSLKDTT  121

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVP  483
             +M CGHTMH +CY EMV  ++Y CPICSKSV +M+RTW+ ++EEI+ T+MPE+Y + +V 
Sbjct  122   VMVCGHTMHCECYNEMVSHDKYCCPICSKSVRDMTRTWKRIDEEIEATIMPEDYQHKKVW  181

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDCN+T+   +HI+G KC HC SYNTR+V  
Sbjct  182   ILCNDCNDTTEVFYHIIGQKCSHCKSYNTRIVAP  215



>ref|XP_008808866.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
 ref|XP_008808875.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
 ref|XP_008808883.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
 ref|XP_008808892.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
Length=309

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 190/259 (73%), Gaps = 2/259 (1%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELV  987
             LD       + G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ ++ + K RH+L 
Sbjct  49    LDSAATERLEKGLMQYGCPHYRRRCRIRAPCCNEIFDCRHCHNETKNLINVEQKHRHDLP  108

Query  986   RRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIG  807
             R++V+QVIC++C+TEQQV  +C+NCGV  G YFCE C+ +DDDT+K+QYHC+ CGICRIG
Sbjct  109   RQEVQQVICSLCSTEQQVRQVCINCGVCMGKYFCETCKFFDDDTSKEQYHCSGCGICRIG  168

Query  806   GRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMD  627
             G+ENFFHC  CG CYS+ L+++H CVE +M   CP+C+E+LFES     ++ CGHT+H+ 
Sbjct  169   GQENFFHCYTCGCCYSIILKNSHPCVEGAMHHDCPVCFEYLFESTNDVSVLPCGHTIHVH  228

Query  626   CYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTST  450
             C +EM    QY CP+CSKSV +MS+ WE L+ EI  T MPE Y  + V ILCNDC  TS 
Sbjct  229   CLKEMQQHLQYACPLCSKSVCDMSKVWEKLDIEIAATPMPESYHNKMVRILCNDCGTTSL  288

Query  449   AIFHILGHKCKHCSSYNTR  393
               FH++  KC +C SYNTR
Sbjct  289   VQFHVVAQKCLNCKSYNTR  307



>ref|XP_003636900.1| RING finger and CHY zinc finger domain-containing protein [Medicago 
truncatula]
 gb|KEH41275.1| CHY and CTCHY and RING-type zinc finger protein [Medicago truncatula]
Length=301

 Score =   311 bits (798),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/305 (51%), Positives = 203/305 (67%), Gaps = 9/305 (3%)
 Frame = -2

Query  1283  AAIAALSYKI*SPPRPQDNTTTPPLAMNMEV--GDVTPTGVQLDDQTVSGEDFGKMLFGC  1110
               +AAL  +             PP + N+E   G+ +   +  +D     +D G M +GC
Sbjct  2     GEVAALHSESNDTKHTTKEDVNPPKS-NLESLPGEESSESINTNDL----QDKGYMEYGC  56

Query  1109  EHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQV  933
             +HYRRRC+IRAPCCNEIF CRHCHN+AK+G++ D K RHE+ R  VKQVIC++C TEQ+V
Sbjct  57    QHYRRRCRIRAPCCNEIFDCRHCHNDAKNGINVDYKHRHEMPRHQVKQVICSLCATEQEV  116

Query  932   AGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVG  753
                C+NCGV  G YFCE C+L+DDD +K QYHCN CGICR GG+E+FFHC KCG C S  
Sbjct  117   QPNCINCGVCMGKYFCETCKLFDDDISKQQYHCNGCGICRTGGQESFFHCNKCGCCLSTQ  176

Query  752   LRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSK  573
             + +NH CVE +M   CP+CYE++FES K  ++M CGHT+H  C  EM   ++Y CP+CSK
Sbjct  177   VENNHPCVEGAMHRDCPVCYEYIFESTKEIVVMPCGHTIHKSCIDEMREHHRYTCPLCSK  236

Query  572   SVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNT  396
             S  +MSR WE L+ EI  T MPE+Y  + V ILCNDC NT    FH +  KC +C+SYNT
Sbjct  237   SFCDMSRVWERLDIEIAATPMPEQYQNKMVWILCNDCGNTGNVRFHFVALKCLNCNSYNT  296

Query  395   RMVKA  381
             R  + 
Sbjct  297   RQTRG  301



>ref|XP_004136332.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 ref|XP_004162482.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 gb|KGN60137.1| hypothetical protein Csa_3G880030 [Cucumis sativus]
Length=307

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 189/262 (72%), Gaps = 4/262 (2%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVR  984
             D Q V   ++  M  GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D KERHE+ R
Sbjct  48    DPQKVLEREY--MQHGCAHYRRRCRIRAPCCNEIFDCRHCHNEIKNSICVDQKERHEIPR  105

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              +V QVIC++C TEQ+V   C+NCGV FG YFCE C+L+DDDT+K QYHCN CGICRIGG
Sbjct  106   HEVNQVICSLCGTEQEVRQDCINCGVCFGKYFCESCKLFDDDTSKKQYHCNGCGICRIGG  165

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             RENFFHC KCG CYS+ L+++H CVE +M   CP+C+E+LF+S     +M CGHT+H +C
Sbjct  166   RENFFHCHKCGCCYSILLKNSHPCVEGAMHHDCPVCFEYLFDSTNDVTVMPCGHTIHQNC  225

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTA  447
              +EM    QY CP+CSKSV +MS+ WE ++ EI  T +PE Y  + V ILCNDC  TS  
Sbjct  226   LKEMRDHFQYACPLCSKSVCDMSKVWEKIDMEIAATPIPEPYQNKMVWILCNDCGKTSKV  285

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              +H++  KC +C SYNTR  + 
Sbjct  286   QYHVVAQKCLNCKSYNTRQTRG  307



>gb|KDP43965.1| hypothetical protein JCGZ_05432 [Jatropha curcas]
Length=282

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 188/266 (71%), Gaps = 2/266 (1%)
 Frame = -2

Query  1172  GVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERH  996
             G +  D   S  + G   +GC HYRRRCKIRAPCCNEIF CRHCHNEAK+ L ++P +RH
Sbjct  2     GTEFVDNNESLIEIGSRNYGCSHYRRRCKIRAPCCNEIFDCRHCHNEAKNALETNPLDRH  61

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             ++ R +V +VIC++C TEQ V   C+NCGV  G YFC  C+ +DDD  K+QYHC+ECGIC
Sbjct  62    DIPRHEVTKVICSLCGTEQDVQRNCVNCGVCMGKYFCAKCKFFDDDVAKNQYHCDECGIC  121

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R GG++NFFHC+KCG CYS  ++D H CVE +M   CP+C+EFLF+++K   ++ CGHT+
Sbjct  122   RTGGKDNFFHCEKCGCCYSKLMKDAHRCVERAMHHNCPVCFEFLFDTMKDITVLPCGHTI  181

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H++C REM    +Y CP+CSKS+ NMS+ W  L++EI  T MPE Y  + V ILCNDC  
Sbjct  182   HLECVREMEQHCRYSCPVCSKSICNMSKLWRKLDQEIAATPMPEIYRNKMVWILCNDCGT  241

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKA  381
              S   FH++ HKC  C SYNTR  + 
Sbjct  242   NSQVQFHVVAHKCLSCKSYNTRQTRG  267



>ref|XP_002309580.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94674.1| unknown [Populus trichocarpa]
 gb|EEE93103.1| zinc finger family protein [Populus trichocarpa]
Length=300

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 190/263 (72%), Gaps = 2/263 (1%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELV  987
             ++ +T    D G M +GC HYRRRC+IRAPCCNE+F CRHCHNEAK+ ++ D K RH++ 
Sbjct  38    MNVETPQILDKGLMEYGCLHYRRRCRIRAPCCNEVFDCRHCHNEAKNNINVDQKHRHDMP  97

Query  986   RRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIG  807
             R +VKQVIC++C TEQ+V  +C+NCGV  G YFCE C+L+DDDT+K QYHC+ CGICRIG
Sbjct  98    RHEVKQVICSLCGTEQEVQQVCINCGVCMGKYFCETCKLFDDDTSKKQYHCDGCGICRIG  157

Query  806   GRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMD  627
             G ENFFHC KCG CYS  L+++H CVE +M   CP+C+EFLFES     ++ CGHT+H  
Sbjct  158   GPENFFHCYKCGCCYSNLLKNSHPCVEGAMHHDCPVCFEFLFESRYDVTVLPCGHTIHES  217

Query  626   CYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTST  450
             C +EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILCNDC  +S 
Sbjct  218   CLKEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYLNKMVWILCNDCGKSSE  277

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
               FH++  KC +C SYNTR  ++
Sbjct  278   VQFHVVAQKCMNCKSYNTRQTRS  300



>ref|XP_002314304.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88259.1| zinc finger family protein [Populus trichocarpa]
Length=291

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 193/265 (73%), Gaps = 2/265 (1%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHE  993
             ++  D   S  + G   +GC HYRRRCKIRAPCCNEIF CRHCHN+AK+GL ++P +RH+
Sbjct  12    LEFGDTEASLMEIGSGNYGCSHYRRRCKIRAPCCNEIFDCRHCHNDAKNGLETNPLDRHD  71

Query  992   LVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICR  813
             + R +V +VIC++C+TEQ V   C+NCGV  G Y+C  C+ +DDD +K+QYHC+ECGICR
Sbjct  72    IPRHEVTKVICSLCDTEQDVKQNCINCGVCMGKYYCSKCKFFDDDVSKNQYHCDECGICR  131

Query  812   IGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMH  633
              GG+ENFFHC KCG CYS+ ++D H CVE +M   CP+C+EFLF++++   ++ CGHT+H
Sbjct  132   TGGKENFFHCNKCGCCYSMLMKDAHRCVERAMHHNCPVCFEFLFDTMRDITVLPCGHTIH  191

Query  632   MDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNT  456
             ++C +EM    +Y CP+CSKS+ +M+R W+ L++EI  T MPE Y  + V ILCNDC   
Sbjct  192   LECLKEMEQHYRYSCPVCSKSICDMTRLWKKLDQEIAATPMPETYQNKMVWILCNDCGAN  251

Query  455   STAIFHILGHKCKHCSSYNTRMVKA  381
             S   FHI+ HKC  C+SYNTR  + 
Sbjct  252   SHVQFHIVAHKCLRCNSYNTRQTRG  276



>ref|XP_008466355.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Cucumis melo]
Length=307

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 189/262 (72%), Gaps = 4/262 (2%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVR  984
             D Q V   ++  M  GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D KERHE+ R
Sbjct  48    DPQEVLEREY--MQHGCAHYRRRCRIRAPCCNEIFDCRHCHNEIKNSICVDQKERHEIPR  105

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              +V QVIC++C TEQ+V   C+NCGV FG YFCE C+L+DDDT+K QYHCN CGICRIGG
Sbjct  106   HEVNQVICSLCGTEQEVRQDCINCGVCFGKYFCESCKLFDDDTSKKQYHCNGCGICRIGG  165

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             RENFFHC KCG CYS+ L+++H CVE +M   CP+C+E+LF+S     +M CGHT+H +C
Sbjct  166   RENFFHCHKCGCCYSILLKNSHPCVEGAMHHDCPVCFEYLFDSTNDVTVMPCGHTIHQNC  225

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTA  447
              +EM    QY CP+CSKSV +MS+ WE ++ EI  T +PE Y  + V ILCNDC  TS  
Sbjct  226   LKEMRDHFQYACPLCSKSVCDMSKVWEKIDMEIAATPIPEPYQNKMVWILCNDCGTTSKV  285

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              +H++  KC +C SYNTR  + 
Sbjct  286   QYHVVAQKCLNCKSYNTRQTRG  307



>ref|XP_006450583.1| hypothetical protein CICLE_v10008946mg [Citrus clementina]
 ref|XP_006450584.1| hypothetical protein CICLE_v10008946mg [Citrus clementina]
 gb|ESR63823.1| hypothetical protein CICLE_v10008946mg [Citrus clementina]
 gb|ESR63824.1| hypothetical protein CICLE_v10008946mg [Citrus clementina]
Length=318

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 189/252 (75%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC+HYRRRC+IRAPCCNEIF CRHCHNEA + ++ D K RH++ R +V QVIC++
Sbjct  67    GFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSL  126

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C+NCGV  G+YFCE C+L+DDDT+K QYHC+ CGICRIGGR+NFFHC KC
Sbjct  127   CGTEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGRDNFFHCNKC  186

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
               CYS+ L+++H CVE +M   CP+C E+LFE+ +  +++ CGHT+H +C +EM   +QY
Sbjct  187   RCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQY  246

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV +MS+ WE  + EI  T MPE Y   +V ILCNDC  TS   FH+L  KC 
Sbjct  247   ACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCP  306

Query  416   HCSSYNTRMVKA  381
             +C SYNTR+ + 
Sbjct  307   NCKSYNTRLTRG  318



>ref|XP_011019697.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Populus euphratica]
Length=300

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 193/271 (71%), Gaps = 2/271 (1%)
 Frame = -2

Query  1187  DVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-D  1011
             D+  +   ++ +T    D G M +GC HYRRRC+IRAPCCNE+F CRHCHNEAK+ ++ D
Sbjct  30    DLIFSEESMNVETPQILDKGLMEYGCLHYRRRCRIRAPCCNEVFDCRHCHNEAKNNINVD  89

Query  1010  PKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCN  831
              K RH++ R ++KQVIC++C TEQ+V  +C+NCGV  G YFCE C+L+DDDT+K QYHC+
Sbjct  90    QKRRHDMPRHEIKQVICSLCGTEQEVQQVCINCGVCMGKYFCESCKLFDDDTSKKQYHCD  149

Query  830   ECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMK  651
              CGICRIGG ENFFHC KCG CYS  L+++H CVE +M   CP+C+EFLFES     ++ 
Sbjct  150   GCGICRIGGPENFFHCYKCGCCYSNLLKNSHPCVEGAMHHDCPVCFEFLFESRYDVTVLP  209

Query  650   CGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILC  474
             CGHT+H  C +EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILC
Sbjct  210   CGHTIHESCLKEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYLNKMVWILC  269

Query  473   NDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             NDC  +S   FH++  KC +C SYNTR  ++
Sbjct  270   NDCGKSSEVQFHVVAQKCLNCKSYNTRQTRS  300



>ref|XP_009349743.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=292

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 183/248 (74%), Gaps = 2/248 (1%)
 Frame = -2

Query  1118  FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTE  942
             FGC HYRRRCKIRAPCC++IF CRHCHNEAK+ L  +P +RH++ R DVK++IC++CN E
Sbjct  31    FGCAHYRRRCKIRAPCCDQIFDCRHCHNEAKNSLEVNPLDRHDVPRHDVKRIICSLCNKE  90

Query  941   QQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCY  762
             Q V  +C+ CGV  G+YFC  C+ +DDD +K QYHC+ECGICR GG ENFFHC KCG CY
Sbjct  91    QDVQQLCIQCGVCMGNYFCSKCKFFDDDVSKKQYHCDECGICRTGGGENFFHCNKCGCCY  150

Query  761   SVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPI  582
             S  L+D+H CVE +M   CP+C+EFLF++ +   +++CGHT+H++C +EM    QY CP+
Sbjct  151   SNALKDSHNCVEKAMHHNCPVCFEFLFDTREDIAVLRCGHTIHLECVKEMQRHFQYSCPV  210

Query  581   CSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSS  405
             CSKS  +MSR WE L+EE+  T MP +Y  + V ILCNDC   S   FHILGHKC  C S
Sbjct  211   CSKSFRDMSRVWEKLDEEVAGTPMPLKYLNKMVWILCNDCGEMSEVNFHILGHKCPKCKS  270

Query  404   YNTRMVKA  381
             +NTR  + 
Sbjct  271   FNTRKTRG  278



>ref|XP_006419634.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
 gb|ESR32874.1| hypothetical protein CICLE_v10005640mg [Citrus clementina]
 gb|KDO75137.1| hypothetical protein CISIN_1g024406mg [Citrus sinensis]
Length=220

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L +P +RHELVR+DVKQVIC+VC+TEQ VA +C NCGV  G+YFC+IC+ YDDD  K Q+
Sbjct  2     LRNPYDRHELVRQDVKQVICSVCDTEQPVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQF  61

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HC++CGICRIGGREN+FHC++CGSCYS  LR+NHLC+ENSM  +CPICYE+LF+SL++T 
Sbjct  62    HCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTT  121

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVP  483
             +MKCGHTMH +CY EM+ +++Y CPICSKSV++MSRTW+ ++EEI+ TVMPE+Y + +V 
Sbjct  122   VMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVW  181

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDCN+T+   FHI+G KC HC SYNTR +  
Sbjct  182   ILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAP  215



>ref|XP_007035497.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 2 [Theobroma 
cacao]
 gb|EOY06423.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 2 [Theobroma 
cacao]
Length=221

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 180/215 (84%), Gaps = 2/215 (1%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L +P +RH+LVR+DVKQVIC+VC+TEQ VA +C NCGV  G+YFCEIC+ +DDDT K Q+
Sbjct  2     LRNPFDRHDLVRQDVKQVICSVCDTEQPVAKLCSNCGVNMGEYFCEICKFFDDDTEKGQF  61

Query  839   HCNECGIC-RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKST  663
             HC++CGIC R+GGRENFFHC+KCGSCYS+ LRDNH CVENSM+ +CPICYE+LF+SLK T
Sbjct  62    HCHDCGICSRVGGRENFFHCKKCGSCYSIALRDNHSCVENSMRHHCPICYEYLFDSLKDT  121

Query  662   MIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EV  486
              +MKCGHTMH +CY EM+ +++Y CPICSKSV++MSR W+ ++EEI+ TVMPE+Y Y +V
Sbjct  122   TVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRIWKRIDEEIEATVMPEDYRYKKV  181

Query  485   PILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              ILCNDCN+T+   FHI+G KC HC SYNTR +  
Sbjct  182   WILCNDCNDTTEVYFHIIGQKCSHCKSYNTRTIAP  216



>ref|XP_009377374.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=293

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 189/266 (71%), Gaps = 7/266 (3%)
 Frame = -2

Query  1157  DQTVSGE-----DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERH  996
             +  V+GE     + G M +GC HY+RRC IRAPCCNEIF CRHCHNEAK+ +S D K RH
Sbjct  28    ESKVTGEATELLEKGYMQYGCPHYQRRCSIRAPCCNEIFDCRHCHNEAKNDISVDQKHRH  87

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             ++ R  VKQVIC++C+TEQ+V  +C+NCGV  G YFCE C+L+DDD +K QYHCN CGIC
Sbjct  88    DMPRHQVKQVICSLCDTEQEVQQVCVNCGVCMGKYFCETCKLFDDDVSKKQYHCNGCGIC  147

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             RIGGRENFFHC KCG CYS  L+++H CVE +M   CP+C+EFLFE+     +M CGHT+
Sbjct  148   RIGGRENFFHCYKCGCCYSTLLKNSHPCVEGAMHHDCPVCFEFLFETRNDVTVMPCGHTI  207

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H +C +EM    QY CP+CSKSV +MS+ WE  + EI    MPE Y  + V ILCNDC  
Sbjct  208   HKNCLKEMRDHYQYACPLCSKSVCDMSKVWEKYDMEIAAQPMPEPYQNKLVSILCNDCGK  267

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKA  381
             +S   +H++  KC +C SYNTR  + 
Sbjct  268   SSQVQYHVVARKCLNCKSYNTRQTRG  293



>ref|XP_011018804.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Populus euphratica]
 ref|XP_011018805.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Populus euphratica]
Length=280

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 186/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQ  969
             S  D G   FGC HYRRRCKIRAPCCNEIF CRHCHNE+K  +  +P +RH++ R ++K+
Sbjct  10    SPVDLGYGNFGCTHYRRRCKIRAPCCNEIFDCRHCHNESKDSMEVNPIDRHDIPRHELKR  69

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             VIC++C+TEQ+V   C +CGV  G YFC  C+ +DDD +K QYHCNECGICR GG+ENFF
Sbjct  70    VICSLCDTEQEVQQQCFHCGVCMGKYFCSKCKFFDDDISKQQYHCNECGICRTGGKENFF  129

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC +CG CYS  L+D+H CVE +M   CP+C+EFLFE+ K   ++ CGHT+H++C +EM 
Sbjct  130   HCNRCGCCYSTSLKDSHNCVERAMHHNCPVCFEFLFETTKGITVLPCGHTIHLECVKEMQ  189

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHIL  432
                QY CP+CSKS  +MSR W+ L++++  T MP+ Y  + V ILCNDC  TS   FHI+
Sbjct  190   QHFQYACPVCSKSYCDMSRVWKKLDQQVALTPMPQMYLNKMVWILCNDCGETSKVNFHIV  249

Query  431   GHKCKHCSSYNTRMVKA  381
              HKC  C+SYNT+  + 
Sbjct  250   AHKCLKCNSYNTKQTRG  266



>ref|XP_010249808.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
 ref|XP_010249809.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
 ref|XP_010249810.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nelumbo nucifera]
Length=326

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 189/264 (72%), Gaps = 2/264 (1%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELV  987
             +D   +   D G M +GC HY RRC+IRA CCNEIF CRHCHNEAK+ +  + K RH+L 
Sbjct  54    VDTTAMERLDKGFMEYGCSHYWRRCRIRAQCCNEIFDCRHCHNEAKNNIDVERKLRHDLP  113

Query  986   RRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIG  807
             R +V+QVIC++C TEQ+V  +C+NCGV  G YFCE C+LYDDDT+K+QYHCN CGICRIG
Sbjct  114   RHEVQQVICSLCGTEQEVRQVCINCGVCMGKYFCETCKLYDDDTSKEQYHCNGCGICRIG  173

Query  806   GRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMD  627
             GRE FFHC  CG CYS+ L+++H CVE +M   CP+C+E+LFES     ++ CGHT+H +
Sbjct  174   GREKFFHCYTCGCCYSILLKNSHPCVEGAMHHDCPVCFEYLFESRNDVSVLPCGHTIHKN  233

Query  626   CYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEVPILCNDCNNTST  450
             C +EM    QY CP+CSKSV +MS+ WE+L+ EI    MPE Y   +V ILCNDC  TS 
Sbjct  234   CLKEMQEHLQYACPLCSKSVCDMSKVWEMLDVEIAAIPMPESYNNKKVWILCNDCGVTSQ  293

Query  449   AIFHILGHKCKHCSSYNTRMVKAD  378
               FH++  KC +C SYNTR  + +
Sbjct  294   VQFHVVAQKCLNCKSYNTRQTRGE  317



>ref|XP_006844347.1| hypothetical protein AMTR_s00142p00031670 [Amborella trichopoda]
 gb|ERN06022.1| hypothetical protein AMTR_s00142p00031670 [Amborella trichopoda]
Length=342

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 185/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPK-ERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCN+IF CRHCHNEA + +   K +RH+L R  V++VIC++
Sbjct  80    GFMQYGCSHYRRRCRIRAPCCNKIFDCRHCHNEAMNSIDVEKMQRHDLPRHQVRKVICSL  139

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             CNTEQ V  +C+NCGV  G YFCE C+L+DDD +K+QYHCN CGICR GGR+NFFHC KC
Sbjct  140   CNTEQDVRQVCINCGVCMGKYFCETCKLFDDDLSKNQYHCNGCGICRTGGRDNFFHCYKC  199

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYSV L+  H CVE +M   CP+C+E+LFES     ++ CGHT+H+DC +EM    Q+
Sbjct  200   GCCYSVMLKTYHPCVERAMHHDCPVCFEYLFESTNDITVLPCGHTIHVDCLKEMRDHLQF  259

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE L+ EI  T MPE Y  + V ILCNDC  TS   FHI+  KC 
Sbjct  260   FCPLCSKSVCDMSKVWEKLDMEIAATPMPESYQNKMVWILCNDCGETSQVQFHIVAQKCL  319

Query  416   HCSSYNTRMVKADRQ*P  366
              C SYNTR+ + D   P
Sbjct  320   SCKSYNTRVTRGDHTTP  336



>ref|XP_010421413.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Camelina sativa]
 ref|XP_010421414.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Camelina sativa]
 ref|XP_010421415.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Camelina sativa]
Length=307

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 188/280 (67%), Gaps = 2/280 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N E    T   V  +         G M  GC HYRRRC IRAPCCNEIF C HCHN
Sbjct  28    PHSINEESESSTLERVAAESLINEVLGRGLMEHGCPHYRRRCCIRAPCCNEIFGCHHCHN  87

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ ++ D K+RH++ R  V+QVIC +C TEQ+V  +C++CGV  G YFCE+C+LYDDD
Sbjct  88    EAKNSINVDQKQRHDIPRHQVRQVICLLCGTEQEVGQVCMHCGVCMGKYFCEVCKLYDDD  147

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T+K QYHC+ CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+EFLFE
Sbjct  148   TSKQQYHCDGCGICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPICFEFLFE  207

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S     ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y
Sbjct  208   SRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY  267

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                 V ILCNDC   S  ++H++  KC  C SYNTR  + 
Sbjct  268   QNRMVQILCNDCGKKSEVLYHVVAQKCPDCKSYNTRQTRG  307



>ref|XP_002274709.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010651767.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 emb|CBI17135.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 193/272 (71%), Gaps = 2/272 (1%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-S  1014
             G V    +++  + VS  + G   +GC HYRRRCKIRAPCC+EIF CRHCHNEAK+ L +
Sbjct  3     GGVDSKLLEICGREVSLTELGSGKYGCTHYRRRCKIRAPCCDEIFDCRHCHNEAKNLLET  62

Query  1013  DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHC  834
             DP +RH++ R +VK+VIC++C+TEQ V   C+ CGV  G+YFCE C+ +DDD +K+QYHC
Sbjct  63    DPHDRHDIPRHEVKKVICSLCDTEQDVQQNCIACGVCMGEYFCEKCKFFDDDVSKNQYHC  122

Query  833   NECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIM  654
              ECGICR GG+ENFFHC KCG CYS  ++D H CVE +M   CP+C+EFLF++ K   ++
Sbjct  123   EECGICRTGGKENFFHCNKCGCCYSNMMKDTHRCVERAMHHNCPVCFEFLFDTTKDITVL  182

Query  653   KCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPIL  477
             +CGHT+H +C +EM     Y CP+CSKS+ +MS  WE ++ E+ +T MPE Y  + V IL
Sbjct  183   QCGHTIHWECVKEMQQHFCYSCPVCSKSICDMSSLWEKIDREVASTPMPEMYRKKMVWIL  242

Query  476   CNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             CNDC   S   FHI+ HKC  C SYNTR ++ 
Sbjct  243   CNDCGAQSEVQFHIVAHKCLSCKSYNTRQIQG  274



>ref|XP_011032318.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Populus euphratica]
Length=299

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 191/265 (72%), Gaps = 2/265 (1%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHE  993
             ++  D   S  + G   +GC HYRRRCKIRAPCCNEIF CRHCHN+AK+GL ++P +RH+
Sbjct  12    LEFGDTEASLMEIGSGNYGCSHYRRRCKIRAPCCNEIFDCRHCHNDAKNGLETNPLDRHD  71

Query  992   LVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICR  813
             + R +V +VIC++C+TEQ V   C+NCGV  G Y+C  C+ +DDD  K+QYHC+ECGICR
Sbjct  72    IPRHEVTKVICSLCDTEQDVKQNCINCGVCLGKYYCSKCKFFDDDVLKNQYHCDECGICR  131

Query  812   IGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMH  633
              GG+ENFFHC KCG CYS+ ++D H CVE +M   CP+C+EFLF++++   ++ CGHT+H
Sbjct  132   TGGKENFFHCNKCGCCYSMLMKDAHRCVERAMHHNCPVCFEFLFDTMRDITVLPCGHTIH  191

Query  632   MDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNT  456
             ++C +EM    +Y CP+CSKS+ +M+  W+ L++EI  T MPE Y  + V ILCNDC   
Sbjct  192   LECLKEMEQHYRYSCPVCSKSICDMTTLWKKLDQEIAATPMPETYQNKMVWILCNDCGAN  251

Query  455   STAIFHILGHKCKHCSSYNTRMVKA  381
             S   FH++ HKC  C+SYNTR  + 
Sbjct  252   SHVQFHVVAHKCSRCNSYNTRQTRG  276



>ref|XP_011032319.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Populus euphratica]
Length=291

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 191/265 (72%), Gaps = 2/265 (1%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHE  993
             ++  D   S  + G   +GC HYRRRCKIRAPCCNEIF CRHCHN+AK+GL ++P +RH+
Sbjct  12    LEFGDTEASLMEIGSGNYGCSHYRRRCKIRAPCCNEIFDCRHCHNDAKNGLETNPLDRHD  71

Query  992   LVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICR  813
             + R +V +VIC++C+TEQ V   C+NCGV  G Y+C  C+ +DDD  K+QYHC+ECGICR
Sbjct  72    IPRHEVTKVICSLCDTEQDVKQNCINCGVCLGKYYCSKCKFFDDDVLKNQYHCDECGICR  131

Query  812   IGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMH  633
              GG+ENFFHC KCG CYS+ ++D H CVE +M   CP+C+EFLF++++   ++ CGHT+H
Sbjct  132   TGGKENFFHCNKCGCCYSMLMKDAHRCVERAMHHNCPVCFEFLFDTMRDITVLPCGHTIH  191

Query  632   MDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNT  456
             ++C +EM    +Y CP+CSKS+ +M+  W+ L++EI  T MPE Y  + V ILCNDC   
Sbjct  192   LECLKEMEQHYRYSCPVCSKSICDMTTLWKKLDQEIAATPMPETYQNKMVWILCNDCGAN  251

Query  455   STAIFHILGHKCKHCSSYNTRMVKA  381
             S   FH++ HKC  C+SYNTR  + 
Sbjct  252   SHVQFHVVAHKCSRCNSYNTRQTRG  276



>gb|EEE55306.1| hypothetical protein OsJ_03270 [Oryza sativa Japonica Group]
Length=299

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D  +RHEL R +V+QVIC++
Sbjct  52    GIMQYGCAHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDAVKRHELPRHEVQQVICSL  111

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C++CGV  G YFCE+C+L+DDD +K QYHCN CGICRIGG+ENFFHC KC
Sbjct  112   CGTEQEVRQVCISCGVCMGKYFCEVCKLFDDDVSKQQYHCNGCGICRIGGKENFFHCSKC  171

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H+ C REM    Q+
Sbjct  172   GCCYSIVLKNSHACVEGAMHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQF  231

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+EE+  T+        V ILCNDC  TS   FH++ HKC+ 
Sbjct  232   ACPLCSKSVCDMSKAWERLDEEL-ATISDTCDNKMVRILCNDCGATSEVQFHLIAHKCQK  290

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  291   CKSYNTRQI  299



>gb|AAS87371.1| zinc finger protein [Oryza sativa Japonica Group]
Length=302

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D  +RHEL R +V+QVIC++
Sbjct  55    GIMQYGCAHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDAVKRHELPRHEVQQVICSL  114

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C++CGV  G YFCE+C+L+DDD +K QYHCN CGICRIGG+ENFFHC KC
Sbjct  115   CGTEQEVRQVCISCGVCMGKYFCEVCKLFDDDVSKQQYHCNGCGICRIGGKENFFHCSKC  174

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H+ C REM    Q+
Sbjct  175   GCCYSIVLKNSHACVEGAMHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQF  234

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+EE+  T+        V ILCNDC  TS   FH++ HKC+ 
Sbjct  235   ACPLCSKSVCDMSKAWERLDEEL-ATISDTCGNKMVRILCNDCGATSEVQFHLIAHKCQK  293

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  294   CKSYNTRQI  302



>ref|NP_197938.2| CHY and CTCHY and RING-type zinc finger protein [Arabidopsis 
thaliana]
 gb|AED93462.1| CHY and CTCHY and RING-type zinc finger protein [Arabidopsis 
thaliana]
Length=308

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 189/280 (68%), Gaps = 2/280 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N E    T   V  +  T    D G M +GC HYRRRC IRAPCCNEIF C HCH 
Sbjct  29    PHSINEESESSTLERVAAESLTNKVLDRGLMEYGCPHYRRRCCIRAPCCNEIFGCHHCHY  88

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ ++ D K+RH++ R  V+QVIC +C TEQ+V  IC++CGV  G YFC++C+LYDDD
Sbjct  89    EAKNNINVDQKQRHDIPRHQVEQVICLLCGTEQEVGQICIHCGVCMGKYFCKVCKLYDDD  148

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T+K QYHC+ CGICRIGGRENFFHC KCG CYS+ L++ H CVE +M   CPIC+EFLFE
Sbjct  149   TSKKQYHCDGCGICRIGGRENFFHCYKCGCCYSILLKNGHPCVEGAMHHDCPICFEFLFE  208

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S     ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y
Sbjct  209   SRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY  268

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                 V ILCNDC   +   +H++  KC +C SYNTR  + 
Sbjct  269   QNRMVQILCNDCGKKAEVQYHVVAQKCPNCKSYNTRQTRG  308



>ref|NP_001044081.1| Os01g0719100 [Oryza sativa Japonica Group]
 dbj|BAD87761.1| zinc finger protein ZFP-like [Oryza sativa Japonica Group]
 dbj|BAF05995.1| Os01g0719100 [Oryza sativa Japonica Group]
 gb|AEP20520.1| zinc finger protein [Oryza sativa Japonica Group]
Length=302

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D  +RHEL R +V+QVIC++
Sbjct  55    GIMQYGCAHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDAVKRHELPRHEVQQVICSL  114

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C++CGV  G YFCE+C+L+DDD +K QYHCN CGICRIGG+ENFFHC KC
Sbjct  115   CGTEQEVRQVCISCGVCMGKYFCEVCKLFDDDVSKQQYHCNGCGICRIGGKENFFHCSKC  174

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H+ C REM    Q+
Sbjct  175   GCCYSIVLKNSHACVEGAMHHDCPICFEYLFESTNDVSVLPCGHTIHVKCLREMEEHCQF  234

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+EE+  T+        V ILCNDC  TS   FH++ HKC+ 
Sbjct  235   ACPLCSKSVCDMSKAWERLDEEL-ATISDTCDNKMVRILCNDCGATSEVQFHLIAHKCQK  293

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  294   CKSYNTRQI  302



>ref|XP_010049052.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Eucalyptus grandis]
 ref|XP_010049053.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Eucalyptus grandis]
 ref|XP_010049054.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Eucalyptus grandis]
Length=316

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 191/276 (69%), Gaps = 14/276 (5%)
 Frame = -2

Query  1166  QLDDQ---TVSGEDFGKM---------LFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKS  1023
             QLD +   +V  ED GK+         LFGC HYRRRC+IRAPCCNEI+ CRHCHNEAK 
Sbjct  41    QLDSKCMPSVFPEDVGKVNDLLEKGCSLFGCSHYRRRCRIRAPCCNEIYDCRHCHNEAKD  100

Query  1022  GLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKD  846
              +  D K+RH++ R +V QVIC++C TEQQV   C+NCGV  G YFC  C+L+DDDT+K 
Sbjct  101   SIDVDQKDRHDMPRHEVSQVICSLCGTEQQVQQFCINCGVCMGKYFCATCKLFDDDTSKK  160

Query  845   QYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKS  666
             QYHC+ CGICR GG ENFFHC KCG CYS+ L+++H C+E +M   CP+C+E+LF+S   
Sbjct  161   QYHCSGCGICRTGGSENFFHCYKCGCCYSILLKNSHPCIEGAMHHDCPVCFEYLFDSRND  220

Query  665   TMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-  489
               +M CGHT+H +C +EM    QY CP+CSKS  +MS+ WE  + EI  T MPE Y  + 
Sbjct  221   VTVMPCGHTIHQNCLKEMRDHFQYACPLCSKSAYDMSKLWEKYDLEIAGTPMPEAYQNKM  280

Query  488   VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             V ILCNDC  T+   FH++G KC +C SYNTR  + 
Sbjct  281   VWILCNDCGKTAQVQFHVVGQKCLNCKSYNTRQTRG  316



>ref|XP_007016889.1| PGPD14 isoform 1 [Theobroma cacao]
 ref|XP_007016890.1| PGPD14 isoform 1 [Theobroma cacao]
 ref|XP_007016891.1| PGPD14 isoform 1 [Theobroma cacao]
 gb|EOY34508.1| PGPD14 isoform 1 [Theobroma cacao]
 gb|EOY34509.1| PGPD14 isoform 1 [Theobroma cacao]
 gb|EOY34510.1| PGPD14 isoform 1 [Theobroma cacao]
Length=296

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 187/266 (70%), Gaps = 2/266 (1%)
 Frame = -2

Query  1172  GVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERH  996
              V+  +Q  +  + G    GC HYRRRCKIRAPCCNEIF CRHCHNEAK+ L  +P E+H
Sbjct  16    SVEFGNQNAALMEIGLGNHGCLHYRRRCKIRAPCCNEIFDCRHCHNEAKNSLECNPLEQH  75

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             E+ R +V++VIC++C+TEQ V   C+NCGV  G YFC  C+ +DD+ +K+QYHCNECGIC
Sbjct  76    EIPRHEVEKVICSLCDTEQDVQQYCINCGVCMGKYFCAKCKFFDDNVSKNQYHCNECGIC  135

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R GG ENFFHC KCG CYS  + D H CVE +M   CP+C+EFLF++++   ++ CGHTM
Sbjct  136   RTGGEENFFHCNKCGCCYSKSMSDAHRCVERAMHHNCPVCFEFLFDTMEDITVLPCGHTM  195

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H++C REM     Y CP+CSKS+ +MS  W  L++EI +T MP  Y  + V ILCNDC  
Sbjct  196   HLECLREMEQHYLYSCPVCSKSICDMSELWRKLDQEIASTRMPAVYQNKMVWILCNDCGA  255

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKA  381
             TS   FHI+ HKC +C SYNTR  + 
Sbjct  256   TSRVQFHIVAHKCLNCESYNTRQTRG  281



>ref|XP_007013714.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
 ref|XP_007013715.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
 gb|EOY31333.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
 gb|EOY31334.1| CHY-type/CTCHY-type/RING-type Zinc finger protein isoform 1 [Theobroma 
cacao]
Length=310

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 183/252 (73%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCC EIF CRHCHNEAK+ ++ D K RH++ R  + QVIC++
Sbjct  59    GFMEYGCLHYRRRCRIRAPCCGEIFDCRHCHNEAKNNINVDQKLRHDIPRHQISQVICSL  118

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C+NCGV  G YFCE C+ +D+DT+K QYHC+ CGICRIGGRENFFHC KC
Sbjct  119   CGTEQEVQQVCINCGVCMGKYFCETCKFFDNDTSKRQYHCDGCGICRIGGRENFFHCYKC  178

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CP+C+EFLFES     ++ CGHT+H DC++EM    QY
Sbjct  179   GCCYSILLKNSHPCVEGAMHHDCPVCFEFLFESRYDVTVLPCGHTIHTDCFKEMRDHFQY  238

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+C KSV +MS+ WE  +EEI  T MPE Y  + V ILCNDC   S   FH+L  KC 
Sbjct  239   ACPLCFKSVCDMSKVWERFDEEIAATPMPEPYQNKMVSILCNDCGTKSEVQFHVLARKCL  298

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  299   NCKSYNTRQTRG  310



>ref|XP_009803954.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Nicotiana sylvestris]
Length=220

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 176/209 (84%), Gaps = 1/209 (0%)
 Frame = -2

Query  1004  ERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNEC  825
             +RHELVR+DV QVIC+VC+TEQ VA +C NCGV  G+YFCE+C+ YDDD  K Q+HC++C
Sbjct  7     DRHELVRQDVTQVICSVCDTEQPVARVCTNCGVNMGEYFCEVCKFYDDDIDKGQFHCDDC  66

Query  824   GICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCG  645
             GICR+GGRENFFHC+KCGSCYSV LR+NH CVENSM+ +CPICYEFLF+SLK T +MKCG
Sbjct  67    GICRVGGRENFFHCKKCGSCYSVSLRNNHSCVENSMRHHCPICYEFLFDSLKDTSVMKCG  126

Query  644   HTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFY-EVPILCND  468
             HTMH +CY EM+ +++Y CPICS+S+++MS+ W+ ++EEI+ T+MPE+  Y +V ILCND
Sbjct  127   HTMHAECYHEMIKRDKYCCPICSRSIIDMSKAWKRMDEEIEETIMPEDLRYKKVWILCND  186

Query  467   CNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             CN+T+   FHI+G KC+HC SYNTRM+  
Sbjct  187   CNDTTEVFFHIIGQKCRHCQSYNTRMISP  215



>ref|XP_006394808.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
 ref|XP_006394809.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
 ref|XP_006394810.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
 gb|ESQ32094.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
 gb|ESQ32095.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
 gb|ESQ32096.1| hypothetical protein EUTSA_v10004654mg [Eutrema salsugineum]
Length=308

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 181/252 (72%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M FGC HYRRRC IRAPCCNEIF C HCHNEAK+ ++ D K+RH++ R+ V+ VIC +
Sbjct  57    GLMEFGCPHYRRRCCIRAPCCNEIFGCHHCHNEAKNSINVDQKQRHDIPRQKVELVICLL  116

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V   C+NCGV  G YFCE+C+LYDDDT+K QYHC+ CGICRIGGRENFFHC KC
Sbjct  117   CGTEQEVRQTCINCGVCMGKYFCEVCKLYDDDTSKKQYHCDGCGICRIGGRENFFHCYKC  176

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+EFLFES     ++ CGHT+H  C  EM    QY
Sbjct  177   GCCYSILLKNSHPCVEGAMHHDCPICFEFLFESRNDVTVLPCGHTIHQKCLEEMREHYQY  236

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE  + EI  T MPE Y    V ILCNDC   S   +H++  KC 
Sbjct  237   ACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYQNRMVRILCNDCGKKSEVQYHVVAQKCP  296

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  ++
Sbjct  297   NCKSYNTRQTRS  308



>ref|XP_006476171.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Citrus sinensis]
 ref|XP_006476172.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Citrus sinensis]
 ref|XP_006476173.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X3 [Citrus sinensis]
 ref|XP_006476174.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X4 [Citrus sinensis]
 ref|XP_006476175.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X5 [Citrus sinensis]
 gb|KDO79657.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79658.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79659.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79660.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79661.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79662.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79663.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79664.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79665.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79666.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
 gb|KDO79667.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
Length=318

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 188/252 (75%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC+HYRRRC+IRAPCCNEIF CRHCHNEA + ++ D K RH++ R +V QVIC++
Sbjct  67    GFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSL  126

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C+NCGV  G+YFCE C+L+DDDT+K QYHC+ CGICRIGG +NFFHC KC
Sbjct  127   CGTEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKC  186

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
               CYS+ L+++H CVE +M   CP+C E+LFE+ +  +++ CGHT+H +C +EM   +QY
Sbjct  187   RCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQY  246

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV +MS+ WE  + EI  T MPE Y   +V ILCNDC  TS   FH+L  KC 
Sbjct  247   ACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCP  306

Query  416   HCSSYNTRMVKA  381
             +C SYNTR+ + 
Sbjct  307   NCKSYNTRLTRG  318



>ref|XP_009377050.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Pyrus x bretschneideri]
Length=292

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 181/248 (73%), Gaps = 2/248 (1%)
 Frame = -2

Query  1118  FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTE  942
             FGC HYRRRCKIRAPCC++IF CRHCHNEAK+ L   P +RH++ R DVK++IC++CN E
Sbjct  31    FGCAHYRRRCKIRAPCCDQIFDCRHCHNEAKNSLEVAPLDRHDVPRHDVKRIICSLCNKE  90

Query  941   QQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCY  762
             Q V  +C+ CGV  G+YFC  C+ +DDD +K QYHC+ECGICR GG ENFFHC KCG CY
Sbjct  91    QDVQQLCIQCGVCMGNYFCSKCKFFDDDVSKKQYHCDECGICRTGGGENFFHCNKCGCCY  150

Query  761   SVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPI  582
             S  L+D+H CVE +M   CP+C+EFLF++ +   +++CGHT+H++C +EM    QY CP+
Sbjct  151   SNALKDSHNCVEKAMHHNCPVCFEFLFDTREDIAVLRCGHTIHLECVKEMQRHFQYSCPV  210

Query  581   CSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSS  405
             CSKS  +MS  WE L+EE+  T MP +Y  + V ILCNDC   S   FHILGHKC  C S
Sbjct  211   CSKSFRDMSHVWEKLDEEVAGTPMPLKYLNKMVWILCNDCGEMSEVNFHILGHKCPMCKS  270

Query  404   YNTRMVKA  381
             +NTR  + 
Sbjct  271   FNTRKTRG  278



>ref|XP_006381379.1| hypothetical protein POPTR_0006s12360g [Populus trichocarpa]
 gb|ERP59176.1| hypothetical protein POPTR_0006s12360g [Populus trichocarpa]
Length=279

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 186/256 (73%), Gaps = 1/256 (0%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQ  969
             S  D G   FGC HYRRRCKIRAPCC+EIF CRHCHNE+K+ +  +P +RH++ R ++K+
Sbjct  10    SPVDLGYGNFGCTHYRRRCKIRAPCCDEIFDCRHCHNESKNSMEVNPIDRHDIPRHELKR  69

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             VIC++C+TEQ+V   C +CGV  G YFC  C+ +DDD +K QYHCNECGICR GG+ENFF
Sbjct  70    VICSLCDTEQEVQQQCFHCGVCMGKYFCSKCKFFDDDISKQQYHCNECGICRTGGKENFF  129

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC +CG CYS  L+D+H CVE +M   CP+C+EFLFE+ K  +++ CGHT+H++C +EM 
Sbjct  130   HCNRCGCCYSTLLKDSHNCVERAMHHNCPVCFEFLFETTKDIIVLPCGHTIHLECVKEMQ  189

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILG  429
                QY CP+CSKS  +MSR W+ L++++  T MP+     V ILCNDC  TS   FHI+ 
Sbjct  190   QHFQYACPLCSKSYCDMSRVWKKLDQQVALTPMPQMLNKMVWILCNDCGETSEVNFHIVA  249

Query  428   HKCKHCSSYNTRMVKA  381
             HKC  C+SYNT+  + 
Sbjct  250   HKCLKCNSYNTKQTRV  265



>gb|KCW84420.1| hypothetical protein EUGRSUZ_B01270 [Eucalyptus grandis]
Length=220

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = -2

Query  1019  LSDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             L +P +RHEL+R+DVKQV+C+VC+TEQ V  +C NCGV+ G+YFC+IC+ YDDDT K Q+
Sbjct  2     LRNPFDRHELIRQDVKQVVCSVCDTEQPVDQVCTNCGVRMGEYFCKICKFYDDDTEKGQF  61

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HC++CGICR+GGR+NFFHC+KCGSCYS+GL+DNH CVE+SM+ +CPICYE+LF+SLK T 
Sbjct  62    HCDDCGICRVGGRKNFFHCKKCGSCYSIGLKDNHSCVEDSMRHHCPICYEYLFDSLKDTT  121

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVP  483
             +MKCGHTMH +CY EM+ +++Y CPICS+SV++MSRTW+ ++EEI+ T MPE+Y   +V 
Sbjct  122   VMKCGHTMHCECYGEMLKRDKYCCPICSRSVIDMSRTWKRMDEEIEATQMPEDYRNKKVW  181

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             ILCNDCN+T+   FHI+G KC HC SYNTR +
Sbjct  182   ILCNDCNDTTEVYFHIIGQKCSHCESYNTRAI  213



>ref|XP_004143281.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 ref|XP_004156269.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis sativus]
 gb|KGN48202.1| hypothetical protein Csa_6G448100 [Cucumis sativus]
Length=288

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 191/270 (71%), Gaps = 8/270 (3%)
 Frame = -2

Query  1184  VTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DP  1008
             ++P G       +S  D G   FGC HYRRRCKIRAPCCNEIF CRHCHNEAK+ L  DP
Sbjct  11    ISPNG------DMSSIDLGYGSFGCSHYRRRCKIRAPCCNEIFDCRHCHNEAKNSLDVDP  64

Query  1007  KERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNE  828
               RH++ R+D+++VIC++C TEQ V   C+ CGV  G YFC  C+ +DDD +K QYHCNE
Sbjct  65    LLRHDIPRQDMEKVICSLCGTEQDVRQYCIQCGVCMGKYFCAKCKFFDDDVSKKQYHCNE  124

Query  827   CGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKC  648
             CGICR+GG +NFFHC+KCG CYS  + ++H CVE +M   CP+C+EFLF+++    ++ C
Sbjct  125   CGICRVGGEDNFFHCKKCGCCYSKLMENSHNCVEKAMHHNCPVCFEFLFDTMSDISVLPC  184

Query  647   GHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCN  471
             GHT+H++C +EM  + QY CP+CSKS  +MS  WE L+ E+ +T MP+ Y ++ V ILCN
Sbjct  185   GHTIHLECVKEMEQRLQYTCPVCSKSYCDMSSVWEKLDHEVASTPMPQMYQHKMVWILCN  244

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             DC+  S   +HI+ HKC  C SYNTR+ + 
Sbjct  245   DCSEISEVNYHIVAHKCLKCKSYNTRLTQG  274



>gb|KEH24054.1| CHY and CTCHY and RING-type zinc finger protein [Medicago truncatula]
Length=298

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 187/263 (71%), Gaps = 4/263 (2%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELV  987
             +DD  VS  + G   FGC HY+RRCKI +PCCNEIF CRHCHNE+K+ +  DP+ RH++ 
Sbjct  9     VDD--VSPSEIGYGHFGCSHYKRRCKIISPCCNEIFDCRHCHNESKNSIQVDPQHRHDIP  66

Query  986   RRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIG  807
             R  VK+VIC++C+TEQ V  +C+ CGV  G YFC  C+ +DDD +K+QYHC+ECGICR G
Sbjct  67    RHHVKRVICSLCSTEQDVQQVCIQCGVCMGRYFCSKCKFFDDDVSKNQYHCDECGICRTG  126

Query  806   GRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMD  627
             G ENFFHC KC  CYS  ++D+H C+E +M   CP+C+EFLF++ K   ++ CGHT+H+ 
Sbjct  127   GEENFFHCNKCECCYSTLMKDSHHCIEKAMHQNCPVCFEFLFDTTKDITVLPCGHTIHLG  186

Query  626   CYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTST  450
             C REM    QY CP+CSKS  +MSR WE ++EE+ +  MPE Y  + V ILCNDC  TS 
Sbjct  187   CVREMQQHLQYSCPVCSKSFCDMSRVWEKMDEEVASMPMPEMYQNKMVWILCNDCGETSE  246

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
               FHI+ HKC  C SYNTR  +A
Sbjct  247   VRFHIVAHKCLSCKSYNTRKTQA  269



>ref|XP_008241382.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
 ref|XP_008241383.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Prunus mume]
Length=292

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/280 (54%), Positives = 193/280 (69%), Gaps = 9/280 (3%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGED-----FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             ME G  + T + L++ T    D      G   FGC HYRRRCKIRAPCC+EIF CRHCHN
Sbjct  1     MESG--SETQMDLNNNTSHQNDHSIMEMGSGNFGCAHYRRRCKIRAPCCDEIFDCRHCHN  58

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             E+K+ L  DP +RH++ R DVK+VIC++CNTEQ V   C+ CGV  G+YFC  C+ +DDD
Sbjct  59    ESKNTLEVDPLDRHDVPRHDVKRVICSLCNTEQDVQQHCIQCGVCMGNYFCPKCKFFDDD  118

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
              +K QYHC+ECGICR GG +NFFHC KC  CYS  L+D+H CVE +M   CP+C+EFLF+
Sbjct  119   VSKKQYHCDECGICRTGGEQNFFHCNKCECCYSKVLKDSHNCVEKAMHHNCPVCFEFLFD  178

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             +     ++ CGHT+H++C +EM    QY CP+CSKS  +MSR WE L++EI  T MP+ Y
Sbjct  179   TRADITVLLCGHTIHLECVKEMERHCQYSCPVCSKSYRDMSRVWEKLDQEIAATPMPQMY  238

Query  497   FYEVP-ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
               +V  ILCNDC  TS   FHI+ HKC  C+SYNTR  + 
Sbjct  239   QNKVVWILCNDCGQTSEVNFHIVAHKCLKCNSYNTRQTQG  278



>ref|XP_004498614.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Cicer arietinum]
 ref|XP_004498615.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Cicer arietinum]
 ref|XP_004498616.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X3 [Cicer arietinum]
 ref|XP_004498617.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X4 [Cicer arietinum]
Length=306

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -2

Query  1139  EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVI  963
             +D G M +GC+HYRRRC+IRAPCCNEIF CRHCHNE+K+ ++ D K RH++ R  VKQVI
Sbjct  52    QDKGYMEYGCQHYRRRCQIRAPCCNEIFDCRHCHNESKNDINIDYKHRHDMPRHQVKQVI  111

Query  962   CAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHC  783
             C++C TEQ+V   C+NCGV  G YFCE C+L+DDD +K QYHCN CGICR GG ENFFHC
Sbjct  112   CSLCGTEQEVQQNCINCGVCMGKYFCETCKLFDDDISKQQYHCNGCGICRTGGHENFFHC  171

Query  782   QKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQ  603
              KCG CYS  L+++H CVE +M   CP+C+E+LFES    ++M CGHT+H  C  EM   
Sbjct  172   YKCGCCYSTLLKNSHPCVEGAMHHDCPVCFEYLFESRNDVIVMPCGHTIHKSCLNEMREH  231

Query  602   NQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGH  426
              QY CP+CSKSV +MS+ WE L+ EI  T MP+ Y  + V ILCNDC  TS   FH +  
Sbjct  232   YQYACPLCSKSVCDMSKVWEKLDLEIAATPMPDPYQNKMVWILCNDCGKTSNVRFHFVAQ  291

Query  425   KCKHCSSYNTRMVKA  381
             KC +C SYNTR  + 
Sbjct  292   KCLNCKSYNTRQTRG  306



>ref|XP_010098810.1| RING finger and CHY zinc finger domain-containing protein 1 [Morus 
notabilis]
 gb|EXB75898.1| RING finger and CHY zinc finger domain-containing protein 1 [Morus 
notabilis]
Length=309

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 196/289 (68%), Gaps = 24/289 (8%)
 Frame = -2

Query  1175  TGVQLDDQTVSGEDFGKML---FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DP  1008
             T + ++D  +  + F ++    FGC HYRRRCKIRAPCCNEIF CRHCHNE+K+ L  DP
Sbjct  7     TQMPIEDSRMKDQSFVELESGNFGCSHYRRRCKIRAPCCNEIFDCRHCHNESKNSLDVDP  66

Query  1007  KERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNE  828
              +RH++ R D+K+VIC++C+TEQ V   C+ CGV  G+YFC  C+ +DDD +K+QYHCNE
Sbjct  67    LDRHDIPRHDLKRVICSLCDTEQDVQQHCIQCGVCMGNYFCSECKFFDDDVSKNQYHCNE  126

Query  827   CGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKC  648
             CGICRIGG+ENFFHC KCG CYS  L+D+H+CVE +M   CP+C+EFLF++ +   ++ C
Sbjct  127   CGICRIGGKENFFHCNKCGCCYSTLLKDSHICVEKAMHHSCPVCFEFLFDTTRDITVLPC  186

Query  647   GHTMHMDCYREMVHQNQ-------------------YRCPICSKSVLNMSRTWEILEEEI  525
             GHT+H++C +EM    Q                   Y CP+CSKS  +MSR WE L++E+
Sbjct  187   GHTIHLECVKEMERHFQNATRILYFLQTVLKPLLWRYSCPVCSKSYCDMSRVWEKLDQEV  246

Query  524   QTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              +T MPE Y  + V ILCNDC   S   FHI+ HKC  C SYNTR  + 
Sbjct  247   ASTPMPEMYQNKMVWILCNDCGENSEVNFHIVAHKCLKCKSYNTRQTQG  295



>ref|XP_009616325.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana tomentosiformis]
 ref|XP_009616326.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana tomentosiformis]
 ref|XP_009616327.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana tomentosiformis]
 ref|XP_009616328.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana tomentosiformis]
Length=310

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 193/281 (69%), Gaps = 5/281 (2%)
 Frame = -2

Query  1211  LAMNMEVGDVTPTGVQLDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCH  1038
             +  N   G +   G + D+++ S E  D G + +GC HYRRRC+IRAPCCNEIF CRHCH
Sbjct  30    VVQNFHEGYLPEDGTR-DEKSSSTEALDIGYLEYGCSHYRRRCRIRAPCCNEIFDCRHCH  88

Query  1037  NEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDD  861
             NEAK+ ++ D K RHE+ R  V++VIC++C+TEQ+V  +C+NC V  G YFCE C+L+DD
Sbjct  89    NEAKNNINIDQKLRHEIPRHKVERVICSLCDTEQEVRQVCINCSVCMGKYFCETCKLFDD  148

Query  860   DTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLF  681
             D  K QYHCN+CGICRIGG ENFFHC KC  CYSV L+++H CVE +M   CP+C+E+LF
Sbjct  149   DIYKRQYHCNDCGICRIGGMENFFHCSKCRCCYSVLLKNSHPCVEGAMHHDCPVCFEYLF  208

Query  680   ESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEE  501
             ES+    +M CGHT+H +C  EM    QY CP+CSKSV +MS+ WE  + EI    MPE 
Sbjct  209   ESVNDVTVMPCGHTIHKNCLNEMQKHYQYACPLCSKSVCDMSKVWEKFDMEIAAAPMPES  268

Query  500   YF-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             Y   +V ILCNDC  TS   FH +  KC  C SYNTR  + 
Sbjct  269   YQDKKVWILCNDCGITSEVQFHFVAQKCPCCKSYNTRQTRG  309



>ref|XP_010917209.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Elaeis guineensis]
 ref|XP_010917902.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Elaeis guineensis]
Length=308

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 197/291 (68%), Gaps = 11/291 (4%)
 Frame = -2

Query  1241  RPQDN------TTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIR  1080
             R QDN      T    L+ N  + +    G  LD   +   D G M +GC HYRRRC IR
Sbjct  19    RGQDNELQTATTCNETLSKNCTMSEEVTDG--LDSADIEKLDKGLMQYGCSHYRRRCHIR  76

Query  1079  APCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVK  903
             APCCNEIF CRHCHNEAK+ ++ + K RH+L R +V+QVIC++C TEQ+V  +C+NCGV 
Sbjct  77    APCCNEIFDCRHCHNEAKNSINVERKHRHDLPRHEVQQVICSLCFTEQEVRQVCINCGVC  136

Query  902   FGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVEN  723
              G YFCE C+ +DD T+K+QYHC+ CGICRIGGRENFFHC  CG CYS+ L+++H CVE 
Sbjct  137   MGKYFCENCKFFDD-TSKEQYHCSGCGICRIGGRENFFHCYTCGCCYSIILKNSHPCVER  195

Query  722   SMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWE  543
             +M   CP+C+E+LFES      + CGHT+H+DC +EM    QY CP+CSKSV +MS+ WE
Sbjct  196   AMHHDCPVCFEYLFESTNDVSALPCGHTIHVDCLKEMQQHLQYACPLCSKSVCDMSKVWE  255

Query  542   ILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTR  393
              L+ EI  T M E Y  + V ILCNDC   S   FH++  KC +C SYNTR
Sbjct  256   KLDIEIAATPMHESYHNKMVRILCNDCGANSLVQFHVVAQKCPNCKSYNTR  306



>ref|XP_002965961.1| hypothetical protein SELMODRAFT_230701 [Selaginella moellendorffii]
 gb|EFJ33381.1| hypothetical protein SELMODRAFT_230701 [Selaginella moellendorffii]
Length=279

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 179/249 (72%), Gaps = 2/249 (1%)
 Frame = -2

Query  1124  MLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEA-KSGLSDPKERHELVRRDVKQVICAVCN  948
             M +GC HYRRRC IRAPCCN IF CRHCHNEA  +  +DP +RH+L R  V++VIC++C 
Sbjct  1     MEYGCAHYRRRCLIRAPCCNGIFNCRHCHNEAMNANEADPSKRHDLPRHKVERVICSLCG  60

Query  947   TEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGS  768
              EQ V  +C  CGV  GDY+C ICR +DDD +K Q+HC+ CGICR+GG+E FFHC KCG 
Sbjct  61    LEQDVHQVCSGCGVSMGDYYCSICRFFDDDVSKGQFHCDSCGICRVGGQEKFFHCDKCGC  120

Query  767   CYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRC  588
             CY+V L+  H CVENSM   CP+C+++LF+S+    +++CGHT+H +C REM    Q+ C
Sbjct  121   CYAVALQKGHSCVENSMHHNCPVCFDYLFDSISDITVLRCGHTIHSECLREMTLHAQFSC  180

Query  587   PICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHC  411
             P+CSKSV +MS  WE L++EI  T MP+ Y  + V ILCNDC  +S   FHI+ HKC HC
Sbjct  181   PVCSKSVCDMSSAWERLDQEIAATPMPDAYRNKLVWILCNDCGGSSEVPFHIVAHKCLHC  240

Query  410   SSYNTRMVK  384
              SYNTR  +
Sbjct  241   YSYNTRQTR  249



>ref|NP_001050105.1| Os03g0348900 [Oryza sativa Japonica Group]
 gb|ABF95919.1| CHY zinc finger family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12019.1| Os03g0348900 [Oryza sativa Japonica Group]
 dbj|BAG87232.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75252.1| hypothetical protein OsI_11560 [Oryza sativa Indica Group]
 gb|EEE59054.1| hypothetical protein OsJ_10832 [Oryza sativa Japonica Group]
Length=260

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 191/263 (73%), Gaps = 8/263 (3%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++LDD +  G  FG+M FGC+HYRRRC+IRAPCCN++F CRHCHNE+       K+ HEL
Sbjct  1     MELDDASRHG--FGRMGFGCKHYRRRCRIRAPCCNDVFHCRHCHNEST------KDGHEL  52

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R  V+ VIC VC+TEQ VA +C NCGV  G+YFC  C+ +DDD  ++ +HC +CGICR+
Sbjct  53    DRHAVESVICLVCDTEQPVAQVCYNCGVCMGEYFCSACKFFDDDVDREHFHCQDCGICRV  112

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GG++NFFHC+KCGSCYSV LRD H C+ENSMK+ CPICYE+LF+SL+ T +++CGHTMH+
Sbjct  113   GGKDNFFHCEKCGSCYSVSLRDKHCCIENSMKNNCPICYEYLFDSLRETSVLRCGHTMHL  172

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTST  450
              C+ EM+  +++ CPICS  + +M +    L+ EI+  ++  +Y  +  I+CNDC +T+ 
Sbjct  173   QCFHEMLKHDKFSCPICSMPIFDMDKFLRALDAEIEANMLHIDYMGKGWIVCNDCRDTTQ  232

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
                 + GHKC HC S+NT  V A
Sbjct  233   VYARVAGHKCCHCQSHNTCRVAA  255



>ref|XP_011088795.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Sesamum indicum]
Length=295

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 193/280 (69%), Gaps = 5/280 (2%)
 Frame = -2

Query  1205  MNMEVGDVTPTGVQLDDQTVSGE---DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             M M   D     + L D +   +   +     +GC+HYRRRCKIRAPCC+E+F CRHCHN
Sbjct  1     MMMSESDQQKPPIVLSDDSSKQQLQMEPAPANYGCKHYRRRCKIRAPCCDEVFDCRHCHN  60

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ L  +P  RH++ R  VK+V+C++C TEQ V   C++CGV  G+YFCE C+ +DDD
Sbjct  61    EAKNALEINPLHRHDVPRHHVKRVMCSLCGTEQDVGQNCVSCGVCMGNYFCEKCKFFDDD  120

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
              +K QYHC+ECGICR GGRENFFHC  CG CYS  ++D H CVE +M   C +C+EFLF+
Sbjct  121   VSKKQYHCDECGICRTGGRENFFHCSNCGCCYSNLIKDAHRCVERAMHHNCAVCFEFLFD  180

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S ++  ++ CGHT+HM+C +EM    +Y CP+CSKS+ +MS  W  L+EEI +T MPE Y
Sbjct  181   STRNIAVLLCGHTIHMECVKEMERHRRYACPVCSKSICDMSNVWRKLDEEIASTPMPEMY  240

Query  497   F-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                +V ILCNDC  TS   FHI+G+KC  CSSYNTR ++ 
Sbjct  241   KNKKVWILCNDCEETSEVQFHIVGYKCLSCSSYNTRQIQG  280



>ref|XP_007202397.1| hypothetical protein PRUPE_ppa009440mg [Prunus persica]
 gb|EMJ03596.1| hypothetical protein PRUPE_ppa009440mg [Prunus persica]
Length=292

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 193/280 (69%), Gaps = 9/280 (3%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGED-----FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             ME G  + T + L++ T    D      G   FGC HYRRRCKIRAPCC+EIF CRHCHN
Sbjct  1     MESG--SETQMDLNNNTSHQNDHSIMEMGSGNFGCAHYRRRCKIRAPCCDEIFDCRHCHN  58

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             E+K+ L  DP +RH++ R DVK+VIC++CNTEQ V   C+ CGV  G+YFC  C+ +DDD
Sbjct  59    ESKNTLEVDPLDRHDVPRHDVKRVICSLCNTEQDVQQHCIQCGVCMGNYFCSKCKFFDDD  118

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
              +K+QYHC+ECGICR GG +NFFHC KC  CYS  L+D+H CVE +M   CP+C+EFLF+
Sbjct  119   VSKNQYHCDECGICRTGGEQNFFHCNKCECCYSKVLKDSHNCVEKAMHHNCPVCFEFLFD  178

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             +     ++ CGHT+H++C +EM    QY CP+CSKS  +MSR WE L++EI  T MP+ Y
Sbjct  179   TRADITVLLCGHTIHLECVKEMERHCQYSCPVCSKSYRDMSRVWEKLDQEIAATPMPQMY  238

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
               + V ILCNDC  TS   FHI+  KC  C+SYNTR  + 
Sbjct  239   QNKMVWILCNDCGQTSEVNFHIVARKCLKCNSYNTRQTQG  278



>ref|XP_004246608.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Solanum lycopersicum]
 ref|XP_010325959.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Solanum lycopersicum]
 ref|XP_010325960.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Solanum lycopersicum]
 ref|XP_010325961.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Solanum lycopersicum]
Length=288

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 184/254 (72%), Gaps = 2/254 (1%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVIC  960
             + G   +GC HYRRRCKIRAPCC+EIF CRHCHN++K+ L  DP ERH++ R D+K+VIC
Sbjct  22    EMGSGDYGCSHYRRRCKIRAPCCDEIFDCRHCHNDSKNSLDVDPLERHDIPRHDIKRVIC  81

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++CNTEQ V   C+ CGV  G YFC  C  +DDD +K+QYHC++CGICR GG ENFFHC 
Sbjct  82    SLCNTEQDVQQKCIQCGVCMGKYFCSKCNFFDDDVSKNQYHCDKCGICRTGGEENFFHCD  141

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
              CG CY+  ++++H C+E +M   CP+C+E++F++ K+ +++ CGHTMH++C  +M    
Sbjct  142   TCGCCYTNSMKESHKCIERAMHHNCPVCFEYIFDTTKNIIVLPCGHTMHLECVMQMEQHF  201

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHK  423
             QY CP+CSKS  +MSR WE L++E+ +T MPE Y   +V ILCNDC  TS   FHI+ HK
Sbjct  202   QYSCPVCSKSYCDMSRVWEQLDQEVASTAMPEMYQDKKVWILCNDCAETSEVNFHIVAHK  261

Query  422   CKHCSSYNTRMVKA  381
             C  C SYNTR  + 
Sbjct  262   CPSCKSYNTRQTRG  275



>ref|XP_006424450.1| hypothetical protein CICLE_v10028942mg [Citrus clementina]
 gb|ESR37690.1| hypothetical protein CICLE_v10028942mg [Citrus clementina]
Length=297

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 191/267 (72%), Gaps = 2/267 (1%)
 Frame = -2

Query  1172  GVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERH  996
             G   +++ VS  + G   +GC HY+RRCKIRAPCC +IF CRHCHNEAK+ L ++P +RH
Sbjct  17    GTYFEEKEVSLMEIGSGNYGCSHYKRRCKIRAPCCGDIFNCRHCHNEAKNSLETNPLDRH  76

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             ++ R ++++VIC++C TEQ     C+NCGV  G Y+C  C+ +DDD TK+QYHC+ECGIC
Sbjct  77    DIPRHEIEKVICSLCGTEQDAQQYCINCGVCMGKYYCAKCKFFDDDITKNQYHCDECGIC  136

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R GG++NFFHC+ CG CYS  ++D H CVE +M   CPIC+EF+F+++K   +++CGHT+
Sbjct  137   RTGGKDNFFHCKTCGCCYSKEMKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTI  196

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H++C +EM    +Y CP+CSKS+ +MS+ W  +++EI +T MP  Y  + V ILCNDC  
Sbjct  197   HLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGA  256

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKAD  378
              S   FH++ HKC  C SYNTR  + D
Sbjct  257   NSHVQFHVIAHKCLSCKSYNTRQTRGD  283



>ref|XP_008466354.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Cucumis melo]
Length=315

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 189/270 (70%), Gaps = 12/270 (4%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVR  984
             D Q V   ++  M  GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D KERHE+ R
Sbjct  48    DPQEVLEREY--MQHGCAHYRRRCRIRAPCCNEIFDCRHCHNEIKNSICVDQKERHEIPR  105

Query  983   RDVKQVICAVCNTEQ--------QVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNE  828
              +V QVIC++C TEQ        QV   C+NCGV FG YFCE C+L+DDDT+K QYHCN 
Sbjct  106   HEVNQVICSLCGTEQEFYWFLIWQVRQDCINCGVCFGKYFCESCKLFDDDTSKKQYHCNG  165

Query  827   CGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKC  648
             CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CP+C+E+LF+S     +M C
Sbjct  166   CGICRIGGRENFFHCHKCGCCYSILLKNSHPCVEGAMHHDCPVCFEYLFDSTNDVTVMPC  225

Query  647   GHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCN  471
             GHT+H +C +EM    QY CP+CSKSV +MS+ WE ++ EI  T +PE Y  + V ILCN
Sbjct  226   GHTIHQNCLKEMRDHFQYACPLCSKSVCDMSKVWEKIDMEIAATPIPEPYQNKMVWILCN  285

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             DC  TS   +H++  KC +C SYNTR  + 
Sbjct  286   DCGTTSKVQYHVVAQKCLNCKSYNTRQTRG  315



>ref|XP_010454896.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Camelina sativa]
 ref|XP_010454897.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Camelina sativa]
Length=307

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 186/280 (66%), Gaps = 2/280 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N E    T   V  +         G M  GC HYRRRC IRAPCCNEIF C HCHN
Sbjct  28    PHSINEESESSTLERVAAESLINEVLGRGLMEHGCPHYRRRCCIRAPCCNEIFGCHHCHN  87

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ ++ D K+RH++ R  V+QVIC +C TEQ+V  IC++CGV  G YFC +C+LYDDD
Sbjct  88    EAKNSINVDHKQRHDIPRHQVRQVICLLCGTEQEVGQICIHCGVCMGKYFCNVCKLYDDD  147

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T+K QYHC+ CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+EFLFE
Sbjct  148   TSKQQYHCDGCGICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPICFEFLFE  207

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S     ++ C HT+H  C  EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y
Sbjct  208   SRNDVTVLPCRHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY  267

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                 V ILCNDC   S  ++H++  KC  C SYNTR  + 
Sbjct  268   QNRMVQILCNDCGKKSEVLYHVVAQKCPDCKSYNTRQTRG  307



>ref|XP_006356627.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356628.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Solanum tuberosum]
Length=311

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 191/274 (70%), Gaps = 4/274 (1%)
 Frame = -2

Query  1190  GDVTPTGVQLDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL  1017
             GD  P  +  ++++   E  D G + +GC HYRRRC+I APCCNE+F CRHCHNE K+ +
Sbjct  37    GDYLPEDITHEEKSTCTEALDRGYLEYGCPHYRRRCRIIAPCCNEMFDCRHCHNEYKNNI  96

Query  1016  S-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQY  840
             + D K RHE+ R  V++VIC++C+ EQ+V  +C+NCGV  G YFCE C+L+DDDT+K QY
Sbjct  97    NVDQKLRHEIPRHKVERVICSLCDKEQEVRQVCINCGVCMGRYFCETCKLFDDDTSKRQY  156

Query  839   HCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTM  660
             HCN CGICRIGG ENFFHC KC  CYSV LR++H CVE +M   CP+C+E+LFES+    
Sbjct  157   HCNGCGICRIGGMENFFHCPKCRCCYSVLLRNSHPCVEGAMHHDCPVCFEYLFESINDVT  216

Query  659   IMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVP  483
             +M CGHT+H +C +EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y   +V 
Sbjct  217   VMPCGHTIHKNCLKEMQEHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYQDKKVW  276

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             ILCNDC  TS   FH +  KC  C SYNTR  + 
Sbjct  277   ILCNDCGITSEVQFHFVAQKCPCCKSYNTRQTRG  310



>ref|XP_009776916.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana sylvestris]
 ref|XP_009776917.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana sylvestris]
 ref|XP_009776918.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Nicotiana sylvestris]
Length=310

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 194/281 (69%), Gaps = 5/281 (2%)
 Frame = -2

Query  1211  LAMNMEVGDVTPTGVQLDDQTVSGE--DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCH  1038
             +  N   G +   G + ++++ S E  D G + +GC HYRRRC+IRAPCCNEIF CRHCH
Sbjct  30    VVQNFHEGYLPEDGTR-EEKSYSTEALDRGYLEYGCSHYRRRCRIRAPCCNEIFVCRHCH  88

Query  1037  NEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDD  861
             NEAK+ ++ D K RHE+ R  V++VIC++C+TEQ+V  +C++CGV  G YFCE C+L+DD
Sbjct  89    NEAKNNINIDQKLRHEIPRHKVERVICSLCDTEQEVRQVCISCGVCMGKYFCETCKLFDD  148

Query  860   DTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLF  681
             D +K QYHCN CGICRIGG ENFFHC KC  CYSV L+ +H CVE +M   CP+C+E+LF
Sbjct  149   DISKRQYHCNGCGICRIGGMENFFHCSKCRCCYSVLLKKSHPCVEGAMHHDCPVCFEYLF  208

Query  680   ESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEE  501
             ES+    +M CGHT+H +C +EM    QY CP+CSKSV +MS+ WE  + EI    MPE 
Sbjct  209   ESVNDVTVMPCGHTIHQNCLKEMQEHYQYACPLCSKSVCDMSKVWEKFDMEIAAAPMPES  268

Query  500   YF-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             Y   +V ILCNDC  TS   FH +  KC  C SYNTR  + 
Sbjct  269   YQDKKVWILCNDCGITSEVQFHFVAQKCPCCKSYNTRQTRG  309



>ref|XP_002962819.1| hypothetical protein SELMODRAFT_78412 [Selaginella moellendorffii]
 gb|EFJ36282.1| hypothetical protein SELMODRAFT_78412 [Selaginella moellendorffii]
Length=279

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 178/249 (71%), Gaps = 2/249 (1%)
 Frame = -2

Query  1124  MLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEA-KSGLSDPKERHELVRRDVKQVICAVCN  948
             M +GC HYRRRC IRAPCCN IF CRHCHNEA  +  +DP +RH+L R  V++VIC++C 
Sbjct  1     MEYGCAHYRRRCLIRAPCCNGIFNCRHCHNEAMNANEADPSKRHDLPRHKVERVICSLCG  60

Query  947   TEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGS  768
              EQ V  +C  CGV  GDY+C ICR +DDD +K Q+HC+ CGICR+GG+E FFHC KCG 
Sbjct  61    LEQDVHQVCSGCGVSMGDYYCSICRFFDDDVSKGQFHCDSCGICRVGGQEKFFHCDKCGC  120

Query  767   CYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRC  588
             CY+V L+  H CVENSM   CP+C+++LF+S     +++CGHT+H +C REM    Q+ C
Sbjct  121   CYAVALQKGHSCVENSMHHNCPVCFDYLFDSTSDITVLRCGHTIHSECLREMTLHAQFSC  180

Query  587   PICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHC  411
             P+CSKSV +MS  WE L++EI  T MP+ Y  + V ILCNDC  +S   FHI+ HKC HC
Sbjct  181   PVCSKSVCDMSSAWERLDQEIAATPMPDAYRNKLVWILCNDCGGSSEVPFHIVAHKCLHC  240

Query  410   SSYNTRMVK  384
              SYNTR  +
Sbjct  241   YSYNTRQTR  249



>ref|XP_010031414.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Eucalyptus grandis]
 ref|XP_010031415.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Eucalyptus grandis]
 gb|KCW50709.1| hypothetical protein EUGRSUZ_J00388 [Eucalyptus grandis]
 gb|KCW50710.1| hypothetical protein EUGRSUZ_J00388 [Eucalyptus grandis]
Length=276

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 184/254 (72%), Gaps = 2/254 (1%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVRRDVKQVIC  960
             D G  + GC HYRRRCKIRAPCC+E+F CRHCHNEAK+ L + P +RH++ R +VKQVIC
Sbjct  8     DLGSGVLGCAHYRRRCKIRAPCCDEVFDCRHCHNEAKNSLETAPLKRHDVPRHEVKQVIC  67

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             + C TEQ+V   C NCGV  G YFC  C+ +DDD +K+QYHC+ECGICR GG+EN+FHC+
Sbjct  68    SSCGTEQEVQQNCQNCGVCMGKYFCAKCKFFDDDVSKNQYHCDECGICRTGGKENYFHCK  127

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
             KCG CYS  +RD H CVE +M   CP+C+E+LF+++K   ++ CGHT+H++C +EM H  
Sbjct  128   KCGCCYSKLMRDAHRCVERAMHHNCPVCFEYLFDTMKDITVLPCGHTIHLECVKEMEHHC  187

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHK  423
             +Y CP+CSKS+ +MS  W  L++EI  T MPE Y  + V ILCNDC       FHI+ +K
Sbjct  188   RYSCPVCSKSICDMSNMWRRLDQEIAKTPMPEAYQNKMVWILCNDCGAQCEVQFHIVANK  247

Query  422   CKHCSSYNTRMVKA  381
             C  C SYNTR ++ 
Sbjct  248   CTSCESYNTRQMQG  261



>emb|CDY54900.1| BnaC02g48590D [Brassica napus]
Length=305

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 180/254 (71%), Gaps = 2/254 (1%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVIC  960
             D G M  GC HYRRRC IR+PCC+EIF C HCHNEAK+ +S DPK+ H++ R+ V+QVIC
Sbjct  52    DRGLMEHGCPHYRRRCCIRSPCCDEIFGCHHCHNEAKNNISVDPKQSHDIPRQKVEQVIC  111

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++C TEQ+V   C NCGV  G YFCE C+LYDDDT+K QYHC+ CGICRIGG ENFFHC 
Sbjct  112   SLCGTEQEVRQTCTNCGVCMGKYFCEACKLYDDDTSKKQYHCDGCGICRIGGHENFFHCY  171

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
             KCG CYS+ L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H  C  EM    
Sbjct  172   KCGCCYSILLKNSHPCVEGAMHHDCPICFEYLFESRNDVTVLPCGHTIHQKCLEEMREHY  231

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHK  423
             QY CP+CSKSV +MS+ WE  + EI  T MPE Y  + V ILCNDC   S   +H++  K
Sbjct  232   QYACPLCSKSVCDMSKVWEKFDVEIAATPMPEPYQNKMVQILCNDCGTKSEVQYHVVAQK  291

Query  422   CKHCSSYNTRMVKA  381
             C +C SYNTR  + 
Sbjct  292   CPNCKSYNTRQTRG  305



>ref|XP_001783611.1| predicted protein [Physcomitrella patens]
 gb|EDQ51575.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/275 (55%), Positives = 192/275 (70%), Gaps = 7/275 (3%)
 Frame = -2

Query  1211  LAMNMEVG-DVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             LA ++E+  D+    + ++D    G   GKM  GC+HYRRRC+IRAPCCNE+F CRHCHN
Sbjct  11    LAQDVELKEDILKEEMPVED----GLSIGKMEHGCKHYRRRCRIRAPCCNEVFDCRHCHN  66

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+    D   RH++ R  V++VIC++CN EQ V  +C NCGV  G YFC+ C+ +DD+
Sbjct  67    EAKNFYEVDESRRHDIPRHRVEKVICSLCNHEQDVKQVCENCGVCMGAYFCDKCKFFDDE  126

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T K+QYHC++CGICRIGGR+NFFHC +CGSCY   LR+ H CVEN+M   CPIC E+LF+
Sbjct  127   TKKEQYHCDKCGICRIGGRDNFFHCDRCGSCYKNSLRNVHPCVENAMHQNCPICVEYLFD  186

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S+    ++ CGHTMH  C ++M   +QY CPICSKS  +MSR W  L+ EI  T MPEEY
Sbjct  187   SVMDISVLPCGHTMHQFCLKQMNQHSQYSCPICSKSTTDMSRFWARLDLEIALTPMPEEY  246

Query  497   F-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYNT  396
                +V ILCNDC  T    +H+LGHKC  C SYNT
Sbjct  247   RNKKVWILCNDCGTTCDVYYHVLGHKCAGCGSYNT  281



>gb|KDO79670.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
Length=316

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 187/257 (73%), Gaps = 2/257 (1%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQ  969
             S E   K    C+HYRRRC+IRAPCCNEIF CRHCHNEA + ++ D K RH++ R +V Q
Sbjct  60    STELLRKGFMECQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQ  119

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             VIC++C TEQ+V  +C+NCGV  G+YFCE C+L+DDDT+K QYHC+ CGICRIGG +NFF
Sbjct  120   VICSLCGTEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFF  179

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC KC  CYS+ L+++H CVE +M   CP+C E+LFE+ +  +++ CGHT+H +C +EM 
Sbjct  180   HCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMR  239

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHIL  432
               +QY CPICSKSV +MS+ WE  + EI  T MPE Y   +V ILCNDC  TS   FH+L
Sbjct  240   EHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVL  299

Query  431   GHKCKHCSSYNTRMVKA  381
               KC +C SYNTR+ + 
Sbjct  300   AQKCPNCKSYNTRLTRG  316



>ref|XP_010670776.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670777.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 193/279 (69%), Gaps = 2/279 (1%)
 Frame = -2

Query  1211  LAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNE  1032
             L  ++++       V   D      D G M +GC+HY+RRC+IRAPCCNEIF C HCHNE
Sbjct  7     LNKSVKLQSDGKVSVDASDHADDLLDVGYMEYGCQHYQRRCRIRAPCCNEIFDCHHCHNE  66

Query  1031  AKSGLSDPK-ERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDT  855
             A + ++  K +RH++ R  V QVIC++C TEQ+V  +C+NCGV  G Y+CEIC+LYDD+T
Sbjct  67    AMNNINLEKTKRHDIPRHQVHQVICSLCGTEQEVRQVCVNCGVCMGKYYCEICKLYDDNT  126

Query  854   TKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFES  675
             +K QYHC+ CGICRIGGRENFFHC KCG CYSV L+++H C+E +M   CP+C+E+LFES
Sbjct  127   SKKQYHCDGCGICRIGGRENFFHCYKCGCCYSVVLKNSHPCIEGAMHHDCPVCFEYLFES  186

Query  674   LKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF  495
                  ++ CGHT+H  C  EM    Q+ CP+CSKSV +MS+ WE  + EI  T MPE Y 
Sbjct  187   RNDVTVLPCGHTIHKKCLDEMQEHCQFACPLCSKSVCDMSKVWEKFDVEIAATPMPEPYQ  246

Query  494   YE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              + V ILCNDC + S   +HI+  KC +C SYNTR +++
Sbjct  247   NKMVSILCNDCESRSCVQYHIVAQKCPNCKSYNTRQLRS  285



>emb|CDM83539.1| unnamed protein product [Triticum aestivum]
Length=299

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/282 (52%), Positives = 189/282 (67%), Gaps = 2/282 (1%)
 Frame = -2

Query  1229  NTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTC  1050
             N  + P   ++  G+ T      +       D G M +GC HYRRRC+IRAPCCNEIF C
Sbjct  19    NVESLPQGPSLFDGNDTARINGSESDEYEKFDKGLMQYGCAHYRRRCRIRAPCCNEIFDC  78

Query  1049  RHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICR  873
             RHCHNE+K+ +  D   RHEL R +++QVIC +C TEQ+V  +C+NCGV  G YFCE+C+
Sbjct  79    RHCHNESKNSIKIDTPTRHELPRHELQQVICTLCGTEQEVRQVCINCGVCMGKYFCEVCK  138

Query  872   LYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICY  693
             L+DDD +K QYHC+ CGICRIGGRENFFHC KCG CYS  L+++H CVE +M   CPIC+
Sbjct  139   LFDDDVSKQQYHCHACGICRIGGRENFFHCSKCGCCYSKVLKNSHACVEGAMHHDCPICF  198

Query  692   EFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTV  513
             E+LFES     ++ CGHT+H  C REM    Q+ CP+CSKSV +MS+ WE L+ E+ T  
Sbjct  199   EYLFESRNDVSVLPCGHTIHEKCLREMKEHCQFACPLCSKSVCDMSKAWERLDAELATLS  258

Query  512   MPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
                +    V ILCNDC   S   FH++ HKC +C SYNTR +
Sbjct  259   NSFDDKM-VRILCNDCGAVSEVQFHLIAHKCHNCKSYNTRQI  299



>ref|XP_008451651.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis melo]
Length=306

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/246 (57%), Positives = 183/246 (74%), Gaps = 1/246 (0%)
 Frame = -2

Query  1106  HYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRDVKQVICAVCNTEQQVAG  927
             H + R +IR    +      H   E +S ++  ++RHELVRRD+ QV+C +CNTEQ+VA 
Sbjct  61    HTKDRRRIRPILISGSNGMHHKSAENRSRVASFEDRHELVRRDIGQVVCLICNTEQEVAK  120

Query  926   ICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLR  747
             +C  C V  G+YFC+IC+ YDD+T K Q+HC+ CGICR+GGRENFFHC++CGSCYS  LR
Sbjct  121   VCRKCNVNMGEYFCDICKFYDDNTEKKQFHCDACGICRVGGRENFFHCERCGSCYSTPLR  180

Query  746   DNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSV  567
             DNH CVENSMKSYCPIC+EFLF+S+K T +M CGHT+H++C+ EM   NQYRCPIC K+V
Sbjct  181   DNHTCVENSMKSYCPICWEFLFDSIKDTTVMPCGHTIHLECFSEMESMNQYRCPICLKTV  240

Query  566   LNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKHCSSYNT-RM  390
             ++MS +W +L+ EI+ T MPEEY +EV + CNDC++ S   FHILGHKC  C+S+NT R 
Sbjct  241   VDMSASWALLKMEIECTPMPEEYSHEVSVHCNDCSHISKVRFHILGHKCSQCNSFNTWRT  300

Query  389   VKADRQ  372
                 RQ
Sbjct  301   SSGGRQ  306



>ref|XP_002872173.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48432.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=308

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 188/280 (67%), Gaps = 2/280 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N +    T   V  +         G M  GC HYRRRC IRAPCCNEIF C HCHN
Sbjct  29    PHSINEDSESSTLERVTAESLINKVLGRGLMEHGCPHYRRRCCIRAPCCNEIFGCHHCHN  88

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ ++ D K+RH++ R  V+QVIC +C TEQ+V  IC++CGV  G YFC++C+L+DDD
Sbjct  89    EAKNNINVDQKQRHDIPRHQVEQVICLLCGTEQEVGQICIHCGVCMGKYFCKVCKLFDDD  148

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T+K QYHC+ CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+EFLFE
Sbjct  149   TSKKQYHCDGCGICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPICFEFLFE  208

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S     ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y
Sbjct  209   SRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY  268

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                 V ILCNDC   S   +H++  KC +C SYNTR  + 
Sbjct  269   QNRMVQILCNDCGKKSEVKYHVVAQKCPNCKSYNTRQTRG  308



>gb|AAD02556.1| PGPD14 [Petunia x hybrida]
Length=285

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/262 (52%), Positives = 191/262 (73%), Gaps = 4/262 (2%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVR  984
             +D++++  D G   +GC HYRRRCKIRAPCC+EIF CRHCHN++K+ L  DP +RH++ R
Sbjct  12    NDESIT--DMGSGNYGCSHYRRRCKIRAPCCDEIFDCRHCHNDSKNSLEVDPHKRHDVPR  69

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              D+K+VIC++CNTEQ V   C++CGV  G Y+C  C  +DDD +KDQYHC++CGICR GG
Sbjct  70    HDIKRVICSLCNTEQDVQQTCVHCGVCMGKYYCSKCNFFDDDVSKDQYHCDKCGICRTGG  129

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
               NFFHC +C  CYS  ++++H+CVE +M   CP+C+E++F++ K+  ++ CGHTMH++C
Sbjct  130   NSNFFHCNRCECCYSNMMKESHICVERAMHHNCPVCFEYVFDTTKNITVLPCGHTMHLEC  189

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTA  447
               +M   NQY CP+CS+S  +MSR WE L++E+ +T MPE Y  + V ILCNDC  TS  
Sbjct  190   VMQMEQHNQYSCPVCSRSYCDMSRVWEKLDQEVASTPMPEMYQNKMVWILCNDCGETSEV  249

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+  KC +C SYNTR  + 
Sbjct  250   NFHIVARKCPNCKSYNTRQTRG  271



>ref|XP_008462499.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis melo]
 ref|XP_008462500.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Cucumis melo]
Length=288

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 189/270 (70%), Gaps = 8/270 (3%)
 Frame = -2

Query  1184  VTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DP  1008
             ++P G       +S  D G   FGC HYRRRCKIRAPCCNEIF CRHCHNEAK+ L  DP
Sbjct  11    ISPNG------DMSSIDLGYGSFGCSHYRRRCKIRAPCCNEIFDCRHCHNEAKNSLGVDP  64

Query  1007  KERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNE  828
               RH++ R D+++VIC++C TEQ V   C+ C V  G YFC  C+ +DDD +K QYHCNE
Sbjct  65    LLRHDIPRHDMEKVICSLCGTEQDVRQYCIQCEVCMGKYFCAKCKFFDDDVSKKQYHCNE  124

Query  827   CGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKC  648
             CGICR+GG +NFFHC+KCG CYS  + ++H CVE +M   CP+C+EFLF+++    ++ C
Sbjct  125   CGICRVGGEDNFFHCKKCGCCYSKLMENSHNCVEKAMHHNCPVCFEFLFDTMSDISVLPC  184

Query  647   GHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCN  471
             GHT+H++C +EM  + QY CP+CSKS  +MS  WE L+ E+ +T MP+ Y ++ V ILCN
Sbjct  185   GHTIHLECVKEMEQRLQYTCPVCSKSYCDMSSVWEKLDHEVASTPMPQMYQHKMVWILCN  244

Query  470   DCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             DC+  S   +HI+ HKC  C SYNTR+ + 
Sbjct  245   DCSEISEVNYHIVAHKCLKCKSYNTRLTQG  274



>ref|XP_010493817.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Camelina sativa]
Length=307

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 184/280 (66%), Gaps = 2/280 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N E    T   V  +         G M  GC HYRRRC IRAPCCNEIF C HCHN
Sbjct  28    PHSINEESESSTLERVAAESLINEVLGRGLMEHGCPHYRRRCCIRAPCCNEIFGCHHCHN  87

Query  1034  EAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDD  858
             EAK+ ++ D K RH++ R  V+QV C +C TEQ+V  IC++CGV  G YFC++C+LYDDD
Sbjct  88    EAKNSINVDQKHRHDIPRHQVRQVTCLLCGTEQEVGQICIHCGVCMGKYFCKVCKLYDDD  147

Query  857   TTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFE  678
             T+K QYHC  CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+EFLFE
Sbjct  148   TSKQQYHCEGCGICRIGGRENFFHCYKCGCCYSILLKNSHPCVEGAMHHDCPICFEFLFE  207

Query  677   SLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY  498
             S     ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE  + EI  T MPE Y
Sbjct  208   SRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY  267

Query  497   FYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
                 V ILCNDC   S   +H++  KC  C SYNTR  + 
Sbjct  268   QNRMVQILCNDCGKKSEVRYHVVAQKCPDCKSYNTRQTRG  307



>ref|XP_006644631.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Oryza brachyantha]
Length=334

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 192/273 (70%), Gaps = 5/273 (2%)
 Frame = -2

Query  1193  VGDVTPTGVQLDDQ---TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKS  1023
             + D   T  ++DD+        + G M +GC HY+RRC+IRAPCCNEIF CRHCHNEAK+
Sbjct  63    LADEKCTAEKIDDEYHDDYQKLEKGIMQYGCTHYQRRCRIRAPCCNEIFDCRHCHNEAKN  122

Query  1022  GLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKD  846
              +  D  +RHEL R +VKQVIC++C TEQ+V  +C++CGV  G YFCE+C+L+DDD +K 
Sbjct  123   SIKIDAVKRHELPRHEVKQVICSLCGTEQEVRQVCISCGVCMGKYFCEVCKLFDDDVSKQ  182

Query  845   QYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKS  666
             QYHC+ CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+E+LF S   
Sbjct  183   QYHCDGCGICRIGGRENFFHCSKCGCCYSIVLKNSHACVEGAMHHDCPICFEYLFNSTND  242

Query  665   TMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEV  486
               ++ CGHT+H+ C +EM    Q+ CP+CSKSV +MS+ WE L+EE+  T+        V
Sbjct  243   VSVLPCGHTIHVKCLQEMEEHCQFACPLCSKSVCDMSKAWERLDEEL-ATISDTCDNKMV  301

Query  485   PILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
              ILCNDC   S   FH++ HKC+ C SYNTR +
Sbjct  302   RILCNDCGAISEVQFHLIAHKCQKCKSYNTRQI  334



>gb|EYU41597.1| hypothetical protein MIMGU_mgv1a011316mg [Erythranthe guttata]
Length=286

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 196/263 (75%), Gaps = 3/263 (1%)
 Frame = -2

Query  1163  LDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELV  987
             +DD+ ++   + K  +GC HYRRRCKI APCCNEIF CRHCHN+AK+ +  +P +RH++ 
Sbjct  11    VDDECMTEMGYQKS-YGCSHYRRRCKIIAPCCNEIFDCRHCHNDAKNSIEVEPLDRHDIP  69

Query  986   RRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIG  807
             R  +++VIC++CNTEQ V  +C+NCG+  G+Y+C IC+ +DDD +K+QYHC +CGICR G
Sbjct  70    RHQLERVICSLCNTEQDVQQMCINCGICMGNYYCSICKFFDDDVSKNQYHCEKCGICRTG  129

Query  806   GRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMD  627
             G+E FFHC KCG CYS  L+D+H+C+E +M   CPIC+E+LF++ + T ++ CGHT+H++
Sbjct  130   GKEYFFHCDKCGCCYSNLLKDSHICIERAMHHDCPICFEYLFDTPRDTTVLPCGHTIHLN  189

Query  626   CYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTST  450
             C +EM    QY CP+CSKS  +M+R WE L++EI +T MP+ Y  + V ILCNDC  TS 
Sbjct  190   CVKEMERHFQYSCPVCSKSYCDMTRIWERLDQEIASTPMPQMYKDKMVWILCNDCGETSE  249

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
               +HIL HKC +C+SYNTR  + 
Sbjct  250   VNYHILAHKCTNCNSYNTRQTRG  272



>ref|XP_010541308.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Tarenaya hassleriana]
Length=292

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 187/259 (72%), Gaps = 2/259 (1%)
 Frame = -2

Query  1154  QTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVRRD  978
             Q  +  + G   +GC HYRRRC+IRAPCC+E+F CRHCHNEAK+ L +DP +RH+L R +
Sbjct  14    QAPNFMEIGSGNYGCSHYRRRCRIRAPCCDEVFDCRHCHNEAKNSLETDPLDRHDLPRHE  73

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             V +V+C+ CNTEQ V   C NCGV  G YFC  C+ +DDD +K QYHCNECGICR GG E
Sbjct  74    VAKVVCSFCNTEQDVQQNCSNCGVCMGKYFCPKCKFFDDDVSKRQYHCNECGICRTGGEE  133

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             NFFHC++CG CYS  ++D H CVE +M   CP+C+E+LF++ +   +++CGHTMH+ C +
Sbjct  134   NFFHCERCGCCYSKVMKDTHRCVEGAMHHNCPVCFEYLFDTTRDITVLRCGHTMHLGCAK  193

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIF  441
             EM   ++Y CP+CSKS+ +MSR W+ L+EEI    MP+ +  + V ILCNDC + S   F
Sbjct  194   EMELHHRYTCPVCSKSICDMSRPWKKLDEEIAAYPMPKLHQNKMVWILCNDCGSNSHVHF  253

Query  440   HILGHKCKHCSSYNTRMVK  384
             H++ HKC+ C SYNTR ++
Sbjct  254   HVIAHKCRSCGSYNTRQIQ  272



>emb|CDP15288.1| unnamed protein product [Coffea canephora]
Length=290

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 182/248 (73%), Gaps = 2/248 (1%)
 Frame = -2

Query  1118  FGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTE  942
             +GC HY+RRCKIRAPCC+EIF CRHCH+E K+ +  DP  RH++ R ++K+VIC++CNTE
Sbjct  29    YGCSHYKRRCKIRAPCCDEIFDCRHCHDELKNSIEVDPLRRHDIPRHEIKRVICSLCNTE  88

Query  941   QQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCY  762
             Q V   C+ CG+  G+YFC IC  +DDD +K+QYHC+ CGICR GG+ENFFHC  CG CY
Sbjct  89    QDVQQKCVKCGICMGEYFCSICNFFDDDVSKNQYHCDRCGICRTGGKENFFHCNGCGCCY  148

Query  761   SVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPI  582
             S  L+D+H C+E +M   CP+C+E+LF++ K   ++ CGHT+H+DC +EM    +Y CP+
Sbjct  149   SNVLKDSHTCIERAMHHNCPVCFEYLFDTTKEITVLFCGHTIHLDCVKEMERHFKYSCPV  208

Query  581   CSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSS  405
             CSKS  +MSR WE L+EE+ +T MP+ Y  + V ILCNDC  TS   FHI+ HKC  CSS
Sbjct  209   CSKSYCDMSRVWEKLDEEVASTAMPQIYRDKMVWILCNDCGETSEVNFHIVAHKCLKCSS  268

Query  404   YNTRMVKA  381
             YNTR  + 
Sbjct  269   YNTRQTRG  276



>ref|NP_001146901.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea 
mays]
 ref|XP_008672785.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Zea mays]
 ref|XP_008672786.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Zea mays]
 ref|XP_008672787.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Zea mays]
 ref|XP_008672788.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Zea mays]
 gb|ACG24303.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea 
mays]
 gb|ACL53878.1| unknown [Zea mays]
 tpg|DAA57830.1| TPA: putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA57831.1| TPA: putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
 tpg|DAA57832.1| TPA: putative RING zinc finger domain superfamily protein isoform 
3 [Zea mays]
 tpg|DAA57833.1| TPA: putative RING zinc finger domain superfamily protein isoform 
4 [Zea mays]
 tpg|DAA57834.1| TPA: putative RING zinc finger domain superfamily protein isoform 
5 [Zea mays]
Length=300

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 183/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D  +RHEL R +V+QV+C++
Sbjct  53    GIMHYGCPHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDKMKRHELPRHEVQQVVCSL  112

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C+NCGV  G YFC +C+L+DDD +K QYHCN CGICRIGGRENFFHC KC
Sbjct  113   CGTEQEVRQVCINCGVCMGKYFCGLCKLFDDDVSKQQYHCNGCGICRIGGRENFFHCSKC  172

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+E+LF+S     ++ CGHT+H+ C +EM    Q+
Sbjct  173   GCCYSIALKNSHACVEGAMHHDCPICFEYLFDSTNDVSVLPCGHTIHVKCLKEMEEHCQF  232

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+ E+ T     ++   V ILCNDC   S   FH++ HKC++
Sbjct  233   ACPLCSKSVCDMSKAWERLDMELATLSDSCDHKM-VRILCNDCGAISDVQFHLIAHKCQN  291

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  292   CKSYNTRQI  300



>gb|KHG29610.1| RING finger and CHY zinc finger domain-containing 1 [Gossypium 
arboreum]
Length=283

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 195/275 (71%), Gaps = 7/275 (3%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSG  1020
             MEV D+ P    LD  +++ + +G+  FGC HYRRRCKIRAPCC+EIF CRHCHN+AK+ 
Sbjct  1     MEV-DLEPK--VLDTPSMTEKGYGE--FGCSHYRRRCKIRAPCCDEIFDCRHCHNDAKNS  55

Query  1019  LS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQ  843
             +  DP +RHE+ R D+K+VIC++C+ EQ V   C+NCGV  G YFC  C  +DDD +K Q
Sbjct  56    IEIDPFDRHEVPRHDIKRVICSLCDREQDVQQYCINCGVCMGKYFCSKCNFFDDDVSKKQ  115

Query  842   YHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKST  663
             YHC+EC ICRIGG ENFFHC KCG CYS+ ++++H CVE +M   C +C+EFLF++ K  
Sbjct  116   YHCDECCICRIGGAENFFHCDKCGCCYSMIMKNSHKCVEKAMHHNCAVCFEFLFDTTKEI  175

Query  662   MIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEY-FYEV  486
              ++ CGHT+H++C REM   +QY CP+CSKS  +M+R WE L+ E+ +T MP+ Y    V
Sbjct  176   TVLPCGHTIHLECVREMERHSQYSCPVCSKSFCDMTRVWERLDREVASTGMPQIYQNRRV  235

Query  485   PILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              ILCNDC   S   FH + HKC  CSSYNT++ + 
Sbjct  236   WILCNDCGENSEVNFHFVAHKCPICSSYNTKLTRG  270



>ref|XP_009385607.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385608.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385609.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385610.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385611.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385612.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385613.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385614.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=307

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 192/285 (67%), Gaps = 20/285 (7%)
 Frame = -2

Query  1241  RPQDNTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNE  1062
             +PQD T TP L               L D+ ++    G   +GC HYRRRC IRAPCC +
Sbjct  39    KPQDLTYTPDL---------------LADERLAK---GLFQYGCPHYRRRCHIRAPCCGK  80

Query  1061  IFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFC  885
             IF CRHCHNEA + +  + + RHEL R++V+QVIC++C TEQ+V  IC+NCGV  G YFC
Sbjct  81    IFYCRHCHNEAMNSIDVERRHRHELPRQEVQQVICSLCGTEQEVQQICINCGVCMGKYFC  140

Query  884   EICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYC  705
               C+L+DDD +K QYHC+ CGICRIGGRENFFHC  CG CYS+ L+++H CVE +M   C
Sbjct  141   GTCKLFDDDVSKQQYHCSGCGICRIGGRENFFHCFTCGCCYSIVLKNSHSCVEGAMHHDC  200

Query  704   PICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEI  525
             P+C+E+LFES     ++ CGHT+H++C +EM    Q+ CP+CSKSV +MS  WEIL+ EI
Sbjct  201   PVCFEYLFESTNDISVLPCGHTIHVNCLKEMQQHLQFACPLCSKSVCDMSEVWEILDMEI  260

Query  524   QTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYNTR  393
               T MP  Y   +V ILCNDC   S   FH++G KC  C SYNTR
Sbjct  261   AATPMPGSYHNKKVRILCNDCGAISEVQFHVVGQKCLKCKSYNTR  305



>ref|XP_006488004.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Citrus sinensis]
Length=297

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 191/267 (72%), Gaps = 2/267 (1%)
 Frame = -2

Query  1172  GVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERH  996
             G   +++ VS  + G   +GC HY+RRCKIRAPCC +IF CRHCHNEAK+ L ++P +RH
Sbjct  17    GTYFEEKEVSLMEIGSGNYGCSHYKRRCKIRAPCCGDIFDCRHCHNEAKNSLETNPLDRH  76

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             ++ R ++++VIC++C TEQ     C+NCGV  G Y+C  C+ +DDD TK+QYHC+ECGIC
Sbjct  77    DIPRHEIEKVICSLCGTEQDAQQYCINCGVCMGKYYCAKCKFFDDDITKNQYHCDECGIC  136

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R GG++NFFHC+ CG CYS  ++D H CVE +M   CPIC+EF+F+++K   ++ CGHT+
Sbjct  137   RTGGKDNFFHCKTCGCCYSKEMKDKHRCVERAMHHNCPICFEFIFDTMKDITVLCCGHTI  196

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H++C +EM    +Y CP+CSKS+ +MS+ W  +++EI +T MP  Y  + V ILCNDC+ 
Sbjct  197   HLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCSA  256

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKAD  378
              S   FH++ HKC  C SYNTR  + D
Sbjct  257   NSHVQFHVIAHKCLSCKSYNTRQTRGD  283



>ref|XP_003569693.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X2 [Brachypodium distachyon]
Length=296

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 182/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNEAK+ +  D   RHE+ R +V+QVIC++
Sbjct  49    GSMKYGCAHYRRRCRIRAPCCNEIFDCRHCHNEAKNSIGIDTMRRHEIPRHEVQQVICSL  108

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  IC+NCGV  G YFCE+C+L+DDD +K QYHC+ CGICRIGGRENFFHC KC
Sbjct  109   CGTEQEVRQICINCGVCMGKYFCEVCKLFDDDVSKQQYHCHGCGICRIGGRENFFHCSKC  168

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS  L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H +C +EM    Q+
Sbjct  169   GCCYSTVLKNSHSCVEGAMHHDCPICFEYLFESTNDVSVLPCGHTIHENCLKEMEEHCQF  228

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+ E+ +     +    V ILCNDC   S   FH++ HKC++
Sbjct  229   SCPLCSKSVCDMSKAWERLDMELASLSDSCDNKM-VRILCNDCGAVSEVQFHLIAHKCQN  287

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  288   CKSYNTRQI  296



>ref|XP_008807700.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
 ref|XP_008807701.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
 ref|XP_008807702.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like [Phoenix dactylifera]
Length=268

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 184/259 (71%), Gaps = 2/259 (1%)
 Frame = -2

Query  1151  TVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDV  975
             T +  D G   +GC HYRRRCKIRAPCC EIF CRHCHNE K+ L  D +ERHE+ R++V
Sbjct  2     TSNEMDSGSGQYGCSHYRRRCKIRAPCCGEIFDCRHCHNEVKNSLEIDLRERHEIPRQEV  61

Query  974   KQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGREN  795
             K VIC++C+TEQ V   C NCGV  G YFC  C+ +DDD +K+QYHC+ CGICR  G EN
Sbjct  62    KMVICSLCDTEQDVQQYCSNCGVCMGKYFCGKCKFFDDDVSKNQYHCDGCGICRTAGEEN  121

Query  794   FFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYRE  615
             FFHC +CG CY+  L+D+H CVE +M   CPIC+E+LFES+K   +M CGHT+H++C +E
Sbjct  122   FFHCYRCGCCYTKSLKDSHHCVERAMHHNCPICFEYLFESIKDISVMPCGHTIHLECLKE  181

Query  614   MVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFH  438
             M    Q+ CP+CS+SV +MS  WE L++E+ +T MPE Y  + V ILCNDC   S   FH
Sbjct  182   MRLHFQFSCPVCSRSVCDMSSVWEKLDQEVASTPMPEMYENKMVWILCNDCGMRSNVHFH  241

Query  437   ILGHKCKHCSSYNTRMVKA  381
             I+ HKC  C+SYNTR  + 
Sbjct  242   IVAHKCPGCNSYNTRQTRG  260



>ref|XP_008661955.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Zea mays]
Length=256

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 175/224 (78%), Gaps = 4/224 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHELVRRD  978
             D  V   D GKM  GCEHYRRRCKI APCCN++F CRHCHNEA +      +RH + R+D
Sbjct  20    DGEVDRRDVGKMKHGCEHYRRRCKIVAPCCNQVFPCRHCHNEATAS----GDRHTICRQD  75

Query  977   VKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRE  798
             V++V+C +C T+Q V+ +C++CGV  G+YFC+IC+ YDDDT K QYHC +CGICR+GG+E
Sbjct  76    VEKVVCLLCETKQPVSQVCISCGVNMGEYFCDICKFYDDDTDKGQYHCIDCGICRVGGKE  135

Query  797   NFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYR  618
             NFFHC KCGSCYSV LRDNH CVENSM+  CPICYE+LF+SL+ T ++ CGHTMH+ C+ 
Sbjct  136   NFFHCVKCGSCYSVILRDNHQCVENSMRQNCPICYEYLFDSLQGTRVLNCGHTMHLTCFE  195

Query  617   EMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEV  486
             EMV  N+Y CPICSK+ L+++  WE+L++EI+ T+MP  Y Y+V
Sbjct  196   EMVAHNKYTCPICSKTALDLTHHWEMLDQEIEATIMPLVYRYKV  239



>gb|KDO79675.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
Length=251

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 184/246 (75%), Gaps = 2/246 (1%)
 Frame = -2

Query  1112  CEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQ  936
             C+HYRRRC+IRAPCCNEIF CRHCHNEA + ++ D K RH++ R +V QVIC++C TEQ+
Sbjct  6     CQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSLCGTEQK  65

Query  935   VAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSV  756
             V  +C+NCGV  G+YFCE C+L+DDDT+K QYHC+ CGICRIGG +NFFHC KC  CYS+
Sbjct  66    VQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSM  125

Query  755   GLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICS  576
              L+++H CVE +M   CP+C E+LFE+ +  +++ CGHT+H +C +EM   +QY CPICS
Sbjct  126   LLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICS  185

Query  575   KSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCKHCSSYN  399
             KSV +MS+ WE  + EI  T MPE Y   +V ILCNDC  TS   FH+L  KC +C SYN
Sbjct  186   KSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYN  245

Query  398   TRMVKA  381
             TR+ + 
Sbjct  246   TRLTRG  251



>ref|XP_006288312.1| hypothetical protein CARUB_v10001557mg [Capsella rubella]
 gb|EOA21210.1| hypothetical protein CARUB_v10001557mg [Capsella rubella]
Length=304

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 192/300 (64%), Gaps = 10/300 (3%)
 Frame = -2

Query  1250  SPPRPQ-DNTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDF-------GKMLFGCEHYRR  1095
             SP +PQ  +     ++ N+    +         + ++ E         G M  GC HYRR
Sbjct  5     SPQQPQKSDQEKGEMSRNLHSQSINEESESSILERITAESIINEVLGRGLMEHGCPHYRR  64

Query  1094  RCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICL  918
             RC IRAPCCNEIF C HCH EAK+ ++ D K RH++ R  V+QVIC +C TEQ+V  IC+
Sbjct  65    RCCIRAPCCNEIFGCHHCHYEAKNSINVDQKHRHDIPRHQVRQVICLLCGTEQEVGQICI  124

Query  917   NCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNH  738
             NCGV  G YFC++C+LYDDDT+K QYHC+ CGICRIGG+ENFFHC KCG CYS+ L+++H
Sbjct  125   NCGVCMGKYFCKVCKLYDDDTSKQQYHCDGCGICRIGGQENFFHCYKCGCCYSILLKNSH  184

Query  737   LCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNM  558
              CVE +M   CPIC+EFLFES     ++ CGHT+H  C  EM    QY CP+CSKSV +M
Sbjct  185   PCVEGAMHHDCPICFEFLFESRNDVTVLPCGHTIHQMCLEEMREHYQYACPLCSKSVCDM  244

Query  557   SRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             S+ WE  + EI  T MPE Y    V ILCNDC   S   +H++  KC  C SYNTR  + 
Sbjct  245   SKVWEKFDMEIAATPMPEPYQNRMVQILCNDCGKKSEVQYHVVAQKCPDCKSYNTRQTRG  304



>ref|XP_004501268.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Cicer arietinum]
Length=287

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 180/252 (71%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC+HYRRRC+IRAPCCNEIF CRHCHNEAK+ ++ D K RH++ R  VKQVIC++
Sbjct  36    GYMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAKNSINIDQKHRHDIPRHQVKQVICSL  95

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V   C NCGV  G YFCE C+L+DDD +K QYHC+ CGICR GG ENFFHC KC
Sbjct  96    CGTEQEVQQNCTNCGVCMGKYFCETCKLFDDDVSKQQYHCSGCGICRTGGCENFFHCYKC  155

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS  L+++H CVE +M   CP+C+E+LFES+    ++ CGHT+H  C  EM    QY
Sbjct  156   GCCYSTLLKNSHPCVEGAMHHDCPVCFEYLFESVTDVTVLLCGHTIHKSCLNEMREHFQY  215

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKSV +MS+ WE ++ EI  T MPE Y  + V ILCNDC   S   FH++  KC 
Sbjct  216   ACPLCSKSVCDMSKVWEKIDLEIAATPMPEPYLNKMVWILCNDCGENSHVQFHLVAQKCL  275

Query  416   HCSSYNTRMVKA  381
             +C SYNTR  + 
Sbjct  276   NCKSYNTRQTRG  287



>ref|XP_006354387.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Solanum tuberosum]
Length=288

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 188/261 (72%), Gaps = 4/261 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRR  981
             D++V+    G   +GC HYRRRCKIRAPCC+E+F CRHCHN++K+ L  DP +RH++ R 
Sbjct  17    DESVAEMASGN--YGCSHYRRRCKIRAPCCDELFDCRHCHNDSKNSLDVDPLKRHDIPRH  74

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             D+K+VIC++CNTEQ V   C+ CGV  G YFC  C  +DDD +K+QYHC++CGICR GG 
Sbjct  75    DIKRVICSLCNTEQDVQQKCIQCGVCMGKYFCSKCNFFDDDVSKNQYHCDKCGICRTGGE  134

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             ENFFHC  CG CY+  ++++H C+E +M   CP+C+E++F++ K+ +++ CGHTMH++C 
Sbjct  135   ENFFHCDTCGCCYTNSMKESHKCIERAMHHNCPVCFEYIFDTTKNIIVLPCGHTMHLECV  194

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAI  444
              +M    QY CP+CS+S  +MSR WE L++E+ +T MPE Y   +V ILCNDC  TS   
Sbjct  195   MQMEQHFQYSCPVCSRSYCDMSRVWEQLDQEVASTAMPEMYQDKKVWILCNDCAETSEVN  254

Query  443   FHILGHKCKHCSSYNTRMVKA  381
             FHI+ HKC  C SYNTR  + 
Sbjct  255   FHIVAHKCPSCKSYNTRQTRG  275



>ref|XP_006650078.1| PREDICTED: uncharacterized RING finger protein C2F3.16-like [Oryza 
brachyantha]
Length=261

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 188/263 (71%), Gaps = 7/263 (3%)
 Frame = -2

Query  1169  VQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLSDPKERHEL  990
             ++LDD   +   FGKM FGC+HYRRRC+IRAPCCN++F CRHCHNE+       K+ HEL
Sbjct  1     MELDD-AAARHGFGKMGFGCKHYRRRCRIRAPCCNDVFHCRHCHNEST------KDGHEL  53

Query  989   VRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRI  810
              R  V+ VIC VC+TEQ VA +C NCGV  G+YFC  C+  DDD  ++ +HC +CGICR+
Sbjct  54    DRHAVESVICLVCDTEQPVAQVCCNCGVCMGEYFCRECKFLDDDVDREHFHCKDCGICRV  113

Query  809   GGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHM  630
             GG+ENFFHC+KCGSCYSV LRD H C+ENSMK+ CPICYE+LF+SL+ T +++CGHTMH+
Sbjct  114   GGQENFFHCEKCGSCYSVSLRDKHCCIENSMKNNCPICYEYLFDSLRETSVLRCGHTMHL  173

Query  629   DCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTST  450
              C+ EM+  +++ CPICS  + +M +    L+ EI+  ++  +Y  +  I+CNDC +T+ 
Sbjct  174   QCFHEMLKHDKFSCPICSMPIFDMDKFLRALDAEIEANMLHIDYMGKGWIVCNDCRDTTQ  233

Query  449   AIFHILGHKCKHCSSYNTRMVKA  381
                 + GHKC HC S NT  V A
Sbjct  234   VYSRVAGHKCCHCQSRNTCRVAA  256



>ref|XP_002268149.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010653992.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 ref|XP_010653993.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Vitis vinifera]
 emb|CBI30162.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 185/275 (67%), Gaps = 2/275 (1%)
 Frame = -2

Query  1199  MEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSG  1020
             ME G          ++  S  + G   FGC HYRRRCKIRAPCC+EIF CRHCHNEAK+ 
Sbjct  1     MESGLEGQMSTHRHEEDESLMEMGSGRFGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKNA  60

Query  1019  LS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQ  843
             L  DP  RH++ R ++K+VIC++C TEQ V   C++CGV  G YFC  C+ +DDD +K  
Sbjct  61    LEVDPLTRHDVPRHEIKRVICSLCGTEQDVQQNCIHCGVCMGQYFCSKCKFFDDDVSKQI  120

Query  842   YHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKST  663
             YHCN+CGICR GG ENFFHC KCG CYS  L+D+H CVE +M   CP+C+E+LF++    
Sbjct  121   YHCNKCGICRTGGEENFFHCDKCGCCYSTALKDSHNCVERAMHHNCPVCFEYLFDTTTDI  180

Query  662   MIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-V  486
              ++ CGHT+H++C +EM    QY CP+CSKS  +MS  WE L++E+  T MP  +  + V
Sbjct  181   TVLHCGHTIHLECLKEMERHFQYSCPVCSKSYCDMSHVWEKLDQEVALTPMPSMFENKMV  240

Query  485   PILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
              ILCNDC  TS   FHI+ HKC  C+SYNTR  + 
Sbjct  241   WILCNDCGETSEVNFHIVAHKCLKCNSYNTRQTRG  275



>gb|EMS60697.1| RING finger and CHY zinc finger domain-containing protein 1 [Triticum 
urartu]
Length=299

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 179/249 (72%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE+K+ +  D   RHEL R +++QVIC++
Sbjct  52    GLMQYGCAHYRRRCRIRAPCCNEIFDCRHCHNESKNSIKIDTPRRHELPRHELQQVICSL  111

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  IC+NCGV  G YFCE+C+L+DDD +K QYHC+ CGICRIGGRENFFHC KC
Sbjct  112   CGTEQEVRQICINCGVCMGKYFCEVCKLFDDDVSKQQYHCHACGICRIGGRENFFHCSKC  171

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS  L+++H CVE +M   CPIC+E+LFES     ++ CGHT+H  C +EM    Q+
Sbjct  172   GCCYSKVLKNSHACVEGAMHHDCPICFEYLFESRNDVSVLPCGHTIHEKCLKEMKEHCQF  231

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+ E+ T     +    V ILCNDC   S   FH++ HKC  
Sbjct  232   ACPLCSKSVCDMSKAWERLDAELATLSNSFDDKV-VRILCNDCGAVSEVQFHLIAHKCHS  290

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  291   CKSYNTRQI  299



>ref|XP_004969767.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Setaria italica]
 ref|XP_004969768.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Setaria italica]
 ref|XP_004969769.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X3 [Setaria italica]
Length=302

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/272 (53%), Positives = 188/272 (69%), Gaps = 10/272 (4%)
 Frame = -2

Query  1175  TGVQLDDQTVSGEDF--------GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSG  1020
             +G    ++ + G D         G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ 
Sbjct  32    SGGNYKEEKIDGSDADDYEKFEKGIMHYGCPHYRRRCRIRAPCCNEIFDCRHCHNEVKNS  91

Query  1019  LS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQ  843
             +  D  +RHEL R +V+QVIC++C TEQ+V  +C+NCGV  G YFC  C+L+DDD +K Q
Sbjct  92    IKVDTMKRHELPRHEVQQVICSLCGTEQEVRQVCINCGVCMGKYFCGSCKLFDDDVSKQQ  151

Query  842   YHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKST  663
             YHCN CGICRIGGRENFFHC KCG CYS+ L+++H CVE +M   CPIC+E+LFES    
Sbjct  152   YHCNGCGICRIGGRENFFHCSKCGCCYSIVLKNSHACVEGAMHHDCPICFEYLFESTNDV  211

Query  662   MIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVP  483
              ++ CGHT+H+ C +EM    Q+ CP+CSKSV +MS+ WE L+ E+  T+        V 
Sbjct  212   SVLPCGHTIHVKCLKEMEEHCQFACPLCSKSVCDMSKAWERLDMEL-ATLSDSCDDKMVR  270

Query  482   ILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             ILCNDC   S   FH++ HKC++C SYNTR +
Sbjct  271   ILCNDCGAISEVQFHLIAHKCQNCKSYNTRQI  302



>ref|XP_011081857.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Sesamum indicum]
 ref|XP_011081858.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 [Sesamum indicum]
Length=322

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 194/290 (67%), Gaps = 14/290 (5%)
 Frame = -2

Query  1244  PRPQDNTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCN  1065
             P P+++    P   ++  G +T T            D G + +GC HYRRRC+IRAPCCN
Sbjct  42    PSPEEHI---PAKESLSQGKITGT---------EALDKGYLKYGCSHYRRRCQIRAPCCN  89

Query  1064  EIFTCRHCHNEAKSGL-SDPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYF  888
             EIF CRHCHNEAK+ +  D K RH++ R  +++VIC++C+TEQ+V  +C NCGV  G Y+
Sbjct  90    EIFDCRHCHNEAKNNICVDQKLRHDVPRHLIEKVICSLCDTEQEVQQVCTNCGVCMGRYY  149

Query  887   CEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSY  708
             C IC+L+DDDT+K+QYHCN CGICRIGG +NFFHC KCG CYS+ L+ +H CVE +M   
Sbjct  150   CAICKLFDDDTSKEQYHCNGCGICRIGGSKNFFHCDKCGCCYSILLKSSHPCVERAMHQD  209

Query  707   CPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEE  528
             CP+C+E+LF+S    + M CGHT+H  C  EM    +Y CPICSKSV +MS+ WE  + E
Sbjct  210   CPVCFEYLFDSRNDVIAMPCGHTIHKTCLVEMQEHYKYACPICSKSVCDMSKVWEKFDLE  269

Query  527   IQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             I  T MP  Y  + V ILCNDC + S   +H++  KC +C SYNTR  + 
Sbjct  270   IAATPMPAYYENKMVWILCNDCGSNSEVKYHVIAQKCPNCKSYNTRQTRG  319



>emb|CDP07032.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 185/266 (70%), Gaps = 2/266 (1%)
 Frame = -2

Query  1172  GVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERH  996
             G +   +  +  D G    GC+HY RRCKIRAPCCNEIF CRHCHNEAK+ L  DP  RH
Sbjct  13    GPEFAGKDENLRDLGSGDHGCKHYSRRCKIRAPCCNEIFNCRHCHNEAKNSLEVDPLHRH  72

Query  995   ELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGIC  816
             +L R +VK VIC++C TEQ V   C +CGV  G YFC+ C+ +DDD +K QYHC+ECGIC
Sbjct  73    DLPRHEVKTVICSLCGTEQNVQQKCQSCGVCMGKYFCQKCKFFDDDVSKKQYHCHECGIC  132

Query  815   RIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTM  636
             R GG+E+FFHC KCG CYS  ++D H CVE +M   CP+C E+LF++ K   ++ CGHT+
Sbjct  133   RTGGKESFFHCNKCGCCYSKLIKDAHNCVERAMHHNCPVCLEYLFDTTKDITVLPCGHTI  192

Query  635   HMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNN  459
             H+DC ++M H ++Y CP+CSKS+ ++S  W ++++E+  T MPE Y  + V ILCNDC  
Sbjct  193   HLDCVQKMEHHSRYSCPVCSKSICDLSNLWRMIDQEVDATQMPEMYKDKMVWILCNDCGA  252

Query  458   TSTAIFHILGHKCKHCSSYNTRMVKA  381
              +   FHIL HKC  C SYNTR ++ 
Sbjct  253   IAEVHFHILAHKCLRCKSYNTRQIQG  278



>gb|KHG03356.1| RING finger and CHY zinc finger domain-containing 1 [Gossypium 
arboreum]
Length=294

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 186/262 (71%), Gaps = 2/262 (1%)
 Frame = -2

Query  1160  DDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAK-SGLSDPKERHELVR  984
             + Q  S  + G   +GC HYRRRCKIRAPCCNE+F CRHCHNE+K S  S P ++H++ R
Sbjct  21    NHQNGSLMETGLGNYGCSHYRRRCKIRAPCCNEVFYCRHCHNESKNSPESSPLKQHDIPR  80

Query  983   RDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGG  804
              +V++VIC++C+TEQ V   C+NCGV  G YFC  C+ +DDD +K+QYHC ECGICR GG
Sbjct  81    HEVEKVICSLCDTEQDVQQYCINCGVCMGKYFCGKCKFFDDDVSKNQYHCVECGICRTGG  140

Query  803   RENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDC  624
             +ENFFHC KCG CYS  +R+ H C+E +M   CPIC+EFLF+++K   ++ CGHTMH+ C
Sbjct  141   KENFFHCNKCGCCYSNLMREVHRCIEKAMHHDCPICFEFLFDTMKDVTVLPCGHTMHLGC  200

Query  623   YREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTA  447
              REM    +Y CP+CSKS+ +MS+ W  L++EI +T MP  Y  + V ILCNDC  TS  
Sbjct  201   LREMEEHYRYSCPVCSKSICDMSKLWRKLDKEIASTPMPAVYQNKMVWILCNDCGATSNV  260

Query  446   IFHILGHKCKHCSSYNTRMVKA  381
              FHI+ HKC  C SYNTR  + 
Sbjct  261   QFHIVAHKCPSCESYNTRQTRG  282



>ref|NP_001190396.1| CHY and CTCHY and RING-type zinc finger protein [Arabidopsis 
thaliana]
 gb|AED93464.1| CHY and CTCHY and RING-type zinc finger protein [Arabidopsis 
thaliana]
Length=318

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 189/290 (65%), Gaps = 12/290 (4%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHN  1035
             P ++N E    T   V  +  T    D G M +GC HYRRRC IRAPCCNEIF C HCH 
Sbjct  29    PHSINEESESSTLERVAAESLTNKVLDRGLMEYGCPHYRRRCCIRAPCCNEIFGCHHCHY  88

Query  1034  EAKSGLS-DPKERHELVRRDVKQ----------VICAVCNTEQQVAGICLNCGVKFGDYF  888
             EAK+ ++ D K+RH++ R  V+Q          VIC +C TEQ+V  IC++CGV  G YF
Sbjct  89    EAKNNINVDQKQRHDIPRHQVEQLTRPLSSSSQVICLLCGTEQEVGQICIHCGVCMGKYF  148

Query  887   CEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSY  708
             C++C+LYDDDT+K QYHC+ CGICRIGGRENFFHC KCG CYS+ L++ H CVE +M   
Sbjct  149   CKVCKLYDDDTSKKQYHCDGCGICRIGGRENFFHCYKCGCCYSILLKNGHPCVEGAMHHD  208

Query  707   CPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEE  528
             CPIC+EFLFES     ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE  + E
Sbjct  209   CPICFEFLFESRNDVTVLPCGHTIHQKCLEEMRDHYQYACPLCSKSVCDMSKVWEKFDME  268

Query  527   IQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             I  T MPE Y    V ILCNDC   +   +H++  KC +C SYNTR  + 
Sbjct  269   IAATPMPEPYQNRMVQILCNDCGKKAEVQYHVVAQKCPNCKSYNTRQTRG  318



>gb|KDO79668.1| hypothetical protein CISIN_1g021012mg [Citrus sinensis]
Length=316

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 187/252 (74%), Gaps = 4/252 (2%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC+HYRRRC+IRAPCCNEIF CRHCHNEA + ++ D K RH++ R +V QVIC++
Sbjct  67    GFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSL  126

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+   +C+NCGV  G+YFCE C+L+DDDT+K QYHC+ CGICRIGG +NFFHC KC
Sbjct  127   CGTEQK--QVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKC  184

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
               CYS+ L+++H CVE +M   CP+C E+LFE+ +  +++ CGHT+H +C +EM   +QY
Sbjct  185   RCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQY  244

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAIFHILGHKCK  417
              CPICSKSV +MS+ WE  + EI  T MPE Y   +V ILCNDC  TS   FH+L  KC 
Sbjct  245   ACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCP  304

Query  416   HCSSYNTRMVKA  381
             +C SYNTR+ + 
Sbjct  305   NCKSYNTRLTRG  316



>gb|KDP29187.1| hypothetical protein JCGZ_16576 [Jatropha curcas]
Length=293

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 184/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQ  969
             S  D G   FGC HYRRRCKIRAPCC+EIF CRHCHNE+K+ +  +  +RH++ R ++K+
Sbjct  23    STLDLGIGDFGCSHYRRRCKIRAPCCDEIFDCRHCHNESKNSMEVNLLDRHDVPRHEIKR  82

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             VIC++C TEQ V   C+ CGV  G YFC  C+ +DDD +K QYHC+EC ICR GG ENFF
Sbjct  83    VICSLCETEQDVQQHCIKCGVCMGKYFCSNCKFFDDDVSKQQYHCSECRICRTGGEENFF  142

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC KCG CYSV L+++H CVE +M   CP+C+EFLF++ K   ++ CGHT+H++C +EM 
Sbjct  143   HCNKCGCCYSVSLKESHNCVERAMHHNCPVCFEFLFDTTKDIAVLSCGHTIHLECVKEME  202

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHIL  432
                QY CP+C KS  +MSR WE L++E+ +T MP+ Y  + V ILCNDC  +S  IFHI+
Sbjct  203   RHFQYACPVCLKSYCDMSRVWEKLDQEVASTPMPQMYQNKMVWILCNDCGESSQVIFHII  262

Query  431   GHKCKHCSSYNTRMVKA  381
              HKC  C+SYNTR  + 
Sbjct  263   AHKCIKCNSYNTRQTRG  279



>ref|XP_006601111.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Glycine max]
 ref|XP_006601112.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X2 [Glycine max]
Length=308

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 188/279 (67%), Gaps = 3/279 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSG-EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCH  1038
             P   N+E      +    D + ++  ++ G M +GC+HYRRRC+IRAPCCNEIF CRHCH
Sbjct  30    PPESNVERLPGEESSQSTDHKNINDLQERGYMEYGCQHYRRRCRIRAPCCNEIFDCRHCH  89

Query  1037  NEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDD  861
             NEAK+ ++ D K RH++ R  VKQVIC++C TEQ+V   C+NCGV  G YFC  C+L+DD
Sbjct  90    NEAKNDINIDQKHRHDIPRHQVKQVICSLCGTEQEVQQNCINCGVCMGKYFCGTCKLFDD  149

Query  860   DTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLF  681
             D +K QYHC+ CGICR GG ENFFHC KCG CYS  L+++H CVE +M   CP+C+E+LF
Sbjct  150   DISKQQYHCSGCGICRTGGSENFFHCYKCGCCYSTLLKNSHPCVEGAMHHDCPVCFEYLF  209

Query  680   ESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEE  501
             ES     +M CGHT+H  C  EM    QY CP+C KSV +MS+ WE  + EI  T MPE+
Sbjct  210   ESRNDVTVMPCGHTIHKSCLNEMREHFQYSCPLCLKSVCDMSKVWEKFDIEIAATPMPEQ  269

Query  500   YFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             Y  + V ILCNDC  TS   FH +  KC +C SYNTR  
Sbjct  270   YQNKMVWILCNDCGKTSHVQFHFVAQKCPNCKSYNTRQT  308



>ref|XP_003603490.1| RING finger and CHY zinc finger domain-containing protein [Medicago 
truncatula]
 gb|AES73741.1| CHY and CTCHY and RING-type zinc finger protein [Medicago truncatula]
Length=309

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 189/285 (66%), Gaps = 6/285 (2%)
 Frame = -2

Query  1229  NTTTPPLAMNMEVGDVTPTGVQLDDQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTC  1050
             N  +    M+ E    +P   +++D      + G M +GC+HYRRRC IRAPCCNEIF C
Sbjct  29    NLPSNEERMHGEKSSQSPDHKKINDL----RERGYMEYGCQHYRRRCHIRAPCCNEIFDC  84

Query  1049  RHCHNEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICR  873
             RHCHNEAK+ +  D K RH++ R  VKQVIC++C TEQ+V   C+NCGV  G YFC  C+
Sbjct  85    RHCHNEAKNSIDIDQKHRHDIPRHQVKQVICSLCETEQEVQQNCINCGVCMGKYFCGTCK  144

Query  872   LYDDDTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICY  693
             L+DDD +K QYHC+ CGICR GG ENFFHC KCG CYS  L++ H CVE +M   CP+C+
Sbjct  145   LFDDDVSKQQYHCSGCGICRTGGSENFFHCYKCGCCYSTLLKNGHPCVEGAMHQDCPVCF  204

Query  692   EFLFESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTV  513
             E+LFES+    ++ CGHT+H  C  EM    QY CP+CSKSV +MS+ WE ++ E+  T 
Sbjct  205   EYLFESVNDVSVLHCGHTIHKSCLNEMREHFQYACPLCSKSVCDMSKVWEKIDLELAATP  264

Query  512   MPEEYFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMVKA  381
             MPE Y  + V ILCNDC   S   FH++  KC +C SYNTR  + 
Sbjct  265   MPEPYLNKTVWILCNDCGENSHVQFHLVAQKCLNCISYNTRQTRG  309



>gb|KHN12074.1| RING finger and CHY zinc finger domain-containing protein 1 [Glycine 
soja]
Length=308

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 188/279 (67%), Gaps = 3/279 (1%)
 Frame = -2

Query  1214  PLAMNMEVGDVTPTGVQLDDQTVSG-EDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCH  1038
             P   N+E      +    D + ++  ++ G M +GC+HYRRRC+IRAPCCNEIF CRHCH
Sbjct  30    PPESNVEHLPGEESSQSTDHKNINDLQERGYMEYGCQHYRRRCRIRAPCCNEIFDCRHCH  89

Query  1037  NEAKSGLS-DPKERHELVRRDVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDD  861
             NEAK+ ++ D K RH++ R  VKQVIC++C TEQ+V   C+NCGV  G YFC  C+L+DD
Sbjct  90    NEAKNDINIDQKHRHDIPRHQVKQVICSLCGTEQEVQQNCINCGVCMGKYFCGTCKLFDD  149

Query  860   DTTKDQYHCNECGICRIGGRENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLF  681
             D +K QYHC+ CGICR GG ENFFHC KCG CYS  L+++H CVE +M   CP+C+E+LF
Sbjct  150   DISKQQYHCSGCGICRTGGSENFFHCYKCGCCYSTLLKNSHPCVEGAMHHDCPVCFEYLF  209

Query  680   ESLKSTMIMKCGHTMHMDCYREMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEE  501
             ES     +M CGHT+H  C  EM    QY CP+C KSV +MS+ WE  + EI  T MPE+
Sbjct  210   ESRNDVTVMPCGHTIHKSCLNEMREHFQYSCPLCLKSVCDMSKVWEKFDIEIAATPMPEQ  269

Query  500   YFYE-VPILCNDCNNTSTAIFHILGHKCKHCSSYNTRMV  387
             Y  + V ILCNDC  TS   FH +  KC +C SYNTR  
Sbjct  270   YQNKMVWILCNDCGKTSHVQFHFVAQKCPNCKSYNTRQT  308



>ref|XP_006354386.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Solanum tuberosum]
Length=328

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 188/261 (72%), Gaps = 4/261 (2%)
 Frame = -2

Query  1157  DQTVSGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRR  981
             D++V+    G   +GC HYRRRCKIRAPCC+E+F CRHCHN++K+ L  DP +RH++ R 
Sbjct  57    DESVAEMASGN--YGCSHYRRRCKIRAPCCDELFDCRHCHNDSKNSLDVDPLKRHDIPRH  114

Query  980   DVKQVICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGR  801
             D+K+VIC++CNTEQ V   C+ CGV  G YFC  C  +DDD +K+QYHC++CGICR GG 
Sbjct  115   DIKRVICSLCNTEQDVQQKCIQCGVCMGKYFCSKCNFFDDDVSKNQYHCDKCGICRTGGE  174

Query  800   ENFFHCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCY  621
             ENFFHC  CG CY+  ++++H C+E +M   CP+C+E++F++ K+ +++ CGHTMH++C 
Sbjct  175   ENFFHCDTCGCCYTNSMKESHKCIERAMHHNCPVCFEYIFDTTKNIIVLPCGHTMHLECV  234

Query  620   REMVHQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYF-YEVPILCNDCNNTSTAI  444
              +M    QY CP+CS+S  +MSR WE L++E+ +T MPE Y   +V ILCNDC  TS   
Sbjct  235   MQMEQHFQYSCPVCSRSYCDMSRVWEQLDQEVASTAMPEMYQDKKVWILCNDCAETSEVN  294

Query  443   FHILGHKCKHCSSYNTRMVKA  381
             FHI+ HKC  C SYNTR  + 
Sbjct  295   FHIVAHKCPSCKSYNTRQTRG  315



>gb|ACG32069.1| RING finger and CHY zinc finger domain-containing protein 1 [Zea 
mays]
Length=300

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 182/249 (73%), Gaps = 2/249 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICAV  954
             G M +GC HYRRRC+IRAPCCNEIF CRHCHNE K+ +  D  +RHEL R +V+QV+C++
Sbjct  53    GIMHYGCPHYRRRCRIRAPCCNEIFDCRHCHNETKNSIKIDKMKRHELPRHEVQQVVCSL  112

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V  +C+NCGV  G YFC +C+L+DDD +K QYHCN CGICRIGGRENFFHC KC
Sbjct  113   CGTEQEVRQVCINCGVCMGKYFCGLCKLFDDDVSKQQYHCNGCGICRIGGRENFFHCSKC  172

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS+ L+++H CVE +M   CPIC+E+LF+S     ++ CGHT+H+ C +EM    Q+
Sbjct  173   GCCYSIALKNSHACVEGAMHHDCPICFEYLFDSTNDVSVLPCGHTIHVKCLKEMEEHCQF  232

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYEVPILCNDCNNTSTAIFHILGHKCKH  414
              CP+CSKSV +MS+ WE L+ E+ T     ++   V ILCNDC   S   FH++  KC++
Sbjct  233   ACPLCSKSVCDMSKAWERLDMELATLSDSCDHKM-VRILCNDCGAISDVQFHLIAXKCQN  291

Query  413   CSSYNTRMV  387
             C SYNTR +
Sbjct  292   CKSYNTRQI  300



>ref|XP_007161277.1| hypothetical protein PHAVU_001G056800g [Phaseolus vulgaris]
 ref|XP_007161278.1| hypothetical protein PHAVU_001G056800g [Phaseolus vulgaris]
 gb|ESW33271.1| hypothetical protein PHAVU_001G056800g [Phaseolus vulgaris]
 gb|ESW33272.1| hypothetical protein PHAVU_001G056800g [Phaseolus vulgaris]
Length=307

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 180/252 (71%), Gaps = 2/252 (1%)
 Frame = -2

Query  1136  DFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVIC  960
             D G M +GC+HYRRRC+IR+PCCNEIF CRHCHNEAK+ ++ D K+RH++ R  VKQVIC
Sbjct  56    DKGYMEYGCQHYRRRCRIRSPCCNEIFDCRHCHNEAKNDINIDQKDRHDIPRHQVKQVIC  115

Query  959   AVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQ  780
             ++C TEQ+V   C+NCGV  G YFC  C+L+DDD +K QYHC+ CGICR GG ENFFHC 
Sbjct  116   SLCGTEQEVQQNCINCGVCMGKYFCGTCKLFDDDISKQQYHCSGCGICRTGGSENFFHCY  175

Query  779   KCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQN  600
             KCG CYS  L+++H CVE +M   CP+C+E+LFES     +M CGHT+H  C  EM    
Sbjct  176   KCGCCYSTLLKNSHPCVERAMHHDCPVCFEYLFESRNDVTVMPCGHTIHKSCLNEMREHF  235

Query  599   QYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHK  423
             +Y CP+CS SV +MS+ WE  + EI  T MPE Y ++ V ILCNDC  TS   FH +G K
Sbjct  236   RYACPLCSASVCDMSKVWEKFDLEIAATPMPEPYQHKMVWILCNDCGKTSHVQFHFVGQK  295

Query  422   CKHCSSYNTRMV  387
             C +C SYNTR  
Sbjct  296   CLNCRSYNTRQT  307



>ref|XP_010031413.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1 isoform X1 [Eucalyptus grandis]
Length=304

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 182/252 (72%), Gaps = 2/252 (1%)
 Frame = -2

Query  1130  GKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGL-SDPKERHELVRRDVKQVICAV  954
             G +   C HYRRRCKIRAPCC+E+F CRHCHNEAK+ L + P +RH++ R +VKQVIC+ 
Sbjct  38    GAIFIRCAHYRRRCKIRAPCCDEVFDCRHCHNEAKNSLETAPLKRHDVPRHEVKQVICSS  97

Query  953   CNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQKC  774
             C TEQ+V   C NCGV  G YFC  C+ +DDD +K+QYHC+ECGICR GG+EN+FHC+KC
Sbjct  98    CGTEQEVQQNCQNCGVCMGKYFCAKCKFFDDDVSKNQYHCDECGICRTGGKENYFHCKKC  157

Query  773   GSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQY  594
             G CYS  +RD H CVE +M   CP+C+E+LF+++K   ++ CGHT+H++C +EM H  +Y
Sbjct  158   GCCYSKLMRDAHRCVERAMHHNCPVCFEYLFDTMKDITVLPCGHTIHLECVKEMEHHCRY  217

Query  593   RCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKCK  417
              CP+CSKS+ +MS  W  L++EI  T MPE Y  + V ILCNDC       FHI+ +KC 
Sbjct  218   SCPVCSKSICDMSNMWRRLDQEIAKTPMPEAYQNKMVWILCNDCGAQCEVQFHIVANKCT  277

Query  416   HCSSYNTRMVKA  381
              C SYNTR ++ 
Sbjct  278   SCESYNTRQMQG  289



>ref|XP_010918917.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X4 [Elaeis guineensis]
 ref|XP_010918918.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X4 [Elaeis guineensis]
Length=268

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 181/253 (72%), Gaps = 2/253 (1%)
 Frame = -2

Query  1133  FGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQVICA  957
              G   +GC HYRRRCKIRAPCC+EIF CRHCHNE K+ L  D +ERHE+ R +VK+VIC+
Sbjct  8     LGSGQYGCSHYRRRCKIRAPCCDEIFDCRHCHNEVKNSLEIDLRERHEIPRHEVKKVICS  67

Query  956   VCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFFHCQK  777
             +C+TEQ V   C NCGV  G YFC  C+ +DD+ +K+QYHC+ CGICR  G ENFFHC +
Sbjct  68    LCDTEQDVQQYCSNCGVCMGKYFCGKCKFFDDNVSKNQYHCDGCGICRTAGEENFFHCYR  127

Query  776   CGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMVHQNQ  597
             CG CYS  L+D+H CVE +M   CPIC+E+LFES K   ++ CGHT+H++C +EM    Q
Sbjct  128   CGCCYSTSLKDSHHCVERAMHHNCPICFEYLFESTKDISVLPCGHTIHLECLKEMRVHFQ  187

Query  596   YRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHILGHKC  420
             + CP+CS+SV NMS  W+ L++E+ +T MPE Y  + V ILCNDC   S   FHI+ HKC
Sbjct  188   FTCPVCSRSVCNMSGVWKKLDQEVASTPMPEMYQNKMVWILCNDCGMRSNVQFHIVAHKC  247

Query  419   KHCSSYNTRMVKA  381
               C+SYNTR  + 
Sbjct  248   PGCNSYNTRQTRG  260



>ref|XP_009775005.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009775006.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009775007.1| PREDICTED: RING finger and CHY zinc finger domain-containing 
protein 1-like isoform X1 [Nicotiana sylvestris]
Length=289

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 185/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  1145  SGEDFGKMLFGCEHYRRRCKIRAPCCNEIFTCRHCHNEAKSGLS-DPKERHELVRRDVKQ  969
             S  + G   FGC HYRRRCKIRAPCC+EIF CRHCHN++K+ L  DP +RH + R D+K+
Sbjct  19    SMTEMGSGNFGCSHYRRRCKIRAPCCDEIFDCRHCHNDSKNSLEVDPLKRHNVPRHDIKR  78

Query  968   VICAVCNTEQQVAGICLNCGVKFGDYFCEICRLYDDDTTKDQYHCNECGICRIGGRENFF  789
             VIC++CNTEQ V   C++CGV  G Y+C  C  +DDD +KDQYHC++CGICR GG  NFF
Sbjct  79    VICSLCNTEQDVQQTCVHCGVCMGKYYCSKCNFFDDDVSKDQYHCDKCGICRTGGNNNFF  138

Query  788   HCQKCGSCYSVGLRDNHLCVENSMKSYCPICYEFLFESLKSTMIMKCGHTMHMDCYREMV  609
             HC KC  CYS  ++++H+CVE +M   CP+C+E++F++ K+  ++ CGHTMH++C ++M 
Sbjct  139   HCNKCECCYSNLMKESHICVERAMHHNCPVCFEYVFDTTKNITVLPCGHTMHLECVKQME  198

Query  608   HQNQYRCPICSKSVLNMSRTWEILEEEIQTTVMPEEYFYE-VPILCNDCNNTSTAIFHIL  432
                QY CP+CS+S  +MSR WE L++E+ +T MPE Y  + V ILCNDC  TS   FHI+
Sbjct  199   QHFQYSCPVCSRSYCDMSRVWEKLDQEVASTPMPEMYQNKMVWILCNDCGETSEVNFHIV  258

Query  431   GHKCKHCSSYNTRMVKA  381
               KC +C SYNT+  + 
Sbjct  259   ARKCPNCKSYNTKQTRG  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3392847999056