BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20637_g2_i2 len=330 path=[1480:0-39 1518:40-190 1122:191-270
1202:271-329]

Length=330
                                                                      Score     E

ref|XP_009618711.1|  PREDICTED: clathrin light chain 1-like           41.2    6e-07   
ref|XP_010686544.1|  PREDICTED: clathrin light chain 2                40.4    9e-07   
ref|XP_004232846.1|  PREDICTED: clathrin light chain 1-like           40.8    1e-06   
ref|XP_009789677.1|  PREDICTED: clathrin light chain 1-like           41.2    3e-06   
ref|XP_006343246.1|  PREDICTED: clathrin light chain 1-like           40.4    4e-06   
ref|XP_004234124.1|  PREDICTED: clathrin light chain 1                40.0    5e-06   
ref|XP_011096250.1|  PREDICTED: clathrin light chain 2-like           38.5    9e-06   
ref|XP_006347068.1|  PREDICTED: clathrin light chain 1-like           40.4    1e-05   
ref|XP_003635272.1|  PREDICTED: clathrin light chain 1                44.3    1e-05   
emb|CDO99572.1|  unnamed protein product                              37.4    2e-05   
ref|XP_004301467.1|  PREDICTED: clathrin light chain 1-like           37.7    3e-05   
gb|EYU43413.1|  hypothetical protein MIMGU_mgv1a010222mg              38.1    4e-05   
gb|EYU27925.1|  hypothetical protein MIMGU_mgv1a010215mg              38.1    6e-05   
ref|XP_008229183.1|  PREDICTED: clathrin light chain 1                37.7    1e-04   
ref|XP_009342641.1|  PREDICTED: clathrin light chain 1-like           38.1    1e-04   
ref|XP_007217514.1|  hypothetical protein PRUPE_ppa024765mg           37.7    1e-04   
emb|CAN72815.1|  hypothetical protein VITISV_004099                   38.1    2e-04   Vitis vinifera
ref|XP_009765300.1|  PREDICTED: clathrin light chain 1-like           36.6    3e-04   
ref|XP_008349495.1|  PREDICTED: clathrin light chain 1-like           36.2    5e-04   
ref|XP_008342977.1|  PREDICTED: clathrin light chain 1-like           36.2    6e-04   
ref|XP_010100552.1|  Clathrin light chain 1                           34.7    0.001   



>ref|XP_009618711.1| PREDICTED: clathrin light chain 1-like [Nicotiana tomentosiformis]
Length=323

 Score = 41.2 bits (95),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFL  254
            LPPPNEM E GFALREWRR  +I L
Sbjct  112  LPPPNEMREEGFALREWRRQNAIRL  136


 Score = 38.5 bits (88),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNAIRLEEKEK+EKE RNQIIEEGEEYK++FYEKRKL +ETN++ N+EKEK YL NQEKF
Sbjct  131  QNAIRLEEKEKREKEIRNQIIEEGEEYKKAFYEKRKLTVETNQSTNREKEKLYLSNQEKF  190

Query  11   HKE  3
            HKE
Sbjct  191  HKE  193



>ref|XP_010686544.1| PREDICTED: clathrin light chain 2 [Beta vulgaris subsp. vulgaris]
Length=332

 Score = 40.4 bits (93),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWR  275
            LPPP++MHE GFALREWR
Sbjct  107  LPPPDQMHEEGFALREWR  124


 Score = 38.5 bits (88),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  KMQNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQE  18
            + QN++RLEEKEKKEKE R QIIEE EEYK +F+EKRKLN ETNK NN++KEK YL NQE
Sbjct  124  RHQNSLRLEEKEKKEKEMRMQIIEEAEEYKRAFFEKRKLNTETNKNNNRDKEKIYLTNQE  183

Query  17   KFHKE  3
            KFHKE
Sbjct  184  KFHKE  188



>ref|XP_004232846.1| PREDICTED: clathrin light chain 1-like [Solanum lycopersicum]
Length=329

 Score = 40.8 bits (94),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 17/19 (89%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPPNEM E GFALREWRR
Sbjct  116  LPPPNEMREEGFALREWRR  134


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  KMQNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQE  18
            + QNAIRLEEKEK+EKE R+QIIEEGEEYK++FYEKR L+IETNKT N+EKEK YL +QE
Sbjct  133  RRQNAIRLEEKEKREKEIRSQIIEEGEEYKKAFYEKRNLSIETNKTTNREKEKLYLTSQE  192

Query  17   KFHKE  3
            KFHKE
Sbjct  193  KFHKE  197



>ref|XP_009789677.1| PREDICTED: clathrin light chain 1-like [Nicotiana sylvestris]
Length=321

 Score = 41.2 bits (95),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFL  254
            LPPPNEM E GFALREWRR  +I L
Sbjct  110  LPPPNEMREEGFALREWRRLNAIRL  134


 Score = 36.2 bits (82),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            NAIRLEEKEK+EKE RNQIIEEGEEYK++FYEKRKL +ETN++ N+EKEK YL NQEKFH
Sbjct  130  NAIRLEEKEKREKEIRNQIIEEGEEYKKAFYEKRKLTVETNQSTNREKEKLYLSNQEKFH  189

Query  8    KE  3
            KE
Sbjct  190  KE  191



>ref|XP_006343246.1| PREDICTED: clathrin light chain 1-like [Solanum tuberosum]
Length=310

 Score = 40.4 bits (93),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNA+RLEE EK+EKE RNQIIEEGEE+K++FYEKRKLNIETNKTNN++KE  Y+ NQEKF
Sbjct  115  QNAVRLEENEKREKEIRNQIIEEGEEHKKAFYEKRKLNIETNKTNNRDKENVYVTNQEKF  174

Query  11   HKE  3
            HKE
Sbjct  175  HKE  177


 Score = 36.6 bits (83),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP+EM E G ALREWRR
Sbjct  96   LPPPSEMREEGLALREWRR  114



>ref|XP_004234124.1| PREDICTED: clathrin light chain 1 [Solanum lycopersicum]
Length=305

 Score = 40.0 bits (92),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNA+RLEE EK+EKE RNQIIEEGEE+K++FYEKRKLNIETNKTNN++KE  Y+ NQEKF
Sbjct  115  QNAVRLEENEKREKEIRNQIIEEGEEHKKAFYEKRKLNIETNKTNNRDKENVYVTNQEKF  174

Query  11   HKE  3
            HKE
Sbjct  175  HKE  177


 Score = 36.2 bits (82),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP+EM E G ALREWRR
Sbjct  96   LPPPSEMREEGLALREWRR  114



>ref|XP_011096250.1| PREDICTED: clathrin light chain 2-like [Sesamum indicum]
Length=350

 Score = 38.5 bits (88),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 45/65 (69%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  KMQNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQE  18
            + QNAIRLEEKEK+EKE RNQIIEE E YK++FYEKRKLN+ET+KTN +E+EK ++ +QE
Sbjct  159  RRQNAIRLEEKEKREKEMRNQIIEEAEAYKQAFYEKRKLNLETSKTNYREREKLFVASQE  218

Query  17   KFHKE  3
            KFH++
Sbjct  219  KFHED  223


 Score = 37.4 bits (85),  Expect(2) = 9e-06, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP+EM E GFA REWRR
Sbjct  142  LPPPSEMQEEGFAFREWRR  160



>ref|XP_006347068.1| PREDICTED: clathrin light chain 1-like [Solanum tuberosum]
Length=330

 Score = 40.4 bits (93),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 17/19 (89%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPPNEM E GFALREWRR
Sbjct  116  LPPPNEMREEGFALREWRR  134


 Score = 35.0 bits (79),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  KMQNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQE  18
            + QNAIRLEEKEK+EKE R QIIEEGEEYK++FYEKR L+IETNKT N+EKEK YL +QE
Sbjct  133  RRQNAIRLEEKEKREKEIRIQIIEEGEEYKKAFYEKRNLSIETNKTTNREKEKLYLTSQE  192

Query  17   KFHKE  3
            KFHKE
Sbjct  193  KFHKE  197



>ref|XP_003635272.1| PREDICTED: clathrin light chain 1 [Vitis vinifera]
Length=375

 Score = 44.3 bits (103),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = -2

Query  197  KMQNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQE  18
            + QNAI+LEEKEK+EKE RNQIIEE EEYK +FYEKRK+NIETNKTNN+E+EK YL NQE
Sbjct  154  RRQNAIQLEEKEKREKEMRNQIIEEAEEYKRAFYEKRKVNIETNKTNNREREKLYLANQE  213

Query  17   KFHKE  3
            KFHKE
Sbjct  214  KFHKE  218


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Composition-based stats.
 Identities = 15/20 (75%), Positives = 15/20 (75%), Gaps = 1/20 (5%)
 Frame = -3

Query  328  LPPPNEMH-EAGFALREWRR  272
            LPPP EM  E GF LREWRR
Sbjct  136  LPPPTEMQPEEGFILREWRR  155



>emb|CDO99572.1| unnamed protein product [Coffea canephora]
Length=341

 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFALREWRR
Sbjct  117  LPPPTEMQEEGFALREWRR  135


 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            NAIRLEEKEK+EKE RNQII EGEEYK++FYEKRK+NIETNK NN+EKEK  L +QEKFH
Sbjct  137  NAIRLEEKEKREKEIRNQIILEGEEYKQAFYEKRKVNIETNKNNNREKEKLCLASQEKFH  196

Query  8    KE  3
            KE
Sbjct  197  KE  198



>ref|XP_004301467.1| PREDICTED: clathrin light chain 1-like [Fragaria vesca subsp. 
vesca]
Length=367

 Score = 37.7 bits (86),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 47/62 (76%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            NAI LEEK K+EKE R+QIIEE EE+K +FYEKRKL  ETNKTN++EKEK YL NQEKFH
Sbjct  146  NAIHLEEKAKREKEMRSQIIEEAEEFKRAFYEKRKLTCETNKTNSREKEKHYLANQEKFH  205

Query  8    KE  3
            KE
Sbjct  206  KE  207


 Score = 36.2 bits (82),  Expect(2) = 3e-05, Method: Composition-based stats.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFLALKS  242
            LPPP +M E GFA REWRR  +I L  K+
Sbjct  126  LPPPEQMREEGFARREWRRLNAIHLEEKA  154



>gb|EYU43413.1| hypothetical protein MIMGU_mgv1a010222mg [Erythranthe guttata]
Length=318

 Score = 38.1 bits (87),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFL  254
            LPPP +M E GFALREWRR  +I L
Sbjct  104  LPPPGDMQEEGFALREWRRINAIRL  128


 Score = 35.4 bits (80),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            NAIRLEEKEKKEKE RNQI+EE EEYK++FYEKRKLN+ETNKTNN+EKEKS L +QEKFH
Sbjct  124  NAIRLEEKEKKEKEMRNQILEEAEEYKQAFYEKRKLNVETNKTNNREKEKSSLASQEKFH  183

Query  8    KE  3
            KE
Sbjct  184  KE  185



>gb|EYU27925.1| hypothetical protein MIMGU_mgv1a010215mg [Erythranthe guttata]
Length=319

 Score = 38.1 bits (87),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFL  254
            LPPP EM E GFA REWRR  +I L
Sbjct  110  LPPPTEMQEEGFAFREWRRQNTIRL  134


 Score = 34.7 bits (78),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QN IRLEEKEKKEKE RN+I+EE EEY ++FYEKR+LN+ETNKT+N+++EKSYL +QEKF
Sbjct  129  QNTIRLEEKEKKEKEMRNKILEEAEEYIKAFYEKRQLNLETNKTSNRDREKSYLSSQEKF  188

Query  11   HKE  3
            HKE
Sbjct  189  HKE  191



>ref|XP_008229183.1| PREDICTED: clathrin light chain 1 [Prunus mume]
Length=421

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            N I LEEKE++E+E RNQIIEE EE+K +FYEKRKLN ETNK +N+E+EK YL NQEKFH
Sbjct  167  NVIHLEEKEQREREMRNQIIEEAEEFKRAFYEKRKLNCETNKAHNREREKLYLVNQEKFH  226

Query  8    KE  3
            KE
Sbjct  227  KE  228


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFA REWRR
Sbjct  147  LPPPEEMREEGFARREWRR  165



>ref|XP_009342641.1| PREDICTED: clathrin light chain 1-like [Pyrus x bretschneideri]
Length=423

 Score = 38.1 bits (87),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            N I LEEKEK+E+E RNQIIEE EE+K +FYEKRKLN ETNK +N+E+EK YL NQEKFH
Sbjct  163  NVIHLEEKEKREREMRNQIIEEAEEFKRAFYEKRKLNCETNKAHNREREKLYLANQEKFH  222

Query  8    KE  3
            KE
Sbjct  223  KE  224


 Score = 33.9 bits (76),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFA REWRR
Sbjct  143  LPPPEEMREEGFARREWRR  161



>ref|XP_007217514.1| hypothetical protein PRUPE_ppa024765mg [Prunus persica]
 gb|EMJ18713.1| hypothetical protein PRUPE_ppa024765mg [Prunus persica]
Length=422

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            N I LEEKE++E+E RNQIIEE EE+K +FYEKRKLN ETN+ +N+E+EK YL NQEKFH
Sbjct  161  NVIHLEEKEQREREMRNQIIEEAEEFKRAFYEKRKLNCETNRAHNREREKLYLVNQEKFH  220

Query  8    KE  3
            KE
Sbjct  221  KE  222


 Score = 33.5 bits (75),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFA REWRR
Sbjct  141  LPPPEEMREEGFARREWRR  159



>emb|CAN72815.1| hypothetical protein VITISV_004099 [Vitis vinifera]
Length=322

 Score = 38.1 bits (87),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNAI+LEEKEK+EKE RNQIIEE EEYK +FYEKRK+NIETNKTNN+E+EK YL NQEKF
Sbjct  156  QNAIQLEEKEKREKEMRNQIIEEAEEYKRAFYEKRKVNIETNKTNNREREKLYLANQEKF  215

Query  11   HKE  3
            HKE
Sbjct  216  HKE  218


 Score = 32.3 bits (72),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 18/26 (69%), Gaps = 1/26 (4%)
 Frame = -3

Query  328  LPPPNEMH-EAGFALREWRR*ISIFL  254
            LPPP EM  E GF LREWRR  +I L
Sbjct  136  LPPPTEMQPEEGFILREWRRQNAIQL  161



>ref|XP_009765300.1| PREDICTED: clathrin light chain 1-like [Nicotiana sylvestris]
Length=288

 Score = 36.6 bits (83),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNAIRLEE E +EKE RNQIIEEGEE+K++FYEKRKLNIETNKTNN++KE  Y  NQEKF
Sbjct  89   QNAIRLEENENREKEIRNQIIEEGEEFKKAFYEKRKLNIETNKTNNRDKENLYSINQEKF  148

Query  11   HKE  3
            HKE
Sbjct  149  HKE  151


 Score = 33.9 bits (76),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR*ISIFL  254
            L PP EM E GFALR+WRR  +I L
Sbjct  70   LLPPTEMREEGFALRDWRRQNAIRL  94



>ref|XP_008349495.1| PREDICTED: clathrin light chain 1-like [Malus domestica]
Length=423

 Score = 36.2 bits (82),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            N I LEEKEK+E+E RN+IIEE EE+K +FYEKRKLN ETNK +N+E+EK YL NQEKFH
Sbjct  163  NVIHLEEKEKREREMRNRIIEEAEEFKRAFYEKRKLNCETNKAHNREREKLYLANQEKFH  222

Query  8    KE  3
            KE
Sbjct  223  KE  224


 Score = 33.5 bits (75),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFA REWRR
Sbjct  143  LPPPEEMREEGFARREWRR  161



>ref|XP_008342977.1| PREDICTED: clathrin light chain 1-like [Malus domestica]
Length=392

 Score = 36.2 bits (82),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  188  NAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKFH  9
            N I LEEKEK+E+E RN+IIEE EE+K +FYEKRKLN ETNK +N+E+EK YL NQEKFH
Sbjct  132  NVIHLEEKEKREREMRNRIIEEAEEFKRAFYEKRKLNCETNKAHNREREKLYLANQEKFH  191

Query  8    KE  3
            KE
Sbjct  192  KE  193


 Score = 33.5 bits (75),  Expect(2) = 6e-04, Method: Composition-based stats.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = -3

Query  328  LPPPNEMHEAGFALREWRR  272
            LPPP EM E GFA REWRR
Sbjct  112  LPPPEEMREEGFARREWRR  130



>ref|XP_010100552.1| Clathrin light chain 1 [Morus notabilis]
 gb|EXB82795.1| Clathrin light chain 1 [Morus notabilis]
Length=322

 Score = 34.7 bits (78),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = -2

Query  191  QNAIRLeekekkekETRNQIIeegeeykesfyeKRKLNIetnktnnkekeKSYLGNQEKF  12
            QNAI+LEEKEK EKE RN+IIEE EEY ++FYEKRKLN+ETNKTNN+EKEK YL NQEKF
Sbjct  132  QNAIQLEEKEKLEKEMRNKIIEEAEEYIQAFYEKRKLNVETNKTNNREKEKLYLANQEKF  191

Query  11   HKE  3
            HKE
Sbjct  192  HKE  194


 Score = 33.9 bits (76),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 1/20 (5%)
 Frame = -3

Query  328  LPPPNEMH-EAGFALREWRR  272
            LPPP EM  E GFALREWRR
Sbjct  112  LPPPTEMEAEEGFALREWRR  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688