BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20603_g1_i2 len=679 path=[3907:0-601 4509:602-678]

Length=679
                                                                      Score     E

ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    426   2e-141   
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    424   2e-140   
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    407   3e-139   
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    414   2e-136   
ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    412   6e-136   
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    406   2e-133   
emb|CDO97479.1|  unnamed protein product                                403   3e-133   
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    404   1e-132   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    402   2e-132   
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    402   2e-132   Medicago sativa subsp. x varia
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    403   3e-132   
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    402   6e-132   
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    402   7e-132   
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    402   7e-132   
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      401   8e-132   
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    401   9e-132   
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    401   1e-131   
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    401   2e-131   
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    400   3e-131   
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    400   4e-131   
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    400   4e-131   
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    399   6e-131   
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    399   7e-131   
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         398   1e-130   
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    398   1e-130   
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             398   2e-130   
ref|XP_002513707.1|  Beta-glucosidase, putative                         397   3e-130   Ricinus communis
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    396   6e-130   
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             396   8e-130   
emb|CDX81229.1|  BnaC09g06400D                                          396   9e-130   
ref|XP_002298197.2|  beta-glucosidase family protein                    396   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    396   1e-129   
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     396   1e-129   
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    395   1e-129   
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     395   2e-129   
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    395   3e-129   
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                395   3e-129   
gb|EPS65933.1|  hypothetical protein M569_08842                         394   3e-129   
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    394   4e-129   
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    394   5e-129   
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    394   5e-129   
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                394   5e-129   
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    394   6e-129   
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                394   6e-129   
ref|XP_002866623.1|  beta-xylosidase 4                                  394   1e-128   
ref|NP_201262.1|  beta-D-xylosidase 4                                   393   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             393   2e-128   
emb|CDY46812.1|  BnaC02g43200D                                          393   2e-128   
emb|CDY18705.1|  BnaA09g06900D                                          393   2e-128   
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                393   2e-128   
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    392   2e-128   
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    392   2e-128   
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    392   3e-128   
ref|XP_002303181.1|  beta-glucosidase family protein                    392   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             392   3e-128   
emb|CBI40687.3|  unnamed protein product                                391   5e-128   
ref|XP_007043027.1|  Beta-D-xylosidase 4                                392   6e-128   
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             391   6e-128   
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            391   7e-128   Raphanus sativus
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    391   8e-128   Vitis vinifera
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    391   8e-128   Vitis vinifera
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    391   8e-128   
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    391   1e-127   
emb|CDY56487.1|  BnaCnng30450D                                          390   2e-127   
emb|CDY51290.1|  BnaA06g23560D                                          390   2e-127   
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    390   2e-127   
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        389   3e-127   
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     390   4e-127   
emb|CDY31313.1|  BnaA02g34280D                                          389   5e-127   
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    389   6e-127   
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    389   7e-127   
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    389   1e-126   
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           388   2e-126   
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      388   2e-126   
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       377   2e-126   
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    386   3e-126   
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                387   4e-126   
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    387   4e-126   Medicago sativa subsp. x varia
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             387   5e-126   
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    385   9e-126   
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           370   1e-125   
emb|CDY52884.1|  BnaC06g27770D                                          370   2e-125   
dbj|BAJ89945.1|  predicted protein                                      377   2e-125   
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                384   3e-125   
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    384   3e-125   
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    384   5e-125   
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    383   7e-125   
emb|CDY35825.1|  BnaC09g37570D                                          384   7e-125   
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    378   9e-125   
ref|XP_002873418.1|  beta-xylosidase 3                                  382   2e-124   
ref|NP_001054038.1|  Os04g0640700                                       382   2e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     383   3e-124   
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                381   4e-124   
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     381   7e-124   
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    381   7e-124   
emb|CDX69892.1|  BnaA10g22410D                                          381   8e-124   
dbj|BAK01582.1|  predicted protein                                      379   8e-124   
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          380   1e-123   Sorghum bicolor [broomcorn]
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              380   1e-123   Populus tremula x Populus alba [gray poplar]
emb|CDY21595.1|  BnaC09g46970D                                          385   1e-123   
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     380   1e-123   
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    379   2e-123   
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             379   3e-123   
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          379   3e-123   
dbj|BAJ90420.1|  predicted protein                                      379   3e-123   
dbj|BAJ90315.1|  predicted protein                                      379   3e-123   
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    379   4e-123   Hordeum vulgare [barley]
ref|NP_196535.1|  beta-xylosidase 3                                     379   4e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          379   7e-123   
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                378   8e-123   
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    377   1e-122   
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                377   3e-122   
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                376   4e-122   
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           376   4e-122   
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              374   8e-122   Populus tremula x Populus alba [gray poplar]
emb|CDX96113.1|  BnaA07g26180D                                          381   1e-121   
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                375   1e-121   
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    373   5e-121   
emb|CDX97115.1|  BnaC09g45100D                                          371   6e-121   
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          371   3e-120   
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                371   5e-120   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                369   3e-119   
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                365   5e-118   
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                365   1e-117   
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                363   4e-117   
gb|EEE61783.1|  hypothetical protein OsJ_16354                          361   2e-116   Oryza sativa Japonica Group [Japonica rice]
emb|CDY67410.1|  BnaCnng54810D                                          352   1e-115   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             353   1e-113   
emb|CDY01780.1|  BnaC06g28200D                                          353   3e-113   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            353   3e-113   
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              353   4e-113   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             352   7e-113   
ref|XP_010094323.1|  Beta-D-xylosidase 1                                352   9e-113   
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     352   1e-112   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            351   2e-112   
gb|KHN26728.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           347   2e-112   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             350   4e-112   
ref|XP_002885319.1|  beta-1,4-xylosidase                                352   4e-112   
gb|KHN33504.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 1           347   5e-112   
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           350   7e-112   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     349   1e-111   
ref|NP_188596.1|  putative beta-D-xylosidase 5                          349   1e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    348   3e-111   
emb|CDY58860.1|  BnaCnng33860D                                          348   3e-111   
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             348   5e-111   
dbj|BAB02547.1|  beta-1,4-xylosidase                                    350   6e-111   Arabidopsis thaliana [mouse-ear cress]
dbj|BAO45878.1|  beta-D-xylosidase                                      347   6e-111   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     347   8e-111   
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           347   9e-111   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     346   1e-110   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            346   1e-110   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         346   2e-110   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                346   2e-110   
emb|CDY33913.1|  BnaA02g30740D                                          346   2e-110   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            346   3e-110   
emb|CDY05634.1|  BnaC02g39030D                                          345   3e-110   
ref|XP_002865732.1|  beta-xylosidase 1                                  345   3e-110   
ref|XP_003592512.1|  Xylosidase                                         345   3e-110   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            346   4e-110   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            345   4e-110   
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     345   4e-110   
gb|AAP83934.1|  auxin-induced beta-glucosidase                          345   5e-110   Oxybasis rubra [pigweed]
gb|KHN39204.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           342   5e-110   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            345   5e-110   
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             345   6e-110   
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                344   6e-110   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    344   7e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85405.1|  BnaC07g27160D                                          344   8e-110   
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    344   9e-110   Ricinus communis
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             344   1e-109   
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              344   1e-109   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    343   1e-109   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             343   2e-109   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     342   5e-109   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             342   5e-109   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                342   5e-109   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                342   6e-109   
ref|XP_004295104.1|  PREDICTED: beta-D-xylosidase 1-like                342   8e-109   
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       342   8e-109   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       342   9e-109   
dbj|BAG28345.1|  arabinofuranosidase                                    341   9e-109   Citrus unshiu [satsuma mandarin]
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              341   1e-108   
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              341   1e-108   
gb|AAS17751.2|  beta xylosidase                                         340   2e-108   Fragaria x ananassa
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              340   2e-108   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    342   2e-108   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                340   2e-108   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  342   3e-108   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                342   3e-108   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             340   5e-108   
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            339   6e-108   
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            339   6e-108   
emb|CDX89954.1|  BnaA10g01280D                                          339   7e-108   
ref|XP_002316021.1|  beta-D-xylosidase family protein                   339   8e-108   Populus trichocarpa [western balsam poplar]
ref|XP_003625957.1|  Beta-xylosidase                                    338   1e-107   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            342   1e-107   
ref|XP_002527511.1|  Beta-glucosidase, putative                         340   1e-107   Ricinus communis
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          338   1e-107   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     338   2e-107   
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              338   3e-107   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            337   3e-107   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            338   3e-107   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         337   3e-107   
dbj|BAF79669.1|  beta-D-xylosidase                                      337   3e-107   Pyrus pyrifolia [sha li]
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        337   4e-107   Pyrus pyrifolia [sha li]
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         338   4e-107   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              337   6e-107   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       337   7e-107   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               337   7e-107   
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              337   7e-107   
emb|CDP17081.1|  unnamed protein product                                333   1e-106   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       336   1e-106   
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          337   1e-106   
emb|CDY15255.1|  BnaC05g01340D                                          335   1e-106   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       336   2e-106   
ref|XP_007051080.1|  Beta-xylosidase 2                                  336   2e-106   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            335   3e-106   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                333   6e-106   
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                334   6e-106   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                334   6e-106   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    333   9e-106   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       333   9e-106   
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             333   1e-105   Populus trichocarpa [western balsam poplar]
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            331   1e-105   
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             333   1e-105   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     332   2e-105   
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            333   2e-105   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             333   2e-105   
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       332   3e-105   
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            332   3e-105   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            333   4e-105   
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            332   4e-105   
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            332   4e-105   
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          329   5e-105   
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         332   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             332   5e-105   
ref|NP_563659.1|  probable beta-D-xylosidase 2                          332   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            332   6e-105   
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            331   7e-105   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              332   7e-105   
ref|XP_003591420.1|  Beta xylosidase                                    331   7e-105   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            331   7e-105   
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            332   8e-105   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            331   8e-105   
ref|XP_002515300.1|  Beta-glucosidase, putative                         331   8e-105   Ricinus communis
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            331   8e-105   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            331   9e-105   
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            331   1e-104   
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       331   1e-104   
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             330   1e-104   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    331   2e-104   Zea mays [maize]
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    330   2e-104   Vitis vinifera
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       331   2e-104   
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    330   2e-104   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          330   2e-104   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              330   2e-104   
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                330   2e-104   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             330   4e-104   
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             329   4e-104   
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          329   5e-104   
ref|XP_002311398.2|  beta-D-xylosidase family protein                   328   7e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004289805.1|  PREDICTED: probable beta-D-xylosidase 5-like       332   7e-104   
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            328   1e-103   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            328   1e-103   
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             328   1e-103   
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       328   1e-103   
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       328   2e-103   
emb|CDY00033.1|  BnaC09g02680D                                          328   2e-103   
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         328   2e-103   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       327   2e-103   
emb|CDY49607.1|  BnaA09g03310D                                          328   2e-103   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    327   3e-103   
ref|XP_003594795.1|  Beta xylosidase                                    327   3e-103   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             327   4e-103   
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            327   4e-103   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            327   8e-103   
dbj|BAC98299.1|  LEXYL2                                                 322   8e-103   Solanum lycopersicum
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       326   8e-103   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            327   8e-103   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       326   9e-103   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   326   9e-103   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       326   1e-102   
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2-like       326   1e-102   
emb|CDO98788.1|  unnamed protein product                                325   1e-102   
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              325   1e-102   
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                326   1e-102   
emb|CBI22910.3|  unnamed protein product                                325   1e-102   
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              325   2e-102   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                325   2e-102   
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    324   3e-102   
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            325   5e-102   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          323   1e-101   
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             317   2e-99    
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             317   2e-99    
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            317   3e-99    
gb|KCW63062.1|  hypothetical protein EUGRSUZ_G006531                    312   7e-99    
emb|CDO97277.1|  unnamed protein product                                316   8e-99    
emb|CBI22460.3|  unnamed protein product                                317   2e-98    
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       300   3e-98    
emb|CAN82161.1|  hypothetical protein VITISV_035506                     317   5e-98    
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                310   1e-96    
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            306   2e-95    
emb|CBI40698.3|  unnamed protein product                                298   4e-95    
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             304   2e-94    
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            304   2e-94    
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  303   2e-94    
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            304   3e-94    
gb|KHN14659.1|  Beta-D-xylosidase 1                                     301   3e-94    
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7            303   5e-94    
gb|EPS60429.1|  hypothetical protein M569_14372                         302   1e-93    
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            302   1e-93    
emb|CAE03635.1|  OSJNBb0003B01.27                                       303   2e-93    
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              302   2e-93    
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            301   5e-93    
ref|XP_008661823.1|  PREDICTED: uncharacterized protein LOC100279...    297   5e-93    
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            299   1e-92    
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    299   2e-92    
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            294   2e-92    
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     294   4e-92    
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            299   8e-92    
gb|KCW63063.1|  hypothetical protein EUGRSUZ_G00654                     293   2e-91    
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             296   3e-91    
gb|AFW65093.1|  putative O-Glycosyl hydrolase superfamily protein       283   3e-91    
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             296   3e-91    
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    296   4e-91    
gb|KGN49379.1|  hypothetical protein Csa_6G522730                       291   4e-91    
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          295   7e-91    
ref|XP_009795794.1|  PREDICTED: probable beta-D-xylosidase 6            295   9e-91    
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             295   1e-90    
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            294   1e-90    
ref|XP_002299457.1|  hypothetical protein POPTR_0001s10850g             294   2e-90    
ref|NP_001068441.1|  Os11g0673200                                       295   2e-90    
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            294   2e-90    
emb|CDP02677.1|  unnamed protein product                                293   2e-90    
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            293   3e-90    
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    293   3e-90    
gb|AFI25186.1|  putative beta-D-xylosidase                              293   3e-90    
ref|XP_004512546.1|  PREDICTED: probable beta-D-xylosidase 6-like       293   4e-90    
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            293   5e-90    
ref|XP_010546936.1|  PREDICTED: probable beta-D-xylosidase 5 isof...    293   5e-90    
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             293   5e-90    
ref|XP_006663366.1|  PREDICTED: probable beta-D-xylosidase 6-like       288   6e-90    
emb|CBI25718.3|  unnamed protein product                                292   6e-90    
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            293   7e-90    
ref|XP_008439653.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    292   1e-89    
ref|XP_006357757.1|  PREDICTED: probable beta-D-xylosidase 6-like       291   2e-89    
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          291   2e-89    
ref|XP_010023414.1|  PREDICTED: probable beta-D-xylosidase 6            291   2e-89    
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            291   3e-89    
ref|XP_010527498.1|  PREDICTED: probable beta-D-xylosidase 6            291   3e-89    
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            291   3e-89    
gb|KDP42389.1|  hypothetical protein JCGZ_02446                         283   3e-89    
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          291   3e-89    
ref|XP_004134574.1|  PREDICTED: probable beta-D-xylosidase 2-like       291   3e-89    
gb|KDP43295.1|  hypothetical protein JCGZ_24216                         283   4e-89    
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             290   4e-89    
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            290   4e-89    
gb|KDP37939.1|  hypothetical protein JCGZ_04582                         291   5e-89    
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            290   6e-89    
ref|XP_003612944.1|  Beta-D-xylosidase                                  290   7e-89    
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    290   9e-89    
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like       290   9e-89    
ref|XP_011026855.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    285   9e-89    
ref|NP_177929.1|  putative beta-D-xylosidase 7                          289   1e-88    
ref|XP_002527212.1|  beta-glucosidase, putative                         277   1e-88    
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   284   1e-88    
ref|XP_011023042.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    289   2e-88    
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                288   2e-88    
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            288   2e-88    
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    288   2e-88    
ref|XP_004231972.1|  PREDICTED: probable beta-D-xylosidase 6            288   3e-88    
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       288   3e-88    
ref|XP_002309869.2|  hypothetical protein POPTR_0007s03380g             288   3e-88    
ref|XP_004288313.1|  PREDICTED: probable beta-D-xylosidase 6-like       288   3e-88    
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg             288   3e-88    
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                   288   3e-88    
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            288   3e-88    
ref|XP_011096573.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    288   4e-88    
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    295   4e-88    
emb|CDP01194.1|  unnamed protein product                                277   5e-88    
gb|EYU28191.1|  hypothetical protein MIMGU_mgv1a001867mg                286   5e-88    
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7-like       287   5e-88    
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             287   6e-88    
gb|KCW75948.1|  hypothetical protein EUGRSUZ_D00316                     286   7e-88    
gb|KDP32160.1|  hypothetical protein JCGZ_12621                         286   1e-87    
ref|XP_008245938.1|  PREDICTED: probable beta-D-xylosidase 5            286   1e-87    
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       286   2e-87    
gb|AES97966.2|  glycoside hydrolase family 3 protein                    286   2e-87    
ref|XP_006653619.1|  PREDICTED: probable beta-D-xylosidase 6-like       285   2e-87    
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             285   2e-87    
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            286   2e-87    
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            286   2e-87    
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            286   2e-87    
ref|XP_011026854.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    286   3e-87    
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            285   3e-87    
ref|XP_008383565.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    286   3e-87    
emb|CDX87482.1|  BnaA07g33910D                                          285   3e-87    
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            285   3e-87    
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            285   4e-87    
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            285   4e-87    
emb|CDP06334.1|  unnamed protein product                                285   4e-87    
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    281   4e-87    
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                   285   4e-87    
ref|XP_009387061.1|  PREDICTED: probable beta-D-xylosidase 2            285   5e-87    
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             285   5e-87    
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   285   5e-87    
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    284   5e-87    
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             285   6e-87    
ref|XP_009360864.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    285   6e-87    
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            285   6e-87    
ref|XP_004976326.1|  PREDICTED: probable beta-D-xylosidase 6-like       279   6e-87    
ref|XP_010105119.1|  putative beta-D-xylosidase 6                       285   7e-87    
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like       285   7e-87    
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            284   7e-87    
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             284   7e-87    
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg             285   8e-87    
ref|XP_007035962.1|  Glycosyl hydrolase family protein                  284   8e-87    
emb|CDP01027.1|  unnamed protein product                                291   8e-87    
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       284   9e-87    
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             284   1e-86    
ref|XP_010558471.1|  PREDICTED: probable beta-D-xylosidase 2            284   1e-86    
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            284   1e-86    
ref|XP_009391117.1|  PREDICTED: probable beta-D-xylosidase 7            284   1e-86    
ref|XP_010046160.1|  PREDICTED: probable beta-D-xylosidase 5            284   1e-86    
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    284   1e-86    
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       284   1e-86    
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       283   1e-86    
ref|XP_003576084.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    283   1e-86    
ref|XP_008371868.1|  PREDICTED: probable beta-D-xylosidase 7            283   1e-86    
gb|AAK38482.1|  beta-D-xylosidase                                       283   1e-86    
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         283   1e-86    
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             283   2e-86    
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            283   2e-86    
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            285   2e-86    
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    284   2e-86    
ref|NP_001067726.1|  Os11g0297800                                       283   2e-86    
ref|XP_007035975.1|  Glycosyl hydrolase family protein                  284   2e-86    
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            283   2e-86    
emb|CDX88410.1|  BnaC06g38540D                                          283   2e-86    
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                283   2e-86    
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              283   2e-86    
gb|AAX92971.1|  beta-D-xylosidase                                       283   3e-86    
ref|XP_008677748.1|  PREDICTED: uncharacterized protein LOC100502...    283   3e-86    
gb|EPS70883.1|  hypothetical protein M569_03875                         281   3e-86    
gb|EAY80660.1|  hypothetical protein OsI_35838                          282   3e-86    
ref|XP_009373165.1|  PREDICTED: probable beta-D-xylosidase 7            283   3e-86    
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                282   4e-86    
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    282   4e-86    
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             282   4e-86    
emb|CBK22068.2|  unnamed protein product                                280   5e-86    
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             282   6e-86    
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            282   6e-86    
ref|XP_003577440.1|  PREDICTED: probable beta-D-xylosidase 7            281   8e-86    
ref|XP_006369735.1|  glycosyl hydrolase family 3 family protein         281   9e-86    
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            281   9e-86    
ref|XP_010914748.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    282   9e-86    
gb|EPS73741.1|  hypothetical protein M569_01013                         281   9e-86    
dbj|BAC41913.1|  putative beta-xylosidase                               280   9e-86    
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    281   1e-85    
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         281   1e-85    
ref|XP_010914751.1|  PREDICTED: probable beta-D-xylosidase 2            281   1e-85    
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            281   1e-85    
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          281   1e-85    
ref|NP_196618.1|  putative beta-D-xylosidase 6                          280   2e-85    
gb|AFW65097.1|  putative O-Glycosyl hydrolase superfamily protein       271   2e-85    
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            280   3e-85    
ref|XP_008371585.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    280   3e-85    
ref|XP_002489310.1|  hypothetical protein SORBIDRAFT_0010s010920        280   3e-85    
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             280   3e-85    
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       280   4e-85    
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            280   4e-85    
ref|XP_008810094.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    280   4e-85    
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            280   4e-85    
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            280   4e-85    
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                279   6e-85    
ref|XP_008810091.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    280   6e-85    
emb|CBI19138.3|  unnamed protein product                                285   6e-85    
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                279   6e-85    
ref|XP_006850394.1|  hypothetical protein AMTR_s00184p00056440          280   6e-85    
gb|EYU33327.1|  hypothetical protein MIMGU_mgv1a001678mg                279   7e-85    
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g             279   7e-85    
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   279   1e-84    
ref|XP_003577615.1|  PREDICTED: probable beta-D-xylosidase 7            278   1e-84    
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       278   1e-84    
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            278   1e-84    
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                278   1e-84    
ref|NP_001067709.2|  Os11g0291000                                       278   1e-84    
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       278   1e-84    
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             279   1e-84    
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        285   1e-84    
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        285   1e-84    
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        285   1e-84    
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   279   1e-84    
gb|EMS60504.1|  putative beta-D-xylosidase 7                            280   2e-84    
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg                278   2e-84    
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       278   2e-84    
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       278   2e-84    
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  278   2e-84    
gb|EEC74020.1|  hypothetical protein OsI_08964                          278   2e-84    
ref|NP_001048140.1|  Os02g0752200                                       277   3e-84    



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   426 bits (1096),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/226 (88%), Positives = 209/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSYTGPGV FSG VPGATSFPQ +LTAASFNVTLF+TIGKVVSTEARAM+NV
Sbjct  108  WWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVSTEARAMYNV  167

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP L S+Y  AYV+GLQQ DDG+K KLKVAA
Sbjct  168  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQQTDDGSKDKLKVAA  227

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVVT+QDM+DTFQPPFK CVLEGNVASVMCSYNQVNGK
Sbjct  228  CCKHYTAYDVDNWKGIQRYNFNAVVTQQDMDDTFQPPFKSCVLEGNVASVMCSYNQVNGK  287

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLLAG+IRG+WNLNGYIVTDCDS N IFNSQHYTKTPEET
Sbjct  288  PTCGDPDLLAGIIRGEWNLNGYIVTDCDSLNEIFNSQHYTKTPEET  333



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   424 bits (1089),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 196/226 (87%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSYTGPGV FSG +P ATSFPQ +LTAASFNVTLF+TIGKVVSTEARAM+NV
Sbjct  105  WWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVSTEARAMYNV  164

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP L S+Y  AYV+GLQQ DDG+K KLKVAA
Sbjct  165  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQQTDDGSKDKLKVAA  224

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVVT+QDM+DTFQPPFK CVLEGNVASVMCSYNQVNGK
Sbjct  225  CCKHYTAYDVDNWKGIQRYNFNAVVTQQDMDDTFQPPFKSCVLEGNVASVMCSYNQVNGK  284

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLLAG+IRG+WNLNGYIVTDCDS N IFNSQHYTKTPEET
Sbjct  285  PTCGDPDLLAGIIRGEWNLNGYIVTDCDSLNEIFNSQHYTKTPEET  330



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   407 bits (1045),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 187/226 (83%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+SYTGPGVKF+G VPGATSFP  +LT+ASFN TLF+TIGK VSTEARAM+NV
Sbjct  100  WWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NI+RDPRWGRGQETPGEDP LAS+Y VAYVKGLQQRDDG K  LKVA+
Sbjct  160  GLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQQRDDGKKDMLKVAS  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RYNFNA VT+QD++DTF PPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDVDDWKGIQRYNFNAKVTQQDLDDTFNPPFKSCVVDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGDHDLLAGVIRG+W LNGYIVTDCDS N I+ +QHYTKTPEET
Sbjct  280  PTCGDHDLLAGVIRGQWKLNGYIVTDCDSLNEIYWAQHYTKTPEET  325



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/226 (84%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+SYTGPGVKF+G VPGATSFPQP+LT+ASFN TLF+TIGK VSTEARAM+NV
Sbjct  100  WWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NI+RDPRWGRGQETPGEDP LAS+Y VAYVKGLQQRDDG K  LKVA+
Sbjct  160  GLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQQRDDGKKDMLKVAS  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RYNFNA VT+QD++DTF PPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDVDDWKGIQRYNFNAKVTQQDLDDTFNPPFKSCVVDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGDHDLLAGVIRG+W LNGYIVTDCDS N I+ +QHYTKTPEET
Sbjct  280  PTCGDHDLLAGVIRGQWKLNGYIVTDCDSLNEIYWAQHYTKTPEET  325



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   412 bits (1059),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 188/226 (83%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+SYTGPGVKF+G VPGATSFPQP+LT+ASFN TLF+TIGK VSTEARAM+NV
Sbjct  99   WWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NI+RDPRWGRGQETPGEDP LAS+Y V YVKGLQQRDDG K  LKVA+
Sbjct  159  GLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVGYVKGLQQRDDGKKDMLKVAS  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RYNFNA VT+QD++DTF PPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDDWKGIQRYNFNAKVTQQDLDDTFNPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGDHDLLAGVIRG+W LNGYIVTDCDS N I+ +QHYTKTPEET
Sbjct  279  PTCGDHDLLAGVIRGQWKLNGYIVTDCDSLNEIYWAQHYTKTPEET  324



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/225 (84%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGV+YTGPGV FS  VPGATSFPQ +LTAASFNV+LFQTIGKVVSTEARAM+NV
Sbjct  130  WWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVVSTEARAMYNV  189

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP L S Y VAYVKGLQQ DDG+  KLKVAA
Sbjct  190  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSTYGVAYVKGLQQTDDGSTNKLKVAA  249

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QD++DTFQPPFK CVLEG+VASVMCSYNQVNGK
Sbjct  250  CCKHYTAYDVDNWKGIERYSFNAVVTQQDLDDTFQPPFKSCVLEGDVASVMCSYNQVNGK  309

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P CGD +LLAG+IRG+W LNGYIVTDCDS  VIF SQ+YTKTPEE
Sbjct  310  PTCGDPNLLAGIIRGEWKLNGYIVTDCDSLQVIFKSQNYTKTPEE  354



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSE LHGVS TGPGV F+  VPGATSFPQ +LTAASFN +LF+ IGKVVSTE RAM+NV
Sbjct  28   WWSEILHGVSNTGPGVHFTSLVPGATSFPQVILTAASFNKSLFEIIGKVVSTEGRAMYNV  87

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP L S YA A+V+GLQQRDDG+K +LKVA+
Sbjct  88   GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSNYAAAFVRGLQQRDDGDKDRLKVAS  147

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNA+VT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  148  CCKHYTAYDLDNWKGIQRYTFNALVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  207

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLL+G++RGKWNLNGYIVTDCDS +VIFN+QHYTKTPEET
Sbjct  208  PTCGDPDLLSGIVRGKWNLNGYIVTDCDSLDVIFNNQHYTKTPEET  253



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSYTGPG KF+ PVPGATSFPQ +LTA +FN +LF+ IGKVVSTEARAM+NV
Sbjct  92   WWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVSTEARAMYNV  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+Y  AYV+GLQQ DD N+++LKVAA
Sbjct  152  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGAAYVRGLQQTDDDNEERLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNA+VT+QD++DT+QPPFK CVLEGNVASVMCSYNQVNGK
Sbjct  212  CCKHYTAYDLDNWKGIQRYTFNALVTQQDLDDTYQPPFKSCVLEGNVASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLLAGVIRG+W LNGYIV+DCDS N +FNSQHYTKTPEET
Sbjct  272  PTCGDPDLLAGVIRGEWKLNGYIVSDCDSLNEMFNSQHYTKTPEET  317



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LFQ IG+VVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ DDG+K KLKVAA
Sbjct  157  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDKNKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVTKQDMEDTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  217  CCKHYTAYDVDNWKGVDRYHFNAVVTKQDMEDTFQPPFKSCVMDGNVASVMCSYNQVNGI  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V + +QHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKNQHYTKTPEE  321



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  +PGATSFP P+L AASFN +LFQTIGKVVSTEARAMHNV
Sbjct  98   WWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVSTEARAMHNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  158  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDGDSNKLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RY FNAVVT+QD++DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDDWKGVQRYTFNAVVTQQDLDDTYQPPFKSCVIDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS +V+F +QHYTKTPEE
Sbjct  278  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVDVLFKNQHYTKTPEE  322



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  115  WWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAMYNV  174

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQRDDG+  +LKVAA
Sbjct  175  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDRLKVAA  234

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVT QD+EDTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  235  CCKHYTAYDLDNWKGTDRYHFNAVVTPQDLEDTFQPPFKSCVIDGNVASVMCSYNQVNGK  294

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++NSQHYTK+PEE
Sbjct  295  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKSPEE  339



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   402 bits (1032),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  +PG+TSFP P+L AASFN +LFQTIGKVVSTEARAMHNV
Sbjct  98   WWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVSTEARAMHNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  158  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDGDSNKLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RY FNAVVT+QD++DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDDWKGVQRYTFNAVVTQQDLDDTYQPPFKSCVIDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS +V+F +QHYTKTPEE
Sbjct  278  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVDVLFKNQHYTKTPEE  322



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ DDG+K KLKVAA
Sbjct  157  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDKNKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  217  CCKHYTAYDIDNWKGVDRYHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V +N+QHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYNNQHYTKTPEE  321



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   402 bits (1032),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  106  WWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAMYNV  165

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQRDDG+  +LKVAA
Sbjct  166  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDRLKVAA  225

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVV+ QD+EDTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  226  CCKHYTAYDLDNWKGTDRYHFNAVVSPQDLEDTFQPPFKSCVIDGNVASVMCSYNQVNGK  285

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++NSQHYTK+PEE
Sbjct  286  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKSPEE  330



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   401 bits (1031),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGV+YTGPGV F+  VPGATSFPQ +LTAASFNVTLFQTIGKVVSTEARAM+NV
Sbjct  94   WWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKVVSTEARAMYNV  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP L S+Y VAYV+GLQQ DDG+  KLKVAA
Sbjct  154  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSKYGVAYVEGLQQTDDGSTNKLKVAA  213

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QD++DTFQPPF+ CVLEG VASVMCSYNQVNGK
Sbjct  214  CCKHYTAYDVDNWKGIERYSFNAVVRQQDLDDTFQPPFRSCVLEGAVASVMCSYNQVNGK  273

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P CGD +LLAG++RG+W LNGYIVTDCDS  VIF SQ+YTKTPEE
Sbjct  274  PTCGDPNLLAGIVRGEWKLNGYIVTDCDSLQVIFKSQNYTKTPEE  318



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   401 bits (1031),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +FS  VPG+TSFP P+L AASFN +LFQTIGKVVSTEARAMHNV
Sbjct  98   WWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVSTEARAMHNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  158  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDGDSNKLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   RY FNAVVT+QD++DT+QPPFK CV++GNVASVMCSYN+VNGK
Sbjct  218  CCKHYTAYDVDSWKGVQRYTFNAVVTQQDLDDTYQPPFKSCVIDGNVASVMCSYNKVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS +V+F SQHYTKTPEE
Sbjct  278  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVDVLFKSQHYTKTPEE  322



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+SYTGPGVKF+  VP ATSFPQP+LT+ASFN TLFQTIGKVVSTE RAM+NV
Sbjct  102  WWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVSTEGRAMYNV  161

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NI+RDPRWGRGQET GEDP L+S+Y VAYVKGLQQRDDG K  LKVA+
Sbjct  162  GQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSRYGVAYVKGLQQRDDGKKDMLKVAS  221

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVDDWK   RYNFNA VT+QD++DTF PPFK CVL+GNVASVMCSYNQVNGK
Sbjct  222  CCKHYTAYDVDDWKGIQRYNFNAKVTQQDLDDTFNPPFKSCVLDGNVASVMCSYNQVNGK  281

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD+DLLAGVIRG+W LNGYIVTDCDS N ++ +QHYTKTPEET
Sbjct  282  PTCGDYDLLAGVIRGQWKLNGYIVTDCDSLNEMYWAQHYTKTPEET  327



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  100  WWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLA LT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA +YV+GLQQ DDG   +LKVAA
Sbjct  160  GLAELTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASSYVRGLQQSDDGKTDRLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R++FNAVVT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDIDNWKGVDRFHFNAVVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG++RGKW LNGYIV+DCDS +V +NSQHYTKTPEE
Sbjct  280  PTCADPDLLAGIVRGKWKLNGYIVSDCDSVDVFYNSQHYTKTPEE  324



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   400 bits (1027),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ DDG+K KLKVAA
Sbjct  157  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDKNKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  217  CCKHYTAYDVDNWKGVDRYHFNAVVTKQDMDDTFQPPFKSCVMDGNVASVMCSYNQVNGI  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V + +QHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKNQHYTKTPEE  321



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   400 bits (1029),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 204/225 (91%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  133  WWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAMYNV  192

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQRDDG+  +LKVAA
Sbjct  193  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDRLKVAA  252

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVV+ QD+EDTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  253  CCKHYTAYDLDNWKGTDRYHFNAVVSPQDLEDTFQPPFKSCVIDGNVASVMCSYNQVNGK  312

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++NSQHYTK+PEE
Sbjct  313  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKSPEE  357



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   400 bits (1027),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  101  WWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQ+ DDGN  +LKVAA
Sbjct  161  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQKSDDGNADRLKVAA  220

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   R  FNAVVT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  221  CCKHYTAYDVDNWKGVNRLTFNAVVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  280

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG IRGKW LNGYIV+DCDS  V+++ QHYTKTPEE
Sbjct  281  PTCADPDLLAGTIRGKWKLNGYIVSDCDSVEVLYDKQHYTKTPEE  325



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   399 bits (1025),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+SYTGPGVKF+  VP ATSFPQP+LT+ASFN TLF+TIGKVVSTE RAM+NV
Sbjct  102  WWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVSTEGRAMYNV  161

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NI+RDPRWGRGQET GEDP L+S+Y VAYVKGLQQRDDG K  LKVA+
Sbjct  162  GQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSKYGVAYVKGLQQRDDGKKDMLKVAS  221

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+DDWK   RYNFNA VT+QD++DTF PPFK CVL+GNVASVMCSYNQVNGK
Sbjct  222  CCKHYTAYDIDDWKGIQRYNFNAKVTQQDLDDTFNPPFKSCVLDGNVASVMCSYNQVNGK  281

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD+DLLAGVIRG+W LNGYIVTDCDS N ++ +QHYTKTPEET
Sbjct  282  PTCGDYDLLAGVIRGQWKLNGYIVTDCDSLNEMYWAQHYTKTPEET  327



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   399 bits (1024),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 204/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFSG VPGATSFPQ +LTAA+FN +LF+ IGKVVSTEARAM+NV
Sbjct  92   WWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVSTEARAMYNV  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQET GEDP+L+S+Y  AYV+GLQ+RDDG+K +LKVAA
Sbjct  152  GLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLSSKYGAAYVRGLQERDDGDKDRLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNA+VT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  212  CCKHYTAYDVDNWKGIQRYNFNALVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLL GVIRG+W LNGYIVTDCDS N +F +Q YTKTPEET
Sbjct  272  PTCGDPDLLYGVIRGQWKLNGYIVTDCDSLNEMFYTQKYTKTPEET  317



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  94   WWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNV  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQRDDG+  KLKVAA
Sbjct  154  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQRDDGDSDKLKVAA  213

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  214  CCKHYTAYDLDNWKGTDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGK  273

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++NSQHYTKTPEE
Sbjct  274  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKTPEE  318



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LFQ IGKVVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQQ D G+  +LKVAA
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQQTDGGSPNRLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNA+VTKQD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDLDNWKGTDRYHFNAMVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++NSQHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKTPEE  321



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LFQ IGKVVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQQ D G+  +LKVAA
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQQTDGGSPNRLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNA+VTKQD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDLDNWKGTDRYHFNAMVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++NSQHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLYNSQHYTKTPEE  321



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   397 bits (1020),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  100  WWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ D+G+ ++LKVAA
Sbjct  160  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVRGLQQTDNGDSERLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDLDNWKGTDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG+IRG+W LNGYIV+DCDS +VI+NSQHYTKTPEE
Sbjct  280  PTCADPDLLAGIIRGEWKLNGYIVSDCDSVDVIYNSQHYTKTPEE  324



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   396 bits (1018),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDPVL+S+Y   YV+GLQQ DDG+K KLKVAA
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPVLSSKYGSGYVRGLQQTDDGDKNKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  217  CCKHYTAYDVDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V +  QHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKQQHYTKTPEE  321



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   396 bits (1018),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  103  WWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  163  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  223  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  283  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  327



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   396 bits (1018),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 180/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  159  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVV +QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVERYNFNAVVNQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  279  PTCADPDLLAGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  323



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF  IGKVVSTEARAM+NV
Sbjct  100  WWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDGN   LKVAA
Sbjct  160  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNPDGLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYN+VNG 
Sbjct  220  CCKHYTAYDLDNWKGVDRYHFNAVVTKQDMDDTFQPPFKSCVVDGNVASVMCSYNKVNGI  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIVTDCDS +V +NSQHYTKTPEE
Sbjct  280  PTCADPDLLSGVIRGEWKLNGYIVTDCDSIDVFYNSQHYTKTPEE  324



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/226 (80%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LFQ IGKVVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YV+GLQQ DDGN  +LKVAA
Sbjct  157  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPILASKYAAGYVQGLQQSDDGNPNRLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   RY+FNA V+KQD++DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDVDAWKGVDRYHFNAQVSKQDLDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D DLLAGVIRG+W LNGYIV+DCDS  V++N QHYTKTPEE 
Sbjct  277  PTCADPDLLAGVIRGEWQLNGYIVSDCDSVQVLYNDQHYTKTPEEA  322



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   396 bits (1017),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FSG VPGATSFPQ +LTAASFNVTLFQTIGKVVSTEARAM+NV
Sbjct  91   WWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVSTEARAMYNV  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA AYVKGLQ+ + GN   LKVAA
Sbjct  151  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAAYVKGLQEIEGGNPNSLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVV KQD++DT+QPPFK CV++GNVASVMCSYNQVNG 
Sbjct  211  CCKHYTAYDLDNWKGIERYSFNAVVNKQDLDDTYQPPFKSCVIDGNVASVMCSYNQVNGI  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GV+RG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  271  PTCADPDLLSGVVRGQWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  315



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   395 bits (1016),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGATSFP P+LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  100  WWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  160  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQTDDGDSNKLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVT+QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDLDNWKGIQRYTFNAVVTQQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRG+W LNGYIV+DCDS  V+F  QHYTKTPEE
Sbjct  280  PTCADPDLLKGVIRGEWKLNGYIVSDCDSVEVLFKDQHYTKTPEE  324



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  104  WWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  163

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  164  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRLKVAA  223

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  224  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  283

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  284  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  328



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   395 bits (1014),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGATSFP P+LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  100  WWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  160  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQTDDGDSNKLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVT+QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDLDNWKGIQRYTFNAVVTQQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G+IRG+W LNGYIV+DCDS  V+F  QHYTKTPEE
Sbjct  280  PTCADPDLLKGIIRGEWKLNGYIVSDCDSVEVLFKDQHYTKTPEE  324



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   395 bits (1014),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  95   WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  155  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDPNRLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  215  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  275  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  319



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   394 bits (1013),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSE LHGVSYTGPGV+F+  VPGATSFPQ +LT+ASFN +LF+ IGKVVSTEARAM+NV
Sbjct  81   WWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVSTEARAMYNV  140

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L S+Y VAYV+GLQ+RDDGNK+KLKVA+
Sbjct  141  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYGVAYVRGLQERDDGNKEKLKVAS  200

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNA+VT+QD++DTF PPFK CV++GNVASVMCSYNQVNGK
Sbjct  201  CCKHYTAYDLDNWKGIQRYSFNAIVTQQDLDDTFNPPFKSCVIDGNVASVMCSYNQVNGK  260

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CGD DLL+  IRG W LNGYIV+DCDS N +F SQHYTKTPEET
Sbjct  261  PACGDPDLLSATIRGTWKLNGYIVSDCDSLNEMFYSQHYTKTPEET  306



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   394 bits (1013),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVV +QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDNWKGVERYNFNAVVNQQDMDDTYQPPFKSCVIDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  322



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   394 bits (1012),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/223 (81%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  V GATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRD G+  KLKVAA
Sbjct  159  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQRDHGDPDKLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGSDRYHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL+GVIRGKWNLNGYIVTDCDS +V +NSQ+YTKTP
Sbjct  279  PTCADPDLLSGVIRGKWNLNGYIVTDCDSIDVFYNSQNYTKTP  321



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   394 bits (1013),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  100  WWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQET GEDP+L+S+YA  YV+GLQQ DDGN  +LKVAA
Sbjct  160  GLAGLTFWSPNVNIFRDPRWGRGQETRGEDPLLSSKYASGYVRGLQQSDDGNADRLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R++FNAVVT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDIDNWKGVDRFHFNAVVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG++RGKW LNGYIV+DCDS  V +N+QHYTKTPEE
Sbjct  280  PTCADPDLLAGIVRGKWKLNGYIVSDCDSVKVFYNTQHYTKTPEE  324



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   394 bits (1012),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  F+G VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  95   WWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  155  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  215  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  275  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  319



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   394 bits (1012),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ DDG+K KLKVAA
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDKNKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  217  CCKHYTAYDVDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V +  QHYTKTPEE
Sbjct  277  PTCADPDLLAGVIRGEWKLNGYIVTDCDSIDVYYKQQHYTKTPEE  321



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   394 bits (1011),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G +F+GPVP ATSFPQ +LT A+FN +LFQ IGKVVSTEARAM+NV
Sbjct  90   WWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKVVSTEARAMYNV  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L S+YA AYV+GLQ+R+DG+K +LKVAA
Sbjct  150  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYAAAYVRGLQEREDGDKSRLKVAA  209

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVVT+QDM+DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  210  CCKHYTAYDVDNWKGIQRYNFNAVVTQQDMDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  269

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P CGD DLLAGVIRG+W LNGYIV+DCDS N I  +QHYTKTPEE
Sbjct  270  PTCGDPDLLAGVIRGEWKLNGYIVSDCDSLNEILYAQHYTKTPEE  314



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  103  WWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  163  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  223  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  283  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  327



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  103  WWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  163  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVVT+QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  223  CCKHYTAYDVDNWKGVERYSFNAVVTQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  283  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  327



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGATSFP P+LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  99   WWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  159  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQQTDDGDSNKLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVT+QD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDLDNWKGVQRYTFNAVVTQQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G+IRGKW LNGYIV+DCDS  V+F  QHYTKTPEE
Sbjct  279  PTCADPDLLKGIIRGKWKLNGYIVSDCDSVQVLFKDQHYTKTPEE  323



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVV +QDM+DTFQPPFK CVL+GNVASVMCSYN+VNG 
Sbjct  218  CCKHYTAYDVDNWKGVERYTFNAVVNQQDMDDTFQPPFKSCVLDGNVASVMCSYNKVNGI  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  322



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  159  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVV +QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVERYNFNAVVNQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W L GYIV+DCDS +V++ +QHYTKTPEE
Sbjct  279  PTCADPDLLAGVIRGEWKLYGYIVSDCDSVDVLYKNQHYTKTPEE  323



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  159  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RYNFNAVV +QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVERYNFNAVVNQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W L GYIV+DCDS +V++ +QHYTKTPEE
Sbjct  279  PTCADPDLLAGVIRGEWKLYGYIVSDCDSVDVLYKNQHYTKTPEE  323



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  95   WWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVSTEARAMYNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQ DDG+  +LKVAA
Sbjct  155  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVQGLQQTDDGDPSRLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   RY+FNA VTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  215  CCKHYTAYDVDAWKGVDRYHFNAQVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGV+RG+W LNGYIV+DCDS +V++N+QHYTKTPEE
Sbjct  275  PTCADPDLLAGVVRGEWKLNGYIVSDCDSVDVLYNNQHYTKTPEE  319



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF  IGKVVSTEARAM+NV
Sbjct  100  WWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDGN   LKVAA
Sbjct  160  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNPDGLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+F+AVVTKQDM+DTFQPPFK CV++GNVASVMCSYN+VNG 
Sbjct  220  CCKHYTAYDLDNWKGVDRYHFDAVVTKQDMDDTFQPPFKSCVVDGNVASVMCSYNKVNGI  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIVTDCDS +V +N QHYTKTPEE
Sbjct  280  PTCADPDLLSGVIRGEWKLNGYIVTDCDSIDVFYNQQHYTKTPEE  324



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF  IGKVVSTEARAM+NV
Sbjct  100  WWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDGN   LKVAA
Sbjct  160  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNPDGLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+F+AVVTKQDM+DTFQPPFK CV++GNVASVMCSYN+VNG 
Sbjct  220  CCKHYTAYDLDNWKGVDRYHFDAVVTKQDMDDTFQPPFKSCVVDGNVASVMCSYNKVNGI  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIVTDCDS +V +N QHYTKTPEE
Sbjct  280  PTCADPDLLSGVIRGEWKLNGYIVTDCDSIDVFYNQQHYTKTPEE  324



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  V GATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  97   WWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDG+  KLKVAA
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQRDDGDPDKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDLDNWKGSDRYHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL+GVIRG+WNLNGYIVTDCDS +V + SQ+YTKTP
Sbjct  277  PTCADPDLLSGVIRGEWNLNGYIVTDCDSLDVFYKSQNYTKTP  319



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +FS  VPGATSFP P+LTAASFN +LF+TIG+ VSTEARAMHNV
Sbjct  97   WWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVSTEARAMHNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRG ETPGEDPVLAS+YA  YVKGLQQ D G+  +LKVAA
Sbjct  157  GLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLASKYAAGYVKGLQQTDGGDPNRLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVVTKQDMEDTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  217  CCKHYTAYDVDNWKGIQRYTFNAVVTKQDMEDTFQPPFKSCVIDGNVASVMCSYNKVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIR +W LNGYIV+DCDS  V++  QHYTKTPEE
Sbjct  277  PTCADPDLLKGVIRSEWKLNGYIVSDCDSVEVLYKDQHYTKTPEE  321



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   391 bits (1004),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  F+  VPGATSFPQ +LTAASFN +LF+ IGK VSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQ DDG+  +LKVAA
Sbjct  158  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGSPDRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R++FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDLDNWKGVDRFHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+G++RG+W LNGYIV+DCDS +V +NSQHYTKTPEE
Sbjct  278  PACADPDLLSGIVRGEWKLNGYIVSDCDSVDVFYNSQHYTKTPEE  322



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   392 bits (1006),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KFS  VPGATSFPQ +LTAASFN TLF+ IG+VVSTEARAM+NV
Sbjct  111  WWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTEARAMYNV  170

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L S+Y  +YVKGLQQ D G+  +LKVAA
Sbjct  171  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSKYGSSYVKGLQQSDGGDPSRLKVAA  230

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVT+QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  231  CCKHYTAYDLDNWKGVDRYHFNAVVTQQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  290

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGV+RG+W LNGYIV+DCDS  V + SQHYTKTPEE
Sbjct  291  PTCADPDLLAGVVRGQWKLNGYIVSDCDSVEVFYKSQHYTKTPEE  335



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   391 bits (1005),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  159  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDTGDANRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QDM+DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVDRYSFNAVVNQQDMDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTP E
Sbjct  279  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPAE  323



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D  +  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDSSDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QD++DT+QPPFK CV++GNVASVMCSYN+VNGK
Sbjct  218  CCKHYTAYDVDNWKGVERYSFNAVVNQQDLDDTYQPPFKSCVVDGNVASVMCSYNKVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  322



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   391 bits (1004),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  F+  VPGATSFPQ +LTAASFN +LF+ IGK VSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQ DDG+  +LKVAA
Sbjct  158  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGSPDRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R++FNAVVTKQDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDLDNWKGVDRFHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+G++RG+W LNGYIV+DCDS +V +NSQHYTKTPEE
Sbjct  278  PACADPDLLSGIVRGEWKLNGYIVSDCDSVDVFYNSQHYTKTPEE  322



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   391 bits (1004),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  F+  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA AYV+GLQQ DDG+  +LKVAA
Sbjct  158  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASAYVRGLQQGDDGSPDRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R +FNAVVTKQDM+DTFQPPFK CV++GNVASVMCS+NQVNGK
Sbjct  218  CCKHYTAYDLDNWKGVDRLHFNAVVTKQDMDDTFQPPFKSCVIDGNVASVMCSFNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+G++RG+W LNGYIV+DCDS +V +NSQHYTKTPEE
Sbjct  278  PTCADPDLLSGIVRGEWKLNGYIVSDCDSVDVFYNSQHYTKTPEE  322



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   391 bits (1004),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+S  GPG  FS  VPGATSFP P+LTAASFN +LFQ IG VVSTEARAM+NV
Sbjct  99   WWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  159  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQQTDDGDSNKLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVT+QD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  219  CCKHYTAYDLDNWKGVQRYTFNAVVTQQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS  V+F +QHYTKTPEE
Sbjct  279  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVEVLFKNQHYTKTPEE  323



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  103  WWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ D G+K KLKVAA
Sbjct  163  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDGGDKNKLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  223  CCKHYTAYDLDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIVTDCDS +V +N+QHYTKTPEE
Sbjct  283  PTCADPDLLAGVIRGEWKLNGYIVTDCDSLDVYYNTQHYTKTPEE  327



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  109  WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  168

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D  +  +LKVAA
Sbjct  169  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQETDSSDANRLKVAA  228

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QD++DT+QPPFK CV++GNVASVMCSYN+VNGK
Sbjct  229  CCKHYTAYDVDNWKGVERYSFNAVVNQQDLDDTYQPPFKSCVVDGNVASVMCSYNKVNGK  288

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  289  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  333



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D  +  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQETDSSDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QD++DT+QPPFK CV++GNVASVMCSYN+VNGK
Sbjct  218  CCKHYTAYDVDNWKGVERYSFNAVVNQQDLDDTYQPPFKSCVVDGNVASVMCSYNKVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  322



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/226 (78%), Positives = 195/226 (86%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +FS  +PGATSFP P+LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  89   WWSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVSTEARAMYNV  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRG ETPGEDPVL S+YA  YVKGLQQ D G+  KLKVAA
Sbjct  149  GLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDPNKLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVVTKQDMEDTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  209  CCKHYTAYDVDNWKGIQRYTFNAVVTKQDMEDTFQPPFKSCVIDGNVASVMCSYNKVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D DLL GV+RG+W LNGYIV+DCDS  V++  QHYTKTPEE 
Sbjct  269  PTCADPDLLKGVVRGEWKLNGYIVSDCDSVEVLYKDQHYTKTPEEA  314



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGATSFP P+LTAASFN +LFQ IG VVS EARAM+NV
Sbjct  99   WWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSNEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  159  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQQTDDGDSDKLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVV++QD++DTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  219  CCKHYTAYDVDNWKGVQRYTFDAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS  V+F  QHYTKTPEE
Sbjct  279  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVEVLFKDQHYTKTPEE  323



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   390 bits (1001),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  109  WWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  168

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D  +  +LKVAA
Sbjct  169  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATRYVKGLQETDSSDANRLKVAA  228

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY+FNAVV +QD++DT+QPPFK CV++GNVASVMCSYN+VNGK
Sbjct  229  CCKHYTAYDVDNWKGVERYSFNAVVNQQDLDDTYQPPFKSCVVDGNVASVMCSYNKVNGK  288

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  289  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  333



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ D G+  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVV +QDM+DT+QPPFK CV++GNVASV+CSYN+VNG 
Sbjct  218  CCKHYTAYDVDNWKGIERYTFNAVVNQQDMDDTYQPPFKSCVIDGNVASVLCSYNKVNGI  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  322



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Fragaria vesca subsp. vesca]
Length=799

 Score =   389 bits (1000),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  123  WWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTEARAMYNV  182

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L S Y   YV+GLQQ D  +K +LKVAA
Sbjct  183  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSNYGSGYVRGLQQTDSEDKSRLKVAA  242

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVTKQDM+DTFQPPFK CVL+GNVASVMCSYN+VNG 
Sbjct  243  CCKHYTAYDLDNWKGVDRYTFNAVVTKQDMDDTFQPPFKSCVLDGNVASVMCSYNKVNGT  302

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIVTDCDS +V + +QHYTKTPEE
Sbjct  303  PTCADPDLLSGVIRGEWKLNGYIVTDCDSIDVYYKNQHYTKTPEE  347



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   389 bits (998),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F+  VPGATSFPQ + TAASFN TLFQ IGKVVS EARAM+N 
Sbjct  101  WWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMYNT  160

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+Y  AYV+GLQQ DD +  KLKVAA
Sbjct  161  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSAYVRGLQQTDDADPNKLKVAA  220

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WKS  RY+FNA+V++QD++DT+QPPFK CV++GNVASVMCSYNQVNGK
Sbjct  221  CCKHYTAYDVDNWKSVDRYHFNALVSQQDLDDTYQPPFKSCVVDGNVASVMCSYNQVNGK  280

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIVTDCDS +V++N+QHYTKTPEE
Sbjct  281  PTCADTDLLSGVIRGEWKLNGYIVTDCDSIDVLYNNQHYTKTPEE  325



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  F+  VPGATSFPQ +LTAASFN TLF+TIGKV+STEARAMHNV
Sbjct  100  WWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVISTEARAMHNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  +V+GLQQ DDGN  +LKVAA
Sbjct  160  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGHVRGLQQSDDGNADRLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   R  FNAVVT+QD++DTFQPPFK CVL+GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDVDHWKGVDRLTFNAVVTQQDLDDTFQPPFKSCVLDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG+IRGKW LNGYIV+DCDS    +  QHYTKTPEE
Sbjct  280  PTCADPDLLAGIIRGKWKLNGYIVSDCDSVKEFYEKQHYTKTPEE  324



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+  VPGATSFPQ +LTAASFN +L++ IGKVVSTEARAM+NV
Sbjct  103  WWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+LAS+Y  +YVKGLQQ D G+  +LKVAA
Sbjct  163  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQQTDGGDPSRLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVVTKQD++DTFQPPFK CV++GNVASVMCSYN+VNG 
Sbjct  223  CCKHYTAYDVDNWKGIERYTFDAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGM  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAGVIRG+W LNGYIV+DCDS +V+F +QHYTKTPEE
Sbjct  283  PTCADPDLLAGVIRGQWKLNGYIVSDCDSVDVLFKNQHYTKTPEE  327



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  100  WWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVVSTEARAMYNV  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NI RDPRWGR QETPGEDP+L+S+YA  YV+GLQQ D G   +LKVAA
Sbjct  160  GLAGLTYWSPNVNIVRDPRWGRTQETPGEDPLLSSKYASGYVRGLQQTDGGGPNRLKVAA  219

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK + RY+FNAVV+KQD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  220  CCKHYTAYDLDNWKGYDRYHFNAVVSKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  279

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++NSQHYTK+PEE
Sbjct  280  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYNSQHYTKSPEE  324



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN TLF+ IG+VVS EARAMHNV
Sbjct  98   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEARAMHNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G    LKVAA
Sbjct  158  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQGAVSG-AGALKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDVDNWKGVERYTFDAVVSQQDLDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG W LNGYI +DCDS +V++N+QHYTKTPE+
Sbjct  277  PTCADKDLLSGVIRGDWKLNGYISSDCDSVDVLYNNQHYTKTPED  321



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   386 bits (992),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FSG VPGATSFPQ +LTAASFNV+LFQ IGK VSTEARAM+NV
Sbjct  91   WWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVSTEARAMYNV  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S++ VAYVKGLQ+ + G+  +LKVAA
Sbjct  151  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKFGVAYVKGLQETEGGDPNRLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R+ FNAVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGFHRFTFNAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GV+RG+W LNGYIV+DCDS  V++N+QHYTK PEE
Sbjct  271  PTCADPDLLSGVVRGQWKLNGYIVSDCDSVEVLYNNQHYTKPPEE  315



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQ+ +  +  +LKVAA
Sbjct  158  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETESSDANRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVV +QDM+DT+QPPFK CV++GNVASVMCSYN+VNG 
Sbjct  218  CCKHYTAYDVDNWKGIERYTFNAVVNQQDMDDTYQPPFKSCVIDGNVASVMCSYNKVNGI  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ +QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGEWKLNGYIVSDCDSVDVLYKNQHYTKTPEE  322



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGAT+FP P+LTAASFN +LFQ IG VVS EARAM+NV
Sbjct  98   WWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSNEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+YA  YVKGLQQ DDG+  KLKVAA
Sbjct  158  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQQTDDGDSDKLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVV++QD++DTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  218  CCKHYTAYDVDNWKGVQRYTFDAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GVIRGKW LNGYIV+DCDS  V++  QHYTKTPEE
Sbjct  278  PTCADPDLLKGVIRGKWKLNGYIVSDCDSVEVLYKDQHYTKTPEE  322



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 176/223 (79%), Positives = 198/223 (89%), Gaps = 0/223 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+  VPGATSFPQ +LTAASFN +LF+ IG+VVSTEARAM+NV
Sbjct  103  WWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEARAMYNV  162

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YV+GLQQ D G+K KLKVAA
Sbjct  163  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDGGDKNKLKVAA  222

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY+FNAVVTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  223  CCKHYTAYDLDNWKGVDRYHFNAVVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGI  282

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLLAGVIRG+W LNGYIVTDCDS +V +N+QHYTKTP
Sbjct  283  PTCADPDLLAGVIRGEWKLNGYIVTDCDSLDVYYNTQHYTKTP  325



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   385 bits (990),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 196/225 (87%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS+ GPG  FS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  97   WWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTEARAMHNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDPVLAS+YA  YVKGLQQ  D +  +LKVAA
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLASKYAAGYVKGLQQAKDPD--RLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY FNAVVTKQD++DTFQPPFK CV EGNVASVMCSYNQVNG 
Sbjct  215  CCKHYTAYDLDNWKGIQRYTFNAVVTKQDLDDTFQPPFKSCVTEGNVASVMCSYNQVNGV  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG IRG W LNGYIV+DCDS +V++N QHYTKTPE+
Sbjct  275  PTCADPDLLAGTIRGDWKLNGYIVSDCDSVDVLYNQQHYTKTPED  319



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   370 bits (949),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 189/225 (84%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G +FS  VPGATSFP P+LTAASFN +LF+ IG+VVSTEA AM+NV
Sbjct  71   WWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNV  130

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAG TYWSPNINIFRDPRWGRG ETPGEDPVL S+YA  YVKGLQQ D G+  KLKVAA
Sbjct  131  GLAGFTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDPSKLKVAA  190

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   RY FNAV+TKQD+EDTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  191  CCKHYTAYDVDKWKGIQRYTFNAVLTKQDLEDTFQPPFKSCVIDGNVASVMCSYNKVNGK  250

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL GV+RG+W LNGY+V  CDS  V++  QHYTKTPEE
Sbjct  251  PTCADPDLLKGVVRGEWKLNGYMVFHCDSVEVLYKYQHYTKTPEE  295



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   370 bits (950),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 191/220 (87%), Gaps = 0/220 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F+G VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+  +LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPF+ CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKDVNRYTFNSVVNQQDMDDTFQPPFRSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYT  661
            P C D DLL+GVIRG+W LNGYIV+DCDS  VI+ SQHYT
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYASQHYT  318



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   377 bits (968),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 193/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  95   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G      LKV
Sbjct  155  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGAGGVTDGALKV  214

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CVL+GNVASVMCSYN+VN
Sbjct  215  AACCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVLDGNVASVMCSYNKVN  274

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            GKP C D DLL GVIRG W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  275  GKPTCADKDLLEGVIRGDWKLNGYIVSDCDSVDVLYTQQHYTKTPEE  321



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN TLFQ IGKVVSTEARAMHNV
Sbjct  94   WWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTEARAMHNV  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YV+GLQ+ D+   +KLKVAA
Sbjct  154  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYATGYVRGLQEADE--PEKLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVV+KQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  212  CCKHYTAYDVDNWKGIERYTFNAVVSKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGV  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+G IRG W LNGYIV+DCDS N ++N QHYTKTPE+
Sbjct  272  PTCADPDLLSGTIRGDWKLNGYIVSDCDSVNELYNRQHYTKTPED  316



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQ +LTAASFN TLF+ IGKVVSTEARAMHNV
Sbjct  93   WWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVSTEARAMHNV  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDPVLAS+YA  YV+GLQ+ DD +  KLKVAA
Sbjct  153  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYATGYVRGLQEADDPD--KLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNA VTKQD++DTFQPPFK CV++GNVASVMCSYNQVNG 
Sbjct  211  CCKHYTAYDVDNWKGIERYTFNAKVTKQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNGV  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG +RG W LNGYIV+DCDS N +++ QHYTKTPE+
Sbjct  271  PTCADKDLLAGTVRGDWKLNGYIVSDCDSVNELYSRQHYTKTPED  315



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   384 bits (986),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+YA  YV+GLQQ DDGN  +LKVAA
Sbjct  161  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGNADRLKVAA  220

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD++DWK   RY+ N VVT+QD+EDTFQPPFK C+L+GNVA VMCSYNQVNGK
Sbjct  221  CCKHYTAYDIEDWKGVDRYHINTVVTQQDLEDTFQPPFKSCILDGNVACVMCSYNQVNGK  280

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D D LAG+IRGKW LNGYI +DCDS    +NSQ+YTKT EE
Sbjct  281  PTCADPDFLAGIIRGKWKLNGYIASDCDSVYEFYNSQNYTKTLEE  325



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   383 bits (984),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN TLF+TIGKVVSTEARAMHNV
Sbjct  96   WWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTEARAMHNV  155

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+LAS+YA  YVKGLQ+    N  +LKVAA
Sbjct  156  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQKAS--NPDRLKVAA  213

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   RY F+AVVTKQD++DTFQPPFK CV +GNVASVMCSYNQVNG 
Sbjct  214  CCKHYTAYDLDNWKGIQRYTFDAVVTKQDLDDTFQPPFKSCVTDGNVASVMCSYNQVNGV  273

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLLAG IRG W LNGYIV+DCDS +V++NSQHYTKTPE+
Sbjct  274  PTCADADLLAGTIRGDWKLNGYIVSDCDSVDVLYNSQHYTKTPED  318



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   384 bits (985),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F GPVPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+   LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVSRYTFNSVVNQQDMDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  V++ +QHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVMYANQHYTKTPEE  323



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 192/226 (85%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G +FS  VPGATSFP P+LTAASFN +LF+ IG+VVSTEA AM+NV
Sbjct  89   WWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNV  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPNINIFRDPRWGRG ETPGEDPVL S+YA  YVKGLQQ D G+  KLKVAA
Sbjct  149  GLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDPNKLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD WK   RY FNAV+TKQD+EDTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  209  CCKHYTAYDVDKWKGIQRYTFNAVLTKQDLEDTFQPPFKSCVIDGNVASVMCSYNKVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D DLL GV+RG+W LNGY+V+DCDS  V++  QHYTKTPEE 
Sbjct  269  PTCADPDLLKGVVRGEWKLNGYMVSDCDSVEVLYKYQHYTKTPEEA  314



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   382 bits (982),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  FSG VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYV+GLQ+ D G+  +LKVAA
Sbjct  158  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPELSSKYAVAYVRGLQETDGGDPNRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDNWKDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLYTKQHYTKTPEE  322



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   382 bits (980),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 197/225 (88%), Gaps = 1/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  89   WWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ    G    LKVAA
Sbjct  149  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDA-GGGSDALKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVV++QD++DTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  208  CCKHYTAYDVDNWKGVERYTFDAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG W LNGYIV+DCDS +V++N+QHYTK PE+
Sbjct  268  PTCADKDLLSGVIRGDWKLNGYIVSDCDSVDVLYNNQHYTKNPED  312



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   383 bits (984),  Expect = 3e-124, Method: Composition-based stats.
 Identities = 174/226 (77%), Positives = 195/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFNVTLF+ IG+VVS EARAMHNV
Sbjct  93   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHNV  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG-NKKKLKVA  358
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G     LKVA
Sbjct  153  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGAGGDSLKVA  212

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYDVD+WK   RY FNAVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNG
Sbjct  213  ACCKHYTAYDVDNWKGVERYTFNAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNG  272

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D DLL+GVIRG W LNGYI +DCDS +V++N+QHYTKTPE+
Sbjct  273  IPTCADKDLLSGVIRGDWKLNGYISSDCDSVDVLYNNQHYTKTPED  318



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   381 bits (979),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F GPVPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+W+PN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+   LKVAA
Sbjct  159  GAAGLTFWAPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVSRYTFNSVVNQQDMDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  V++ +QHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVMYANQHYTKTPEE  323



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FSG V GATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  158  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W    R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDNWTDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLYRDQHYTKTPEE  322



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FSG VPGATSFPQ +LTAASFNV+LFQ IGK VSTEARAM+NV
Sbjct  95   WWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVSTEARAMYNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L S+YAVAYVKGLQ+ D  +  +LKVAA
Sbjct  155  GQAGLTFWSPNVNIFRDPRWGRGQETPGEDPMLTSKYAVAYVKGLQEADGEDPNRLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK+  R  FNAVV +QDM+DTFQPPFK CV EGNVASVMCSYNQVNGK
Sbjct  215  CCKHYTAYDVDNWKNVNRLTFNAVVNQQDMDDTFQPPFKSCVTEGNVASVMCSYNQVNGK  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  V++  QHYTKTPEE
Sbjct  275  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVMYLKQHYTKTPEE  319



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   381 bits (978),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F GPVPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+   LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN++V +QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVSRYTFNSLVNQQDMDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DL++GVIRG+W LNGYIV+DCDS  V++ +QHYTKTPEE
Sbjct  279  PTCADPDLISGVIRGQWKLNGYIVSDCDSVEVMYANQHYTKTPEE  323



>dbj|BAK01582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=709

 Score =   379 bits (973),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 194/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  29   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  88

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ    G      LKV
Sbjct  89   GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAGGVTDGALKV  148

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CVL+GNVASVMCSYN+VN
Sbjct  149  AACCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVLDGNVASVMCSYNKVN  208

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            GKP C D DLL GVIRG W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  209  GKPTCADKDLLEGVIRGDWKLNGYIVSDCDSVDVLYTQQHYTKTPEE  255



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VP ATSFPQP+LTAASFN TLF+ IG+VVS EARAMHNV
Sbjct  92   WWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVSNEARAMHNV  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G+   LKVAA
Sbjct  152  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGS-GSLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FNAVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDVDNWKGVERYTFNAVVSQQDLDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG W LNGYI +DCDS +V++N+QHYTKTPE+
Sbjct  271  PTCADKDLLSGVIRGDWKLNGYISSDCDSVDVLYNNQHYTKTPED  315



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 199/232 (86%), Gaps = 7/232 (3%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKV----VSTEARA  169
            WWSEALHGVSY GPG  FS  VPGATSFPQ +LTAASFN +LF  IGKV    VSTEARA
Sbjct  100  WWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVISQVVSTEARA  159

Query  170  MHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKL  349
            M+NVGLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDGN   L
Sbjct  160  MYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNPDGL  219

Query  350  KVAACCKHYTAYDVDDWKSHVRYNFNA-VVTKQDMEDTFQPPFKKCVLEGNVASVMCSYN  526
            KVAACCKHYTAYD+D+WK   RY+FNA VVTKQDM+DTFQPPFK CV++GNVASVMCSYN
Sbjct  220  KVAACCKHYTAYDLDNWKGVDRYHFNAVVVTKQDMDDTFQPPFKSCVVDGNVASVMCSYN  279

Query  527  QVNGKPVCGDHDLLAGVIRGKWNLNG--YIVTDCDSFNVIFNSQHYTKTPEE  676
            +VNG P C D DLL+GVIRG+W LNG  YIVTDCDS +V +NSQHYTKTPEE
Sbjct  280  KVNGIPTCADPDLLSGVIRGEWKLNGYVYIVTDCDSIDVFYNSQHYTKTPEE  331



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F+GPVPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+   LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVHRYTFNSVVNQQDMDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  VI+ SQHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYASQHYTKTPEE  323



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 195/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFNVTLF+ IG+VVS EARAMHNV
Sbjct  93   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHNV  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG-NKKKLKVA  358
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G     LKVA
Sbjct  153  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGAGGDSLKVA  212

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYDVD+WK   RY FNAVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNG
Sbjct  213  ACCKHYTAYDVDNWKGVERYTFNAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNQVNG  272

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D DLL+GVIRG W LNGYI +DCDS +V++N+QHYTKTPE+
Sbjct  273  IPTCADKDLLSGVIRGDWKLNGYISSDCDSVDVLYNNQHYTKTPED  318



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Fragaria vesca subsp. vesca]
Length=774

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPG-VKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHN  178
            WWSEALHGVS  G G  KF+  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAM+N
Sbjct  97   WWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVSTEARAMYN  156

Query  179  VGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVA  358
            VGLAGLTYW+PNINIFRDPRWGRGQETPGEDP+L S Y   YV+GLQQ D  +K +LKVA
Sbjct  157  VGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQQTDSQDKNRLKVA  216

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D WK + RY FNAVVT+QDMEDTFQPP K CVLEGN ASVMCSY QVNG
Sbjct  217  ACCKHYTAYDLDHWKGYDRYTFNAVVTQQDMEDTFQPPLKSCVLEGNAASVMCSYQQVNG  276

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D DLL+GVIRG+WNLNGYIVTDCDS +V +N QHYTKTPEE
Sbjct  277  KPTCADPDLLSGVIRGEWNLNGYIVTDCDSIDVYYNYQHYTKTPEE  322



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   379 bits (974),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  FSG VPGATSFPQ +LTAASFNV+LF+ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  +  +  +LKVAA
Sbjct  158  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQDTEGEDPNRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W++  RY F+AVV +QDM+DTFQPPFK CV++GNVASVMCSYN+VNGK
Sbjct  218  CCKHYTAYDVDNWQNVQRYTFDAVVNQQDMDDTFQPPFKSCVVDGNVASVMCSYNKVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V++ SQHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVMYTSQHYTKTPEE  322



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FSG V GATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  113  WWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  172

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  173  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNRLKVAA  232

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W    R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  233  CCKHYTAYDVDNWTDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  292

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V+F  QHYTKTP E
Sbjct  293  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLFRDQHYTKTPGE  337



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 194/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  95   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ    G      LKV
Sbjct  155  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAGGVTDGALKV  214

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CVL+GNVASVMCSYN+VN
Sbjct  215  AACCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVLDGNVASVMCSYNKVN  274

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            GKP C D DLL GVIRG W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  275  GKPTCADKDLLEGVIRGDWKLNGYIVSDCDSVDVLYTQQHYTKTPEE  321



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 194/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  95   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ    G      LKV
Sbjct  155  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAGGVTDGALKV  214

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CVL+GNVASVMCSYN+VN
Sbjct  215  AACCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVLDGNVASVMCSYNKVN  274

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            GKP C D DLL GVIRG W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  275  GKPTCADKDLLEGVIRGDWKLNGYIVSDCDSVDVLYTQQHYTKTPEE  321



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   379 bits (973),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 194/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  97   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ    G      LKV
Sbjct  157  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAGGVTDGALKV  216

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CVL+GNVASVMCSYN+VN
Sbjct  217  AACCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVLDGNVASVMCSYNKVN  276

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            GKP C D DLL GVIRG W LNGYIV+DCDS +V++  QHYTKTPEE
Sbjct  277  GKPTCADKDLLEGVIRGDWKLNGYIVSDCDSVDVLYTQQHYTKTPEE  323



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   379 bits (973),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 197/225 (88%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G +F+G VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  93   WWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  153  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNRLKVAA  212

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W++  R  FNAVV +QD+ DTFQPPFK CV++G+VASVMCSYNQVNGK
Sbjct  213  CCKHYTAYDIDNWRNVNRLTFNAVVNQQDLADTFQPPFKSCVVDGHVASVMCSYNQVNGK  272

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V+F  QHY KTPEE
Sbjct  273  PTCADPDLLSGVIRGQWQLNGYIVSDCDSVDVLFRKQHYAKTPEE  317



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   379 bits (972),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FSG V GATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  113  WWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  172

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  173  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNRLKVAA  232

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W    R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  233  CCKHYTAYDVDNWTDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  292

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V+F  QHYTKTP E
Sbjct  293  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVLFRDQHYTKTPGE  337



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   378 bits (971),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  FSG + GATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  158  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W    R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDNWTDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS +V + +QHYTKTP E
Sbjct  278  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVDVFYTNQHYTKTPGE  322



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   377 bits (969),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 195/225 (87%), Gaps = 1/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN TLF+ IG+VVS EARAMHNV
Sbjct  98   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEARAMHNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L S+YAV YV GLQ    G    LKVAA
Sbjct  158  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQGAVSG-AGALKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+AVV++QD++DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDVDNWKGVERYTFDAVVSQQDLDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG W LNGYI +DCDS +V++N+QHYTKTPE+
Sbjct  277  PTCADKDLLSGVIRGDWKLNGYISSDCDSVDVLYNNQHYTKTPED  321



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVS EARAMHNV
Sbjct  96   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSNEARAMHNV  155

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ         LKVAA
Sbjct  156  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASRYAVGYVSGLQDAGADADGPLKVAA  215

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY F+A V++QD++DTFQPPFK CV++G VASVMCSYN+VNGK
Sbjct  216  CCKHYTAYDVDNWKGVERYTFDAKVSQQDLDDTFQPPFKSCVIDGKVASVMCSYNKVNGK  275

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG W LNGYIV+DCDS +V+++ QHYTKTPEE
Sbjct  276  PTCADKDLLSGVIRGDWKLNGYIVSDCDSVDVLYSQQHYTKTPEE  320



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F+G VPGATSFPQ  LTAASFN +LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+  +LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPF+ CV++GNVA VMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKDVSRYTFNSVVNQQDMDDTFQPPFRSCVVDGNVARVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  VI+ +QHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYANQHYTKTPEE  323



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/226 (77%), Positives = 196/226 (87%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  FS  VPGATSFPQ +LTAASFN +LF+ IGKVVSTEARAM+NV
Sbjct  97   WWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNV  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD-GNKKKLKVA  358
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+S+Y  +YVKGLQQ DD  +  +LKVA
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSSYVKGLQQPDDNADPSRLKVA  216

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+WK   RY+FNAVVT+QDM+DTF PPFK CV++GNVASVMCSYNQVNG
Sbjct  217  ACCKHYTAYDLDNWKGVDRYHFNAVVTQQDMDDTFDPPFKSCVVDGNVASVMCSYNQVNG  276

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D  LLAGVIRG+W LNGYIV+DCDS  V F+ QHYTKTPE+
Sbjct  277  KPTCADPHLLAGVIRGQWKLNGYIVSDCDSVEVFFDDQHYTKTPEQ  322



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   374 bits (959),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 179/236 (76%), Positives = 199/236 (84%), Gaps = 13/236 (6%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKV-----VSTEAR  166
            WWSEALHGVSY GPG  FS  V GATSFPQ +LTAASFN +LF+ IGKV     VSTEAR
Sbjct  98   WWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYTQVVSTEAR  157

Query  167  AMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKK  346
            AM+NVGLAGLT+WSPNINIFRDPRWGRGQETPGEDP+L+S+Y   YVKGLQQRDDG+  K
Sbjct  158  AMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQRDDGDPDK  217

Query  347  LKVAACCKHYTAYDVDDWKSHVRYNFNA-VVTKQDMEDTFQPPFKKCVLEGNVASVMCSY  523
            LKVAACCKHYTAYD+D+WK   RY+FNA VVTKQDM+DTFQPPFK CV++GNVASVMCSY
Sbjct  218  LKVAACCKHYTAYDLDNWKGSDRYHFNAVVVTKQDMDDTFQPPFKSCVIDGNVASVMCSY  277

Query  524  NQVNGKPVCGDHDLLAGVIRGKWNLNG-------YIVTDCDSFNVIFNSQHYTKTP  670
            NQVNGKP C D DLL+GVIRG+WNLNG       YIVTDCDS +V + SQ+YTKTP
Sbjct  278  NQVNGKPTCADPDLLSGVIRGEWNLNGYQWGCCRYIVTDCDSLDVFYKSQNYTKTP  333



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F+G VPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+  +LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPF+ CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKDVSRYTFNSVVNQQDMDDTFQPPFRSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  VI+ +QHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYANQHYTKTPEE  323


 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = +2

Query  344  KLKVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSY  523
            +LKVAACCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPF+ CV++GNVASVMCSY
Sbjct  452  RLKVAACCKHYTAYDVDNWKDVSRYTFNSVVNQQDMDDTFQPPFRSCVVDGNVASVMCSY  511

Query  524  NQVNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NQVNGKP C D DLL+GVIRG+W LNGYIV+DCDS  VI+ +QHYTKTPEE
Sbjct  512  NQVNGKPTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYANQHYTKTPEE  562



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG+VVSTEARAMHNV
Sbjct  93   WWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHNV  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLT+WSPNINIFRDPRWGRGQETPGEDP+LAS+YAV YV GLQ     G    LKVA
Sbjct  153  GLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGGGGGGGALKVA  212

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYDVD+WK   RY F+AVV++QD++DT+QPPFK CV++GNVASVMCSYN+VNG
Sbjct  213  ACCKHYTAYDVDNWKGVERYTFDAVVSQQDLDDTYQPPFKSCVIDGNVASVMCSYNKVNG  272

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D DLL+GVIRG W LNGYIV+DCDS +V++N+QHYTK PE+
Sbjct  273  KPTCADKDLLSGVIRGDWKLNGYIVSDCDSVDVLYNNQHYTKNPED  318



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   373 bits (958),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG KFS P+P AT FPQ +LTA++FN +LF+TI KVVSTEARAM+N 
Sbjct  92   WWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVSTEARAMYNA  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT++SPNINIFRDPRWGRGQETPGEDP+L+S Y  AYV+GLQ+ DDG++++LKVA 
Sbjct  152  GLAGLTFFSPNINIFRDPRWGRGQETPGEDPLLSSNYGAAYVRGLQRTDDGDEERLKVAG  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHY AYD+D+WK   RY+FNAVVT+QD+EDT+ PPFK CVL G+ ASVMCSYNQVNGK
Sbjct  212  CCKHYIAYDLDNWKGIQRYSFNAVVTQQDLEDTYMPPFKSCVLYGDPASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P CG+ +LL GV+RG+W LNGYIV+D DS N +FNSQHYTKTPEET
Sbjct  272  PTCGNPELLVGVVRGQWKLNGYIVSDFDSLNEMFNSQHYTKTPEET  317



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   371 bits (952),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 173/225 (77%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F GPVPGATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+   LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+      M+DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVSRYTFNSKTENIYMDDTFQPPFKSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNGYIV+DCDS  VI+ +QHYTKTPEE
Sbjct  279  PTCADPDLLSGVIRGQWKLNGYIVSDCDSVEVIYANQHYTKTPEE  323



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY GPG  FSG VPGATSFPQ + + ASFN +L++ IGKVVSTEARAM+NV
Sbjct  91   WWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVSTEARAMYNV  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPNINIFRDPRWGRGQET GEDP+L S+YAV YVKGLQ  DDG+  +LKVAA
Sbjct  151  GLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLTSKYAVGYVKGLQSSDDGDPNRLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+WK   R++FNA VTKQDM+DTFQPPFK CV++G VASVMCSYNQVNG 
Sbjct  211  CCKHYTAYDLDNWKGVDRFHFNAKVTKQDMDDTFQPPFKSCVIDGQVASVMCSYNQVNGI  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LLAG +RG+WNLNGYIV+DCDS  V+++ Q YTKTPE+
Sbjct  271  PTCADPNLLAGTVRGEWNLNGYIVSDCDSVEVLYDKQRYTKTPED  315



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   371 bits (952),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 193/226 (85%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKF-SGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHN  178
            WWSEALHG+   GPGV F    VP ATSFPQ +LTAASFNV+LF  IGK VSTEARAMHN
Sbjct  94   WWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMHN  153

Query  179  VGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVA  358
            VG AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+ QYAVAYVK LQQRDDG++ +LKVA
Sbjct  154  VGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQQRDDGDQTRLKVA  213

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D WK   R  F+A VT+QD++DT+QPPFK CVL+GNVASVMCSYNQVNG
Sbjct  214  ACCKHYTAYDLDHWKGFDRLTFDAQVTQQDLDDTYQPPFKSCVLDGNVASVMCSYNQVNG  273

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP CG+ +LL GVIRGKW LNGYIV+DCDS  V+FN+QHY  +PEE
Sbjct  274  KPTCGNPELLNGVIRGKWKLNGYIVSDCDSVAVLFNNQHYKSSPEE  319



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WW+EALHGVS+ GP  +FS  VP AT FPQ +LTAASFNV+LF+ IGK VSTEARAM+NV
Sbjct  96   WWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYNV  155

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKV A
Sbjct  156  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNRLKVGA  215

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH TAYD++ WK   RY FNAVVT+QD++DT+ PPFK CV++GNVA +MCSYNQVNGK
Sbjct  216  CCKHSTAYDLEKWKGVSRYTFNAVVTQQDLDDTYNPPFKSCVIDGNVACIMCSYNQVNGK  275

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL+G+IRG+W LNGYIV+DCDS  +++ +QHYTKTPEE
Sbjct  276  PTCADPGLLSGLIRGQWKLNGYIVSDCDSLGILYGAQHYTKTPEE  320



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 193/226 (85%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFS-GPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHN  178
            WWSEALHG+   GPG KF    V  ATSFPQ +LTAASFNV+LF  IGK +STEARAMHN
Sbjct  98   WWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGKAISTEARAMHN  157

Query  179  VGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVA  358
            VG AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+SQYAVAYVK LQQRDDG++ +LKVA
Sbjct  158  VGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSQYAVAYVKALQQRDDGDQTRLKVA  217

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD++ WK   R+ F+A VT+QD++DT+QPPFK CVL+GNVASVMCSYNQVNG
Sbjct  218  ACCKHYTAYDLEHWKEFDRFTFDAQVTQQDLDDTYQPPFKSCVLDGNVASVMCSYNQVNG  277

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP CG+ +LL GV+RG+W LNGYIV+DCDS  V+FN QHY  +PEE
Sbjct  278  KPSCGNPELLNGVVRGQWKLNGYIVSDCDSVEVLFNHQHYKNSPEE  323



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 190/225 (84%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WW+EALHGVS+ GP  +F+  VP AT FPQ +LTAASFNV+LF+ IGK VSTEARAM+NV
Sbjct  96   WWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYNV  155

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D GN  +LKVAA
Sbjct  156  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDSGNPNRLKVAA  215

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH TAYD++ WK   RY FNAVVT+QD++DT+  PFK CV +G VA +MCSYNQVNGK
Sbjct  216  CCKHSTAYDLEKWKGVSRYTFNAVVTQQDLDDTYNAPFKSCVTDGKVACIMCSYNQVNGK  275

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL+G+IRG+W LNGYIV+DCDS  +++ +QHYTKTPEE
Sbjct  276  PTCADPGLLSGLIRGQWKLNGYIVSDCDSLGILYGAQHYTKTPEE  320



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   363 bits (932),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 191/226 (85%), Gaps = 4/226 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKF-SGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHN  178
            WWSEALHG+   GPGV F    VP ATSFPQ +LTAASFNV+LF  IGK VSTEARAMHN
Sbjct  94   WWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMHN  153

Query  179  VGLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVA  358
            VG AGLT+WSPN+NIFRDPRWGRGQETPGEDP+L+ QYAVAYVK LQQRDDG++ +LKVA
Sbjct  154  VGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQQRDDGDQTRLKVA  213

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D WK   R  F+A   +QD++DT+QPPFK CVL+GNVASVMCSYNQVNG
Sbjct  214  ACCKHYTAYDLDHWKGFDRLTFDA---QQDLDDTYQPPFKSCVLDGNVASVMCSYNQVNG  270

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP CG+ +LL GVIRGKW LNGYIV+DCDS  V+FN+QHY  +PEE
Sbjct  271  KPTCGNPELLNGVIRGKWKLNGYIVSDCDSVAVLFNNQHYKSSPEE  316



>gb|EEE61783.1| hypothetical protein OsJ_16354 [Oryza sativa Japonica Group]
Length=771

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/267 (65%), Positives = 197/267 (74%), Gaps = 43/267 (16%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIG-------------  142
            WWSEALHGVSY GPG +FS  VPGATSFPQP+LTAASFN +LF+ IG             
Sbjct  55   WWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGESACNNTSQFFFS  114

Query  143  -----------------------------KVVSTEARAMHNVGLAGLTYWSPNINIFRDP  235
                                         +VVSTEARAMHNVGLAGLT+WSPNINIFRDP
Sbjct  115  SKSPFSICIAMENLHCDFRSRLVRFYRGARVVSTEARAMHNVGLAGLTFWSPNINIFRDP  174

Query  236  RWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAACCKHYTAYDVDDWKSHVR  415
            RWGRGQETPGEDP+LAS+YAV YV GLQ    G    LKVAACCKHYTAYDVD+WK   R
Sbjct  175  RWGRGQETPGEDPLLASKYAVGYVTGLQDAG-GGSDALKVAACCKHYTAYDVDNWKGVER  233

Query  416  YNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGKPVCGDHDLLAGVIRGKWN  595
            Y F+AVV++QD++DTFQPPFK CV++GNVASVMCSYN+VNGKP C D DLL+GVIRG W 
Sbjct  234  YTFDAVVSQQDLDDTFQPPFKSCVIDGNVASVMCSYNKVNGKPTCADKDLLSGVIRGDWK  293

Query  596  LNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            LNGYIV+DCDS +V++N+QHYTK PE+
Sbjct  294  LNGYIVSDCDSVDVLYNNQHYTKNPED  320



>emb|CDY67410.1| BnaCnng54810D [Brassica napus]
Length=525

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 193/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD--GNKKKLKV  355
            GLAGLTYWSPNIN+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D  G  ++LKV
Sbjct  145  GLAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKV  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            ++CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+VN
Sbjct  205  SSCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            G P C D +LL GVIRG+W L+GYIV+DCDS  V F+S HYTKT E+
Sbjct  265  GIPTCADPNLLRGVIRGQWRLDGYIVSDCDSIEVYFDSIHYTKTRED  311



>ref|XP_006406478.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
 gb|ESQ47931.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
Length=749

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 194/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKK--KLKV  355
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   DG +K  +LKV
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDGGRKSRRLKV  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            ++CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+VN
Sbjct  205  SSCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            G P C D +LL GVIRG+W L+GYIV+DCDS  V F+S HYTKT E+
Sbjct  265  GIPTCADPNLLRGVIRGQWRLDGYIVSDCDSIEVYFDSIHYTKTRED  311



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   353 bits (906),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 192/230 (83%), Gaps = 8/230 (3%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G G  F+GPVPGATSFPQ +LTAASFN++LFQ IGKVVSTEARAM+NV
Sbjct  99   WWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVSTEARAMYNV  158

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L S+YAVAYVKGLQ  D G+  +LKVAA
Sbjct  159  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQGTDGGDPNRLKVAA  218

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+WK   RY FN+VV +QDM+DTFQPPF+ CV++GNVASVMCSYNQVNGK
Sbjct  219  CCKHYTAYDVDNWKGVHRYTFNSVVNQQDMDDTFQPPFRSCVVDGNVASVMCSYNQVNGK  278

Query  542  PVCGDHDLLAGVIR-----GKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+  +R     G + +  YIV+DCDS  V++ SQHYTKTPEE
Sbjct  279  PTCADPDLLS--VRLIYFFGVYVIR-YIVSDCDSVEVMYASQHYTKTPEE  325



>ref|XP_009145766.1| PREDICTED: probable beta-D-xylosidase 5 [Brassica rapa]
Length=782

 Score =   353 bits (906),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 193/227 (85%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD--GNKKKLKV  355
            GLAGLTYWSPNIN+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D  G  ++LKV
Sbjct  145  GLAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKV  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            ++CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+VN
Sbjct  205  SSCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            G P C D +LL GVIRG+W L+GYIV+DCDS  V F+S HYTKT E+
Sbjct  265  GIPTCADPNLLRGVIRGQWRLDGYIVSDCDSIEVYFDSIHYTKTRED  311



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 186/225 (83%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA++YA  YVKGLQ   DG   +LKVAA
Sbjct  150  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ--GDGAGSRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PFK CV+EGNVASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPFKACVVEGNVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G IRG+W LNGYIV+DCDS  V++  QHYT+TPEE
Sbjct  268  PTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQHYTRTPEE  312



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   352 bits (904),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA++YA  YVKGLQ   DG   +LKVAA
Sbjct  150  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PFK CV+EGNVASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVNRFHFNARVSKQDLVDTYDVPFKACVVEGNVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G IRG+W LNGYIV+DCDS  V+++ QHYT+TPEE
Sbjct  268  PTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYDEQHYTRTPEE  312



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   352 bits (904),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 188/225 (84%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  97   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  156

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+GLQ    GN  KLKVAA
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGNGAGN--KLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V++QD+EDT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  215  CCKHYTAYDLDNWNGVDRYHFNARVSRQDLEDTYDVPFKACVVEGKVASVMCSYNQVNGK  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W+LNGYIV+DCDS  V+++SQHYTKTPEE
Sbjct  275  PTCADPDLLKNTIRGQWHLNGYIVSDCDSVGVLYDSQHYTKTPEE  319



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   352 bits (902),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 184/225 (82%), Gaps = 14/225 (6%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVSY G G  FSG V GATSFPQ +LTAASFNV+LFQ IGKVVSTEARAM+NV
Sbjct  98   WWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEARAMYNV  157

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L+S+YAVAYVKGLQ+ D G+  +LKVAA
Sbjct  158  GSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNRLKVAA  217

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYDVD+W    R+ FNAVV +QDM DTFQPPFK CV++GNVASVMCSYNQVNGK
Sbjct  218  CCKHYTAYDVDNWTDVHRFTFNAVVNQQDMADTFQPPFKSCVVDGNVASVMCSYNQVNGK  277

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL+GVIRG+W LNG               QHYTKTPEE
Sbjct  278  PTCADPDLLSGVIRGQWKLNG--------------DQHYTKTPEE  308



>ref|XP_010466113.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 191/226 (85%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D G  ++LKV+
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRRLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYDVD+WK   R++F+A VT QD+EDT+QPPFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDVDNWKGIDRFHFDAKVTNQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL GVIRG+W L+GYIV+DCDS  V F+  HYTKT E+
Sbjct  265  IPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFDDIHYTKTRED  310



>gb|KHN26728.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  92   PLLTAASFNVTLFQTIGKVVSTEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGED  271
            P+LTAASFN +LF+ IG+VVSTEARAM+NVGLAGLTYWSPNINIFRDPRWGRGQETPGED
Sbjct  2    PILTAASFNASLFEAIGRVVSTEARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGED  61

Query  272  PVLASQYAVAYVKGLQQRDDGNKKKLKVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDM  451
            P+L+S+YA  YVKGLQQ DDG+  KLKVAACCKHYTAYD+D+WK   RY FNAVVT+QDM
Sbjct  62   PLLSSKYATGYVKGLQQTDDGDSNKLKVAACCKHYTAYDLDNWKGIQRYTFNAVVTQQDM  121

Query  452  EDTFQPPFKKCVLEGNVASVMCSYNQVNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSF  631
            +DTFQPPFK CV++GNVASVMCSYNQVNGKP C D DLL GVIRG+W LNGYIV+DCDS 
Sbjct  122  DDTFQPPFKSCVIDGNVASVMCSYNQVNGKPTCADPDLLKGVIRGEWKLNGYIVSDCDSV  181

Query  632  NVIFNSQHYTKTPEE  676
             V+F  QHYTKTPEE
Sbjct  182  EVLFKDQHYTKTPEE  196



>ref|XP_006298950.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
 gb|EOA31848.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
Length=762

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 191/226 (85%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   + G  ++LKV+
Sbjct  145  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHEAGKSRRLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A VT QD+EDT+QPPFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDAKVTNQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL GVIRGKW L+GYIV+DCDS  V F+  HYTKT E+
Sbjct  265  IPTCADPNLLRGVIRGKWRLDGYIVSDCDSIQVYFDDIHYTKTRED  310



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   352 bits (904),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 191/223 (86%), Gaps = 1/223 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDP++ S+YAV YVKGLQ  +D G  ++LKV+
Sbjct  145  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVQDAGKSRRLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKT  667
             P C D +LL GVIRG+W L+GYIV+DCDS  V F+  HYTKT
Sbjct  265  IPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFDDIHYTKT  307



>gb|KHN33504.1| Beta-xylosidase/alpha-L-arabinofuranosidase 1 [Glycine soja]
Length=648

 Score =   347 bits (889),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +2

Query  92   PLLTAASFNVTLFQTIGKVVSTEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGED  271
            P+LTAASFN +LF+ IG+VVSTEARAM+NVGLAGLTYWSPNINIFRDPRWGRGQETPGED
Sbjct  2    PILTAASFNASLFEAIGRVVSTEARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGED  61

Query  272  PVLASQYAVAYVKGLQQRDDGNKKKLKVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDM  451
            P+L+S+YA  YVKGLQQ DDG+  KLKVAACCKHYTAYD+D+WK   RY FNAVVT+QDM
Sbjct  62   PLLSSKYATGYVKGLQQTDDGDSNKLKVAACCKHYTAYDLDNWKGIQRYTFNAVVTQQDM  121

Query  452  EDTFQPPFKKCVLEGNVASVMCSYNQVNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSF  631
            +DTFQPPFK CV++GNVASVMCSYNQVNGKP C D DLL G+IRG+W LNGYIV+DCDS 
Sbjct  122  DDTFQPPFKSCVIDGNVASVMCSYNQVNGKPTCADPDLLKGIIRGEWKLNGYIVSDCDSV  181

Query  632  NVIFNSQHYTKTPEE  676
             V+F  QHYTKTPEE
Sbjct  182  EVLFKDQHYTKTPEE  196



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   350 bits (897),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+VV  EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVVPDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLAS+YA  YVKGLQ   DG   +LKVAA
Sbjct  150  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVKGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PFK CV+EG+VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPFKACVVEGHVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G IRG+W LNGYIV+DCDS  V++  QHYT+TPEE
Sbjct  268  PTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQHYTRTPEE  312



>ref|XP_010546993.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546994.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010546995.1| PREDICTED: beta-D-xylosidase 1-like isoform X3 [Tarenaya hassleriana]
Length=775

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSDVGPGVRFGGQFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGL+YWSPN+NIFRDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  151  GMAGLSYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNAVGNR--LKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNAKVTKQDLEDTYNVPFKACVAEGRVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  269  PTCADQDLLKNTIRGQWRLNGYIVSDCDSVDVFFNKQHYTSTPEE  313



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D G  ++LKV+
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRRLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+Q PFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQTPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL GVIRG+W L+GYIV+DCDS  V FN  HYTKT E+
Sbjct  265  IPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFNDIHYTKTRED  310



>gb|KFK26586.1| hypothetical protein AALP_AA8G267600 [Arabis alpina]
Length=772

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGTAAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGFDRFHFNAKVTKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADEDLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTSTPEE  315



>emb|CDY58860.1| BnaCnng33860D [Brassica napus]
Length=771

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD--GNKKKLKV  355
            GLAGLTYWSPNIN+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D  G  ++LKV
Sbjct  145  GLAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKV  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            ++CCKHYTAYD+D+WK   R++F+A VT+QD+EDT+QPPFK CV EG+V+SVMCSYN+VN
Sbjct  205  SSCCKHYTAYDLDNWKGIDRFHFDAKVTRQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKT  667
            G P C D +LL GVIR +W L+GYIV+DCDS  V F+S HYTKT
Sbjct  265  GIPTCADPNLLRGVIRSQWRLDGYIVSDCDSIEVYFDSIHYTKT  308



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 186/226 (82%), Gaps = 3/226 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G VPGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  94   WWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA  YV+GLQ        +LKVAA
Sbjct  154  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAARYVQGLQ---SATGNRLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+ DT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRYHFNARVSKQDLADTYDVPFKACVVEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D DLL G IRG+W+LNGYIV+DCDS  V++++QHYT TPEE+
Sbjct  271  PTCADPDLLKGTIRGQWHLNGYIVSDCDSVGVMYDTQHYTTTPEES  316



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   350 bits (897),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 190/226 (84%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV F+G VPGATSFP  +LTAASFN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ-RDDGNKKKLKVA  358
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D G  ++LKV+
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRRLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+Q PFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDTYQTPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL GVIRG+W L+GYIV+DCDS  V FN  HYTKT E+
Sbjct  265  IPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFNDIHYTKTRED  310



>dbj|BAO45878.1| beta-D-xylosidase [Acacia mangium]
Length=763

 Score =   347 bits (890),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L+  IG+VVS EARAM+N 
Sbjct  85   WWSEALHGVSNVGPGTKFGGAFPAATSFPQVISTAASFNQSLWNQIGRVVSDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA QYA +YV GLQ   DG   +LKVAA
Sbjct  145  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGQYAASYVHGLQ--GDGAGNRLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W S  R++FNA+V+KQD+E+T+  PFK CVL+G VASVMCSYNQVNGK
Sbjct  203  CCKHYTAYDLDNWNSIDRFHFNAMVSKQDLEETYNVPFKACVLDGKVASVMCSYNQVNGK  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS  V+  SQHYTKTPEE
Sbjct  263  PTCADPDLLRNTIRGQWRLNGYIVSDCDSVQVLHESQHYTKTPEE  307



>ref|XP_010671663.1| PREDICTED: beta-D-xylosidase 1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   347 bits (890),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 186/225 (83%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  84   WWSEALHGVSNVGPGTKFQGAFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNG  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G  GLTYWSPN+NIFRDPRWGRGQETPGEDP LA++YA +YV+GLQ   + NK +LKVAA
Sbjct  144  GTGGLTYWSPNVNIFRDPRWGRGQETPGEDPSLAAKYAASYVRGLQ--GNYNKNRLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  202  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFKACVLEGKVASVMCSYNQVNGK  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D D+L   IRG+W LNGYIV+DCDS  V+++SQHYT+TPEE
Sbjct  262  PTCADPDILRNTIRGQWRLNGYIVSDCDSVGVMYDSQHYTRTPEE  306



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   347 bits (889),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+ V  EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRGVPDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLAS+YA  YVKGLQ   DG   +LKVAA
Sbjct  150  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVKGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PFK CV+EG+VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVNRFHFNARVSKQDLADTYNVPFKACVVEGHVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL G IRG+W LNGYIV+DCDS  V++  QHYT+TPEE
Sbjct  268  PTCADPDLLKGTIRGQWRLNGYIVSDCDSVGVLYEEQHYTRTPEE  312



>ref|XP_009151303.1| PREDICTED: beta-D-xylosidase 1 [Brassica rapa]
Length=772

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYTKTPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTKTPEE  315



>ref|XP_010268028.1| PREDICTED: probable beta-D-xylosidase 2 [Nelumbo nucifera]
Length=767

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 186/226 (82%), Gaps = 3/226 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFNV+L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNVSLWEQIGQVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDP++A +YA+ YV+GLQ  +DGN  +LKVAA
Sbjct  151  GMAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGEYAIRYVRGLQG-NDGN--RLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+DDW    R++FNA V+KQD+EDT+  PFK CVLEGNVASVMCSYNQVNG 
Sbjct  208  CCKHYTAYDLDDWNGVDRFHFNAKVSKQDLEDTYNVPFKACVLEGNVASVMCSYNQVNGI  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D +LL   IRG+W LNGYIV+DCDS  V F+ QHYT TPEE 
Sbjct  268  PTCADPNLLRNTIRGQWRLNGYIVSDCDSVGVFFDQQHYTSTPEEA  313



>gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 187/225 (83%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGVKF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  92   WWSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNG  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+GLQ    GN  +LKVAA
Sbjct  152  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQS-ITGN--RLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVVEGKVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  269  PTCADPDLLKNTIRGEWRLNGYIVSDCDSVGVLYDNQHYTSTPEE  313



>ref|XP_009129779.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=772

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVTKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTTTPEE  315



>emb|CDY33913.1| BnaA02g30740D [Brassica napus]
Length=772

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVTKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTTTPEE  315



>ref|XP_009779847.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana sylvestris]
Length=794

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 191/229 (83%), Gaps = 4/229 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TGPGV+F+  VPGATS P  +L+AASFNV L+ T+GKVVSTEARAMHNV
Sbjct  83   WWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVLLWYTLGKVVSTEARAMHNV  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD----GNKKKL  349
            GLAGLTYWSPN+N+ RDPRWGR QETPGEDP++ S+YAV YV+GLQ+ D      ++ KL
Sbjct  143  GLAGLTYWSPNVNVLRDPRWGRAQETPGEDPLVVSKYAVNYVRGLQEVDGEEYFSSQNKL  202

Query  350  KVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQ  529
            KV++CCKHYTAYD+DDWK   RY+F+A VT QDMEDTFQPPFK CV EG+V+SVMCSYN+
Sbjct  203  KVSSCCKHYTAYDLDDWKGIDRYHFDANVTAQDMEDTFQPPFKSCVEEGHVSSVMCSYNR  262

Query  530  VNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            VNG P C D +LL GVIR +W+L+GYIV+DCDS  V +++ HYT TPE+
Sbjct  263  VNGVPTCADPNLLKGVIRDQWSLDGYIVSDCDSIEVYYDAIHYTATPED  311



>emb|CDY05634.1| BnaC02g39030D [Brassica napus]
Length=772

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEDIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVTKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTTTPEE  315



>ref|XP_002865732.1| beta-xylosidase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41991.1| beta-xylosidase 1 [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGSKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDP++A++YA +YV+GLQ    GN+  LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAAKYAASYVRGLQGTAAGNR--LKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VT+QD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVTQQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRGKW LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGKWRLNGYIVSDCDSVDVFFNQQHYTSTPEE  315



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   345 bits (886),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 190/228 (83%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F   VPGATSFP  +L+AASFN TL+ T+G+VVS EARAM+NV
Sbjct  82   WWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQVVSNEARAMYNV  141

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKK---LK  352
             LAGLT+WSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YV+GLQ+  D    K   LK
Sbjct  142  DLAGLTFWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVGDEASAKGDRLK  201

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYDVD+WK   R++F+A VTKQD+EDT+QPPFK CVLEG+V+SVMCSYN+V
Sbjct  202  VSSCCKHYTAYDVDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCVLEGHVSSVMCSYNRV  261

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D DLL GVIRG+W L+GYIV+DCDS  V +NS HYTKTPE+
Sbjct  262  NGIPTCADPDLLQGVIRGQWGLDGYIVSDCDSVEVYYNSIHYTKTPED  309



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   346 bits (887),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  F+G VPGATSFP  +L+AASFN +L+  +G+VVSTEARAM+NV
Sbjct  90   WWSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQVVSTEARAMYNV  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK---KKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S YAV YV+GLQ+  +GNK    +LK
Sbjct  150  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSDYAVNYVRGLQEVSEGNKTGGDRLK  209

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYDVD+WK   R++F+A VT+QDMEDT+QPPFK CV EG+V+SVMCSYN+V
Sbjct  210  VSSCCKHYTAYDVDNWKGVDRFHFDAQVTEQDMEDTYQPPFKSCVQEGHVSSVMCSYNRV  269

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D +LL GV+RG+W L+GYIV+DCDS  V +N  HYT TPE+
Sbjct  270  NGVPTCADPNLLQGVVRGQWGLDGYIVSDCDSIEVYYNDIHYTATPED  317



>ref|XP_009603126.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tomentosiformis]
Length=790

 Score =   345 bits (886),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 192/229 (84%), Gaps = 4/229 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TGPGV+F+  VPGATS P  +L+AASFNV+L+ T+GKVVSTEARAMHNV
Sbjct  83   WWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVSLWYTLGKVVSTEARAMHNV  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD----GNKKKL  349
            GLAGLTYWSPN+N+ RDPRWGR QETPGEDP++ S+YAV YV+GLQ+ D      ++ KL
Sbjct  143  GLAGLTYWSPNVNVLRDPRWGRAQETPGEDPLVVSKYAVNYVRGLQEVDGEEYFSSQNKL  202

Query  350  KVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQ  529
            KV++CCKHYTAYD+D+WK   RY+F+A VT QDMEDTFQPPFK CV EG+V+SVMCSYN+
Sbjct  203  KVSSCCKHYTAYDLDNWKGIDRYHFDANVTAQDMEDTFQPPFKSCVEEGHVSSVMCSYNR  262

Query  530  VNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            VNG P C D +LL GVIR +W+L+GYIV+DCDS  V +++ HYT TPE+
Sbjct  263  VNGVPTCADPNLLKGVIRDQWSLDGYIVSDCDSIEVYYDAIHYTATPED  311



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   345 bits (885),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 186/225 (83%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TGPGVKF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDP +A++YA +YV+GLQ    GN  +LKVAA
Sbjct  146  GVAGLTYWSPNVNIFRDPRWGRGQETPGEDPTVAAKYAASYVRGLQGNAAGN--RLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D W    R++FNA V+KQD+E+T+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  204  CCKHYTAYDLDFWNGMDRFHFNARVSKQDLEETYNVPFKACVVEGRVASVMCSYNQVNGK  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS  V+FN QHYT TPE+
Sbjct  264  PTCADPNLLRNTIRGQWRLNGYIVSDCDSVGVLFNDQHYTATPED  308



>gb|AAP83934.1| auxin-induced beta-glucosidase [Oxybasis rubra]
Length=767

 Score =   345 bits (884),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  84   WWSEALHGVSNVGPGTKFRGAFPAATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNG  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP LASQYA +YV+GLQ     NK +LKVAA
Sbjct  144  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLASQYAASYVRGLQ--GIYNKNRLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W +  R++FNA V+KQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  202  CCKHYTAYDLDNWNAVDRFHFNAKVSKQDLEDTYNVPFKGCVQEGRVASVMCSYNQVNGK  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS  V+++ QHYT+TPEE
Sbjct  262  PTCADPDLLRNTIRGQWRLNGYIVSDCDSVGVLYDDQHYTRTPEE  306



>gb|KHN39204.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=648

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = +2

Query  89   QPLLTAASFNVTLFQTIGKVVSTEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGE  268
             P+LTAASFN +LF+ IG+VVSTEARAM+NVGLAGLTYWSPNINIFRDPRWGRG ETPGE
Sbjct  1    MPILTAASFNTSLFEVIGRVVSTEARAMYNVGLAGLTYWSPNINIFRDPRWGRGLETPGE  60

Query  269  DPVLASQYAVAYVKGLQQRDDGNKKKLKVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQD  448
            DPVL S+YA  YVKGLQQ D G+  KLKVAACCKHYTAYDVD+WK   RY FNAVVTKQD
Sbjct  61   DPVLTSKYAAGYVKGLQQTDGGDPNKLKVAACCKHYTAYDVDNWKGIQRYTFNAVVTKQD  120

Query  449  MEDTFQPPFKKCVLEGNVASVMCSYNQVNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDS  628
            MEDTFQPPFK CV++GNVASVMCSYN+VNGKP C D DLL GV+RG+W LNGYIV+DCDS
Sbjct  121  MEDTFQPPFKSCVIDGNVASVMCSYNKVNGKPTCADPDLLKGVVRGEWKLNGYIVSDCDS  180

Query  629  FNVIFNSQHYTKTPEET  679
              V++  QHYTKTPEE 
Sbjct  181  VEVLYKDQHYTKTPEEA  197



>ref|XP_010507856.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   345 bits (885),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 189/226 (84%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV+F+G VPGATSFP  +LT A+FN +L+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTTANFNTSLWLKMGEVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKK-LKVA  358
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ   D  K + LKV+
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRWLKVS  204

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A VT QD+EDT+QPPFK CV EG+V+SVMCSYN+VNG
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDAKVTNQDLEDTYQPPFKSCVEEGDVSSVMCSYNRVNG  264

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL GVIRG+W L+GYIV+DCDS  V F+  HYTKT E+
Sbjct  265  IPTCADPNLLRGVIRGQWRLDGYIVSDCDSIQVYFDDIHYTKTRED  310



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   345 bits (884),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 187/226 (83%), Gaps = 5/226 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAA+FN +L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK-KKLKVA  358
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+GLQ    GN   +LKVA
Sbjct  146  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ----GNTGSRLKVA  201

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNG
Sbjct  202  ACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNG  261

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D D+L   IRG+W L+GYIV+DCDS  V++N+QHYT+TPEE
Sbjct  262  KPTCADPDILKNTIRGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEE  307



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score =   344 bits (883),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+  IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA++YA  YV+GLQ  D   KK+LKVAA
Sbjct  150  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAAKYAANYVQGLQGND--GKKRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVDRYHFNAKVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG W L+GYIV+DCDS  V+++SQH+T TPEE
Sbjct  268  PTCADPDLLKNTIRGAWGLDGYIVSDCDSVGVLYDSQHFTPTPEE  312



>ref|NP_199747.1| bifunctional {beta}-D-xylosidase/{alpha}-L-arabinofuranosidase 
[Arabidopsis thaliana]
 sp|Q9FGY1.1|BXL1_ARATH RecName: Full=Beta-D-xylosidase 1; Short=AtBXL1; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09906.1| xylosidase [Arabidopsis thaliana]
 gb|AAM53325.1| xylosidase [Arabidopsis thaliana]
 gb|AED95802.1| bifunctional {beta}-D-xylosidase/{alpha}-L-arabinofuranosidase 
[Arabidopsis thaliana]
Length=774

 Score =   344 bits (883),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG+S  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDP++A++YA +YV+GLQ    GN  +LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAAKYAASYVRGLQGTAAGN--RLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VT+QD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVTQQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTSTPEE  315



>emb|CDX85405.1| BnaC07g27160D [Brassica napus]
Length=772

 Score =   344 bits (883),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  93   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  152

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN  +LKVAA
Sbjct  153  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVAA  210

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  211  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYNVPFKSCVYEGKVASVMCSYNQVNGK  270

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  271  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTTTPEE  315



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   344 bits (883),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGVKF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  100  WWSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVSDEARAMYNG  159

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDPVLA +YA +YV+GLQ        KLKVAA
Sbjct  160  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ---SSTGLKLKVAA  216

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  217  CCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYDVPFKACVVEGKVASVMCSYNQVNGK  276

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IRG+W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  277  PTCADPILLKNTIRGQWGLNGYIVSDCDSVGVLYDNQHYTSTPEE  321



>ref|XP_006280043.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
 gb|EOA12941.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
Length=776

 Score =   344 bits (883),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  95   WWSEALHGVSDVGPGARFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN+  LKVAA
Sbjct  155  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGTAAGNR--LKVAA  212

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VT+QD+EDT+  PF+ CV EG VASVMCSYNQVNGK
Sbjct  213  CCKHYTAYDLDNWNGVDRFHFNAKVTQQDLEDTYNVPFRSCVSEGKVASVMCSYNQVNGK  272

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  273  PTCADEDLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTNTPEE  317



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   344 bits (882),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 182/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN TL++ IG+VVS EARAM+N 
Sbjct  92   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEARAMYNG  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA  YA +YVKGLQ     N  +LKVAA
Sbjct  152  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ---GNNGDRLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PFK CV +GNVASVMCSYNQVNG 
Sbjct  209  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFKMCVQDGNVASVMCSYNQVNGV  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+WNLNGYIV+DCDS  V +N+QHYT TPEE
Sbjct  269  PTCADPNLLKRTIRGQWNLNGYIVSDCDSVGVFYNTQHYTSTPEE  313



>ref|XP_008458374.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Cucumis 
melo]
Length=768

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF GP PGATSFPQ + TAASFN +L+  IG+VVS EARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTKFGGPFPGATSFPQVITTAASFNQSLWLEIGRVVSDEARAMYNG  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA++YA  YV+GLQ   +  +++LKVAA
Sbjct  147  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAAKYAANYVQGLQ--GNAGRRRLKVAA  204

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  205  CCKHYTAYDLDNWNGVDRYHFNAKVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNGK  264

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG W L+GYIV+DCDS  V+++SQH+T TPEE
Sbjct  265  PTCADPDLLKNTIRGAWGLDGYIVSDCDSVGVLYDSQHFTPTPEE  309



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score =   343 bits (880),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGAT FPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATMFPQVITTAASFNQSLWRQIGRVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G  GLTYWSPN+NIFRDPRWGRGQETPGEDP LA++YA +YV+GLQ   DG   +LKVAA
Sbjct  150  GQGGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVQGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVLEGQVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL   IRG+W LNGYIV+DCDS  V ++SQHYT+TPEE
Sbjct  268  PTCADPDLLRNTIRGQWGLNGYIVSDCDSVGVFYDSQHYTRTPEE  312



>ref|XP_010440503.1| PREDICTED: beta-D-xylosidase 1 [Camelina sativa]
Length=775

 Score =   342 bits (878),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  94   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDP++A +YA +YV+GLQ    GN  +LKVAA
Sbjct  154  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQGTAAGN--RLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VT+QD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  212  CCKHYTAYDLDNWNGVDRFHFNAKVTQQDLEDTYNVPFKSCVSEGKVASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT +PEE
Sbjct  272  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTNSPEE  316



>ref|XP_006395069.1| hypothetical protein EUTSA_v10003681mg [Eutrema salsugineum]
 gb|ESQ32355.1| hypothetical protein EUTSA_v10003681mg [Eutrema salsugineum]
Length=773

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  94   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ    GN  +LKVAA
Sbjct  154  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VTKQD+EDT+  PF+ CV EG VASVMCSYNQVNG 
Sbjct  212  CCKHYTAYDLDNWNGVDRFHFNAKVTKQDLEDTYNVPFRSCVYEGKVASVMCSYNQVNGI  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W+LNGYIV+DCDS +V FN QHYT TPEE
Sbjct  272  PTCADENLLKNTIRGQWHLNGYIVSDCDSVDVFFNQQHYTTTPEE  316



>ref|XP_003546334.1| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=775

 Score =   342 bits (877),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 181/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGAT FPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  95   WWSEALHGVSNVGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNG  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP LA++YA +YVKGLQ    GN   LKVAA
Sbjct  155  GQAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQGDSAGNH--LKVAA  212

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  213  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVLEGQVASVMCSYNQVNGK  272

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL   IRG+W LNGYIV+DCDS  V F++QHYTKTP
Sbjct  273  PTCADPDLLRNTIRGQWRLNGYIVSDCDSVGVFFDNQHYTKTP  315



>ref|XP_010482214.1| PREDICTED: beta-D-xylosidase 1-like [Camelina sativa]
Length=775

 Score =   342 bits (877),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  94   WWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDP++A +YA +YV+GLQ    GN  +LKVAA
Sbjct  154  GVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQGTAAGN--RLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA VT+QD+EDT+  PFK CV EG VASVMCSYNQVNGK
Sbjct  212  CCKHYTAYDLDNWNGVDRFHFNAKVTQQDLEDTYNVPFKSCVSEGKVASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS +V FN QHYT +PEE
Sbjct  272  PTCADENLLKNTIRGQWRLNGYIVSDCDSVDVFFNQQHYTNSPEE  316



>ref|XP_004295104.1| PREDICTED: beta-D-xylosidase 1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   342 bits (876),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 182/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA++YA +YVKGLQ   DG   +LKVAA
Sbjct  150  GQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAASYVKGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PF+ CVLEG VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLADTYDVPFRGCVLEGKVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL   IRG+W LNGYIV+DCDS  V ++ QHYT+TP
Sbjct  268  PTCADPDLLKNTIRGEWKLNGYIVSDCDSVGVFYDQQHYTRTP  310



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   342 bits (876),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 184/226 (81%), Gaps = 3/226 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA  YV+GLQ        +LKVAA
Sbjct  149  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAANYVRGLQST---TGIRLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+ DT+  PFK CV+EG VASVMCSYNQVNGK
Sbjct  206  CCKHYTAYDLDNWNGVDRYHFNARVSKQDLADTYDVPFKSCVVEGKVASVMCSYNQVNGK  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D DLL G IRG+W L+GYIV+DCDS  V++++QH+T TPEE+
Sbjct  266  PTCADPDLLKGTIRGQWGLSGYIVSDCDSVGVMYDTQHFTATPEES  311



>ref|XP_006605998.1| PREDICTED: probable beta-D-xylosidase 5-like [Glycine max]
Length=794

 Score =   342 bits (877),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F   VPGATSFP  +L+AASFN +L+Q +G+VVSTEARAM+NV
Sbjct  80   WWSEALHGVSNLGPGTRFDKKVPGATSFPAVILSAASFNASLWQKMGQVVSTEARAMYNV  139

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD---GNKKKLK  352
             LAGLT+WSPN+N+FRDPRWGRGQETPGEDP++ S+YAV Y++GLQ+ +D       +LK
Sbjct  140  DLAGLTFWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVMYLRGLQEVEDEASAKADRLK  199

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYD+D+WK   R++F+A VTKQD+ED++QPPFK CV+EG+V+SVMCSYN+V
Sbjct  200  VSSCCKHYTAYDLDNWKGIDRFHFDAKVTKQDLEDSYQPPFKSCVVEGHVSSVMCSYNRV  259

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D DLL G+IRG+W L+GYIV+DCDS  V +N+ HYT TPE+
Sbjct  260  NGIPTCADPDLLKGIIRGQWGLDGYIVSDCDSVEVYYNAIHYTATPED  307



>dbj|BAG28345.1| arabinofuranosidase [Citrus unshiu]
Length=769

 Score =   341 bits (875),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 186/226 (82%), Gaps = 5/226 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAA+FN +L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK-KKLKVA  358
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+ LQ    GN   +LKVA
Sbjct  146  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRRLQ----GNTGSRLKVA  201

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNG
Sbjct  202  ACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNG  261

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D D+L   IRG+W L+GYIV+DCDS  V++N+QHYT+TPEE
Sbjct  262  KPTCADPDILKNTIRGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEE  307



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  151  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGXGNRLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PF+ CV++GNVASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYDVPFRACVVDGNVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IRG+W LNGYIV+DCDS  V ++ QHYTKTPEE
Sbjct  269  PTCADPNLLKGTIRGQWRLNGYIVSDCDSVGVYYDDQHYTKTPEE  313



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  151  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGXGNRLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PF+ CV++GNVASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYDVPFRACVVDGNVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IRG+W LNGYIV+DCDS  V ++ QHYTKTPEE
Sbjct  269  PTCADPNLLKGTIRGQWRLNGYIVSDCDSVGVYYDDQHYTKTPEE  313



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 182/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVL+++YA +YVKGLQ   DG   +LKVAA
Sbjct  150  GQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSAKYAASYVKGLQ--GDGAGNRLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PF+ CVLEG VASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLADTYDVPFRGCVLEGKVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL   IRG+W LNGYIV+DCDS  V ++ QHYT+TP
Sbjct  268  PTCADPDLLKNTIRGEWKLNGYIVSDCDSVGVFYDQQHYTRTP  310



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 186/225 (83%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA +YA +YV+GLQ  ++GN  +LKVAA
Sbjct  151  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLAGKYAASYVRGLQG-NEGN--RLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV+EGNVASVMCSYNQVNG 
Sbjct  208  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVVEGNVASVMCSYNQVNGV  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS  V ++ QHYT TPEE
Sbjct  268  PTCADPNLLRNTIRGEWRLNGYIVSDCDSVGVFYDDQHYTSTPEE  312



>ref|XP_006488872.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Citrus 
sinensis]
Length=826

 Score =   342 bits (876),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 186/226 (82%), Gaps = 5/226 (2%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAA+FN +L++ IG+VVS EARAM+N 
Sbjct  126  WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNG  185

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK-KKLKVA  358
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+GLQ    GN   +LKVA
Sbjct  186  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ----GNTGSRLKVA  241

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNG
Sbjct  242  ACCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVEGKVASVMCSYNQVNG  301

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            KP C D D+L   I G+W L+GYIV+DCDS  V++N+QHYT+TPEE
Sbjct  302  KPTCADPDILKNTIHGQWRLDGYIVSDCDSVGVLYNTQHYTRTPEE  347



>ref|XP_004487789.1| PREDICTED: beta-D-xylosidase 1-like [Cicer arietinum]
Length=776

 Score =   340 bits (873),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 181/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF GP P ATSFPQ + TAASFN +L+  IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGTKFGGPFPAATSFPQVITTAASFNQSLWLQIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP LA +YA  YV+GLQ   DG   +LKVAA
Sbjct  149  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAGKYAANYVQGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLADTYDIPFKSCVLEGKVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS  V +++QHYTKTPEE
Sbjct  267  PTCADPELLRNTIRGEWRLNGYIVSDCDSVGVFYDNQHYTKTPEE  311



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   342 bits (878),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 190/228 (83%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F+  VPGATSFP  +L+AASFN TL+  +G+VVSTEARAM+NV
Sbjct  143  WWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQVVSTEARAMYNV  202

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ---RDDGNKKKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YV+GLQ+     +    KLK
Sbjct  203  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVGGESNSTHDKLK  262

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+V
Sbjct  263  VSSCCKHYTAYDLDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCVEEGHVSSVMCSYNRV  322

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D DLL G++RG+W L+GYIV+DCDS  V +NS HYT TPE+
Sbjct  323  NGIPTCADPDLLKGIVRGQWGLDGYIVSDCDSVAVFYNSIHYTATPED  370



>ref|XP_003533205.2| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=823

 Score =   342 bits (876),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/223 (72%), Positives = 182/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGAT FPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  143  WWSEALHGVSNVGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNG  202

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP LA++YA +YVKGLQ   DG   +LKVAA
Sbjct  203  GQAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQ--GDGAGNRLKVAA  260

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  261  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVLEGQVASVMCSYNQVNGK  320

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL   IRG+W LNGYIV+DCDS  V F++QHYT+TP
Sbjct  321  PTCADPDLLRNTIRGQWGLNGYIVSDCDSVGVFFDNQHYTRTP  363



>ref|XP_007200259.1| hypothetical protein PRUPE_ppa015037mg [Prunus persica]
 gb|EMJ01458.1| hypothetical protein PRUPE_ppa015037mg [Prunus persica]
Length=798

 Score =   340 bits (873),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 190/228 (83%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+G VPGATSFP  +L+AASFN +L+  +G+VVSTEARAM+NV
Sbjct  84   WWSEALHGVSDLGPGTKFNGTVPGATSFPAVILSAASFNSSLWLKMGQVVSTEARAMYNV  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK---KKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S Y V YV+GLQ+  +G      +LK
Sbjct  144  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSNYGVNYVRGLQEVSEGKNAGGDRLK  203

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYDVD+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+V
Sbjct  204  VSSCCKHYTAYDVDNWKGVDRFHFDAQVTKQDLEDTYQPPFKSCVEEGHVSSVMCSYNRV  263

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D +LL GVIRG+W L+GYIV+DCDS  V +++ HYT TPE+
Sbjct  264  NGIPTCADPNLLQGVIRGQWALDGYIVSDCDSIEVYYDAIHYTATPED  311



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   339 bits (870),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 184/228 (81%), Gaps = 2/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV F G  PGATSFPQ + +AASFN TL++ IGK VS EARAM+N 
Sbjct  85   WWSEALHGVSDVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP +AS+YAV+YV+GLQQ   G     +LK+
Sbjct  145  GQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVASRYAVSYVRGLQQASGGPHGHGRLKL  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYD+D+W+   R++FNA V+KQD+EDTF  PFK CV+EG VASVMCSYNQVN
Sbjct  205  AACCKHYTAYDLDNWRGVDRFHFNAKVSKQDLEDTFDVPFKACVVEGKVASVMCSYNQVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            G P C D +LL   IRG+W LNGYIV+DCDS  V +N+QHYT TPEE 
Sbjct  265  GVPTCADPNLLRNTIRGQWALNGYIVSDCDSVGVFYNTQHYTSTPEEA  312



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   339 bits (870),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+GP P ATSFPQ + TAASFN +L+++IG+VVS EARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNEARAMYNG  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPVLA +YA +YV+GLQ  D   + +LKVAA
Sbjct  147  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---RSRLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  204  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  264  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  308



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   339 bits (869),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+GP P ATSFPQ + TAASFN +L+++IG+VVS EARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNEARAMYNG  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPVLA +YA +YV+GLQ  D   + +LKVAA
Sbjct  147  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---RSRLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  204  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  264  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  308



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   339 bits (869),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 183/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGAT+FPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+N+FRDPRWGRGQETPGEDPV+A +YA +YV+GLQ     N  +LKVAA
Sbjct  146  GMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ---GNNGLRLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV+ G VASVMCSYNQVNGK
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKSCVVAGKVASVMCSYNQVNGK  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IRG+W LNGYIV+DCDS  V+F++QHYT TPEE
Sbjct  263  PTCADPYLLKNTIRGEWGLNGYIVSDCDSVGVLFDTQHYTATPEE  307



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   338 bits (868),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 183/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  P ATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YVKGLQ   DGN  KLKVAA
Sbjct  146  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGRYAASYVKGLQG-TDGN--KLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYDVD+W    R++FNA+V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  203  CCKHFTAYDVDNWNGVDRFHFNALVSKQDIEDTFDVPFRMCVKEGKVASVMCSYNQVNGV  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG W L+GYIV+DCDS  V++NSQHYT TPEE
Sbjct  263  PTCADPNLLKKTVRGVWGLDGYIVSDCDSVGVLYNSQHYTSTPEE  307



>ref|XP_008236322.1| PREDICTED: probable beta-D-xylosidase 5 [Prunus mume]
Length=916

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 191/228 (84%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+G VPGATSFP  +L+AASFN +L+  +G+VVSTEARAM+NV
Sbjct  84   WWSEALHGVSDLGPGTKFNGTVPGATSFPAVILSAASFNSSLWLKMGQVVSTEARAMYNV  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNK---KKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S Y V YV+GLQ+  +G K    +LK
Sbjct  144  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSNYGVNYVRGLQEVSEGIKAGDDRLK  203

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYDVD+WK   R++F+A VTKQD+EDT+QPPFK CV EG+V+SVMCSYN+V
Sbjct  204  VSSCCKHYTAYDVDNWKGVDRFHFDAQVTKQDLEDTYQPPFKSCVEEGHVSSVMCSYNRV  263

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D +LL GVIRG+W L+GYIV+DCDS  V +++ HYT TPE+
Sbjct  264  NGIPTCADPNLLQGVIRGQWGLDGYIVSDCDSIEVYYDAIHYTPTPED  311



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 192/228 (84%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G GV+F+G VPGATSFP  +L+AASFN TL+  +G+VVSTEAR MH+V
Sbjct  83   WWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQVVSTEARTMHSV  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQR-DDGNK--KKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YV+GLQ+  D+GN    KLK
Sbjct  143  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVGDEGNSTADKLK  202

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYD+D WK   R++F+A VTKQD+EDT+QPPF+ CV E +V+SVMCSYN+V
Sbjct  203  VSSCCKHYTAYDLDKWKGVDRFHFDAKVTKQDLEDTYQPPFRSCVEEAHVSSVMCSYNRV  262

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D DLL G+IRG+WNL+GYIV+DCDS  V ++S +YT TPE+
Sbjct  263  NGIPTCADPDLLKGIIRGEWNLDGYIVSDCDSIEVYYDSINYTATPED  310



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   338 bits (868),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 184/226 (81%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G VPGATSFPQ +LTAASFN +L++ IG+ VSTEARAM+N 
Sbjct  84   WWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVSTEARAMYNE  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG-NKKKLKVA  358
            GLAGLT+WSPN+NIFRDPRWGRGQETPGEDP +  +YA  YV+GLQ   D  +  +LKVA
Sbjct  144  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVVGRYAGRYVRGLQNAFDAKDPNRLKVA  203

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+WK   R++F+A V+KQD+EDT+QPPF+ CV+EG  ASVMCSYNQVNG
Sbjct  204  ACCKHYTAYDLDNWKGVDRFHFDAKVSKQDLEDTYQPPFETCVVEGRAASVMCSYNQVNG  263

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D +LL   IRG W LNGYIV+DCDS  V ++SQHYT TPE+
Sbjct  264  IPTCADPNLLTKTIRGDWGLNGYIVSDCDSVGVFYDSQHYTATPED  309



>gb|KHN12900.1| Beta-D-xylosidase 1 [Glycine soja]
Length=774

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 180/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHG S  GPG KF G  PGAT FPQ + TAASFN +L+Q IG+VVS EARAM+N 
Sbjct  94   WWSEALHGGSNMGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP LA++YA +YVKGLQ    GN   LKVAA
Sbjct  154  GQAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQGDSAGNH--LKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CVLEG VASVMCSYNQVNGK
Sbjct  212  CCKHYTAYDLDNWNGVDRFHFNAKVSKQDLEDTYDVPFKACVLEGQVASVMCSYNQVNGK  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTP  670
            P C D DLL   IRG+W LNGYIV+DCDS  V F++QHYT+TP
Sbjct  272  PTCADPDLLRNTIRGQWGLNGYIVSDCDSVGVFFDNQHYTRTP  314



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   338 bits (866),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  151  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV++G VASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYDVPFKACVVDGKVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IR +W LNGYIV+DCDS  V ++ QHYTKTPEE
Sbjct  269  PTCADPNLLKGTIRSQWRLNGYIVSDCDSVGVYYDDQHYTKTPEE  313



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFNV+L++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNVSLWEKIGEVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NIFRDPRWGRGQETPGEDPV+A++YA +YV+GLQ  D G   +LKVAA
Sbjct  146  GMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAAKYAASYVRGLQGTDAGG--RLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V++QD++DTF  PF+ CV+EG VASVMCSYNQVNG 
Sbjct  204  CCKHYTAYDLDNWAGVDRFHFNAKVSQQDIKDTFDIPFRSCVMEGKVASVMCSYNQVNGV  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL G +RG W L+GYIV+DCDS  V +++QHY  TPEE
Sbjct  264  PTCADPKLLRGTVRGSWRLDGYIVSDCDSVGVFYDNQHYASTPEE  308



>ref|XP_009383731.1| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   338 bits (866),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS +GPGV+F G  PGATSFPQ + +AASFN TL++ +G+VVS EARAM+N 
Sbjct  94   WWSEALHGVSNSGPGVRFGGAFPGATSFPQVISSAASFNATLWELMGQVVSDEARAMYNG  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG-NKKKLKVA  358
            G AGLT+WSPN+NI+RDPRWGRGQETPGEDP ++++YA AYV+GLQQ + G +  +LKVA
Sbjct  154  GQAGLTFWSPNVNIYRDPRWGRGQETPGEDPAVSARYAAAYVRGLQQANGGTSHARLKVA  213

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            ACCKHYTAYD+D+WK   R++FNA V+KQD+EDT+  PFK CV+EG VASVMCSYNQVNG
Sbjct  214  ACCKHYTAYDLDNWKGVDRFHFNAKVSKQDLEDTYDVPFKACVVEGKVASVMCSYNQVNG  273

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
             P C D +LL   +RG+W LNGYIV+DCDS  V +++QHYT TPE+ 
Sbjct  274  VPSCADSNLLRHTVRGQWRLNGYIVSDCDSVGVFYSAQHYTSTPEDA  320



>gb|AGR44452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=774

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKF-GTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  149  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV++GNVASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFKACVVDGNVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPE  673
            P C D DLL G IRG+W LNGYIV+DCDS  V +++QHYTKTPE
Sbjct  267  PTCADPDLLKGTIRGQWKLNGYIVSDCDSVGVYYDNQHYTKTPE  310



>dbj|BAF79669.1| beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKF-GTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  149  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV++GNVASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFKACVVDGNVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPE  673
            P C D DLL G IRG+W LNGYIV+DCDS  V +++QHYTKTPE
Sbjct  267  PTCADPDLLKGTIRGQWKLNGYIVSDCDSVGVYYDNQHYTKTPE  310



>dbj|BAD98523.1| alpha-L-arabinofuranosidase / beta-D-xylosidase [Pyrus pyrifolia]
Length=774

 Score =   337 bits (865),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKF-GTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  149  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PFK CV++GNVASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFKACVVDGNVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPE  673
            P C D DLL G IRG+W LNGYIV+DCDS  V +++QHYTKTPE
Sbjct  267  PTCADPDLLKGTIRGQWKLNGYIVSDCDSVGVYYDNQHYTKTPE  310



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   338 bits (866),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 188/228 (82%), Gaps = 3/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  G GV F+  VPGATSFP  +L+AASFN TL+  +G+VVSTEARAMHNV
Sbjct  85   WWSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNV  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQ---RDDGNKKKLK  352
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP + S+YAV YVKGLQQ     D +  +LK
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPFVVSRYAVNYVKGLQQVGESGDEDDDRLK  204

Query  353  VAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQV  532
            V++CCKHYTAYD+D+WK   R++F+A VTKQD+EDT+QPPF+ CV E +V+SVMCSYN+V
Sbjct  205  VSSCCKHYTAYDIDNWKGVDRFHFDAKVTKQDLEDTYQPPFRSCVEEAHVSSVMCSYNRV  264

Query  533  NGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            NG P C D DLL GVIRG+WNL+GYIV+DCDS  V ++  +YT TPE+
Sbjct  265  NGVPTCADPDLLKGVIRGQWNLDGYIVSDCDSIEVYYDRINYTATPED  312



>ref|XP_008353169.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=774

 Score =   337 bits (863),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKF-GTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP+LA++Y   YVKGLQ   DG   +LKVAA
Sbjct  149  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPILAAKYGARYVKGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PF+ CV++GNVASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFRACVVDGNVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IRG+W LNGYIV+DCDS  V +++QHYTKTPEE
Sbjct  267  PTCADPELLKGTIRGQWKLNGYIVSDCDSVGVYYDNQHYTKTPEE  311



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   337 bits (863),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF    PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  85   WWSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA  YA +YVKGLQ   DGN  +LKVAA
Sbjct  145  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGSYAASYVKGLQG-TDGN--RLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  202  CCKHFTAYDIDNWNGVDRFHFNAQVSKQDIEDTFDVPFRMCVKEGKVASVMCSYNQVNGV  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG+W L+GYIV+DCDS  V +NSQHYT TPEE
Sbjct  262  PTCADPNLLKKTVRGQWGLDGYIVSDCDSVGVFYNSQHYTSTPEE  306



>ref|NP_001280797.1| putative beta-D-xylosidase precursor [Malus domestica]
 gb|ADI79208.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Malus domestica]
Length=774

 Score =   337 bits (863),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 185/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSNVGPGTKF-GTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP+LA++Y   YVKGLQ   DG   +LKVAA
Sbjct  149  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPILAAKYGARYVKGLQ--GDGAGNRLKVAA  206

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PF+ CV++GNVASVMCSYNQVNGK
Sbjct  207  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYNVPFRACVVDGNVASVMCSYNQVNGK  266

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IRG+W LNGYIV+DCDS  V +++QHYTKTPEE
Sbjct  267  PTCADPELLKGTIRGQWKLNGYIVSDCDSVGVYYDNQHYTKTPEE  311



>ref|XP_009348894.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   337 bits (863),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 181/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G   GATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  91   WWSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  150

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDPVLA++Y   YVKGLQ   DG   +LKVAA
Sbjct  151  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+EDT+  PF+ CV++G VASVMCSYNQVNGK
Sbjct  209  CCKHYTAYDLDNWNGVDRFHFNARVSKQDLEDTYDVPFRACVVDGKVASVMCSYNQVNGK  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL G IR +W LNGYIV+DCDS  V ++ QHYTKTPEE
Sbjct  269  PTCADPSLLKGTIRSQWRLNGYIVSDCDSVGVYYDDQHYTKTPEE  313



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAA+FN +L++ IG+VVS E RAM+N 
Sbjct  156  WWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVSDEGRAMYNG  215

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            GL GLTYWSPN+NIFRDPRWGRGQETPGEDPVLA +YA +YV+GLQ   DG   +LKVAA
Sbjct  216  GLGGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGNLDGG--RLKVAA  273

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V++QD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  274  CCKHFTAYDLDNWSGVDRFHFNAKVSRQDIEDTFDVPFRSCVKEGKVASVMCSYNQVNGI  333

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IRG W L+GYIV+DCDS  V++++QHYT TPEE
Sbjct  334  PTCADPQLLRHTIRGAWRLDGYIVSDCDSVGVLYDNQHYTSTPEE  378



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   336 bits (862),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 183/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  92   WWSEALHGVSNVGPGSKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNG  151

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+   YA +YVKGLQ  +DGN  +LKVAA
Sbjct  152  GVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGTYAASYVKGLQG-NDGN--RLKVAA  208

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  209  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGKVASVMCSYNQVNGV  268

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RGKW L+GYIV+DCDS  V +++QHYT TPEE
Sbjct  269  PTCADPNLLKKTVRGKWRLDGYIVSDCDSVGVFYDTQHYTTTPEE  313



>ref|XP_006830079.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 186/227 (82%), Gaps = 2/227 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GP V F+G +PGATSFP  +L+ ASFN TL+  +G+VVSTEARAM+N 
Sbjct  94   WWSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVSTEARAMYNT  153

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD--GNKKKLKV  355
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDPV+ S+YAV YV+GLQ  D+   +   LKV
Sbjct  154  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVVSRYAVNYVRGLQDPDNEATSSNSLKV  213

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            ++CCKHYTAYDVD+WK   R++F+A V  QDMEDT+QPPFK CV EG V+SVMCSYN+VN
Sbjct  214  SSCCKHYTAYDVDNWKGVDRFHFDATVKLQDMEDTYQPPFKNCVEEGQVSSVMCSYNRVN  273

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            G P C D +LL GV+RG+WNL+GYIV+DCDS  V +N+ HY+ TPE+
Sbjct  274  GIPTCADPNLLKGVVRGQWNLDGYIVSDCDSIEVFYNAIHYSATPED  320



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 182/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L+++IG+VVS EARAM+N 
Sbjct  82   WWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVSNEARAMYNG  141

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPVLA +YA +YV+GLQ  D   + +LKVAA
Sbjct  142  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---RSRLKVAA  198

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  199  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  258

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  259  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  303



>ref|XP_010111676.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC31467.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=802

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 189/231 (82%), Gaps = 6/231 (3%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG  F+  VPGATSFP  +L+AA+FN +L+  +G+ VSTEARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAVSTEARAMYNA  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDD-----GNK-K  343
            GLAGLTYWSPN+N+FRDPRWGRGQETPGEDP++ S+YAV YVKGLQ+  +     GN+  
Sbjct  147  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQEMSNEEGSGGNQGD  206

Query  344  KLKVAACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSY  523
            +LKV++CCKHYTAYDVD+WK   R++F+A VTKQD+EDT+QPPFK CV +G+V+SVMCSY
Sbjct  207  RLKVSSCCKHYTAYDVDNWKGVDRFHFDAKVTKQDLEDTYQPPFKSCVEKGHVSSVMCSY  266

Query  524  NQVNGKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            N+VNG P C D DLL GVIRG+W L+GYI +DCDS  V +NS HYT TPE+
Sbjct  267  NRVNGIPTCADPDLLKGVIRGQWGLDGYIASDCDSIEVYYNSIHYTATPED  317



>ref|XP_007051080.1| Beta-xylosidase 2 [Theobroma cacao]
 gb|EOX95237.1| Beta-xylosidase 2 [Theobroma cacao]
Length=818

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF    P ATSFPQ + TAASFN TL++ IG+VVS EARAM+N 
Sbjct  134  WWSEALHGVSNVGPGTKFGRAFPAATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNG  193

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA  YA +YVKGLQ     N  +LKVAA
Sbjct  194  GMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ---GNNGDRLKVAA  250

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PFK CV +GNVASVMCSYNQVNG 
Sbjct  251  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFKMCVKDGNVASVMCSYNQVNGV  310

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG+W LNGYIV+DCDS  V +N+QHYT TPE+
Sbjct  311  PTCADPNLLKKTVRGQWKLNGYIVSDCDSVGVFYNTQHYTSTPEQ  355



>ref|XP_010069867.1| PREDICTED: probable beta-D-xylosidase 2 [Eucalyptus grandis]
Length=784

 Score =   335 bits (860),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 178/226 (79%), Gaps = 0/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  95   WWSEALHGVSNVGPGTRFGGDFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNG  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPNINI RDPRWGRGQETPGEDPV+  QYA +YV+GLQ  D     +LKVAA
Sbjct  155  GMGGLTYWSPNINILRDPRWGRGQETPGEDPVVVGQYAASYVRGLQGADGNGGGRLKVAA  214

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    RY+FNA V+KQDMEDTF  PF+ CV+EG VASVMCSYNQVNG 
Sbjct  215  CCKHFTAYDLDNWNGVDRYHFNARVSKQDMEDTFSVPFRMCVMEGKVASVMCSYNQVNGI  274

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            P C D +LL   +RG W L+GY+V+DCDS  V + +QHYT TP++ 
Sbjct  275  PTCADPNLLRKTVRGAWRLDGYVVSDCDSVGVFYGNQHYTSTPQQA  320



>gb|EYU23074.1| hypothetical protein MIMGU_mgv1a019840mg, partial [Erythranthe 
guttata]
Length=739

 Score =   333 bits (855),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN +L++ IGKVVS E RAM+N 
Sbjct  61   WWSEALHGVSNVGPGTRFGGQFPGATSFPQVITTAASFNESLWEEIGKVVSDEGRAMYNG  120

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G +GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA  YV+GLQ  D     +LKVAA
Sbjct  121  GASGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAARYVRGLQGSD---GDRLKVAA  177

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD++DTF  PFK CV +GNVASVMCSYNQVNG 
Sbjct  178  CCKHYTAYDLDNWNGVDRFHFNAQVSKQDLKDTFNIPFKSCVKDGNVASVMCSYNQVNGI  237

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL G IRG W L+GYIV+DCDS  V+F++QHYT+TPEE
Sbjct  238  PTCADPKLLKGTIRGDWRLDGYIVSDCDSVGVLFDNQHYTRTPEE  282



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   334 bits (857),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 181/228 (79%), Gaps = 2/228 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGV F G  PGATSFPQ + +AASFN TL++ IGK VS EARAM+N 
Sbjct  85   WWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDG--NKKKLKV  355
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP +A +YAV+YV+GLQQ   G  +  +LK+
Sbjct  145  GQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVAGRYAVSYVRGLQQPYGGPHDHSRLKL  204

Query  356  AACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVN  535
            AACCKHYTAYD+D+W+   RY+FNA V+KQD+EDTF  PFK CV++G VA  MCSYNQVN
Sbjct  205  AACCKHYTAYDLDNWRGVDRYHFNAKVSKQDLEDTFNVPFKACVMQGRVACAMCSYNQVN  264

Query  536  GKPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEET  679
            G P C D +LL   IRG+W LNGYIV+DCDS  V +N+QHY  TPEE 
Sbjct  265  GVPTCADPNLLRSTIRGEWKLNGYIVSDCDSVGVFYNAQHYASTPEEA  312



>ref|XP_010556264.1| PREDICTED: beta-D-xylosidase 1-like [Tarenaya hassleriana]
Length=768

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  P ATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  90   WWSEALHGVSDVGPGTRFGGAYPAATSFPQVITTAASFNQSLWEEIGRVVSNEARAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NI RDPRWGR QETPGEDP ++ +Y  +YV+GLQ    GN   LKVAA
Sbjct  150  GTAGLTYWSPNVNIVRDPRWGRIQETPGEDPFVSGKYGASYVRGLQ--GSGNGDSLKVAA  207

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R +FNA VTKQD+EDTF  PF+ CV EGNVASVMCSYNQVNGK
Sbjct  208  CCKHYTAYDLDNWMGIDRLHFNANVTKQDLEDTFNVPFQTCVKEGNVASVMCSYNQVNGK  267

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D DLL  ++RG WNL GYIV+DCDS  V+FN QHYTKTPEE
Sbjct  268  PTCTDVDLLKNIVRGDWNLKGYIVSDCDSVEVLFNKQHYTKTPEE  312



>ref|XP_004162442.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 2-like 
[Cucumis sativus]
Length=772

 Score =   333 bits (855),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + T ASFNV+L++ IG+VVS EARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTEFGGDFPGATSFPQVITTVASFNVSLWEAIGRVVSDEARAMYNG  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+A +YA  Y+KGLQ  D     +LKVAA
Sbjct  147  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGEYAARYIKGLQGNDG---DRLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA VT+QDM DTF+ PF+KCV EG VASVMCSYNQVNG 
Sbjct  204  CCKHFTAYDLDNWNGTDRFHFNAKVTRQDMVDTFEVPFRKCVKEGKVASVMCSYNQVNGV  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IR +W LNGYIV+DCDS  V +++QHYT T EE
Sbjct  264  PTCADPNLLKGTIRNQWGLNGYIVSDCDSVGVFYDNQHYTSTAEE  308



>ref|XP_004136155.1| PREDICTED: probable beta-D-xylosidase 2-like [Cucumis sativus]
 gb|KGN45007.1| hypothetical protein Csa_7G407600 [Cucumis sativus]
Length=772

 Score =   333 bits (855),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + T ASFNV+L++ IG+VVS EARAM+N 
Sbjct  87   WWSEALHGVSNVGPGTEFGGDFPGATSFPQVITTVASFNVSLWEAIGRVVSDEARAMYNG  146

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+A +YA  Y+KGLQ  D     +LKVAA
Sbjct  147  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGEYAARYIKGLQGNDG---DRLKVAA  203

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA VT+QDM DTF+ PF+KCV EG VASVMCSYNQVNG 
Sbjct  204  CCKHFTAYDLDNWNGTDRFHFNAKVTRQDMVDTFEVPFRKCVKEGKVASVMCSYNQVNGV  263

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL G IR +W LNGYIV+DCDS  V +++QHYT T EE
Sbjct  264  PTCADPNLLKGTIRNQWGLNGYIVSDCDSVGVFYDNQHYTSTAEE  308



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN TL++ IG+VVS EARAM N 
Sbjct  85   WWSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMFNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D     +LKVAA
Sbjct  145  GVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNDG---DRLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  202  CCKHFTAYDLDNWNGVDRFHFNAQVSKQDMEDTFDVPFRMCVKEGKVASVMCSYNQVNGI  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   +RG+W L+GYIV+DCDS  V ++ QHYT TPEE
Sbjct  262  PTCADPKLLKKTVRGQWKLDGYIVSDCDSVGVYYSQQHYTTTPEE  306



>gb|KHN19223.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=681

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 182/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGVKF+   PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVLA  YA +YV+GLQ   DGN  +LKVAA
Sbjct  149  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVRGLQG-TDGN--RLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+E+TF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  206  CCKHFTAYDLDNWNGMDRFHFNAQVSKQDIEETFDVPFRMCVSEGKVASVMCSYNQVNGV  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG W L+GYIV+DCDS  V +++QHYT TPEE
Sbjct  266  PTCADPNLLKKTVRGLWQLDGYIVSDCDSVGVFYDNQHYTPTPEE  310



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  88   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  147

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA AYV+GLQ  D   + +LKVAA
Sbjct  148  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAAAYVRGLQGND---RSRLKVAA  204

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  205  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  264

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  265  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  309



>gb|KCW61272.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=749

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  108  WWSEALHGVSNVGPGTRFGGAFPGATSFPQVITTAASFNSSLWEEIGRVVSDEARAMYNG  167

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+N+FRDPRWGRGQETPGEDPV+A +YA +YV+GLQ  + GN  +LKVAA
Sbjct  168  GMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVMAGKYAASYVRGLQG-NVGN--RLKVAA  224

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV++G VASVMCSYNQVNG 
Sbjct  225  SCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVDGKVASVMCSYNQVNGV  284

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS  V++ +QHYT TPE+
Sbjct  285  PTCADPNLLKNTIRGQWRLNGYIVSDCDSVGVLYENQHYTTTPED  329



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  88   WWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGRVVSDEARAMYNG  147

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
             + GLTYWSPN+NIFRDPRWGRGQETPGEDPV+A  YA  YV+GLQ  ++G+  +LKVAA
Sbjct  148  EMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGIYAERYVRGLQGNEEGD--RLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  206  CCKHYTAYDLDNWSGVDRFHFNAKVSKQDMEDTFDVPFRSCVREGKVASVMCSYNQVNGI  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG W LNGYIV+DCDS  V + +QHYT TPEE
Sbjct  266  PTCADPELLRKTIRGGWGLNGYIVSDCDSVGVFYENQHYTSTPEE  310



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   333 bits (853),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 183/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPGVKF+   PGATSFPQ + TAASFN +L+++IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVSDEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPNINIFRDPRWGRGQETPGEDPVLA  YAV+YV+GLQ    GN  +LKVAA
Sbjct  149  GVAGLTYWSPNINIFRDPRWGRGQETPGEDPVLAGTYAVSYVRGLQG-THGN--RLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  206  CCKHFTAYDLDNWNGVDRFHFNAQVSKQDIEDTFDVPFRMCVSEGRVASVMCSYNQVNGV  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG W L+GYIV+DCDS  V +++QHY  TPEE
Sbjct  266  PTCADPNLLKNTLRGLWQLDGYIVSDCDSVGVFYSNQHYASTPEE  310



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   332 bits (852),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TG GVKF G  PGATSFPQ + TAASFN +L++ IG+VVS E RAM+N 
Sbjct  83   WWSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGRVVSEEGRAMYNG  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NIFRDPRWGRGQETPGEDP L +QY V+YVKGLQ        +LKVAA
Sbjct  143  GAAGLTFWSPNVNIFRDPRWGRGQETPGEDPHLVAQYGVSYVKGLQGGGGRGNTRLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+DDW  + RY+FNA V+ QD+EDT+  PFK CV+EGNVASVMCSYNQ+NGK
Sbjct  203  CCKHYTAYDLDDWNGYDRYHFNAKVSMQDLEDTYNAPFKACVVEGNVASVMCSYNQINGK  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IR +W+LNGYIV+DCDS  V+F  QHYT+ PE+
Sbjct  263  PSCADPTLLRDTIRNQWHLNGYIVSDCDSVGVLFEKQHYTRYPED  307



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D   + +LKVAA
Sbjct  149  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  206  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  266  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  310



>ref|XP_010687347.1| PREDICTED: probable beta-D-xylosidase 5 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   333 bits (853),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 186/226 (82%), Gaps = 1/226 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TGPGV F+  VPGATSFP  +L+AASFN +L+  +G+VVSTEARAM+NV
Sbjct  82   WWSEALHGVSNTGPGVHFNATVPGATSFPAVILSAASFNTSLWYMMGQVVSTEARAMYNV  141

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQR-DDGNKKKLKVA  358
            GLAGLTYWSPN+N++RDPRWGRGQETPGEDP++ S+Y V YV+GLQ+    G+K  LKV+
Sbjct  142  GLAGLTYWSPNVNVYRDPRWGRGQETPGEDPLVVSKYGVNYVRGLQEVGSHGSKDMLKVS  201

Query  359  ACCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNG  538
            +CCKHYTAYD+D+WK   R++F+A V+ QD+EDT+QPPFK CV +G+V+SVMCSYN+VNG
Sbjct  202  SCCKHYTAYDIDNWKGVDRFHFDAKVSLQDLEDTYQPPFKSCVEKGHVSSVMCSYNRVNG  261

Query  539  KPVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
             P C D  LL G+IR +W LNGY+VTDCDS  V + S  YT TPEE
Sbjct  262  VPTCADPKLLKGIIREEWGLNGYVVTDCDSIQVYYESIKYTSTPEE  307



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L++ IG+V S EARAM+N 
Sbjct  85   WWSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA +YA +YV+GLQ+  DGN  +LKVAA
Sbjct  145  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQE-TDGN--RLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  202  SCKHFTAYDLDNWNGVDRFHFNAQVSKQDIEDTFNVPFRMCVKEGKVASVMCSYNQVNGV  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   +RG+W LNGYIV+DCDS  V +NSQHYT TPEE
Sbjct  262  PTCADPILLKRTVRGQWGLNGYIVSDCDSVGVFYNSQHYTSTPEE  306



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  89   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  148

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D   + +LKVAA
Sbjct  149  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  206  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  266  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  310



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS TGPGVKF G  P ATSFPQ + TAASFN +L++ IG+VVS E RAM+N 
Sbjct  90   WWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRAMYNG  149

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLT+WSPN+NI RDPRWGR QETPGEDP L +QYA++YVKGLQ        +LKVAA
Sbjct  150  GAAGLTFWSPNVNILRDPRWGRCQETPGEDPHLVAQYAISYVKGLQGGGGRGTSRLKVAA  209

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+DDW    RY+FNA V++QD+EDT+  PFK CV+EGNVASVMCSYNQ+NGK
Sbjct  210  CCKHYTAYDLDDWNGFDRYHFNAKVSRQDLEDTYNVPFKACVVEGNVASVMCSYNQINGK  269

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IR +W LNGYIV+DCDS  V+F  QHYT+ PE+
Sbjct  270  PSCADPTLLRDTIRAQWRLNGYIVSDCDSVGVLFEQQHYTRFPED  314



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score =   332 bits (850),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  83   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D   + +LKVAA
Sbjct  143  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAA  199

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  200  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  259

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  260  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  304



>ref|XP_006444470.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
 ref|XP_006492318.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492319.1| PREDICTED: probable beta-D-xylosidase 2-like isoform X2 [Citrus 
sinensis]
 gb|ESR57710.1| hypothetical protein CICLE_v10018959mg [Citrus clementina]
Length=770

 Score =   332 bits (850),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TA+SFN TL++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDPVL+ +YA +YV+GLQ  D     +LKVAA
Sbjct  146  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSGKYAASYVRGLQGSDG---DRLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV+EG VASVMCSYNQVNG 
Sbjct  203  SCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVMEGKVASVMCSYNQVNGV  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D ++L   IRG+W LNGYIV+DCDS  V +++QH+T TPEE
Sbjct  263  PTCADPNILKRTIRGEWRLNGYIVSDCDSVGVYYDTQHFTSTPEE  307



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score =   332 bits (850),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  88   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  147

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D   + +LKVAA
Sbjct  148  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAA  204

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYNQVNG 
Sbjct  205  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNQVNGV  264

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  265  PTCADPNLLKKTIRNQWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  309



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   332 bits (850),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  88   WWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNG  147

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
             + GLTYWSPN+NIFRDPRWGRGQETPGEDPV+A  YA  YVKGLQ  ++ +  +LKVAA
Sbjct  148  DMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGIYAERYVKGLQGNEEDD--RLKVAA  205

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  206  CCKHYTAYDLDNWSGVDRFHFNAKVSKQDMEDTFDVPFRSCVREGKVASVMCSYNQVNGI  265

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG W LNGYIV+DCDS  V + +QHYT TPEE
Sbjct  266  PTCADPELLRKTIRGGWGLNGYIVSDCDSVGVFYENQHYTSTPEE  310



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   331 bits (849),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN TL++ IG+VVS EARAM N 
Sbjct  85   WWSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+  +YA +YV+GLQ   DGN  +LKVAA
Sbjct  145  GVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQG-SDGN--RLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  202  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFDVPFRMCVKEGKVASVMCSYNQVNGI  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG+W L+GYIV+DCDS  V +  QHYT TPEE
Sbjct  262  PTCADPNLLKKTVRGQWRLDGYIVSDCDSVGVYYEQQHYTSTPEE  306



>ref|XP_010024778.1| PREDICTED: putative beta-D-xylosidase [Eucalyptus grandis]
 gb|KCW61273.1| hypothetical protein EUGRSUZ_H04033 [Eucalyptus grandis]
Length=788

 Score =   332 bits (851),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG +F G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  108  WWSEALHGVSNVGPGTRFGGAFPGATSFPQVITTAASFNSSLWEEIGRVVSDEARAMYNG  167

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+N+FRDPRWGRGQETPGEDPV+A +YA +YV+GLQ  + GN  +LKVAA
Sbjct  168  GMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVMAGKYAASYVRGLQG-NVGN--RLKVAA  224

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKHYTAYD+D+W    RY+FNA V+KQD+EDT+  PFK CV++G VASVMCSYNQVNG 
Sbjct  225  SCKHYTAYDLDNWNGVDRYHFNARVSKQDLEDTYNVPFKACVVDGKVASVMCSYNQVNGV  284

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W LNGYIV+DCDS  V++ +QHYT TPE+
Sbjct  285  PTCADPNLLKNTIRGQWRLNGYIVSDCDSVGVLYENQHYTTTPED  329



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   331 bits (849),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF+G  P ATSFPQ + T ASFN +L++ IG+V S EARAM+N 
Sbjct  81   WWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDEARAMYNG  140

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA +YA +YV+GLQ  D     +LKVAA
Sbjct  141  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQGTD---SSRLKVAA  197

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EGNVASVMCSYNQVNG 
Sbjct  198  SCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFNVPFRMCVKEGNVASVMCSYNQVNGV  257

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IRG+W+L+GYIV+DCDS  V + +QHYT TPEE
Sbjct  258  PTCADPNLLKRTIRGQWHLDGYIVSDCDSVGVFYTNQHYTSTPEE  302



>ref|XP_008451490.1| PREDICTED: probable beta-D-xylosidase 2 [Cucumis melo]
Length=773

 Score =   331 bits (849),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 180/222 (81%), Gaps = 3/222 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + T ASFNV+L++ IG+VVS EARAM+N 
Sbjct  88   WWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTVASFNVSLWEAIGRVVSDEARAMYNG  147

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP++A +YA +YVKGLQ  DD    +LKVAA
Sbjct  148  GAAGLTYWSPNVNIFRDPRWGRGQETPGEDPMVAGEYAASYVKGLQGNDD---DRLKVAA  204

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+++W    R++FNA VT+QD+ DTF+ PF+KCV EG VASVMCSYNQVNG 
Sbjct  205  CCKHFTAYDLENWNGTDRFHFNAKVTRQDIVDTFEVPFRKCVREGKVASVMCSYNQVNGV  264

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKT  667
            P C D +LL G IR +W LNGYIV+DCDS  V +++QHYT T
Sbjct  265  PTCADPNLLKGTIRNQWGLNGYIVSDCDSVGVFYDNQHYTST  306



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  95   WWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNG  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+N+ RDPRWGR QETPGEDP +  +YA +YV+GLQ  +DGN  +LKVAA
Sbjct  155  GVAGLTYWSPNVNVLRDPRWGRAQETPGEDPTVVGRYAASYVRGLQG-NDGN--RLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  212  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFDVPFRMCVEEGKVASVMCSYNQVNGV  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG W L+GYIV+DCDS  V +NSQHYT TPEE
Sbjct  272  PTCADPNLLKKTVRGAWRLDGYIVSDCDSVGVFYNSQHYTSTPEE  316



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   331 bits (849),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  84   WWSEALHGVSNVGPGTKFGGKFPTATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNG  143

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGRGQETPGEDPVLA +YA +YV+GLQ  D     +LKVAA
Sbjct  144  GMAGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGTDG---DRLKVAA  200

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKHYTAYD+D+W    R++FNA V+KQD+ DTF  PF++CV+EG VASVMCSYNQVNG 
Sbjct  201  CCKHYTAYDLDNWGGVDRFHFNAQVSKQDIVDTFDVPFRECVMEGKVASVMCSYNQVNGI  260

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   IRG W LNGYIV+DCDS  V + +QHYT TPEE
Sbjct  261  PTCADPKLLRNTIRGDWRLNGYIVSDCDSVGVFYKNQHYTSTPEE  305



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   331 bits (849),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN TL++ IG+VVS EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NI RDPRWGRGQETPGEDP+L  +YA +YVKGLQ  D    ++LKVAA
Sbjct  146  GAAGLTYWSPNVNILRDPRWGRGQETPGEDPLLVGKYAASYVKGLQGNDG---ERLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDM+DTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  203  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDMKDTFDVPFRMCVKEGKVASVMCSYNQVNGI  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +R +W LNGYIV+DCDS  V ++ QHYT TPEE
Sbjct  263  PTCADPNLLRKTVRTQWGLNGYIVSDCDSVGVFYDKQHYTSTPEE  307



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   331 bits (849),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN TL++ IG+VVS EARAM N 
Sbjct  85   WWSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NIFRDPRWGRGQETPGEDPV+  +YA +YV+GLQ   DGN  +LKVAA
Sbjct  145  GVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQG-SDGN--RLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  202  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDMEDTFDVPFRMCVKEGKVASVMCSYNQVNGI  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG+W L+GYIV+DCDS  V +  QHYT TPEE
Sbjct  262  PTCADPNLLKKTVRGQWRLDGYIVSDCDSVGVYYEQQHYTSTPEE  306



>ref|XP_010522822.1| PREDICTED: probable beta-D-xylosidase 2 [Tarenaya hassleriana]
Length=767

 Score =   331 bits (848),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  85   WWSEALHGVSNVGPGTKFGGAYPAATSFPQVITTVASFNASLWESIGRVVSDEARAMYNG  144

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ   DGN  +LKVAA
Sbjct  145  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQG-TDGN--RLKVAA  201

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVASVMCSYNQVNG 
Sbjct  202  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASVMCSYNQVNGV  261

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +R +W LNGYIV+DCDS  V +N+QHYT TPEE
Sbjct  262  PTCADPNLLKKTVRSQWGLNGYIVSDCDSVGVFYNTQHYTGTPEE  306



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  PGATSFPQ + TAASFN +L++ IG+VVS EARAM+N 
Sbjct  95   WWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNG  154

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+AGLTYWSPN+NI RDPRWGR QETPGEDP +  +YA +YV+GLQ  DDGN  +LKVAA
Sbjct  155  GVAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVGRYAASYVRGLQG-DDGN--RLKVAA  211

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQDMEDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  212  CCKHFTAYDLDNWNGVDRFHFNARVSKQDMEDTFDVPFRMCVKEGKVASVMCSYNQVNGV  271

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   +RG W L+GYIV+DCDS    +NSQHYT TPEE
Sbjct  272  PTCADPNLLKKTVRGAWRLDGYIVSDCDSVGGFYNSQHYTSTPEE  316



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + TAASFN +L++ IG+V S EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNG  145

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G AGLTYWSPN+NIFRDPRWGRGQETPGEDP+LA +YA +YV+GLQ   DGN  +LKVAA
Sbjct  146  GTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQG-TDGN--RLKVAA  202

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
             CKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EG VASVMCSYNQVNG 
Sbjct  203  SCKHFTAYDLDNWNGVDRFHFNAQVSKQDIEDTFNVPFRMCVKEGKVASVMCSYNQVNGV  262

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D  LL   +RG+W LNGYIV+DCDS  V +NSQHYT TPEE
Sbjct  263  PTCADPILLKRTVRGQWGLNGYIVSDCDSVGVFYNSQHYTSTPEE  307



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  2    WWSEALHGVSYTGPGVKFSGPVPGATSFPQPLLTAASFNVTLFQTIGKVVSTEARAMHNV  181
            WWSEALHGVS  GPG KF G  P ATSFPQ + T ASFN +L+++IG+VVS EARAM+N 
Sbjct  83   WWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNG  142

Query  182  GLAGLTYWSPNINIFRDPRWGRGQETPGEDPVLASQYAVAYVKGLQQRDDGNKKKLKVAA  361
            G+ GLTYWSPN+NI RDPRWGRGQETPGEDPV+A +YA +YV+GLQ  D   + +LKVAA
Sbjct  143  GVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAA  199

Query  362  CCKHYTAYDVDDWKSHVRYNFNAVVTKQDMEDTFQPPFKKCVLEGNVASVMCSYNQVNGK  541
            CCKH+TAYD+D+W    R++FNA V+KQD+EDTF  PF+ CV EGNVAS+MCSYN+VNG 
Sbjct  200  CCKHFTAYDLDNWNGVDRFHFNAKVSKQDIEDTFDVPFRMCVKEGNVASIMCSYNEVNGV  259

Query  542  PVCGDHDLLAGVIRGKWNLNGYIVTDCDSFNVIFNSQHYTKTPEE  676
            P C D +LL   IR +W LNGYIV+DCDS  V++++QHYT TPEE
Sbjct  260  PTCADPNLLKKTIRNEWGLNGYIVSDCDSVGVLYDTQHYTGTPEE  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1017575415288