BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20598_g1_i1 len=2005 path=[1:0-761 763:762-841 843:842-887
889:888-2004]

Length=2005
                                                                      Score     E

ref|XP_009629262.1|  PREDICTED: transcription factor bHLH112-like       346   4e-108   
ref|XP_003635184.1|  PREDICTED: transcription factor bHLH112 isof...    342   3e-106   
ref|XP_009764035.1|  PREDICTED: transcription factor bHLH112-like       340   9e-106   
ref|XP_010646711.1|  PREDICTED: transcription factor bHLH112 isof...    335   1e-103   
ref|XP_004232764.1|  PREDICTED: transcription factor bHLH112            330   5e-102   
emb|CDO99682.1|  unnamed protein product                                319   2e-97    
ref|XP_007025886.1|  Transcription factor, putative                     317   2e-96    
ref|XP_006377272.1|  hypothetical protein POPTR_0011s03560g             298   2e-89    
ref|XP_006383985.1|  hypothetical protein POPTR_0004s02870g             296   2e-88    
ref|XP_011003381.1|  PREDICTED: transcription factor bHLH112 isof...    293   1e-87    
ref|XP_011003379.1|  PREDICTED: transcription factor bHLH112 isof...    291   1e-86    
ref|XP_011003380.1|  PREDICTED: transcription factor bHLH112 isof...    285   4e-84    
ref|XP_011009499.1|  PREDICTED: transcription factor bHLH112-like...    283   2e-83    
ref|XP_011009498.1|  PREDICTED: transcription factor bHLH112-like...    281   1e-82    
ref|XP_002317263.2|  hypothetical protein POPTR_0011s03560g             280   1e-82    Populus trichocarpa [western balsam poplar]
gb|KDP20840.1|  hypothetical protein JCGZ_21311                         278   2e-81    
ref|XP_007148280.1|  hypothetical protein PHAVU_006G195000g             273   5e-80    
ref|XP_009802434.1|  PREDICTED: transcription factor bHLH112-like       264   3e-78    
ref|XP_003541762.1|  PREDICTED: transcription factor bHLH112-like...    266   1e-77    
ref|XP_002518591.1|  transcription factor, putative                     268   1e-77    Ricinus communis
ref|XP_007148281.1|  hypothetical protein PHAVU_006G195000g             266   2e-77    
ref|XP_009617305.1|  PREDICTED: transcription factor bHLH112-like       260   2e-76    
ref|XP_006597380.1|  PREDICTED: transcription factor bHLH112-like...    262   7e-76    
ref|XP_004485677.1|  PREDICTED: transcription factor bHLH112-like...    261   3e-75    
ref|XP_006594645.1|  PREDICTED: transcription factor bHLH112-like...    259   5e-75    
ref|XP_008226756.1|  PREDICTED: transcription factor bHLH123            259   5e-75    
ref|XP_011012087.1|  PREDICTED: transcription factor bHLH123-like...    258   2e-74    
ref|XP_011012088.1|  PREDICTED: transcription factor bHLH123-like...    257   3e-74    
ref|XP_007213019.1|  hypothetical protein PRUPE_ppa023041mg             256   1e-73    
ref|XP_006597381.1|  PREDICTED: transcription factor bHLH112-like...    255   3e-73    
ref|XP_004485676.1|  PREDICTED: transcription factor bHLH112-like...    254   6e-73    
ref|XP_006467938.1|  PREDICTED: transcription factor bHLH112-like...    252   1e-71    
ref|XP_008224893.1|  PREDICTED: transcription factor bHLH112 isof...    246   9e-70    
gb|AFK38358.1|  unknown                                                 244   2e-69    
ref|XP_007021136.1|  Basic helix-loop-helix DNA-binding superfami...    244   2e-69    
ref|XP_007211684.1|  hypothetical protein PRUPE_ppa005924mg             242   1e-68    
ref|XP_011095780.1|  PREDICTED: transcription factor bHLH123            240   4e-68    
ref|XP_010267864.1|  PREDICTED: transcription factor bHLH112-like       241   6e-68    
ref|XP_011097951.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    239   2e-67    
ref|XP_008224894.1|  PREDICTED: transcription factor bHLH112 isof...    239   3e-67    
gb|KDP38997.1|  hypothetical protein JCGZ_00754                         236   1e-66    
ref|XP_002280367.3|  PREDICTED: transcription factor bHLH123 isof...    237   2e-66    Vitis vinifera
ref|XP_011096171.1|  PREDICTED: transcription factor bHLH112 isof...    236   5e-66    
ref|XP_003593403.1|  Transcription factor bHLH112                       232   4e-65    
ref|XP_010240994.1|  PREDICTED: transcription factor bHLH123-like       233   5e-65    
gb|EYU27864.1|  hypothetical protein MIMGU_mgv1a011041mg                226   1e-64    
ref|XP_008224896.1|  PREDICTED: transcription factor bHLH112 isof...    231   1e-64    
emb|CAN78236.1|  hypothetical protein VITISV_016390                     231   3e-64    Vitis vinifera
ref|XP_010644310.1|  PREDICTED: transcription factor bHLH123 isof...    229   8e-64    
ref|XP_011030917.1|  PREDICTED: transcription factor bHLH123            229   1e-63    
ref|XP_011096172.1|  PREDICTED: transcription factor bHLH112 isof...    229   2e-63    
ref|XP_006370578.1|  ethylene-responsive family protein                 228   2e-63    
ref|XP_009594898.1|  PREDICTED: transcription factor bHLH123-like       228   2e-63    
ref|XP_011086152.1|  PREDICTED: transcription factor bHLH112-like       229   2e-63    
ref|XP_006449162.1|  hypothetical protein CICLE_v10015039mg             228   7e-63    
ref|XP_008789835.1|  PREDICTED: transcription factor bHLH123-like       227   8e-63    
ref|XP_006851218.1|  hypothetical protein AMTR_s00043p00225670          226   1e-62    
ref|XP_002317553.1|  ethylene-responsive family protein                 226   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_004293560.1|  PREDICTED: transcription factor bHLH113-like       223   1e-61    
ref|XP_010057695.1|  PREDICTED: transcription factor bHLH112-like       222   4e-61    
ref|XP_009790944.1|  PREDICTED: transcription factor bHLH123-like       221   4e-61    
ref|XP_010909853.1|  PREDICTED: transcription factor bHLH112 isof...    221   1e-60    
ref|XP_010062929.1|  PREDICTED: transcription factor bHLH123            220   1e-60    
ref|XP_003528420.1|  PREDICTED: transcription factor bHLH123-like       221   2e-60    
ref|XP_009355551.1|  PREDICTED: transcription factor bHLH123-like...    220   3e-60    
ref|XP_009417259.1|  PREDICTED: transcription factor bHLH123-like...    219   3e-60    
ref|XP_003532569.1|  PREDICTED: transcription factor bHLH123-like       221   3e-60    
ref|XP_002534446.1|  transcription factor, putative                     215   3e-60    Ricinus communis
ref|XP_008383961.1|  PREDICTED: transcription factor bHLH112 isof...    219   3e-60    
ref|XP_010928675.1|  PREDICTED: transcription factor bHLH123-like       220   3e-60    
ref|XP_010931879.1|  PREDICTED: transcription factor bHLH112-like       219   4e-60    
ref|XP_008383959.1|  PREDICTED: transcription factor bHLH112 isof...    220   5e-60    
ref|XP_008383958.1|  PREDICTED: transcription factor bHLH112 isof...    219   6e-60    
ref|XP_008386041.1|  PREDICTED: transcription factor bHLH123-like       218   1e-59    
gb|KHN45735.1|  Transcription factor bHLH123                            219   1e-59    
ref|XP_008810246.1|  PREDICTED: transcription factor bHLH112-like       218   2e-59    
emb|CBI20463.3|  unnamed protein product                                215   2e-59    
gb|KGN49165.1|  hypothetical protein Csa_6G516730                       216   3e-59    
ref|XP_010112076.1|  hypothetical protein L484_002935                   218   3e-59    
gb|KEH19696.1|  BHLH transcription factor-like protein                  216   5e-59    
ref|XP_004244171.1|  PREDICTED: transcription factor bHLH123            216   7e-59    
ref|XP_003596544.1|  Transcription factor bHLH123                       214   3e-58    
ref|XP_003636605.1|  Transcription factor bHLH123                       213   4e-58    
gb|KEH38833.1|  BHLH transcription factor-like protein                  213   4e-58    
ref|XP_008355967.1|  PREDICTED: transcription factor bHLH112-like...    213   4e-58    
ref|XP_008366231.1|  PREDICTED: transcription factor bHLH123-like...    213   5e-58    
ref|XP_009355552.1|  PREDICTED: transcription factor bHLH123-like...    213   7e-58    
ref|XP_006452112.1|  hypothetical protein CICLE_v10008228mg             213   7e-58    
ref|XP_009377291.1|  PREDICTED: transcription factor bHLH123-like...    213   8e-58    
ref|XP_010924017.1|  PREDICTED: transcription factor bHLH123-like       213   9e-58    
ref|XP_008383960.1|  PREDICTED: transcription factor bHLH112 isof...    213   2e-57    
ref|XP_009803615.1|  PREDICTED: transcription factor bHLH112-like       212   2e-57    
ref|XP_004294314.1|  PREDICTED: transcription factor bHLH123-like       211   2e-57    
ref|XP_009369411.1|  PREDICTED: transcription factor bHLH112 isof...    211   3e-57    
ref|XP_010052471.1|  PREDICTED: transcription factor bHLH112 isof...    210   3e-57    
ref|XP_008439935.1|  PREDICTED: transcription factor bHLH112-like...    210   3e-57    
ref|XP_006360115.1|  PREDICTED: transcription factor bHLH123-like       211   3e-57    
ref|XP_009369342.1|  PREDICTED: transcription factor bHLH112 isof...    211   5e-57    
ref|XP_009617831.1|  PREDICTED: transcription factor bHLH112-like       211   6e-57    
ref|XP_009417260.1|  PREDICTED: transcription factor bHLH112-like...    207   6e-57    
gb|KHN08360.1|  Transcription factor bHLH123                            208   6e-57    
ref|XP_008793684.1|  PREDICTED: transcription factor bHLH123-like       206   8e-57    
ref|XP_008439936.1|  PREDICTED: transcription factor bHLH112-like...    208   1e-56    
ref|XP_003541039.2|  PREDICTED: transcription factor bHLH123-like       210   1e-56    
ref|XP_010052470.1|  PREDICTED: transcription factor bHLH112 isof...    207   2e-56    
ref|XP_008777138.1|  PREDICTED: transcription factor bHLH123-like       209   2e-56    
ref|XP_009397158.1|  PREDICTED: transcription factor bHLH112-like       209   3e-56    
ref|XP_007133119.1|  hypothetical protein PHAVU_011G153000g             209   3e-56    
ref|XP_009405924.1|  PREDICTED: transcription factor bHLH112-like       207   3e-56    
ref|XP_004509986.1|  PREDICTED: transcription factor bHLH123-like...    208   4e-56    
gb|KHN28608.1|  Transcription factor bHLH123                            209   4e-56    
ref|XP_003526151.1|  PREDICTED: transcription factor bHLH123-like       208   8e-56    
ref|XP_004151277.1|  PREDICTED: transcription factor bHLH123-like       207   1e-55    
emb|CDP05832.1|  unnamed protein product                                207   1e-55    
gb|KGN56169.1|  hypothetical protein Csa_3G088430                       207   1e-55    
ref|XP_004509985.1|  PREDICTED: transcription factor bHLH123-like...    206   1e-55    
ref|XP_008355969.1|  PREDICTED: transcription factor bHLH112-like...    206   1e-55    
ref|XP_008366237.1|  PREDICTED: transcription factor bHLH123-like...    206   2e-55    
ref|XP_009113124.1|  PREDICTED: transcription factor bHLH112-like...    203   2e-55    
ref|XP_009377292.1|  PREDICTED: transcription factor bHLH123-like...    206   2e-55    
ref|XP_009113123.1|  PREDICTED: transcription factor bHLH112-like...    202   3e-55    
ref|XP_003539573.2|  PREDICTED: transcription factor bHLH123-like...    206   3e-55    
ref|XP_006592891.1|  PREDICTED: transcription factor bHLH123-like...    206   4e-55    
emb|CDY61978.1|  BnaCnng38940D                                          203   5e-55    
ref|XP_010909854.1|  PREDICTED: transcription factor bHLH112 isof...    205   5e-55    
ref|XP_009113121.1|  PREDICTED: transcription factor bHLH112-like...    202   6e-55    
ref|XP_009369478.1|  PREDICTED: transcription factor bHLH112 isof...    204   6e-55    
ref|XP_009113122.1|  PREDICTED: transcription factor bHLH112-like...    202   6e-55    
ref|XP_010111014.1|  hypothetical protein L484_004995                   206   7e-55    
ref|XP_006343407.1|  PREDICTED: transcription factor bHLH112-like       196   8e-55    
ref|XP_006594799.1|  PREDICTED: transcription factor bHLH123-like...    205   9e-55    
ref|XP_003541866.1|  PREDICTED: transcription factor bHLH123-like...    204   1e-54    
ref|XP_004248340.1|  PREDICTED: transcription factor bHLH123-like       202   1e-54    
emb|CDY12908.1|  BnaA09g13660D                                          202   1e-54    
ref|NP_564782.1|  transcription factor bHLH112                          202   2e-54    Arabidopsis thaliana [mouse-ear cress]
gb|AAM62823.1|  unknown                                                 202   2e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052472.1|  PREDICTED: transcription factor bHLH112 isof...    201   5e-54    
gb|EYU19181.1|  hypothetical protein MIMGU_mgv1a026531mg                202   8e-54    
ref|XP_007149667.1|  hypothetical protein PHAVU_005G089000g             202   1e-53    
gb|EEC79477.1|  hypothetical protein OsI_20507                          192   2e-53    Oryza sativa Indica Group [Indian rice]
gb|KCW76493.1|  hypothetical protein EUGRSUZ_D00881                     197   2e-53    
ref|XP_004970206.1|  PREDICTED: transcription factor bHLH123-like...    200   3e-53    
ref|XP_003580620.1|  PREDICTED: transcription factor bHLH112-like       201   3e-53    
ref|NP_001185284.1|  transcription factor bHLH112                       198   5e-53    
ref|XP_009418757.1|  PREDICTED: transcription factor bHLH112-like...    197   6e-53    
gb|EEE55506.1|  hypothetical protein OsJ_03706                          196   6e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006592892.1|  PREDICTED: transcription factor bHLH123-like...    199   8e-53    
ref|XP_010547083.1|  PREDICTED: transcription factor bHLH112 isof...    198   1e-52    
ref|XP_009420212.1|  PREDICTED: transcription factor bHLH112-like...    198   1e-52    
ref|NP_001044465.2|  Os01g0784900                                       197   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418756.1|  PREDICTED: transcription factor bHLH112-like...    196   2e-52    
ref|XP_006594800.1|  PREDICTED: transcription factor bHLH123-like...    198   2e-52    
ref|XP_010547092.1|  PREDICTED: transcription factor bHLH112 isof...    197   2e-52    
ref|XP_004976935.1|  PREDICTED: transcription factor bHLH112-like       197   3e-52    
gb|EEC71608.1|  hypothetical protein OsI_04012                          196   3e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_006300501.1|  hypothetical protein CARUB_v10020420mg             196   3e-52    
ref|XP_010694303.1|  PREDICTED: transcription factor bHLH123 isof...    197   7e-52    
ref|XP_010547064.1|  PREDICTED: transcription factor bHLH112 isof...    196   7e-52    
gb|EMT01196.1|  Transcription factor bHLH112                            196   7e-52    
ref|XP_010694302.1|  PREDICTED: transcription factor bHLH123 isof...    197   8e-52    
ref|NP_001055968.1|  Os05g0501200                                       192   8e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644815.1|  PREDICTED: transcription factor bHLH123-like       194   1e-51    
ref|XP_004487635.1|  PREDICTED: transcription factor bHLH123-like...    196   2e-51    
ref|XP_004487634.1|  PREDICTED: transcription factor bHLH123-like...    196   2e-51    
ref|XP_004970205.1|  PREDICTED: transcription factor bHLH123-like...    195   2e-51    
ref|XP_006475253.1|  PREDICTED: transcription factor bHLH123-like...    195   2e-51    
ref|XP_010430180.1|  PREDICTED: transcription factor bHLH112 isof...    193   3e-51    
ref|XP_010665766.1|  PREDICTED: transcription factor bHLH112            195   3e-51    
gb|KFK40679.1|  hypothetical protein AALP_AA2G027200                    192   9e-51    
ref|XP_002886524.1|  hypothetical protein ARALYDRAFT_475161             191   2e-50    
ref|NP_001144636.1|  uncharacterized protein LOC100277655               190   4e-50    Zea mays [maize]
tpg|DAA57329.1|  TPA: putative HLH DNA-binding domain superfamily...    189   5e-50    
ref|XP_004234582.1|  PREDICTED: transcription factor bHLH112-like       188   6e-50    
ref|XP_009402586.1|  PREDICTED: transcription factor bHLH123-like...    188   6e-50    
ref|XP_010473379.1|  PREDICTED: transcription factor bHLH112-like       189   1e-49    
ref|XP_010418134.1|  PREDICTED: transcription factor bHLH112            189   1e-49    
ref|XP_006655458.1|  PREDICTED: transcription factor bHLH123-like       187   1e-49    
ref|XP_009384213.1|  PREDICTED: transcription factor bHLH103-like       187   2e-49    
ref|XP_010694304.1|  PREDICTED: transcription factor bHLH123 isof...    191   2e-49    
ref|XP_010547074.1|  PREDICTED: transcription factor bHLH112 isof...    189   2e-49    
ref|XP_009402587.1|  PREDICTED: transcription factor bHLH123-like...    187   2e-49    
ref|XP_006652870.1|  PREDICTED: transcription factor bHLH112-like       189   3e-49    
gb|EMT02903.1|  Transcription factor bHLH112                            188   4e-49    
ref|XP_004487636.1|  PREDICTED: transcription factor bHLH123-like...    189   4e-49    
gb|AAD21412.1|  Hypothetical protein                                    184   4e-49    Arabidopsis thaliana [mouse-ear cress]
gb|KDO75640.1|  hypothetical protein CISIN_1g011373mg                   188   5e-49    
ref|XP_006467939.1|  PREDICTED: transcription factor bHLH112-like...    188   5e-49    
emb|CDY29448.1|  BnaC05g32220D                                          187   1e-48    
ref|XP_003567189.1|  PREDICTED: transcription factor bHLH123            186   1e-48    
emb|CDY19619.1|  BnaA05g20270D                                          187   1e-48    
ref|XP_006391984.1|  hypothetical protein EUTSA_v10023487mg             185   3e-48    
ref|XP_006391985.1|  hypothetical protein EUTSA_v10023487mg             185   4e-48    
ref|XP_010466266.1|  PREDICTED: transcription factor bHLH123            186   5e-48    
ref|XP_009104936.1|  PREDICTED: transcription factor bHLH112 isof...    183   6e-48    
emb|CDY49037.1|  BnaA01g22830D                                          183   7e-48    
emb|CAJ86024.1|  B0808H03.1                                             184   8e-48    Oryza sativa [red rice]
emb|CDM84514.1|  unnamed protein product                                183   9e-48    
ref|NP_001053983.1|  Os04g0631600                                       184   1e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104922.1|  PREDICTED: transcription factor bHLH112 isof...    183   1e-47    
gb|EAY95687.1|  hypothetical protein OsI_17552                          184   1e-47    Oryza sativa Indica Group [Indian rice]
emb|CDY25292.1|  BnaC01g29610D                                          182   1e-47    
ref|XP_002447167.1|  hypothetical protein SORBIDRAFT_06g029680          184   2e-47    Sorghum bicolor [broomcorn]
ref|XP_009420210.1|  PREDICTED: transcription factor bHLH112-like...    184   3e-47    
ref|XP_010544250.1|  PREDICTED: transcription factor bHLH123-like       183   3e-47    
ref|XP_009104950.1|  PREDICTED: transcription factor bHLH112 isof...    181   5e-47    
ref|XP_009405008.1|  PREDICTED: transcription factor bHLH112-like       180   6e-47    
ref|XP_010545555.1|  PREDICTED: transcription factor bHLH123 isof...    182   7e-47    
ref|XP_009104927.1|  PREDICTED: transcription factor bHLH112 isof...    181   8e-47    
ref|XP_006406363.1|  hypothetical protein EUTSA_v10020666mg             182   9e-47    
ref|XP_009145606.1|  PREDICTED: transcription factor bHLH123 isof...    182   9e-47    
ref|XP_010545557.1|  PREDICTED: transcription factor bHLH123 isof...    182   1e-46    
ref|XP_008668450.1|  PREDICTED: uncharacterized protein LOC100383...    181   2e-46    
ref|XP_006297611.1|  hypothetical protein CARUB_v10013632mg             181   2e-46    
ref|XP_009135702.1|  PREDICTED: transcription factor bHLH123-like...    180   2e-46    
ref|XP_008668451.1|  PREDICTED: uncharacterized protein LOC100383...    181   2e-46    
ref|XP_009135703.1|  PREDICTED: transcription factor bHLH123-like...    180   2e-46    
ref|XP_004972712.1|  PREDICTED: transcription factor bHLH123-like       179   5e-46    
ref|XP_004961600.1|  PREDICTED: transcription factor bHLH112-like       177   5e-46    
emb|CDY32387.1|  BnaC03g41710D                                          179   6e-46    
ref|XP_002445156.1|  hypothetical protein SORBIDRAFT_07g004980          177   2e-45    Sorghum bicolor [broomcorn]
ref|XP_009110325.1|  PREDICTED: transcription factor bHLH123-like...    177   3e-45    
emb|CDY55587.1|  BnaA01g36370D                                          177   3e-45    
ref|XP_009110318.1|  PREDICTED: transcription factor bHLH123-like...    177   3e-45    
dbj|BAK01805.1|  predicted protein                                      174   4e-45    
ref|NP_001152376.1|  DNA binding protein                                177   5e-45    Zea mays [maize]
ref|XP_002440027.1|  hypothetical protein SORBIDRAFT_09g024720          173   1e-44    Sorghum bicolor [broomcorn]
gb|KFK39385.1|  hypothetical protein AALP_AA3G238100                    175   2e-44    
ref|XP_003566069.1|  PREDICTED: transcription factor bHLH123-like       171   2e-44    
ref|NP_188700.1|  transcription factor bHLH123                          174   4e-44    Arabidopsis thaliana [mouse-ear cress]
emb|CDX82232.1|  BnaA03g35890D                                          173   7e-44    
dbj|BAB02240.1|  unnamed protein product                                174   2e-43    Arabidopsis thaliana [mouse-ear cress]
emb|CDY43070.1|  BnaCnng10760D                                          171   6e-43    
gb|EAZ05804.1|  hypothetical protein OsI_28041                          170   1e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_006362967.1|  PREDICTED: transcription factor bHLH123-like       157   7e-42    
ref|XP_010538175.1|  PREDICTED: transcription factor bHLH103 isof...    163   1e-41    
ref|XP_010538167.1|  PREDICTED: transcription factor bHLH103 isof...    163   2e-41    
ref|XP_006449161.1|  hypothetical protein CICLE_v10015039mg             166   2e-41    
ref|NP_001191254.1|  uncharacterized protein LOC100533153               157   5e-41    
gb|KGN64594.1|  hypothetical protein Csa_1G070590                       162   1e-40    
gb|KEH19697.1|  BHLH transcription factor-like protein                  162   2e-40    
ref|XP_003571405.1|  PREDICTED: transcription factor bHLH112-like       161   3e-40    
gb|EPS73915.1|  hypothetical protein M569_00841                         153   3e-40    
ref|XP_008441703.1|  PREDICTED: transcription factor bHLH112-like...    160   4e-40    
gb|KDO74385.1|  hypothetical protein CISIN_1g043722mg                   161   8e-40    
ref|XP_008366245.1|  PREDICTED: transcription factor bHLH123-like...    160   2e-39    
ref|NP_001175413.1|  Os08g0179400                                       160   3e-39    
ref|NP_001170271.1|  putative HLH DNA-binding domain superfamily ...    159   3e-39    Zea mays [maize]
ref|XP_009377293.1|  PREDICTED: transcription factor bHLH123-like...    159   5e-39    
ref|XP_008662298.1|  PREDICTED: uncharacterized protein LOC100502...    158   7e-39    
ref|XP_006849290.1|  hypothetical protein AMTR_s00167p00019840          147   1e-37    
ref|NP_001185285.1|  transcription factor bHLH112                       153   2e-37    
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    159   3e-37    
dbj|BAD12937.1|  bHLH transcription factor (bHLH123)-like protein       153   5e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010920705.1|  PREDICTED: transcription factor bHLH68-like        149   1e-36    
ref|NP_001169880.1|  putative HLH DNA-binding domain superfamily ...    151   2e-36    Zea mays [maize]
ref|XP_010530401.1|  PREDICTED: transcription factor bHLH103-like       148   2e-36    
ref|NP_001240956.1|  uncharacterized protein LOC100777095               146   2e-35    
ref|XP_010938699.1|  PREDICTED: transcription factor bHLH113            144   3e-35    
emb|CDY46374.1|  BnaA09g19880D                                          145   3e-35    
ref|XP_006833385.1|  hypothetical protein AMTR_s00109p00114170          144   7e-35    
ref|XP_007160320.1|  hypothetical protein PHAVU_002G311700g             145   7e-35    
ref|XP_004513012.1|  PREDICTED: transcription factor bHLH68-like        145   8e-35    
ref|XP_006396624.1|  hypothetical protein EUTSA_v10029319mg             144   1e-34    
emb|CDO98010.1|  unnamed protein product                                144   1e-34    
ref|XP_009628051.1|  PREDICTED: transcription factor bHLH68-like ...    144   1e-34    
ref|XP_003530506.1|  PREDICTED: transcription factor bHLH68 isofo...    144   1e-34    
gb|ABK26980.1|  unknown                                                 144   1e-34    Picea sitchensis
ref|NP_849836.1|  transcription factor bHLH112                          144   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847873.1|  hypothetical protein AMTR_s00029p00092220          143   1e-34    
ref|XP_009774581.1|  PREDICTED: transcription factor bHLH68-like ...    142   2e-34    
gb|KFK32220.1|  hypothetical protein AALP_AA6G213400                    142   3e-34    
ref|XP_009397264.1|  PREDICTED: transcription factor bHLH113-like       141   3e-34    
gb|AID21616.1|  At4g21340p-like protein                                 142   3e-34    
gb|AID21579.1|  AT4G21340p                                              142   4e-34    
ref|XP_008441707.1|  PREDICTED: transcription factor bHLH133-like...    142   4e-34    
gb|AID21605.1|  At4g21340p-like protein                                 142   4e-34    
ref|XP_010271336.1|  PREDICTED: transcription factor bHLH113            141   5e-34    
ref|XP_008789390.1|  PREDICTED: uncharacterized protein LOC103706900    139   5e-34    
ref|XP_006343090.1|  PREDICTED: transcription factor bHLH68-like        142   7e-34    
ref|XP_002325008.2|  hypothetical protein POPTR_0018s09060g             142   8e-34    
gb|ABK94460.1|  unknown                                                 142   8e-34    
emb|CCI61496.1|  unnamed protein product                                141   9e-34    
ref|XP_011048370.1|  PREDICTED: transcription factor bHLH68             142   1e-33    
ref|XP_009608011.1|  PREDICTED: transcription factor bHLH68-like        140   2e-33    
ref|XP_006579394.1|  PREDICTED: uncharacterized protein LOC100777...    141   2e-33    
ref|XP_010249647.1|  PREDICTED: transcription factor bHLH68-like        140   2e-33    
ref|XP_011078299.1|  PREDICTED: transcription factor bHLH68             140   3e-33    
gb|AFK44804.1|  unknown                                                 136   3e-33    
gb|ACN21652.1|  putative basic helix-loop-helix protein BHLH16          136   4e-33    
ref|XP_008462744.1|  PREDICTED: transcription factor bHLH68 isofo...    140   5e-33    
emb|CBI22512.3|  unnamed protein product                                136   5e-33    
gb|AGN12875.1|  putative transcription factor bHLH103                   139   6e-33    
ref|XP_009395038.1|  PREDICTED: transcription factor bHLH133-like       139   6e-33    
ref|XP_004235685.1|  PREDICTED: transcription factor bHLH68             139   6e-33    
gb|KHG21853.1|  Transcription factor bHLH68 -like protein               139   6e-33    
ref|XP_008242571.1|  PREDICTED: transcription factor bHLH68             140   7e-33    
ref|XP_009628050.1|  PREDICTED: transcription factor bHLH68-like ...    139   7e-33    
ref|XP_006356148.1|  PREDICTED: transcription factor bHLH68-like ...    139   1e-32    
ref|XP_009774580.1|  PREDICTED: transcription factor bHLH68-like ...    137   2e-32    
ref|XP_004241742.1|  PREDICTED: transcription factor bHLH68-like ...    138   2e-32    
ref|XP_002527479.1|  transcription factor, putative                     135   2e-32    
ref|XP_010254734.1|  PREDICTED: transcription factor bHLH110-like...    139   2e-32    
ref|XP_007204357.1|  hypothetical protein PRUPE_ppa007164mg             139   3e-32    
gb|KHN41646.1|  Transcription factor bHLH68                             138   3e-32    
ref|XP_009134667.1|  PREDICTED: transcription factor bHLH103            136   3e-32    
ref|XP_006346516.1|  PREDICTED: transcription factor bHLH113-like       135   3e-32    
gb|KDO47961.1|  hypothetical protein CISIN_1g036196mg                   136   3e-32    
gb|KHG24213.1|  Transcription factor protein                            135   4e-32    
gb|AEL97574.1|  bHLH                                                    137   5e-32    
ref|XP_009620310.1|  PREDICTED: transcription factor bHLH68             137   5e-32    
ref|XP_006486976.1|  PREDICTED: transcription factor bHLH113-like       135   6e-32    
ref|XP_008779448.1|  PREDICTED: transcription factor bHLH113-like       134   6e-32    
ref|XP_002269988.1|  PREDICTED: transcription factor bHLH113 isof...    134   7e-32    
ref|XP_010323419.1|  PREDICTED: transcription factor bHLH68-like        137   7e-32    
ref|XP_003637888.1|  Transcription factor bHLH68                        135   7e-32    
ref|XP_004503451.1|  PREDICTED: transcription factor bHLH68-like ...    134   7e-32    
ref|XP_006465638.1|  PREDICTED: transcription factor bHLH68-like ...    136   8e-32    
ref|XP_002982885.1|  hypothetical protein SELMODRAFT_117274             130   8e-32    
ref|XP_006465639.1|  PREDICTED: transcription factor bHLH68-like ...    136   8e-32    
ref|XP_010100638.1|  hypothetical protein L484_002738                   137   9e-32    
gb|KDO56950.1|  hypothetical protein CISIN_1g019574mg                   136   1e-31    
ref|XP_010647961.1|  PREDICTED: transcription factor bHLH113 isof...    135   1e-31    
gb|KDO56951.1|  hypothetical protein CISIN_1g019574mg                   136   1e-31    
gb|ACN21651.1|  putative basic helix-loop-helix protein BHLH15          134   1e-31    
ref|XP_010925897.1|  PREDICTED: transcription factor bHLH68-like        136   1e-31    
ref|XP_006579393.1|  PREDICTED: uncharacterized protein LOC100777...    136   1e-31    
gb|ABN05289.1|  hypothetical protein At4g21340                          135   1e-31    
ref|XP_006426930.1|  hypothetical protein CICLE_v10026009mg             136   1e-31    
emb|CDY39156.1|  BnaC09g21880D                                          134   1e-31    
ref|XP_010923557.1|  PREDICTED: transcription factor bHLH113-like...    133   2e-31    
ref|XP_008462743.1|  PREDICTED: transcription factor bHLH68 isofo...    136   2e-31    
ref|XP_004970207.1|  PREDICTED: transcription factor bHLH123-like...    136   2e-31    
ref|XP_002514268.1|  transcription factor, putative                     136   2e-31    
ref|XP_004487637.1|  PREDICTED: transcription factor bHLH123-like...    137   2e-31    
ref|XP_006341272.1|  PREDICTED: transcription factor bHLH68-like ...    135   2e-31    
ref|XP_010254048.1|  PREDICTED: transcription factor bHLH68-like        135   2e-31    
ref|XP_008793073.1|  PREDICTED: transcription factor bHLH68-like ...    135   2e-31    
ref|XP_002284145.1|  PREDICTED: transcription factor bHLH68             135   3e-31    
ref|XP_006422897.1|  hypothetical protein CICLE_v10028922mg             134   3e-31    
ref|XP_007042552.1|  Basic helix-loop-helix DNA-binding superfami...    133   3e-31    
ref|XP_004241741.1|  PREDICTED: transcription factor bHLH68-like ...    135   3e-31    
emb|CAN77172.1|  hypothetical protein VITISV_041271                     135   3e-31    
ref|XP_007024222.1|  Basic helix-loop-helix DNA-binding superfami...    134   4e-31    
gb|AFK35850.1|  unknown                                                 134   4e-31    
ref|XP_006383713.1|  hypothetical protein POPTR_0005s25240g             134   6e-31    
ref|XP_002457528.1|  hypothetical protein SORBIDRAFT_03g008830          130   6e-31    
ref|XP_010915876.1|  PREDICTED: transcription factor bHLH68-like ...    134   7e-31    
ref|XP_006408924.1|  hypothetical protein EUTSA_v10002020mg             134   8e-31    
emb|CDY62906.1|  BnaC01g41100D                                          132   9e-31    
ref|XP_004503450.1|  PREDICTED: transcription factor bHLH68-like ...    133   9e-31    
ref|XP_008793074.1|  PREDICTED: transcription factor bHLH68-like ...    133   9e-31    
gb|KHG01483.1|  Transcription factor bHLH68 -like protein               133   9e-31    
gb|AID21683.1|  At4g21340p-like protein                                 132   9e-31    
ref|XP_007215744.1|  hypothetical protein PRUPE_ppa009187mg             132   1e-30    
gb|AID21651.1|  At4g21340p-like protein                                 132   1e-30    
emb|CDY67445.1|  BnaAnng24280D                                          132   1e-30    
dbj|BAK00706.1|  predicted protein                                      134   1e-30    
ref|XP_006383714.1|  hypothetical protein POPTR_0005s25240g             134   1e-30    
ref|XP_002299721.1|  hypothetical protein POPTR_0001s18660g             132   1e-30    
ref|XP_009419079.1|  PREDICTED: transcription factor bHLH113-like       130   2e-30    
gb|KEH27144.1|  BHLH transcription factor-like protein                  132   2e-30    
ref|XP_006413790.1|  hypothetical protein EUTSA_v10025811mg             132   2e-30    
gb|AID21630.1|  At4g21340p-like protein                                 131   2e-30    
gb|ADQ37370.1|  unknown                                                 132   2e-30    
ref|XP_002307676.2|  hypothetical protein POPTR_0005s25240g             134   3e-30    
ref|XP_010940117.1|  PREDICTED: transcription factor bHLH110-like       127   3e-30    
gb|ABV21210.1|  At4g21340                                               131   3e-30    
ref|XP_010556003.1|  PREDICTED: transcription factor bHLH113 isof...    130   3e-30    
ref|XP_010456929.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    131   3e-30    
ref|NP_193865.2|  transcription factor bHLH103                          131   3e-30    
ref|XP_010466100.1|  PREDICTED: transcription factor bHLH113-like...    130   3e-30    
ref|XP_006290049.1|  hypothetical protein CARUB_v10003683mg             131   3e-30    
ref|XP_010062499.1|  PREDICTED: transcription factor bHLH68-like ...    132   3e-30    
ref|XP_011072388.1|  PREDICTED: transcription factor bHLH68-like ...    132   3e-30    
emb|CDP03300.1|  unnamed protein product                                132   3e-30    
ref|XP_009380570.1|  PREDICTED: transcription factor bHLH68-like ...    131   4e-30    
ref|XP_010466099.1|  PREDICTED: transcription factor bHLH113-like...    130   4e-30    
ref|XP_010263576.1|  PREDICTED: transcription factor bHLH110-like...    133   5e-30    
ref|XP_011080686.1|  PREDICTED: transcription factor bHLH68-like        131   5e-30    
ref|XP_007013110.1|  Basic helix-loop-helix DNA-binding superfami...    131   5e-30    
gb|ADQ37380.1|  unknown                                                 130   5e-30    
ref|XP_002869892.1|  hypothetical protein ARALYDRAFT_492747             130   5e-30    
ref|XP_009409460.1|  PREDICTED: transcription factor bHLH68-like ...    131   6e-30    
ref|XP_009409459.1|  PREDICTED: transcription factor bHLH68-like ...    131   6e-30    
ref|XP_004170414.1|  PREDICTED: transcription factor bHLH112-like       131   7e-30    
ref|XP_009336861.1|  PREDICTED: transcription factor bHLH68-like ...    131   7e-30    
ref|XP_003530507.1|  PREDICTED: transcription factor bHLH68 isofo...    131   7e-30    
ref|XP_010049661.1|  PREDICTED: transcription factor bHLH68-like        131   7e-30    
ref|XP_008785926.1|  PREDICTED: transcription factor bHLH113-like       129   8e-30    
ref|XP_010439490.1|  PREDICTED: transcription factor bHLH103-like       130   9e-30    
ref|XP_010487895.1|  PREDICTED: transcription factor bHLH113            129   9e-30    
gb|EYU32948.1|  hypothetical protein MIMGU_mgv1a013049mg                128   1e-29    
ref|XP_002885391.1|  hypothetical protein ARALYDRAFT_342218             132   1e-29    
ref|XP_010434190.1|  PREDICTED: transcription factor bHLH103-like       129   1e-29    
ref|XP_010688253.1|  PREDICTED: transcription factor bHLH68             131   1e-29    
ref|XP_010538192.1|  PREDICTED: transcription factor bHLH103 isof...    129   1e-29    
ref|XP_011010531.1|  PREDICTED: transcription factor bHLH68-like ...    129   1e-29    
emb|CAB81059.1|  putative protein                                       129   1e-29    
ref|XP_009114498.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    129   1e-29    
ref|XP_009370127.1|  PREDICTED: transcription factor bHLH113-like       128   1e-29    
ref|XP_011048803.1|  PREDICTED: transcription factor bHLH110-like...    130   2e-29    
ref|XP_006341273.1|  PREDICTED: transcription factor bHLH68-like ...    130   2e-29    
gb|AFK45495.1|  unknown                                                 130   2e-29    
ref|XP_006589632.1|  PREDICTED: transcription factor bHLH113-like       128   2e-29    
ref|XP_010556002.1|  PREDICTED: transcription factor bHLH113 isof...    127   2e-29    
gb|KHN06774.1|  Transcription factor bHLH113                            128   2e-29    
ref|NP_192426.2|  transcription factor bHLH114                          127   2e-29    
ref|XP_010449084.1|  PREDICTED: transcription factor bHLH103-like       129   2e-29    
ref|XP_009777548.1|  PREDICTED: transcription factor bHLH68             129   2e-29    
gb|AID21676.1|  At4g21340p-like protein                                 128   3e-29    
ref|XP_002510430.1|  transcription factor, putative                     130   3e-29    
emb|CBI17458.3|  unnamed protein product                                124   3e-29    
ref|XP_004142511.1|  PREDICTED: transcription factor bHLH68-like        130   3e-29    
gb|KDO75641.1|  hypothetical protein CISIN_1g011373mg                   130   3e-29    
ref|XP_007143069.1|  hypothetical protein PHAVU_007G041200g             127   3e-29    
ref|XP_006643643.1|  PREDICTED: uncharacterized protein LOC102705754    130   3e-29    
ref|XP_010915877.1|  PREDICTED: transcription factor bHLH68-like ...    129   3e-29    
ref|XP_011008318.1|  PREDICTED: transcription factor bHLH68-like ...    128   3e-29    
ref|XP_004171254.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    130   3e-29    
ref|XP_010047918.1|  PREDICTED: transcription factor bHLH68             129   4e-29    
ref|XP_009392306.1|  PREDICTED: transcription factor bHLH110-like       124   4e-29    
ref|XP_010647962.1|  PREDICTED: uncharacterized protein LOC100249...    127   4e-29    
ref|XP_011048801.1|  PREDICTED: transcription factor bHLH110-like...    130   4e-29    
ref|XP_008783244.1|  PREDICTED: transcription factor bHLH68-like        129   4e-29    
ref|XP_007143068.1|  hypothetical protein PHAVU_007G041200g             127   4e-29    
ref|XP_006847529.1|  hypothetical protein AMTR_s00014p00103240          129   4e-29    
ref|XP_009345063.1|  PREDICTED: transcription factor bHLH113-like       127   4e-29    
ref|XP_007222467.1|  hypothetical protein PRUPE_ppa003517mg             132   5e-29    
ref|XP_009377815.1|  PREDICTED: transcription factor bHLH68-like        128   5e-29    
ref|XP_009381049.1|  PREDICTED: transcription factor bHLH68-like ...    128   5e-29    
ref|XP_008342665.1|  PREDICTED: transcription factor bHLH68-like        128   5e-29    
ref|XP_004486757.1|  PREDICTED: transcription factor bHLH68-like        128   5e-29    
ref|XP_008367900.1|  PREDICTED: transcription factor bHLH68-like ...    129   5e-29    
emb|CDY14219.1|  BnaA08g13500D                                          129   5e-29    
ref|XP_009109051.1|  PREDICTED: transcription factor bHLH68-like        129   5e-29    
emb|CDP07480.1|  unnamed protein product                                130   5e-29    
sp|Q9M0X8.2|BH114_ARATH  RecName: Full=Transcription factor bHLH1...    127   5e-29    
ref|XP_008803478.1|  PREDICTED: transcription factor bHLH66-like        126   6e-29    
gb|KHG20931.1|  Transcription factor bHLH68 -like protein               128   6e-29    
ref|XP_009381048.1|  PREDICTED: transcription factor bHLH68-like ...    128   6e-29    
ref|XP_003597718.1|  Transcription factor bHLH68                        127   6e-29    
gb|AES67968.2|  BHLH transcription factor-like protein                  128   7e-29    
ref|XP_009758976.1|  PREDICTED: transcription factor bHLH113            126   7e-29    
ref|XP_010936524.1|  PREDICTED: transcription factor bHLH113-like...    127   7e-29    
ref|XP_008221374.1|  PREDICTED: transcription factor bHLH111            131   7e-29    
gb|AFK49339.1|  unknown                                                 127   7e-29    
ref|XP_003597717.1|  Transcription factor bHLH68                        127   7e-29    
ref|XP_010268188.1|  PREDICTED: transcription factor bHLH113-like       123   8e-29    
ref|XP_008462742.1|  PREDICTED: transcription factor bHLH68 isofo...    129   8e-29    
ref|XP_010936678.1|  PREDICTED: transcription factor bHLH110-like       129   8e-29    
gb|KDP33703.1|  hypothetical protein JCGZ_07274                         129   8e-29    
ref|XP_011092529.1|  PREDICTED: transcription factor bHLH113-like       126   9e-29    
ref|XP_008795968.1|  PREDICTED: transcription factor bHLH110            129   9e-29    
ref|XP_007201519.1|  hypothetical protein PRUPE_ppa015566mg             126   9e-29    
gb|KDP44245.1|  hypothetical protein JCGZ_05712                         122   1e-28    
ref|NP_001240881.1|  uncharacterized protein LOC100786555               127   1e-28    
ref|XP_010691655.1|  PREDICTED: transcription factor bHLH113-like       125   1e-28    
dbj|BAD44875.1|  putative ethylene-responsive protein                   128   1e-28    
ref|NP_001041771.1|  Os01g0105700                                       128   1e-28    
ref|XP_009353585.1|  PREDICTED: transcription factor bHLH68-like ...    127   1e-28    
ref|XP_003555279.1|  PREDICTED: transcription factor bHLH113-like...    126   1e-28    
ref|XP_010490296.1|  PREDICTED: transcription factor bHLH133-like       126   1e-28    
ref|XP_011001256.1|  PREDICTED: transcription factor bHLH113 isof...    126   1e-28    
ref|XP_006451208.1|  hypothetical protein CICLE_v10008684mg             127   1e-28    
ref|XP_002300244.2|  hypothetical protein POPTR_0001s30670g             125   1e-28    
ref|NP_174087.1|  transcription factor bHLH110                          129   1e-28    
ref|XP_009145780.1|  PREDICTED: transcription factor bHLH113 isof...    125   1e-28    
ref|XP_010507790.1|  PREDICTED: transcription factor bHLH113-like       125   2e-28    
ref|XP_011074574.1|  PREDICTED: transcription factor bHLH110-like...    126   2e-28    
ref|XP_007135661.1|  hypothetical protein PHAVU_010G147600g             126   2e-28    
ref|XP_010478110.1|  PREDICTED: transcription factor bHLH110 isof...    127   2e-28    
ref|XP_007017613.1|  Basic helix-loop-helix DNA-binding superfami...    128   2e-28    
gb|AAM61088.1|  unknown                                                 125   2e-28    
emb|CDX95443.1|  BnaC01g33350D                                          125   2e-28    
gb|ADQ37358.1|  unknown                                                 127   2e-28    
ref|XP_003531664.1|  PREDICTED: transcription factor bHLH68-like ...    126   2e-28    
ref|XP_009407409.1|  PREDICTED: transcription factor bHLH113-like...    124   2e-28    
ref|NP_566639.1|  transcription factor bHLH113                          125   2e-28    
ref|XP_006605977.1|  PREDICTED: transcription factor bHLH113-like...    122   2e-28    
ref|XP_011074570.1|  PREDICTED: transcription factor bHLH110-like...    126   2e-28    
ref|XP_009407410.1|  PREDICTED: transcription factor bHLH113-like...    123   2e-28    
ref|XP_008455002.1|  PREDICTED: transcription factor bHLH113            124   2e-28    
ref|XP_009409063.1|  PREDICTED: transcription factor bHLH68-like ...    124   2e-28    
ref|XP_004299993.1|  PREDICTED: transcription factor bHLH68-like        127   2e-28    
ref|XP_010478109.1|  PREDICTED: transcription factor bHLH110 isof...    128   3e-28    
ref|XP_007033750.1|  Basic helix-loop-helix DNA-binding superfami...    121   3e-28    
ref|XP_009111844.1|  PREDICTED: transcription factor bHLH113-like...    124   3e-28    
ref|XP_009380568.1|  PREDICTED: transcription factor bHLH68-like ...    126   3e-28    
ref|XP_009111836.1|  PREDICTED: transcription factor bHLH113-like...    124   3e-28    
gb|EEC69777.1|  hypothetical protein OsI_00047                          127   3e-28    
ref|XP_009380567.1|  PREDICTED: transcription factor bHLH68-like ...    126   3e-28    
ref|XP_007152861.1|  hypothetical protein PHAVU_004G166300g             126   3e-28    
ref|XP_006583063.1|  PREDICTED: transcription factor bHLH68-like ...    125   3e-28    
ref|XP_002890742.1|  hypothetical protein ARALYDRAFT_472970             127   4e-28    
ref|XP_006355783.1|  PREDICTED: transcription factor bHLH113-like...    120   4e-28    
ref|XP_004231389.1|  PREDICTED: transcription factor bHLH113-like       124   4e-28    
ref|NP_179600.2|  transcription factor bHLH133                          126   4e-28    
ref|XP_006585586.1|  PREDICTED: transcription factor bHLH68-like ...    125   4e-28    
ref|XP_004137092.1|  PREDICTED: transcription factor bHLH123-like       124   4e-28    
ref|XP_007033748.1|  Basic helix-loop-helix DNA-binding superfami...    121   4e-28    



>ref|XP_009629262.1| PREDICTED: transcription factor bHLH112-like [Nicotiana tomentosiformis]
Length=447

 Score =   346 bits (888),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 258/477 (54%), Positives = 305/477 (64%), Gaps = 90/477 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG-  1653
             MAD+F  AGVCGG +WWN +RS+FG+S C+A++I +  NFAW NN        L++MK  
Sbjct  1     MADEFQ-AGVCGG-NWWNSSRSIFGSSLCAASSIGN--NFAWPNN-------DLLDMKSS  49

Query  1652  -RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATT-DWNQA  1479
              RS+DES  S     SVVLQELPK          DST L MLGIGLS SST++T DWN  
Sbjct  50    CRSNDESGNS---DESVVLQELPKH---------DST-LQMLGIGLSSSSTSSTPDWNHT  96

Query  1478  LVQTNERA------MLQEDRNSRLNYGQEIGVECSD---------------SSFKPVAKD  1362
             ++  NERA      +LQED NS LNY QE GV+CS                +SFK   +D
Sbjct  97    MMHGNERADSSYPSILQEDLNSSLNYRQETGVDCSHELGKNFSTITEDSSRNSFK--HQD  154

Query  1361  F---------STSTPSATNFAPSY-------NYPSNllqtlldsdpqpqpqqplisnqqI  1230
             F         ST+T  +T  + S+       NYPS LLQTL D+DP P PQQ        
Sbjct  155   FTLGMNPITSSTNTDQSTVISSSFPMNSSFSNYPSALLQTLFDNDPPPPPQQQPQQQSLF  214

Query  1229  SYAPPP---PA--NFRPNLND-FSP------PLLKPTFPNAAAS-FWNQSPASLNDVRAA  1089
             +    P   PA  N+RPNLND FSP      PLL+P+ P    S F   +P SLN++R  
Sbjct  215   TNNNQPMNFPATLNYRPNLNDHFSPSLPKFPPLLRPSLPKQTPSNFPFTNPTSLNNMRG-  273

Query  1088  TFLPSTQSQFLP-SVFSDKLSKPSRKS-SNVEEARQSSSMAKKASNQEAAFKRPRIETPS  915
               LPS  SQ LP   F +K S P+  + SNVEE R+S   AKK+ N E AFKRPR+ETPS
Sbjct  274   NLLPSMHSQLLPLPTFHEKSSAPNVSAKSNVEEFRESR--AKKSGNSEPAFKRPRMETPS  331

Query  914   PLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNG  735
             PLPTFKVRKEKLGDR+TA+QQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS PYLK G
Sbjct  332   PLPTFKVRKEKLGDRITAIQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSTPYLKTG  391

Query  734   CSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              S   H Q     +++EG K +LRS+GLCLVPISSTFPVATETT+DFWTP FG +FR
Sbjct  392   -SPPLHQQTADKVKEQEGSKQDLRSRGLCLVPISSTFPVATETTTDFWTPNFGGTFR  447



>ref|XP_003635184.1| PREDICTED: transcription factor bHLH112 isoform X1 [Vitis vinifera]
 emb|CBI18658.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   342 bits (878),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 241/487 (49%), Positives = 296/487 (61%), Gaps = 93/487 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T GVCGG +WWNPAR+ F  G SPCS A +ND G+F W          ++V++K
Sbjct  1     MADEFQT-GVCGG-TWWNPARNSFIGGPSPCSTA-LNDTGSFGWPT--------EMVDIK  49

Query  1655  GRSSDESCGSASDGSSVVLQEL-----PKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTD  1491
              RS +ES  S SD SS+V Q++     P S     +M M+ST L M+G GLS SST TTD
Sbjct  50    ARSCEESA-SVSD-SSIVFQDIQKPQQPDSASGGGSMLMEST-LQMMGFGLSSSST-TTD  105

Query  1490  WNQALVQTNERA------MLQEDRNSRLNYGQEI---------------GVECSDSSFKP  1374
             WN AL++ + RA      MLQ+D +SRLN G +                G + S  + KP
Sbjct  106   WNPALIRGSGRAESNYHSMLQDDMSSRLN-GMDSPQIQKDWSPKNFSTGGEDSSICALKP  164

Query  1373  VAKDFST-------------STPSATNFA-------PSYNYPSNllqtlldsdpqpqpqq  1254
             + + F+              ST +   F+        SY YPS LLQ L D DPQPQ   
Sbjct  165   MNQGFALDQQRLNSINSSGDSTVTCQGFSSGFPMGSASYGYPSTLLQGLYDPDPQPQQYL  224

Query  1253  plisnqqISYAPPPPANFRPNLNDFSP------PLLKPTFPNAAAS----------FWNQ  1122
                 +   S      AN+R ++N+ SP      P +KP+ P    +          FWN 
Sbjct  225   FDNRSMNYSSM----ANYRTSMNELSPSWPKYSPYMKPSLPKQQPNSHLHFTNNTPFWNA  280

Query  1121  SPASLNDVRAATFLPSTQSQFLPSVFSDK--LSKPSRKSSNVEEARQSSSMAKKASNQEA  948
             S A+LND+RA+ F PS QSQFL   F +K   SK + K  N EE R S S+ KK+S  E 
Sbjct  281   SAAALNDIRAS-FFPSPQSQFLTPTFEEKPNCSKLTTKL-NTEEVRDSGSVLKKSS-AEP  337

Query  947   AFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  768
             AFKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV
Sbjct  338   AFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  397

Query  767   NVLSAPYLKNGCSV----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
             +VLS PY+KNG  +    +    +D EG K +LRS+GLCLVPISSTFPVA ETT+D+WTP
Sbjct  398   SVLSTPYMKNGAPIQPQQTSEKLKDTEGSKQDLRSRGLCLVPISSTFPVANETTADYWTP  457

Query  599   TFGASFR  579
             TFG +FR
Sbjct  458   TFGGTFR  464



>ref|XP_009764035.1| PREDICTED: transcription factor bHLH112-like [Nicotiana sylvestris]
Length=455

 Score =   340 bits (873),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 248/477 (52%), Positives = 302/477 (63%), Gaps = 82/477 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG-  1653
             MAD+F  AGVCGG +WWN +RS+FG+S C+A++I +  NFAW NN        L++MK  
Sbjct  1     MADEFQ-AGVCGG-NWWNSSRSIFGSSLCAASSIGN--NFAWPNN-------DLLDMKSS  49

Query  1652  -RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RS+DES G++ D  SVVLQELPK H Q H    DST   +     S S ++T DWN  +
Sbjct  50    CRSNDES-GNSDD--SVVLQELPKHHQQPH----DSTLQMLGIGLSSSSISSTPDWNHTM  102

Query  1475  VQTNERA------MLQEDRNSRLNYGQEIGVECS---------------DSSFKPV-AKD  1362
             +  NERA      +LQED NS LNY QE GV+CS               ++S+K V  +D
Sbjct  103   MHGNERADSSYPTILQEDLNSSLNYRQETGVDCSHELGKNFSTITEDSSNNSYKQVNHQD  162

Query  1361  F---------STSTPSATNFAPSY-------NYPSNllqtlldsdpqpqpqqplisnqqI  1230
             F         ST+T  +T  + S+       NYPS LLQTL D+DP P  QQP   +   
Sbjct  163   FTLGMNPITSSTNTDQSTVISSSFPMNSSFSNYPSALLQTLFDNDPPPHQQQPQQQSLFT  222

Query  1229  SYAPP----PPANFRPNLND-FSP------PLLKPTFPNAA-ASFWNQSPASLNDVRAAT  1086
             +   P       N+RPNLND FSP      PLL+P+ P    +SF    P SLN++R   
Sbjct  223   NNNQPMNFPVSLNYRPNLNDHFSPSLPKFPPLLRPSLPKQTPSSFPFTDPTSLNNMRG-N  281

Query  1085  FLPSTQSQFLPS--VFSDKLSKPSRKS-SNVEEARQSSSMAKKASNQEAAFKRPRIETPS  915
              LPS  SQ L     F +K S P+  + S+VE  R+S   AKK+ N E AFKRPR+ETPS
Sbjct  282   LLPSMHSQLLLQSPTFHEKSSVPNNSAKSDVEGFRESR--AKKSGNSEPAFKRPRMETPS  339

Query  914   PLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNG  735
             PLPTFKVRKEKLGDR+TA+QQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS PYLK G
Sbjct  340   PLPTFKVRKEKLGDRITAIQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSTPYLKTG  399

Query  734   CSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              S   H Q     +++EG K +LRS+GLCLVPISSTFPVATETT+DFWTP FG +FR
Sbjct  400   -SPPLHQQSADKVKEQEGSKQDLRSRGLCLVPISSTFPVATETTTDFWTPNFGGTFR  455



>ref|XP_010646711.1| PREDICTED: transcription factor bHLH112 isoform X2 [Vitis vinifera]
Length=462

 Score =   335 bits (859),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 294/487 (60%), Gaps = 95/487 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T GVCGG +WWNPAR+ F  G SPCS A +ND G+F W          ++V++K
Sbjct  1     MADEFQT-GVCGG-TWWNPARNSFIGGPSPCSTA-LNDTGSFGWPT--------EMVDIK  49

Query  1655  GRSSDESCGSASDGSSVVLQEL-----PKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTD  1491
              RS +ES  S SD SS+V Q++     P S     +M M+ST L M+G GLS SST TTD
Sbjct  50    ARSCEESA-SVSD-SSIVFQDIQKPQQPDSASGGGSMLMEST-LQMMGFGLSSSST-TTD  105

Query  1490  WNQALVQTNERA------MLQEDRNSRLNYGQEI---------------GVECSDSSFKP  1374
             WN AL++ + RA      MLQ+D +SRLN G +                G + S  + KP
Sbjct  106   WNPALIRGSGRAESNYHSMLQDDMSSRLN-GMDSPQIQKDWSPKNFSTGGEDSSICALKP  164

Query  1373  VAKDFST-------------STPSATNFA-------PSYNYPSNllqtlldsdpqpqpqq  1254
             + + F+              ST +   F+        SY YPS LLQ L D DPQPQ   
Sbjct  165   MNQGFALDQQRLNSINSSGDSTVTCQGFSSGFPMGSASYGYPSTLLQGLYDPDPQPQQYL  224

Query  1253  plisnqqISYAPPPPANFRPNLNDFSP------PLLKPTFPNAAAS----------FWNQ  1122
                 +   S      AN+R ++N+ SP      P +KP+ P    +          FWN 
Sbjct  225   FDNRSMNYSSM----ANYRTSMNELSPSWPKYSPYMKPSLPKQQPNSHLHFTNNTPFWNA  280

Query  1121  SPASLNDVRAATFLPSTQSQFLPSVFSDK--LSKPSRKSSNVEEARQSSSMAKKASNQEA  948
             S A+LND+RA+ F PS QSQFL   F +K   SK + K  N EE R S S+ KK+S  E 
Sbjct  281   SAAALNDIRAS-FFPSPQSQFLTPTFEEKPNCSKLTTKL-NTEEVRDSGSVLKKSS-AEP  337

Query  947   AFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  768
             AFKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ 
Sbjct  338   AFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ-  396

Query  767   NVLSAPYLKNGCSV----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
              VLS PY+KNG  +    +    +D EG K +LRS+GLCLVPISSTFPVA ETT+D+WTP
Sbjct  397   -VLSTPYMKNGAPIQPQQTSEKLKDTEGSKQDLRSRGLCLVPISSTFPVANETTADYWTP  455

Query  599   TFGASFR  579
             TFG +FR
Sbjct  456   TFGGTFR  462



>ref|XP_004232764.1| PREDICTED: transcription factor bHLH112 [Solanum lycopersicum]
Length=440

 Score =   330 bits (847),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 228/470 (49%), Positives = 286/470 (61%), Gaps = 83/470 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG-  1653
             MAD++  A VCGG  WWN +RS+FG+S C+++      NFAW N+        L++MK  
Sbjct  1     MADEYQ-ASVCGGN-WWNSSRSIFGSSLCASSVPLGNSNFAWTND-------HLLDMKSS  51

Query  1652  -RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RS+DES  S     SVVLQELPK          DST L +LG GL+ SST   +W+  L
Sbjct  52    CRSNDESGNS---DESVVLQELPK---------HDST-LQILGSGLNSSST-NDNWSHTL  97

Query  1475  VQTNERA-------MLQEDRNSRLNYGQEIGVECSDSSFK---------PVA-------K  1365
             +  N+R+       + QED NS +NY QE GV+CS +SFK         P+         
Sbjct  98    MHGNDRSESSYPSILQQEDINSSMNYQQESGVDCSSNSFKQDFTLGMNHPITSSTNTHHD  157

Query  1364  DFSTSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYAP----PPPANFR  1197
               S++ P  ++F+   NYPS LLQTL D+DP  Q Q         +  P        N+R
Sbjct  158   QISSTFPMNSSFS---NYPSALLQTLFDNDPPQQQQLQQSLFATNNNQPMNFPTSSLNYR  214

Query  1196  PNLNDFSPPLLKPTFPN---------------------AAASFWNQSPA-SLNDVRAATF  1083
             P+LNDFSP +  P FPN                     A AS +N S A SLN++RA T 
Sbjct  215   PDLNDFSPSM--PKFPNSLLIPKQTTTPSNHFPNYSLNATASLYNTSSATSLNNMRA-TL  271

Query  1082  LPSTQSQFLPS-VFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPL  909
             +PS   Q L S  F+D    P+    S VE+ R+S  ++KK+   EA  KR RIETPSPL
Sbjct  272   MPSMHPQILQSPTFNDNSRAPNVTPKSKVEDLRESR-VSKKSVTNEATLKRARIETPSPL  330

Query  908   PTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCS  729
             PTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVN LS PYLKNG +
Sbjct  331   PTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNALSTPYLKNGST  390

Query  728   VSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              +QH Q  ++ ++ +LRS+GLCLVPISSTFPVATE+++DFWTP FG +FR
Sbjct  391   TTQHQQIADKVKEEDLRSRGLCLVPISSTFPVATESSTDFWTPNFGGTFR  440



>emb|CDO99682.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   319 bits (818),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 221/484 (46%), Positives = 283/484 (58%), Gaps = 83/484 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MAD+F    VCGG SWWN +RSMFG+SPCS+  ++D+G+F W+           ++ K R
Sbjct  1     MADEFQ-GEVCGG-SWWNSSRSMFGSSPCSSGILHDLGSFGWST--------DFLDSKAR  50

Query  1649  SSDESCG-SASDGSSVVLQEL-----PKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
             SSD+  G SA+   S+V+Q+L     P+S     N+S+DST L +LGIGLS  S +TTDW
Sbjct  51    SSDDQSGNSANSDGSIVIQDLQKPNQPESASNNSNLSIDST-LQILGIGLS--SPSTTDW  107

Query  1487  NQALV---------QTNERAML------------------------QEDRNSRL--NYGQ  1413
             ++ L+         Q+N + ML                        Q+D +S L  N+  
Sbjct  108   DRTLMHGSSNGRSDQSNYQPMLQEDHNSSMNYRQERGLDSCPADQIQKDWSSTLKNNFST  167

Query  1412  EIGVECSDSSFK-----PVAKDFSTSTPSATNFAP-SYNYPSNllqtlldsdpqpqpqqp  1251
              +  + S +SFK     P+    +TS  +A   A  S ++P +       S         
Sbjct  168   IVEEDSSINSFKSSGNQPLNSITTTSQCTAATCAGVSTSFPISSASYGYSSTLLQTLFDT  227

Query  1250  lisnqqISYAPPPPANFRPNL---NDFSPPLLK----PTFPNAAA-------SFWNQSPA  1113
              +   Q S     P N+       N+FSP L K    P   N  +       +F N S A
Sbjct  228   EVPQPQQSLYGTRPMNYPSTTSYQNEFSPSLPKFSPLPKLQNTNSLQLSTNPNFCNGSAA  287

Query  1112  SLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKKASNQEAAFK  939
             + ND+R   F PS QSQF  S F++K S PS   K SN +  R   S+AKK+S+ E AFK
Sbjct  288   AFNDLRV-NFFPSVQSQFPSSTFNEKPSLPSITTKVSN-DGIRGLGSVAKKSSS-EPAFK  344

Query  938   RPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVL  759
             RPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAI+YIKFLHDQVNVL
Sbjct  345   RPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVNVL  404

Query  758   SAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFG  591
             S PYLKNG  + +       +D+EG K +L+S+GLCLVPISSTFPVA ETT+DFWTPTFG
Sbjct  405   STPYLKNGSPIQRQQASDKVKDQEGSKEDLKSRGLCLVPISSTFPVAAETTTDFWTPTFG  464

Query  590   ASFR  579
              +FR
Sbjct  465   GTFR  468



>ref|XP_007025886.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY28508.1| Transcription factor, putative [Theobroma cacao]
Length=466

 Score =   317 bits (811),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 226/487 (46%), Positives = 283/487 (58%), Gaps = 91/487 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFG--ASPCSAATINDMGNF-AWAnnddhhhhHQLVNM  1659
             MA++F  AG+CGG +WWN ++SMF   +SPCSA  I DMG+F +W           +V+ 
Sbjct  1     MAEEFH-AGICGG-TWWNSSKSMFSGCSSPCSAG-IADMGSFGSWG--------ADMVDT  49

Query  1658  K-GRSSDESCGSASDGSSVVLQELPKSHHQTHNMS------MDSTHLHMLGIGLSPSSTA  1500
             K  RS D+   ++   SS+V Q   +   Q  + S      +DST L M+G GL  SS+ 
Sbjct  50    KAARSCDQESNNSVSDSSIVFQGAHQKPQQADSDSGGSSILIDST-LQMMGFGL--SSST  106

Query  1499  TTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECS----------------DSS  1383
             T+DWNQ+L+++N R     ++LQED NSRL+  QE G++ S                DSS
Sbjct  107   TSDWNQSLLRSNGRTESYNSILQEDINSRLSCRQETGMDSSQIQKNWSPKTYASPGEDSS  166

Query  1382  ---FKPVAKDFST-----STPSATNF-------APSYNYPSNllqtlldsdpqpqpqqpl  1248
                FKP+ +DFS      STP+           + SY YPS +L   L        Q  L
Sbjct  167   ITTFKPINQDFSVTKSGDSTPACQGLSAGFPMGSASYGYPSTVLLQSLFEPDPQPQQSLL  226

Query  1247  isnqqISYAPPPPANFRPNLNDFS-------PPLLKPTFPNAA----------ASFWNQS  1119
              +      +   PA +  N N+ S        P L+P+ P               FWN S
Sbjct  227   NNRSINYMS--APATYGANANELSSPPWPKLAPCLRPSLPKQQQPSSLHFSNNTPFWNAS  284

Query  1118  PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAF  942
                L+DV+A+ FLPS QSQFL   F +K + PS    +N EE R   SM K +S  E  F
Sbjct  285   STGLSDVKAS-FLPSPQSQFLAQTFDEKPNCPSLTIKTNTEEVRD--SMKKGSS--EPPF  339

Query  941   KRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNV  762
             KRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNV
Sbjct  340   KRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNV  399

Query  761   LSAPYLKNGCSVSQHHQ------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
             LS PY+K   + S   Q      ++ EG K +LRS+GLCLVPISSTFPVA ETT+DFWTP
Sbjct  400   LSTPYMKQAAAASIQQQQSPDKLKEPEGPKQDLRSRGLCLVPISSTFPVANETTADFWTP  459

Query  599   TFGASFR  579
             TFG +FR
Sbjct  460   TFGGTFR  466



>ref|XP_006377272.1| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
 gb|ABK95256.1| unknown [Populus trichocarpa]
 gb|ERP55069.1| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
Length=467

 Score =   298 bits (763),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 219/482 (45%), Positives = 277/482 (57%), Gaps = 80/482 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF--AWAnnddhhhhHQL  1668
             MA++F  AG+CG   W N ++SMF  G SPCS  ++  + MG +  +WA          +
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHMGTYNGSWATA-------DM  52

Query  1667  VNMKGRS----SDESCGSASDGSSVVLQELPKSHHQTHNMS-----MDSTHLHMLGIGLS  1515
             V++K RS       +  S SD +S+     PK      +       +DST L M+G GLS
Sbjct  53    VDLKPRSISCKESHNTTSVSD-TSIAFLNSPKPQQANSDSGGSSNLIDST-LQMMGFGLS  110

Query  1514  PSSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS--  1356
              SS++++DWNQAL+  N R     +MLQED NS      +I  + S  S+   A+DFS  
Sbjct  111   -SSSSSSDWNQALLSGNGRTESYNSMLQEDMNSGGLNSSQIRKDWSPKSYARTAEDFSLD  169

Query  1355  -----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq  1233
                         S P+   F+         SY YPS L+Q+L + D     Q   + N +
Sbjct  170   QQRLNPVNSSSNSPPTCQGFSTGFSMEPTASYCYPSTLIQSLFEPDHLQPQQVQSLFNNR  229

Query  1232  -ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLN  1104
              ++Y  P   N+  N+++ S P       L+K       AS         +WN SP  +N
Sbjct  230   PMNYLSPTAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGIN  289

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAFKRPRI  927
             D+RA+ FLPS+ SQFL   F +K + PS     N EE R S S+ KK    E AFKRPRI
Sbjct  290   DIRAS-FLPSSPSQFLLPTFQEKPNCPSLTIQPNREEVRDSVSVVKKGC--EPAFKRPRI  346

Query  926   ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY  747
             E PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PY
Sbjct  347   EAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQATVLSTPY  406

Query  746   LKNGCSVSQHHQ------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             +KNG  + QH Q       D EG K +LRS+GLCLVPISSTFPVA ETT+DFWTPTFG +
Sbjct  407   MKNGNPI-QHQQAPEDKLNDLEGPKQDLRSRGLCLVPISSTFPVANETTADFWTPTFGGT  465

Query  584   FR  579
             FR
Sbjct  466   FR  467



>ref|XP_006383985.1| hypothetical protein POPTR_0004s02870g [Populus trichocarpa]
 gb|ERP61782.1| hypothetical protein POPTR_0004s02870g [Populus trichocarpa]
Length=480

 Score =   296 bits (758),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 216/480 (45%), Positives = 279/480 (58%), Gaps = 81/480 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF-AWAnnddhhhhHQLV  1665
             MA++F  AG+CG   W N ++S+F  G SPCS  +I  + MG + +W           +V
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSVFMGGLSPCSTVSITSDHMGTYGSWTTA-------DMV  52

Query  1664  NMKGRS-----SDESCGSASDGSSVVLQ----ELPKSHHQTHNMSMDSTHLHMLGIGLSP  1512
             ++K RS     S+    S SD S   L     +   S     ++ +DST L M+G GLS 
Sbjct  53    DLKARSISCKESNHITTSVSDASIPFLNSQKPQQADSDSGGSSILIDST-LQMMGYGLSS  111

Query  1511  SSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS---  1356
             SS++++DWNQAL+  N R     +M+QE+ NS      +I  + S  S+   A+DFS   
Sbjct  112   SSSSSSDWNQALLPGNGRTESYNSMMQEEMNSGGLNSSQIQKDWSPKSYTSTAEDFSLDQ  171

Query  1355  ----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqp-qpqqplisnqq  1233
                        S P+   F+         SY YPS L+Q+L + +    Q  Q L +N+ 
Sbjct  172   QRLNPVNSSGNSPPTCQGFSTGFSMEPSASYGYPSTLIQSLFEPEYPQPQQAQSLFNNRF  231

Query  1232  ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLND  1101
             ++Y  P   N+  N+ + S P       L+KP  P    S         +WN SP  +ND
Sbjct  232   MNYLSPTAPNYGTNMTELSSPSWPKVSPLIKP-LPKQQPSTLHFTNNTPYWNASPTGIND  290

Query  1100  VRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIET  921
             +RA   LPS+QSQFL   F +K +  +  +   +E R S S+ KK S  E AFKRPRIET
Sbjct  291   IRA-NLLPSSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGS--EPAFKRPRIET  347

Query  920   PSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK  741
             PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PY+K
Sbjct  348   PSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ--VLSTPYMK  405

Query  740   NGCSVSQHHQQ-------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             NG  +  HHQQ       D EG K +LRS+GLCLVP+SSTFPVA ETT+DFWTPTFG +F
Sbjct  406   NGNPI--HHQQAPADKLNDLEGPKQDLRSRGLCLVPVSSTFPVANETTADFWTPTFGGTF  463



>ref|XP_011003381.1| PREDICTED: transcription factor bHLH112 isoform X3 [Populus euphratica]
Length=467

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 210/481 (44%), Positives = 275/481 (57%), Gaps = 78/481 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF-AWAnnddhhhhHQLV  1665
             MA++F  AG+CG   W N ++S+F  G SPCS  +I  + M  + +W           +V
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSVFMGGLSPCSTVSIASDHMETYGSWTTA-------DMV  52

Query  1664  NMKGRS-----SDESCGSASDGSSVVLQ----ELPKSHHQTHNMSMDSTHLHMLGIGLSP  1512
             ++K RS     S+    S SD S   L     +   S     ++ +DST L M+G GLS 
Sbjct  53    DLKARSISCKESNHITTSVSDTSIPFLNSQKPQQADSDSGGSSILIDST-LQMMGYGLSS  111

Query  1511  SSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS---  1356
             SS++++DWN A +  N R     +M+QE+ NS      +I  + S  S+   A+DFS   
Sbjct  112   SSSSSSDWNPAFLPGNGRTESYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQ  171

Query  1355  ----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq-  1233
                        S P+   F+         SY YPS L+Q+L + +     Q   + N + 
Sbjct  172   RRLNPVNSSGNSPPTCQGFSTGFSMEPSASYGYPSTLIQSLFEPEHPQPQQAQSLFNNRF  231

Query  1232  ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLND  1101
             ++Y  P   N+  N+ + S P       L+K + P    S         +WN SP  +ND
Sbjct  232   MNYLSPTAPNYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPTRIND  291

Query  1100  VRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIET  921
             +RA   LP +QSQFL   F +K +  +  +   +E R S S+ KK S  E AFKRPRIET
Sbjct  292   IRA-NLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGS--EPAFKRPRIET  348

Query  920   PSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK  741
             PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PY+K
Sbjct  349   PSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSVLSTPYMK  408

Query  740   NGCSVSQHHQQ-------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             NG  +  HHQQ       D EG K +LRS+GLCLVP+ STFPVA ETT+DFWTPTFG +F
Sbjct  409   NGNPI--HHQQAPADKLNDLEGPKQDLRSRGLCLVPVPSTFPVANETTADFWTPTFGGTF  466

Query  581   R  579
             R
Sbjct  467   R  467



>ref|XP_011003379.1| PREDICTED: transcription factor bHLH112 isoform X1 [Populus euphratica]
Length=483

 Score =   291 bits (745),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 209/480 (44%), Positives = 274/480 (57%), Gaps = 78/480 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF-AWAnnddhhhhHQLV  1665
             MA++F  AG+CG   W N ++S+F  G SPCS  +I  + M  + +W           +V
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSVFMGGLSPCSTVSIASDHMETYGSWTTA-------DMV  52

Query  1664  NMKGRS-----SDESCGSASDGSSVVLQ----ELPKSHHQTHNMSMDSTHLHMLGIGLSP  1512
             ++K RS     S+    S SD S   L     +   S     ++ +DST L M+G GLS 
Sbjct  53    DLKARSISCKESNHITTSVSDTSIPFLNSQKPQQADSDSGGSSILIDST-LQMMGYGLSS  111

Query  1511  SSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS---  1356
             SS++++DWN A +  N R     +M+QE+ NS      +I  + S  S+   A+DFS   
Sbjct  112   SSSSSSDWNPAFLPGNGRTESYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQ  171

Query  1355  ----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq-  1233
                        S P+   F+         SY YPS L+Q+L + +     Q   + N + 
Sbjct  172   RRLNPVNSSGNSPPTCQGFSTGFSMEPSASYGYPSTLIQSLFEPEHPQPQQAQSLFNNRF  231

Query  1232  ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLND  1101
             ++Y  P   N+  N+ + S P       L+K + P    S         +WN SP  +ND
Sbjct  232   MNYLSPTAPNYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPTRIND  291

Query  1100  VRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIET  921
             +RA   LP +QSQFL   F +K +  +  +   +E R S S+ KK S  E AFKRPRIET
Sbjct  292   IRA-NLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGS--EPAFKRPRIET  348

Query  920   PSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK  741
             PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PY+K
Sbjct  349   PSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSVLSTPYMK  408

Query  740   NGCSVSQHHQQ-------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             NG  +  HHQQ       D EG K +LRS+GLCLVP+ STFPVA ETT+DFWTPTFG +F
Sbjct  409   NGNPI--HHQQAPADKLNDLEGPKQDLRSRGLCLVPVPSTFPVANETTADFWTPTFGGTF  466



>ref|XP_011003380.1| PREDICTED: transcription factor bHLH112 isoform X2 [Populus euphratica]
Length=481

 Score =   285 bits (728),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 208/480 (43%), Positives = 272/480 (57%), Gaps = 80/480 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF-AWAnnddhhhhHQLV  1665
             MA++F  AG+CG   W N ++S+F  G SPCS  +I  + M  + +W           +V
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSVFMGGLSPCSTVSIASDHMETYGSWTTA-------DMV  52

Query  1664  NMKGRS-----SDESCGSASDGSSVVLQ----ELPKSHHQTHNMSMDSTHLHMLGIGLSP  1512
             ++K RS     S+    S SD S   L     +   S     ++ +DST L M+G GLS 
Sbjct  53    DLKARSISCKESNHITTSVSDTSIPFLNSQKPQQADSDSGGSSILIDST-LQMMGYGLSS  111

Query  1511  SSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS---  1356
             SS++++DWN A +  N R     +M+QE+ NS      +I  + S  S+   A+DFS   
Sbjct  112   SSSSSSDWNPAFLPGNGRTESYNSMMQEEMNSAGLNSSQIQKDWSPKSYTSTAEDFSLDQ  171

Query  1355  ----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq-  1233
                        S P+   F+         SY YPS L+Q+L + +     Q   + N + 
Sbjct  172   RRLNPVNSSGNSPPTCQGFSTGFSMEPSASYGYPSTLIQSLFEPEHPQPQQAQSLFNNRF  231

Query  1232  ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLND  1101
             ++Y  P   N+  N+ + S P       L+K + P    S         +WN SP  +ND
Sbjct  232   MNYLSPTAPNYGTNMTELSSPSWPKVSPLIKSSLPKQQPSTLHFTNNTPYWNASPTRIND  291

Query  1100  VRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIET  921
             +RA   LP +QSQFL   F +K +  +  +   +E R S S+ KK S  E AFKRPRIET
Sbjct  292   IRA-NLLPPSQSQFLVPAFEEKSNCSNLTTKPSKEVRDSVSVVKKGS--EPAFKRPRIET  348

Query  920   PSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK  741
             PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PY+K
Sbjct  349   PSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ--VLSTPYMK  406

Query  740   NGCSVSQHHQQ-------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             NG  +  HHQQ       D EG K +LRS+GLCLVP+ STFPVA ETT+DFWTPTFG +F
Sbjct  407   NGNPI--HHQQAPADKLNDLEGPKQDLRSRGLCLVPVPSTFPVANETTADFWTPTFGGTF  464



>ref|XP_011009499.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Populus 
euphratica]
Length=467

 Score =   283 bits (723),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 211/482 (44%), Positives = 273/482 (57%), Gaps = 80/482 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF--AWAnnddhhhhHQL  1668
             MA++F  AG+CG   W N ++SMF  G SPCS  ++  +  G +  +WA          +
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHTGTYNGSWATA-------DM  52

Query  1667  VNMKGRS----SDESCGSASDGSSVVLQELPKSHHQTHNMS-----MDSTHLHMLGIGLS  1515
             V++K RS       +  S SD +S+     PK      +       +DST L M+G  LS
Sbjct  53    VDLKPRSISCKESHNTTSVSD-TSIAFLNSPKPQQANSDSGGSSNLIDST-LQMMGFRLS  110

Query  1514  PSSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS--  1356
              SS++++DWNQAL+  N R     +MLQED NS      +I  + S  S+   A+DFS  
Sbjct  111   -SSSSSSDWNQALLSGNGRPESYNSMLQEDMNSGGLNSSQIQKDWSPKSYAKTAEDFSLD  169

Query  1355  -----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqpli-snq  1236
                         S P+   F+         SY YPS L+Q+L + D     Q   + +N+
Sbjct  170   QQRLNPVNSSSNSPPTCQGFSTGFSMEPTASYGYPSTLIQSLFEPDHPQPHQVQSLFNNR  229

Query  1235  qISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLN  1104
              ++Y  P   N+  N+++ S P       L+K       AS         +WN SP  +N
Sbjct  230   PMNYLSPAAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGIN  289

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAFKRPRI  927
             D+RA+ FLPS+ SQFL   F +K + P      N EE R S S+ KK    E  FKRPRI
Sbjct  290   DIRAS-FLPSSPSQFLLPTFEEKPNCPGLTIEPNREEVRDSVSVVKKGC--EPEFKRPRI  346

Query  926   ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY  747
             E PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH Q +VLS PY
Sbjct  347   EAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHGQASVLSTPY  406

Query  746   LKNGCSVSQHHQ------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             +KNG  + QH Q       D EG K +LRS+GLCL+P+SS FPVA ETT+DFWTPTFG +
Sbjct  407   MKNGNPI-QHQQAPEDKLNDLEGPKQDLRSRGLCLMPMSSIFPVANETTADFWTPTFGGT  465

Query  584   FR  579
             FR
Sbjct  466   FR  467



>ref|XP_011009498.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Populus 
euphratica]
Length=483

 Score =   281 bits (718),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 210/481 (44%), Positives = 271/481 (56%), Gaps = 80/481 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF--AWAnnddhhhhHQL  1668
             MA++F  AG+CG   W N ++SMF  G SPCS  ++  +  G +  +WA          +
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHTGTYNGSWATA-------DM  52

Query  1667  VNMKGRS----SDESCGSASDGSSVVLQELPKSHHQTHNMS-----MDSTHLHMLGIGLS  1515
             V++K RS       +  S SD +S+     PK      +       +DST L M+G  LS
Sbjct  53    VDLKPRSISCKESHNTTSVSD-TSIAFLNSPKPQQANSDSGGSSNLIDST-LQMMGFRLS  110

Query  1514  PSSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS--  1356
              SS++++DWNQAL+  N R     +MLQED NS      +I  + S  S+   A+DFS  
Sbjct  111   -SSSSSSDWNQALLSGNGRPESYNSMLQEDMNSGGLNSSQIQKDWSPKSYAKTAEDFSLD  169

Query  1355  -----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq  1233
                         S P+   F+         SY YPS L+Q+L + D     Q   + N +
Sbjct  170   QQRLNPVNSSSNSPPTCQGFSTGFSMEPTASYGYPSTLIQSLFEPDHPQPHQVQSLFNNR  229

Query  1232  -ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLN  1104
              ++Y  P   N+  N+++ S P       L+K       AS         +WN SP  +N
Sbjct  230   PMNYLSPAAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGIN  289

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAFKRPRI  927
             D+RA+ FLPS+ SQFL   F +K + P      N EE R S S+ KK    E  FKRPRI
Sbjct  290   DIRAS-FLPSSPSQFLLPTFEEKPNCPGLTIEPNREEVRDSVSVVKKGC--EPEFKRPRI  346

Query  926   ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY  747
             E PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH Q +VLS PY
Sbjct  347   EAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHGQASVLSTPY  406

Query  746   LKNGCSVSQHHQ------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             +KNG  + QH Q       D EG K +LRS+GLCL+P+SS FPVA ETT+DFWTPTFG +
Sbjct  407   MKNGNPI-QHQQAPEDKLNDLEGPKQDLRSRGLCLMPMSSIFPVANETTADFWTPTFGGT  465

Query  584   F  582
             F
Sbjct  466   F  466



>ref|XP_002317263.2| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
 gb|EEE97875.2| hypothetical protein POPTR_0011s03560g [Populus trichocarpa]
Length=459

 Score =   280 bits (715),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 211/476 (44%), Positives = 269/476 (57%), Gaps = 76/476 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATI--NDMGNF--AWAnnddhhhhHQL  1668
             MA++F  AG+CG   W N ++SMF  G SPCS  ++  + MG +  +WA          +
Sbjct  1     MAEEFQ-AGICGENWWMNSSKSMFIGGLSPCSTVSLPSDHMGTYNGSWATA-------DM  52

Query  1667  VNMKGRS----SDESCGSASDGSSVVLQELPKSHHQTHNMS-----MDSTHLHMLGIGLS  1515
             V++K RS       +  S SD +S+     PK      +       +DST L M+G GLS
Sbjct  53    VDLKPRSISCKESHNTTSVSD-TSIAFLNSPKPQQANSDSGGSSNLIDST-LQMMGFGLS  110

Query  1514  PSSTATTDWNQALVQTNER-----AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS--  1356
              SS++++DWNQAL+  N R     +MLQED NS      +I  + S  S+   A+DFS  
Sbjct  111   -SSSSSSDWNQALLSGNGRTESYNSMLQEDMNSGGLNSSQIRKDWSPKSYARTAEDFSLD  169

Query  1355  -----------TSTPSATNFA--------PSYNYPSNllqtlldsdpqpqpqqplisnqq  1233
                         S P+   F+         SY YPS L+Q+L + D     Q   + N +
Sbjct  170   QQRLNPVNSSSNSPPTCQGFSTGFSMEPTASYCYPSTLIQSLFEPDHLQPQQVQSLFNNR  229

Query  1232  -ISYAPPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLN  1104
              ++Y  P   N+  N+++ S P       L+K       AS         +WN SP  +N
Sbjct  230   PMNYLSPTAPNYGTNMSELSSPSWTKVSPLIKSCLQKQQASSLHFTNNTTYWNASPTGIN  289

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRK-SSNVEEARQSSSMAKKASNQEAAFKRPRI  927
             D+RA+ FLPS+ SQFL   F +K + PS     N EE R S S+ KK    E AFKRPRI
Sbjct  290   DIRAS-FLPSSPSQFLLPTFQEKPNCPSLTIQPNREEVRDSVSVVKKGC--EPAFKRPRI  346

Query  926   ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY  747
             E PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  V    Y
Sbjct  347   EAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQATVC---Y  403

Query  746   LKNGCSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             L       ++   D EG K +LRS+GLCLVPISSTFPVA ETT+DFWTPTFG +FR
Sbjct  404   LIFFFLPYEYKLNDLEGPKQDLRSRGLCLVPISSTFPVANETTADFWTPTFGGTFR  459



>gb|KDP20840.1| hypothetical protein JCGZ_21311 [Jatropha curcas]
Length=480

 Score =   278 bits (710),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 213/481 (44%), Positives = 282/481 (59%), Gaps = 82/481 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATIN--DMGNF-AWAnnddhhhhHQLV  1665
             MA++F T G+CGG  WWN ++S+F  G+SPCS   IN  DM  + +W           +V
Sbjct  1     MAEEFQT-GICGG-DWWNLSKSVFMGGSSPCSTTGINASDMEKYGSWVVT-------DVV  51

Query  1664  NMKGRS----SDESCGSASDGSSVVLQELPKSHHQTHNMS------MDSTHLHMLGIGLS  1515
             + K RS    ++    S SD S +          QT + S      +DST L M+G G+S
Sbjct  52    DWKPRSCKVSNNNDINSVSDSSVIFQDSQKPQQQQTDSDSGGSGILLDST-LQMMGFGIS  110

Query  1514  PSSTATTDWNQALVQTNERA-----MLQEDRNSRL--------NYGQEIGVECSDSSFKP  1374
              S +++++W+Q L++ N R+     +LQED +S          ++    G + S ++FK 
Sbjct  111   SSPSSSSEWSQTLLRGNGRSESYNSILQEDMSSSQIQKDWCPKSFTTSTGEDSSINAFKT  170

Query  1373  VA-KDFS------TSTPSATNFA-------PSYNYPSNllqtlldsdpqpqpqqplisnq  1236
             +  +DFS      ++T +  + +        SY YPS         D  PQPQQ L +N+
Sbjct  171   INNQDFSLNSSGNSTTTTCQDLSGGFPMGSASYGYPS--TLIQSLFDSDPQPQQSLFNNR  228

Query  1235  qISYAPPPPANFRPNLNDFSP------PLLKPTFPNAA----------ASFWNQSPASLN  1104
              I+Y+ PP  N    LN+ SP      P LK + P             A FWN +  +L 
Sbjct  229   TINYSCPP--NHGSILNELSPSWPKLAPFLKASLPKQQLASGLHFSNNAPFWNATATALT  286

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSS-NVEEARQS-SSMAKKASNQEAAFKRPR  930
             D++A+ F+ S+Q Q+L   F +K + P+  +  N EE R S SS+ KK +  E AFKRPR
Sbjct  287   DIKAS-FVTSSQPQYLLPAFEEKPNCPNLTTKHNNEEVRDSGSSVVKKGT--EPAFKRPR  343

Query  929   IETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAP  750
             IETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS P
Sbjct  344   IETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSTP  403

Query  749   YLKNGCSVSQHHQQDE-----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             Y+KNG  +      D+     EG K +LRS+GLCLVPISSTFPVA ETT+DFWTPTFG +
Sbjct  404   YMKNGNPIQHQQAADKLKDQTEGSKEDLRSRGLCLVPISSTFPVANETTADFWTPTFGGT  463

Query  584   F  582
             F
Sbjct  464   F  464



>ref|XP_007148280.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
 gb|ESW20274.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
Length=453

 Score =   273 bits (697),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 207/477 (43%), Positives = 283/477 (59%), Gaps = 90/477 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN--PARSMF--GASPCSAATINDMGNFA-WAnnddhhhhHQLV  1665
             MA++F  A +CG  SWWN  P RS+F   +S CS A   D GN++ W             
Sbjct  1     MAEEFQ-AAICGE-SWWNINPTRSVFPLMSSTCSVAAA-DAGNYSTW-------------  44

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQ-----THNMSMDSTHLHMLGIGLSPSSTA  1500
                 +S+++     S  +S+   ++ K   +     T ++ +DST L M+G G+S  S+ 
Sbjct  45    ----QSTEDINNFISSDNSLSFLDVEKPQQRDSASGTGSILIDST-LQMMGFGMS--SST  97

Query  1499  TTDWNQALVQTNERAMLQED--------RNSRL-------NYGQEIGVECSDSSFKPVAK  1365
             +++WNQ+L+ ++  ++LQE+         +S++       N+    G + +  +FK + +
Sbjct  98    SSNWNQSLLGSDFHSVLQEETGMGGGSSHDSQIQKDWSPKNFSSAAGQDSTVDAFKSMNQ  157

Query  1364  DFS----------TSTPSATNFAP----SYNYPSNllqtlldsdpqpqpqqplisnqqIS  1227
             +FS          TST S ++  P    SY YPS L+Q+L + + QPQPQ  L +N  +S
Sbjct  158   EFSLDQQSLSSVVTSTGSLSDGFPVVSASYGYPSTLIQSLYEPEAQPQPQNSLFTNPTMS  217

Query  1226  YAPPPPANFRPNLNDFSPP------LLKPTFPNA---------AASFWNQSPASLNDVRA  1092
             Y+    AN+    N+ SP       LLKP+ P             SFWN S  +L+D+RA
Sbjct  218   YSSST-ANYGTCSNELSPTWSKISSLLKPSTPKQQLSGLHFSDTTSFWNGSAEALHDIRA  276

Query  1091  ATFLPSTQSQFLPSVFSDKLSKPSRKSSNV--EEARQSSSMAKKASNQEAAFKRPRIETP  918
               F  S+Q Q+    F DK + P+   + +  EE+  ++S AKK S+ E AFKR RIETP
Sbjct  277   GVF-ASSQPQYQTPKFEDKSNTPNTLLNKLKREESPDAASSAKKNSS-EPAFKRQRIETP  334

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PY+KN
Sbjct  335   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSVLSTPYIKN  394

Query  737   GCSVSQHHQQD------EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             G  +   HQQD       EGRK +LRS+GLCLVPISSTFPVA E++ DFWTPTFG +
Sbjct  395   GAPI--QHQQDCDNLKESEGRKEDLRSRGLCLVPISSTFPVANESSVDFWTPTFGGA  449



>ref|XP_009802434.1| PREDICTED: transcription factor bHLH112-like [Nicotiana sylvestris]
Length=336

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 190/428 (44%), Positives = 245/428 (57%), Gaps = 103/428 (24%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATIND-MGNF-AWAnnddhhhhHQLVNMK  1656
             MAD++  AGVCG  SWWN  +++FG SPC+++  +D +GN  +W  +        L++MK
Sbjct  1     MADEYFQAGVCGESSWWNSTKNIFGLSPCASSIYDDPIGNLISWPIS-------DLLDMK  53

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              +                                         I LS S ++T DWN + 
Sbjct  54    TK-----------------------------------------IDLS-SPSSTLDWNHSA  71

Query  1475  ---VQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTP-SATNFAP---SY  1317
                +     +MLQED NS LNY QE GV+C +     + ++FS+ T  S+TN  P    +
Sbjct  72    NDKLDNTYPSMLQEDINSSLNYQQENGVDCPNK----LKRNFSSITEDSSTNSKPMNQDF  127

Query  1316  NYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPPLLKPTFPNAAA  1137
              Y S+LLQTL D+DP  QPQQ   +N Q        +N+R + NDF+P L          
Sbjct  128   TYYSDLLQTLFDTDPDQQPQQSFFTNNQPINCTS--SNYRQSFNDFAPSL----------  175

Query  1136  SFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSS--MAKKA  963
                   P S +++RA+          LP++ S          SN+EE R+S+S  + K  
Sbjct  176   ------PTS-SEIRAS----------LPNITS---------KSNIEEIRESTSRSLTKNN  209

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             SN E ++KRPRIETPSPLPTFKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  210   SN-EPSYKRPRIETPSPLPTFKVRKEKMGDRITALQQLVSPFGKTDTASVLQEAIEYIKF  268

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWT  603
             LHDQVNVLS  Y+K G        ++ EG K +LRSQGLCLVPISSTFPV  ETT DFWT
Sbjct  269   LHDQVNVLSNTYMKKGSPTQCQQVREREGLKQDLRSQGLCLVPISSTFPVTAETTMDFWT  328

Query  602   PTFGASFR  579
             PTFGA+F+
Sbjct  329   PTFGATFK  336



>ref|XP_003541762.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Glycine 
max]
 gb|KHN19075.1| Transcription factor bHLH112 [Glycine soja]
Length=437

 Score =   266 bits (679),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 267/456 (59%), Gaps = 62/456 (14%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN---PARSMFGASP--CSAATINDMGNFA-WAnnddhhhhHQL  1668
             MA+DF  A +CG  +WWN   P RS+F   P  CS A  +  GN++ W            
Sbjct  1     MAEDFQ-AAICGE-NWWNNINPTRSVFPLMPSTCSVAAADHAGNYSTW------QSTTDF  52

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
             V++KG     SC      +++   +  K         + ++ L M+G G   SS+ +++W
Sbjct  53    VDLKGT---RSCAELETDNNLSFLDAEKPQQSESGSILINSTLQMMGFG--KSSSTSSNW  107

Query  1487  NQALVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS----------TSTPSA  1338
             NQ+L+ +   ++LQE+  + +  G ++    +  + KP+ ++FS          TST S 
Sbjct  108   NQSLLGSGFDSVLQEE--TGIGGGSQVS---TVDALKPMNQEFSLDQQSLNSVVTSTGSL  162

Query  1337  TNFAP----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP  1170
             +   P    SY YPS L+Q+L + +PQPQ Q  L +N  +SY+    AN+    N+ SP 
Sbjct  163   SGGFPVVSASYGYPSTLIQSLYEPEPQPQQQNSLFTNPSMSYSSSS-ANYGICSNELSPT  221

Query  1169  ------LLKPTFPNAAAS---------FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK  1035
                   L KP+ P    S         FWN S  +LND+RA  F  S+Q+Q+  + F +K
Sbjct  222   WSKVSSLPKPSMPKQQLSGLHFSNNTAFWNSSAEALNDIRAGVFT-SSQAQYQTAKFEEK  280

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
              + P+   + ++  R+ S  A K ++ E AFKR RIETPSPLPTFKVRKEKLGDR+TALQ
Sbjct  281   PNCPNTLLNKLK--REESPDAAKKNSPEPAFKRQRIETPSPLPTFKVRKEKLGDRITALQ  338

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRK  690
             QLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PY+KN  +  QH Q     +D EG K
Sbjct  339   QLVSPFGKTDTASVLHEAIEYIKFLHDQVSVLSTPYMKNNGAPIQHQQDCDNLKDSEGAK  398

Query  689   AELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
              +LRS+GLCLVPISSTFPVA ET+ DFWT TFG + 
Sbjct  399   QDLRSRGLCLVPISSTFPVANETSVDFWTSTFGGAL  434



>ref|XP_002518591.1| transcription factor, putative [Ricinus communis]
 gb|EEF43978.1| transcription factor, putative [Ricinus communis]
Length=494

 Score =   268 bits (684),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 217/509 (43%), Positives = 290/509 (57%), Gaps = 107/509 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MA++F T G+CGG +WW+ +++MF  G+SPCSA   +D+G    +          + ++K
Sbjct  1     MAEEFQT-GICGG-NWWSLSKNMFMGGSSPCSAG--HDLG----STYGSWLVSDMVDHLK  52

Query  1655  GRSSDESCGSA--------SDGSSVVLQELPKSHHQTHN--------MSMDSTHLHMLGI  1524
              RSS  SC  +        SD +SVV Q+  K   Q+ +        + MD++ L M+  
Sbjct  53    PRSSI-SCKDSTNINTILVSDHNSVVFQDSHKPQQQSDSDHSGGSSSILMDNSTLQMMSF  111

Query  1523  GLSPSSTATT---DWN-QALVQTNER-----AMLQEDRNS-RLNYGQEIGVECSDSSFKP  1374
             G+S SS++++   DW+ Q L++ N R     +MLQED N+  LN   +I  + S  SF  
Sbjct  112   GISSSSSSSSPSSDWSCQTLLRGNGRGESYNSMLQEDMNTPGLNNTSQIQKDWSPKSFTS  171

Query  1373  VAKDFSTSTPSATN------------------------------FAPSYNYPSNllqtll  1284
             + +D + +   ATN                               + SY YP+ ++Q L 
Sbjct  172   IGEDSTINAYKATNQDFSLDHQQQQRLNHPTTCQNLSTSFPMGSSSASYGYPATVIQGLY  231

Query  1283  dsdpqpqpqqplisnqqIS-----YAPPPPANFRPNLNDFSP------PLLKPTFPN---  1146
             + DPQPQPQQ        S     YA P  +N+   LN+ SP      P ++P+ P    
Sbjct  232   EPDPQPQPQQQQQQQSLFSERTMNYASP--SNYGTILNELSPSWSKLAPYIRPSLPKQQQ  289

Query  1145  --AAAS---------FWN--QSPASLNDVRAATFLPS--TQSQFLPSVFSDKLSKPSRK-  1014
               AA           FWN   S  +LND++A+ F+ S  +Q Q+L   F +K + P+   
Sbjct  290   QPAAGGGLHFSNNTPFWNPSGSATALNDIKAS-FVQSNNSQPQYLMPTFEEKPNCPNVTL  348

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
               N E+ R S S+ KK S  E A KR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  349   KPNNEQVRDSGSVVKKGS--EPAIKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFG  406

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGL  666
             KTDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + QH Q    ++ EG K +L+S+GL
Sbjct  407   KTDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGNPI-QHQQAEKLKETEGLKQDLKSRGL  465

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT DFWTPTFG +FR
Sbjct  466   CLVPISSTFPVANETTVDFWTPTFGGTFR  494



>ref|XP_007148281.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
 gb|ESW20275.1| hypothetical protein PHAVU_006G195000g [Phaseolus vulgaris]
Length=451

 Score =   266 bits (679),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 206/477 (43%), Positives = 281/477 (59%), Gaps = 92/477 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN--PARSMF--GASPCSAATINDMGNFA-WAnnddhhhhHQLV  1665
             MA++F  A +CG  SWWN  P RS+F   +S CS A   D GN++ W             
Sbjct  1     MAEEFQ-AAICGE-SWWNINPTRSVFPLMSSTCSVAAA-DAGNYSTW-------------  44

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQ-----THNMSMDSTHLHMLGIGLSPSSTA  1500
                 +S+++     S  +S+   ++ K   +     T ++ +DST L M+G G+S  S+ 
Sbjct  45    ----QSTEDINNFISSDNSLSFLDVEKPQQRDSASGTGSILIDST-LQMMGFGMS--SST  97

Query  1499  TTDWNQALVQTNERAMLQED--------RNSRL-------NYGQEIGVECSDSSFKPVAK  1365
             +++WNQ+L+ ++  ++LQE+         +S++       N+    G + +  +FK + +
Sbjct  98    SSNWNQSLLGSDFHSVLQEETGMGGGSSHDSQIQKDWSPKNFSSAAGQDSTVDAFKSMNQ  157

Query  1364  DFS----------TSTPSATNFAP----SYNYPSNllqtlldsdpqpqpqqplisnqqIS  1227
             +FS          TST S ++  P    SY YPS L+Q+L + + QPQPQ  L +N  +S
Sbjct  158   EFSLDQQSLSSVVTSTGSLSDGFPVVSASYGYPSTLIQSLYEPEAQPQPQNSLFTNPTMS  217

Query  1226  YAPPPPANFRPNLNDFSPP------LLKPTFPNA---------AASFWNQSPASLNDVRA  1092
             Y+    AN+    N+ SP       LLKP+ P             SFWN S  +L+D+RA
Sbjct  218   YSSST-ANYGTCSNELSPTWSKISSLLKPSTPKQQLSGLHFSDTTSFWNGSAEALHDIRA  276

Query  1091  ATFLPSTQSQFLPSVFSDKLSKPSRKSSNV--EEARQSSSMAKKASNQEAAFKRPRIETP  918
               F  S+Q Q+    F DK + P+   + +  EE+  ++S AKK S+ E AFKR RIETP
Sbjct  277   GVF-ASSQPQYQTPKFEDKSNTPNTLLNKLKREESPDAASSAKKNSS-EPAFKRQRIETP  334

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PY+KN
Sbjct  335   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ--VLSTPYIKN  392

Query  737   GCSVSQHHQQD------EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGAS  585
             G  +   HQQD       EGRK +LRS+GLCLVPISSTFPVA E++ DFWTPTFG +
Sbjct  393   GAPI--QHQQDCDNLKESEGRKEDLRSRGLCLVPISSTFPVANESSVDFWTPTFGGA  447



>ref|XP_009617305.1| PREDICTED: transcription factor bHLH112-like [Nicotiana tomentosiformis]
Length=353

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 187/436 (43%), Positives = 234/436 (54%), Gaps = 102/436 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATIND-MGNF-AWAnnddhhhhHQLVNMK  1656
             MAD+F   GVCG  SWWN  +++FG SP   ++I D +G+  +W           L++MK
Sbjct  1     MADEFQ-VGVCGENSWWNSTKNIFGLSPNCVSSIYDPIGHLISWP-------ISDLLDMK  52

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLS-PSSTATTDWNQA  1479
              +SSD+S                               L +LGI LS PSST   DWN +
Sbjct  53    TKSSDDST------------------------------LQILGIDLSLPSSTP--DWNHS  80

Query  1478  ---LVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTP-SATNFAPSYNY  1311
                 +     +MLQED NS LNY QE  V C       + ++FS+ T  S+TN   S+N 
Sbjct  81    PNDKLDDTYLSMLQEDLNSSLNYQQENAVNCPK-----LKRNFSSITEDSSTN---SFNK  132

Query  1310  PSNllqtlldsdpqpqpqqplisnqqIS-YAPPPPAN------FRPNLNDFSPP----LL  1164
             P N          Q           Q S Y    P N      ++ NL+DF+P     LL
Sbjct  133   PMNQDFPYYSELLQTLFDTDPNQQPQQSFYTNNQPINCTSSTKYKQNLDDFAPSLPTHLL  192

Query  1163  KPTFPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEA-RQ  987
             KP+                +++ A           LP++FS          SN+EE    
Sbjct  193   KPS----------------SEILAN----------LPNLFS---------KSNIEEIPES  217

Query  986   SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLH  807
             +SS   K S+ E ++KRPRIETPSPLPTFKVRKEK+GDR+TALQQLVSPFGKTDTASVL 
Sbjct  218   TSSSLSKNSSNEPSYKRPRIETPSPLPTFKVRKEKMGDRITALQQLVSPFGKTDTASVLQ  277

Query  806   EAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVAT  627
             EAIEYIKFLHDQVNVLS PY+K G        +++EG K +LRSQGLCLVPISSTFP   
Sbjct  278   EAIEYIKFLHDQVNVLSNPYMKKGSPTQCQQVKEQEGLKQDLRSQGLCLVPISSTFPATA  337

Query  626   ETTSDFWTPTFGASFR  579
             ETT DFWTP FGA+F+
Sbjct  338   ETTMDFWTPKFGATFK  353



>ref|XP_006597380.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Glycine 
max]
 gb|KHN33622.1| Transcription factor bHLH123 [Glycine soja]
Length=460

 Score =   262 bits (670),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 269/484 (56%), Gaps = 95/484 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN---PARSMFGASP--CSAATINDMGNFA-WAnnddhhhhHQL  1668
             MA++F  A +CG  SWWN   P RS+F   P  CS A   D GN++ W            
Sbjct  1     MAEEFQ-AAICGE-SWWNIINPTRSVFPLMPSTCSVAAA-DAGNYSTW------QSTTDF  51

Query  1667  VNMKGRSSDESCGSASD------GSSVVLQELPKSHHQ-THNMSMDSTHLHMLGIGLSPS  1509
             V++KG     SC   +D       +S+   +  K H   T ++ +DST L M+G G+S  
Sbjct  52    VDLKGT---RSCAEETDINLVSSDTSLSFLDAEKPHQSGTGSILIDST-LQMMGFGMS--  105

Query  1508  STATTDWNQALVQTNERAMLQED---------RNSRL-------NYGQEIGVE--CSDSS  1383
             S+ + +W+Q+L+ ++  ++LQE+          +S++       N+  + G E   +  +
Sbjct  106   SSTSPNWSQSLLGSSFDSVLQEETGIGGGGSSNDSQIQKDWSPKNFSSDGGSEQVSTVDA  165

Query  1382  FKPVAKDFS----------TSTP---SATNF---APSYNYPSNllqtlldsdpqpqpqqp  1251
             FKP+ ++FS          TST    S  NF   + SY YPS L+Q+L +  PQPQ    
Sbjct  166   FKPMNQEFSLDQQSLNSVVTSTDGSLSGGNFPVVSASYGYPSTLIQSLYEHQPQPQN---  222

Query  1250  lisnqqISYAPPPPANFRPNLNDFSPP------LLKPTFP----------NAAASFWNQS  1119
                    S    P  ++    N+ SP        LKP+ P          N    FWN S
Sbjct  223   -------SLFTNPSMSYGTCSNELSPTWSKVSSFLKPSMPKQQLRGLHFSNNTTPFWNSS  275

Query  1118  PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFK  939
               +LND+RA  F  S+Q+Q+    F +K + P      ++   +S   AKK S + AAFK
Sbjct  276   AEALNDIRAGVFA-SSQAQYQTPKFEEKPNCPHTLLKKLKR-EESPDAAKKNSPEPAAFK  333

Query  938   RPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVL  759
             R RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VL
Sbjct  334   RQRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSVL  393

Query  758   SAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTF  594
               PY+KN  +  QH Q     +D EG K +LRS+GLCLVP+SSTFPVA ET  DFWTPTF
Sbjct  394   RTPYMKNNGAPIQHQQDCDNLKDSEGPKQDLRSRGLCLVPVSSTFPVANETIVDFWTPTF  453

Query  593   GASF  582
             G + 
Sbjct  454   GGAL  457



>ref|XP_004485677.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Cicer 
arietinum]
Length=467

 Score =   261 bits (666),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 198/473 (42%), Positives = 258/473 (55%), Gaps = 70/473 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP--------CSAATINDMGNFAWAnnddhhhhH  1674
             MA+++  AG+CG  +WWN   S  G  P        CS A  ND GN++   N+      
Sbjct  1     MAEEYQ-AGICGE-TWWNINNSTRGVFPLMMNSSSTCSIAA-NDGGNYSTWQNEFFGLKE  57

Query  1673  QLVNMKGRSSDESCGS--ASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTA  1500
                  K  S +E+  +   SDGS   L        ++ N+ +DST L ++  GLS  S  
Sbjct  58    TTTTTKSCSIEETNTNFDVSDGSFCFLDTHKPQQSESANL-IDST-LQIMDFGLS--SPT  113

Query  1499  TTDWNQALVQTN-----------ERAMLQEDRNSRLNYGQEIGVECSDSS----------  1383
             +++WN +L  T            E  M++   NS++          S +S          
Sbjct  114   SSNWNHSLFGTGRPENNFHSVLEEETMIESSNNSQIQKEWNTKNMISSTSGIRQVSTLDA  173

Query  1382  FKPVAKDFSTSTPSA------TNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYA  1221
             FKP+ ++FS    S          + SY+YPS L+Q+L D   QPQPQ           +
Sbjct  174   FKPMDQEFSLDEQSGLSCGFPIETSNSYDYPSTLIQSLFDPQTQPQPQTHNSLFTNPCIS  233

Query  1220  PPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLNDVRAA  1089
                 AN+  + N+ S P       L+KP+ P    S         FWN S  +LND+RA 
Sbjct  234   YSSSANYGTSSNEVSSPTWSKISSLMKPSMPKQQLSGLQFSNNTPFWNASAEALNDIRAG  293

Query  1088  TFLPSTQSQFLPSVFSDK-LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSP  912
               L S+Q+Q+    F DK L+ P    + ++  R+ S    K ++ E A KR RIETPSP
Sbjct  294   V-LASSQAQYQSPNFEDKRLNCPITLLNKLK--REESPERTKKNSSEGAVKRARIETPSP  350

Query  911   LPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGC  732
             LPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY+KNG 
Sbjct  351   LPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYMKNGS  410

Query  731   SVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA  588
              + QHHQ     ++ EG+K +LRSQGLCLVPI+STFPV  ET  DFWTP+FG 
Sbjct  411   PI-QHHQGCDNVKESEGKKQDLRSQGLCLVPIASTFPVTNETIVDFWTPSFGG  462



>ref|XP_006594645.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Glycine 
max]
Length=435

 Score =   259 bits (662),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 195/456 (43%), Positives = 265/456 (58%), Gaps = 64/456 (14%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN---PARSMFGASP--CSAATINDMGNFA-WAnnddhhhhHQL  1668
             MA+DF  A +CG  +WWN   P RS+F   P  CS A  +  GN++ W            
Sbjct  1     MAEDFQ-AAICGE-NWWNNINPTRSVFPLMPSTCSVAAADHAGNYSTW------QSTTDF  52

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
             V++KG     SC      +++   +  K         + ++ L M+G G   SS+ +++W
Sbjct  53    VDLKGT---RSCAELETDNNLSFLDAEKPQQSESGSILINSTLQMMGFG--KSSSTSSNW  107

Query  1487  NQALVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS----------TSTPSA  1338
             NQ+L+ +   ++LQE+  + +  G ++    +  + KP+ ++FS          TST S 
Sbjct  108   NQSLLGSGFDSVLQEE--TGIGGGSQVS---TVDALKPMNQEFSLDQQSLNSVVTSTGSL  162

Query  1337  TNFAP----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP  1170
             +   P    SY YPS L+Q+L + +PQPQ Q  L +N  +SY+    AN+    N+ SP 
Sbjct  163   SGGFPVVSASYGYPSTLIQSLYEPEPQPQQQNSLFTNPSMSYSSSS-ANYGICSNELSPT  221

Query  1169  ------LLKPTFPNAAAS---------FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK  1035
                   L KP+ P    S         FWN S  +LND+RA  F  S+Q+Q+  + F +K
Sbjct  222   WSKVSSLPKPSMPKQQLSGLHFSNNTAFWNSSAEALNDIRAGVFT-SSQAQYQTAKFEEK  280

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
              + P+   + ++  R+ S  A K ++ E AFKR RIETPSPLPTFKVRKEKLGDR+TALQ
Sbjct  281   PNCPNTLLNKLK--REESPDAAKKNSPEPAFKRQRIETPSPLPTFKVRKEKLGDRITALQ  338

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRK  690
             QLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PY+KN  +  QH Q     +D EG K
Sbjct  339   QLVSPFGKTDTASVLHEAIEYIKFLHDQ--VLSTPYMKNNGAPIQHQQDCDNLKDSEGAK  396

Query  689   AELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
              +LRS+GLCLVPISSTFPVA ET+ DFWT TFG + 
Sbjct  397   QDLRSRGLCLVPISSTFPVANETSVDFWTSTFGGAL  432



>ref|XP_008226756.1| PREDICTED: transcription factor bHLH123 [Prunus mume]
Length=453

 Score =   259 bits (663),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 258/483 (53%), Gaps = 96/483 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNP-ARSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T G     +WW+  AR+ F  G SP  A+T+N +G+F W           +V++
Sbjct  1     MADEFQTTG-----NWWDSSARTRFETGTSP-PASTLNSLGSFGW--------QPDMVDL  46

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHH--QTHNMSMDSTHLHMLGIGLSPSSTATTDWN  1485
             K RSS +S GS S  SS+V   + K      +   S     LHM+G+GLS   +  TDWN
Sbjct  47    KARSSMDS-GSVSGTSSMVFHSVHKLEEGPDSATGSGGDPSLHMMGLGLS---SQATDWN  102

Query  1484  QAL-----VQTNERAMLQEDRNSRLNYGQE-----------IGVECSDSS---FKPVAKD  1362
              AL      +T+ R++LQE+ NS  N+ QE               C DSS   FK + + 
Sbjct  103   HALFRGEKAETSFRSILQENMNSNTNFHQENDQQLQWRDKLFAGGCGDSSNNEFKQMNRG  162

Query  1361  FS-------------TSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYA  1221
             FS              ST +      S+   S        S        P   NQQ + A
Sbjct  163   FSLDQTQFSPQYSSGDSTVTCQGLPSSFQMDSGAALYGSPSTILQGLLGPHHDNQQPNSA  222

Query  1220  P---PPPANFRPNLND--------------FSPPLLKPT----FPNAAASFWNQ-SPASL  1107
             P   P  AN+  N +D               SPP   P     F N A +FWN    A++
Sbjct  223   PMNFPYQANYGVNSSDQLLPSWSKVPQFLRTSPPKQPPQSHLQFSNNA-TFWNAPHEAAM  281

Query  1106  NDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRI  927
              DVR + F PS Q QF  + F +K         N+ E ++S ++ KK S  E A KRPR 
Sbjct  282   KDVRPS-FFPSLQQQFPTARFEEK-------PKNISEVQESGAVGKK-SGSETASKRPRN  332

Query  926   ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY  747
             ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QVNVLS PY
Sbjct  333   ETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVNVLSTPY  392

Query  746   LKNGCSVSQHHQQD-------EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA  588
             +K+G ++   HQQ+       ++G K +LRS+GLCLVP+SSTFPV   TT DFWTPTFG 
Sbjct  393   MKSGAAI--QHQQNSDQSKDPDQGPKQDLRSRGLCLVPVSSTFPVTHGTTVDFWTPTFGG  450

Query  587   SFR  579
             +FR
Sbjct  451   TFR  453



>ref|XP_011012087.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Populus 
euphratica]
Length=450

 Score =   258 bits (659),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 267/487 (55%), Gaps = 107/487 (22%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA--RSMFGASPCSAAT--INDMGNFAWAnnddhhhhHQLVN  1662
             MAD++ +       +WW+ +  R+ F ++  ++ T  +N + +FAW          ++ +
Sbjct  1     MADEYTST------NWWDSSSSRNRFDSTGSTSTTSGLNSLRSFAWPT--------EIAD  46

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
             +KGRSS E+  S SD SSV   +  K   Q H+ S D   LHM+G+GLS   +   DWNQ
Sbjct  47    VKGRSSMETV-SVSD-SSVAFHDSQK-LQQGHDSSAD---LHMMGLGLS---SQVMDWNQ  97

Query  1481  ALVQTNE-----RAMLQEDRNSRLNYGQEI----------------GV--ECSDSSFKPV  1371
             AL++ ++     R+MLQ++ +S  NY QE                 GV  + S S FK +
Sbjct  98    ALLRGDKSENSFRSMLQDNLSSSTNYQQETAGIGSSQSQWRERVFTGVTGDSSMSEFKQM  157

Query  1370  AKDF-------------STSTPSATNFAPS--------YNYPSNllqtlldsdpqpqpqq  1254
              + F             S ST S      S        Y  PS +LQ LL S+ Q +   
Sbjct  158   NRGFPLDQPQFRPHGSSSDSTVSCQGLQSSFPMDSSGIYGSPSTMLQGLLISENQARQSS  217

Query  1253  plisnqqISYAPPPPANFRPNLNDF------SPPLLKPTFPNAAAS----------FWNQ  1122
                     +Y     AN+  + N+        P LL+ + P  A+S          FWN 
Sbjct  218   FENRPMSYAYG----ANYGLSTNELLPFWPKGPQLLRNSPPKQASSNQLHFSNNTPFWNA  273

Query  1121  SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAF  942
             S +++NDVR + F PS Q QF  S F +K  +      N+ E R S+ +A K S  EAA 
Sbjct  274   SASAMNDVRPSYF-PSMQPQFATSNFDEKPKQ------NISEVRDSN-IAVKKSGSEAAT  325

Query  941   KRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNV  762
             KRPR ETPS LP+FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV V
Sbjct  326   KRPRNETPSSLPSFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVTV  385

Query  761   LSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
              S PY+K+G  +   HQQ      D EG+K +LRS+GLCLVP+SSTFPV  ETT DFWTP
Sbjct  386   FSTPYMKSGTPI--LHQQSSDKSKDLEGQKQDLRSRGLCLVPVSSTFPVTHETTVDFWTP  443

Query  599   TFGASFR  579
             TFG +FR
Sbjct  444   TFGGTFR  450



>ref|XP_011012088.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   257 bits (657),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 266/487 (55%), Gaps = 108/487 (22%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA--RSMFGASPCSAAT--INDMGNFAWAnnddhhhhHQLVN  1662
             MAD++ +       +WW+ +  R+ F ++  ++ T  +N + +FAW          ++ +
Sbjct  1     MADEYTST------NWWDSSSSRNRFDSTGSTSTTSGLNSLRSFAWPT--------EIAD  46

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
             +KGRSS E+  S SD SSV   +  K   Q H+ S D   LHM+G+GLS   +   DWNQ
Sbjct  47    VKGRSSMETV-SVSD-SSVAFHDSQK-LQQGHDSSAD---LHMMGLGLS---SQVMDWNQ  97

Query  1481  ALVQTNE-----RAMLQEDRNSRLNYGQEI----------------GV--ECSDSSFKPV  1371
             AL++ ++     R+MLQ++ +S  NY QE                 GV  + S S FK +
Sbjct  98    ALLRGDKSENSFRSMLQDNLSSSTNYQQETAGIGSSQSQWRERVFTGVTGDSSMSEFKQM  157

Query  1370  AKDF-------------STSTPSATNFAPS--------YNYPSNllqtlldsdpqpqpqq  1254
              + F             S ST S      S        Y  PS +LQ LL S+ Q +   
Sbjct  158   NRGFPLDQPQFRPHGSSSDSTVSCQGLQSSFPMDSSGIYGSPSTMLQGLLISENQARQSS  217

Query  1253  plisnqqISYAPPPPANFRPNLNDF------SPPLLKPTFPNAAAS----------FWNQ  1122
                     +Y     AN+  + N+        P LL+ + P  A+S          FWN 
Sbjct  218   FENRPMSYAYG----ANYGLSTNELLPFWPKGPQLLRNSPPKQASSNQLHFSNNTPFWNA  273

Query  1121  SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAF  942
             S +++NDVR + F PS Q QF  S F +K         N+ E R S+ +A K S  EAA 
Sbjct  274   SASAMNDVRPSYF-PSMQPQFATSNFDEK-------PKNISEVRDSN-IAVKKSGSEAAT  324

Query  941   KRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNV  762
             KRPR ETPS LP+FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV V
Sbjct  325   KRPRNETPSSLPSFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVTV  384

Query  761   LSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
              S PY+K+G  +   HQQ      D EG+K +LRS+GLCLVP+SSTFPV  ETT DFWTP
Sbjct  385   FSTPYMKSGTPI--LHQQSSDKSKDLEGQKQDLRSRGLCLVPVSSTFPVTHETTVDFWTP  442

Query  599   TFGASFR  579
             TFG +FR
Sbjct  443   TFGGTFR  449



>ref|XP_007213019.1| hypothetical protein PRUPE_ppa023041mg [Prunus persica]
 gb|EMJ14218.1| hypothetical protein PRUPE_ppa023041mg [Prunus persica]
Length=453

 Score =   256 bits (654),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 202/486 (42%), Positives = 260/486 (53%), Gaps = 102/486 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T G     +WW+ + R+ F  G SP  A+T+N +G+F W           +V++
Sbjct  1     MADEFQTTG-----NWWDSSSRTRFETGTSP-PASTLNSLGSFGW--------QPDMVDI  46

Query  1658  KGRSSDESCGSASDGSSVV------LQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTAT  1497
             K RSS +S GS S  SS+V      L+E P S       S     LHM+G+GLS   +  
Sbjct  47    KARSSMDS-GSVSGTSSMVFHGAHKLEEGPDSA----TGSGGDPSLHMMGLGLS---SQA  98

Query  1496  TDWNQAL-----VQTNERAMLQEDRNSRLNYGQE-----------IGVECSDSS---FKP  1374
             TDWN AL      +T+ R++LQE+ NS  N+ QE               C DSS   FK 
Sbjct  99    TDWNHALFRGEKAETSFRSILQENMNSNTNFHQENDQQLQWRDKLFAGGCGDSSNNEFKQ  158

Query  1373  VAKDFS-------------TSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqq  1233
             + + FS              ST +      S+   S        S        P   NQQ
Sbjct  159   MNRGFSLDQTQFSPQYSSGDSTVTCQGLPSSFQMDSGAALYGSPSTILQGLLGPHHDNQQ  218

Query  1232  ISYAP---PPPANFRPNLND-FSPPLLK-PTFPNAA---------------ASFWNQ-SP  1116
              + AP   P  AN+  N +D   PP  K P F   +               A+FWN    
Sbjct  219   PNSAPMNFPYQANYGVNSSDQLLPPWSKVPQFLRTSPPKQPPQSHLQFSNNATFWNAPHE  278

Query  1115  ASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKR  936
             A++ DVR + F PS Q Q+  + F +K         N+ E ++S ++ KK S  E A KR
Sbjct  279   AAMKDVRPS-FFPSLQPQYPTARFEEK-------PKNISEVQESGAVGKK-SGSETATKR  329

Query  935   PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS  756
             PR ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QVNVLS
Sbjct  330   PRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVNVLS  389

Query  755   APYLKNGCSVSQHHQQD-------EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPT  597
              PY+K+G ++   HQQ+       ++G K +LRS+GLCLVP+SSTFPV   TT DFWTPT
Sbjct  390   TPYMKSGAAI--QHQQNSDKSKDPDQGPKQDLRSRGLCLVPVSSTFPVTHGTTVDFWTPT  447

Query  596   FGASFR  579
             FG +FR
Sbjct  448   FGGTFR  453



>ref|XP_006597381.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Glycine 
max]
Length=458

 Score =   255 bits (651),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 202/484 (42%), Positives = 267/484 (55%), Gaps = 97/484 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN---PARSMFGASP--CSAATINDMGNFA-WAnnddhhhhHQL  1668
             MA++F  A +CG  SWWN   P RS+F   P  CS A   D GN++ W            
Sbjct  1     MAEEFQ-AAICGE-SWWNIINPTRSVFPLMPSTCSVAAA-DAGNYSTW------QSTTDF  51

Query  1667  VNMKGRSSDESCGSASD------GSSVVLQELPKSHHQ-THNMSMDSTHLHMLGIGLSPS  1509
             V++KG     SC   +D       +S+   +  K H   T ++ +DST L M+G G+S  
Sbjct  52    VDLKGT---RSCAEETDINLVSSDTSLSFLDAEKPHQSGTGSILIDST-LQMMGFGMS--  105

Query  1508  STATTDWNQALVQTNERAMLQED---------RNSRL-------NYGQEIGVE--CSDSS  1383
             S+ + +W+Q+L+ ++  ++LQE+          +S++       N+  + G E   +  +
Sbjct  106   SSTSPNWSQSLLGSSFDSVLQEETGIGGGGSSNDSQIQKDWSPKNFSSDGGSEQVSTVDA  165

Query  1382  FKPVAKDFS----------TSTP---SATNF---APSYNYPSNllqtlldsdpqpqpqqp  1251
             FKP+ ++FS          TST    S  NF   + SY YPS L+Q+L +  PQPQ    
Sbjct  166   FKPMNQEFSLDQQSLNSVVTSTDGSLSGGNFPVVSASYGYPSTLIQSLYEHQPQPQN---  222

Query  1250  lisnqqISYAPPPPANFRPNLNDFSPP------LLKPTFP----------NAAASFWNQS  1119
                    S    P  ++    N+ SP        LKP+ P          N    FWN S
Sbjct  223   -------SLFTNPSMSYGTCSNELSPTWSKVSSFLKPSMPKQQLRGLHFSNNTTPFWNSS  275

Query  1118  PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFK  939
               +LND+RA  F  S+Q+Q+    F +K + P      ++   +S   AKK S + AAFK
Sbjct  276   AEALNDIRAGVFA-SSQAQYQTPKFEEKPNCPHTLLKKLKR-EESPDAAKKNSPEPAAFK  333

Query  938   RPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVL  759
             R RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VL
Sbjct  334   RQRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ--VL  391

Query  758   SAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTF  594
               PY+KN  +  QH Q     +D EG K +LRS+GLCLVP+SSTFPVA ET  DFWTPTF
Sbjct  392   RTPYMKNNGAPIQHQQDCDNLKDSEGPKQDLRSRGLCLVPVSSTFPVANETIVDFWTPTF  451

Query  593   GASF  582
             G + 
Sbjct  452   GGAL  455



>ref|XP_004485676.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Cicer 
arietinum]
Length=471

 Score =   254 bits (650),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 198/477 (42%), Positives = 258/477 (54%), Gaps = 74/477 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP--------CSAATINDMGNFAWAnnddhhhhH  1674
             MA+++  AG+CG  +WWN   S  G  P        CS A  ND GN++   N+      
Sbjct  1     MAEEYQ-AGICGE-TWWNINNSTRGVFPLMMNSSSTCSIAA-NDGGNYSTWQNEFFGLKE  57

Query  1673  QLVNMKGRSSDESCGS--ASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTA  1500
                  K  S +E+  +   SDGS   L        ++ N+ +DST L ++  GLS  S  
Sbjct  58    TTTTTKSCSIEETNTNFDVSDGSFCFLDTHKPQQSESANL-IDST-LQIMDFGLS--SPT  113

Query  1499  TTDWNQALVQTN-----------ERAMLQEDRNSRLNYGQEIGVECSDSS----------  1383
             +++WN +L  T            E  M++   NS++          S +S          
Sbjct  114   SSNWNHSLFGTGRPENNFHSVLEEETMIESSNNSQIQKEWNTKNMISSTSGIRQVSTLDA  173

Query  1382  FKPVAKDFSTSTPSA------TNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYA  1221
             FKP+ ++FS    S          + SY+YPS L+Q+L D   QPQPQ           +
Sbjct  174   FKPMDQEFSLDEQSGLSCGFPIETSNSYDYPSTLIQSLFDPQTQPQPQTHNSLFTNPCIS  233

Query  1220  PPPPANFRPNLNDFSPP-------LLKPTFPNAAAS---------FWNQSPASLNDVRAA  1089
                 AN+  + N+ S P       L+KP+ P    S         FWN S  +LND+RA 
Sbjct  234   YSSSANYGTSSNEVSSPTWSKISSLMKPSMPKQQLSGLQFSNNTPFWNASAEALNDIRAG  293

Query  1088  TFLPSTQSQFLPSVFSDK-LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSP  912
               L S+Q+Q+    F DK L+ P    + ++  R+ S    K ++ E A KR RIETPSP
Sbjct  294   V-LASSQAQYQSPNFEDKRLNCPITLLNKLK--REESPERTKKNSSEGAVKRARIETPSP  350

Query  911   LPTFKV----RKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYL  744
             LPTFKV    RKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPY+
Sbjct  351   LPTFKVCGQVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYM  410

Query  743   KNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA  588
             KNG  + QHHQ     ++ EG+K +LRSQGLCLVPI+STFPV  ET  DFWTP+FG 
Sbjct  411   KNGSPI-QHHQGCDNVKESEGKKQDLRSQGLCLVPIASTFPVTNETIVDFWTPSFGG  466



>ref|XP_006467938.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Citrus 
sinensis]
 gb|KDO75639.1| hypothetical protein CISIN_1g011373mg [Citrus sinensis]
Length=487

 Score =   252 bits (643),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 206/510 (40%), Positives = 263/510 (52%), Gaps = 116/510 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI---NDMGNFAWAnnddhhhhHQLVNM  1659
             MA++F T G+CGG  W NP RS    SPCSAA I   + MG+F W +ND       +V+ 
Sbjct  1     MAEEFQT-GICGGAWWINPTRSS-SLSPCSAAGIGLSDHMGSFLWPSNDHF----HMVDT  54

Query  1658  K-------GRSSDESC-----------GSASDGSSVVLQELPKSHHQTHN-------MSM  1554
             K       G ++ + C             ++D SS+   E    H QT +       + M
Sbjct  55    KTTTLTPAGTATTKFCEESANNNNNNNSVSADTSSMAFTE---KHQQTDSDSGGSSSILM  111

Query  1553  DSTHLHMLGIGLSPSSTATTDWNQALVQTNERA------MLQEDRNSRL--------NYG  1416
             DST L M+ + +  SS+++TD  QAL++ N RA      M  ED NS++        +Y 
Sbjct  112   DST-LQMMSL-VPSSSSSSTDCFQALLRGNGRAENNYRSMRLEDLNSQIQKEWSPSKSYA  169

Query  1415  QEIGV-----EC-SDSSFKPVAKDFSTSTP--------SATNFAP-------SYNYPS--  1305
                G      EC S     PV K  + S P        S    +P       SY Y S  
Sbjct  170   SSAGAGDHHQECFSLDQSHPVIKSATASFPDNCTVSESSCQGLSPGFPVDSASYGYTSAL  229

Query  1304  --NllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP--------LLKPT  1155
               +  +       Q        +    +Y     AN+  N N+ SPP         +KP+
Sbjct  230   LQSYFEPQPQPVQQQSLYSSNNTRSMGNYMST--ANYGNNYNEVSPPWPKFAAASFVKPS  287

Query  1154  FPNAA-----------ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RK  1014
              P                FWN +  +LND+       S     L +   +K + P+   K
Sbjct  288   LPKQQQPSGGLHFSNNTPFWNAT--ALNDI-------SRPGGLLAAALGEKRTCPTFTAK  338

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
              +N EE R S S AKK S+ E AFKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  339   YNNNEEVRDSGSAAKKGSS-EPAFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFG  397

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ-----HHQQDEEGRKAELRSQG  669
             KTDTASVLHEAI+YIKFLHDQV+VL+ PY+K G  + Q     H  +D E  K +L S+G
Sbjct  398   KTDTASVLHEAIDYIKFLHDQVSVLATPYMKQGTQIPQQQSCDHKLKDPEAPKQDLNSRG  457

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTFPVA ETT+DFWTPTFG +FR
Sbjct  458   LCLVPISSTFPVANETTADFWTPTFGGTFR  487



>ref|XP_008224893.1| PREDICTED: transcription factor bHLH112 isoform X1 [Prunus mume]
Length=462

 Score =   246 bits (627),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 207/484 (43%), Positives = 269/484 (56%), Gaps = 89/484 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CG  SWWN +R    ASPCS    + MG+F   N         +V++K  
Sbjct  1     MAEEFQ-AGICGS-SWWNTSRHALVASPCSVGFNDHMGSFGCPN--------DMVDIK--  48

Query  1649  SSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTAT-TDWNQALV  1473
             +S  SCG  ++  SV   +    H  + ++ +DST L M+G   S SS++T +D NQAL+
Sbjct  49    ASRSSCGEINN--SVSDHDDDHQHTDSGSVLIDST-LQMIGFDHSSSSSSTPSDLNQALL  105

Query  1472  QTNERAMLQED--RNSRLNYGQEIGVECSDSS----FKPVAKDFS--------------T  1353
              +       E    NS L  G  +GV+   SS    FKP+++DFS              T
Sbjct  106   LSRSGGGRAESNFHNSMLQEG--VGVDEDSSSLIDGFKPMSQDFSLDQLGSSSSSGFPIT  163

Query  1352  STPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnq-------------qISYAPP-  1215
             S+ SA N   SY +PS  LQ++ DS+      Q  + N                S  PP 
Sbjct  164   SSSSAAN---SYGFPSTFLQSIFDSEVSQPQPQQSLFNNNHFSNDLLLPPSPTSSCWPPR  220

Query  1214  --PPANFRPNLNDFSPPLLKPT--------FPNAAAS-FWNQSPASL----NDVRAATFL  1080
               P +  RP+     P  L+P         FPN   + FWN   A+     N +R++  L
Sbjct  221   YSPSSCLRPSAVSL-PKQLQPGGGGGGGLHFPNNINTPFWNTPAATALNHGNGIRSSNGL  279

Query  1079  -PSTQSQFLPSVFSDKLSKPSRKSSNV-------EEARQSSSMAKKA----SNQEAAFKR  936
               S+QSQ      S  + +    S N        E+ + S+S+ KK+    S+ E  FKR
Sbjct  280   FSSSQSQLTAPASSALVHEHKPNSHNFTTKGNTNEDVQDSNSVVKKSGSSMSSCEPVFKR  339

Query  935   PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS  756
              RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH+QV+VLS
Sbjct  340   ARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHEQVSVLS  399

Query  755   APYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFG  591
              PY+KNG  +     S H  ++ EG K +L+S+GLCLVPISSTFPVA ETT DFWTPTFG
Sbjct  400   TPYMKNGAPMQHQQGSDHKMKEAEGAKHDLKSRGLCLVPISSTFPVANETT-DFWTPTFG  458

Query  590   ASFR  579
             A+FR
Sbjct  459   ATFR  462



>gb|AFK38358.1| unknown [Lotus japonicus]
Length=444

 Score =   244 bits (624),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 247/455 (54%), Gaps = 59/455 (13%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN--PARSMFG----ASPCSAATINDMGNFA-WAnnddhhhhHQ  1671
             MA++F  AG+CG  +WWN  P RS F     +S CS A  ND GN++ W  +       +
Sbjct  1     MAEEFQ-AGICGE-TWWNMNPTRSAFPLMSPSSTCSVAA-NDAGNYSTWQTDFLDLRATR  57

Query  1670  LVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMS--MDSTHLHMLGIGLSPSSTAT  1497
                 +  +++      S G   +  + P+     +  S  +  + L ++G GLS  S  +
Sbjct  58    PCVAEETNNNNMVSDVSPG--FLDAQKPQQSESANGTSSFLIGSTLQIMGFGLS--SPTS  113

Query  1496  TDWN-QALVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDF--------STSTP  1344
             ++WN Q+L   + R    E+     +      V   D++FK + +DF        S  T 
Sbjct  114   SNWNNQSLFHCSGRPQSMEETGLDSSGHHNPQVSSVDANFKAMNQDFGLDQQGLNSVITS  173

Query  1343  SA--------TNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNL  1188
             S          N + SY YPSNL+Q+L DS PQPQ           S    P  +F  + 
Sbjct  174   SGNLSGGLIPINGSGSYGYPSNLVQSLYDSQPQPQNS---------SLFTNPSMSFSSS-  223

Query  1187  NDFSPP---LLKPTFPNAAAS---------FWNQSPASLNDVRAATFLPSTQSQFLPSVF  1044
             N+ SP    +LKP  P    S         FWN S  +L+D+RA  F  S+Q+Q+    F
Sbjct  224   NELSPTFSSILKPAMPKQQLSGLHFSNSTPFWNASAEALHDIRAGVFA-SSQTQYQTPSF  282

Query  1043  SDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVT  864
              +K   P     N  +  +S   AKK+++ E A KRPRIETPSPLPTFKVRKEKLGDR+T
Sbjct  283   EEKKQNPPSALLNKLKREESPDAAKKSTSTEPALKRPRIETPSPLPTFKVRKEKLGDRIT  342

Query  863   ALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHH---QQDEEGR  693
             ALQQLVSPFGKTDTASVLHEAI+YIKFLHDQVNVLS PY+K+G  +          +E  
Sbjct  343   ALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVNVLSTPYMKSGAPIQNQQGTCDNVKESS  402

Query  692   KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA  588
             + +LR +GLCLVPISSTFPV  E T DFWTPTFG 
Sbjct  403   EEDLRRRGLCLVPISSTFPVTNEATVDFWTPTFGG  437



>ref|XP_007021136.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOY12661.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=459

 Score =   244 bits (624),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 198/492 (40%), Positives = 262/492 (53%), Gaps = 108/492 (22%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS--MFGASPCSAATINDMGN---FAWAnnddhhhhHQLV  1665
             MAD+F T     G +WW+ +R+   F A+  S+++     +   F WA         ++V
Sbjct  1     MADEFNT-----GTNWWDSSRTNTRFDAAGSSSSSSGLNNSLGSFGWAT--------EMV  47

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQ-THNMSMDSTHLHMLGIGLSPSSTATTDW  1488
             ++K   S     S+  GSSVV Q+ PK      H    D   LHM+G+GLS   +   DW
Sbjct  48    DIKAARSSMDSVSSVSGSSVVFQDAPKLQGVPDHPPPGD---LHMMGLGLS---SQAMDW  101

Query  1487  NQALVQTNE-----RAMLQEDRNSRLNYGQE------------------IGVECSDSSFK  1377
             NQAL++ ++     R+MLQ++ NS  NY QE                  +G + S + FK
Sbjct  102   NQALLRGDKSESSFRSMLQDNLNSSANYQQETAGMGSSQVQWRDKMFSGVGGDASVNEFK  161

Query  1376  PVAKDFSTSTPSATNFAPS------------------------YNYPSNllqtlldsdpq  1269
              +++ FS      + F+P                         Y  PS +LQ LL S+ Q
Sbjct  162   QISRGFSLD---QSQFSPHGSSSDSTVTCQGLPSSFQMDSTALYGSPSTILQGLLGSENQ  218

Query  1268  pqpqqplisnqqISYAPPPPANFRPNLNDFSPPLLK-PTFPNAA---------------A  1137
              Q       +    Y     A++  N N+  P   K P F  ++               A
Sbjct  219   AQQSSYENRSINYQYGAAA-ASYGMNTNELLPSWSKVPQFLRSSPPKQHLHGQLHFSNNA  277

Query  1136  SFWNQSPA-SLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
              FWN S A S+ DVR   F PS Q+QF    F +K         N+ E R SS++ KK+ 
Sbjct  278   PFWNPSAAASMTDVRPG-FFPSLQTQFPTGNFDEK-------PKNISEGRDSSTVVKKSG  329

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             N E A KRPR ETP+PLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  330   N-EPASKRPRNETPTPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  388

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             H+QV+VLS PY+K+G ++ QH Q     +D EG K +LRS+GLCLVP+SSTFPV  E+T 
Sbjct  389   HEQVSVLSTPYMKSGAAI-QHQQSSEKSKDPEGPKQDLRSRGLCLVPVSSTFPVTHESTV  447

Query  614   DFWTPTFGASFR  579
             DFWTPTFG +FR
Sbjct  448   DFWTPTFGGTFR  459



>ref|XP_007211684.1| hypothetical protein PRUPE_ppa005924mg [Prunus persica]
 gb|EMJ12883.1| hypothetical protein PRUPE_ppa005924mg [Prunus persica]
Length=437

 Score =   242 bits (618),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 197/471 (42%), Positives = 255/471 (54%), Gaps = 88/471 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CG  SWWN +R    ASPCS    + +G+F   N         +V++K  
Sbjct  1     MAEEFQ-AGICGS-SWWNTSRHALVASPCSVGFNDHIGSFGCPN--------DMVDIK--  48

Query  1649  SSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIG-LSPSSTATTDWNQALV  1473
             +S  SCG  ++  SV   +    H  + +  +DST L M+G    S  S+  +D NQAL+
Sbjct  49    ASRSSCGEINN--SVSDHDDDHQHTNSGSFLIDST-LQMIGFDHSSSPSSTPSDLNQALL  105

Query  1472  QTNERAMLQED--RNSRLNYGQEIGVECSDSS----FKPVAKDFS--------------T  1353
              +       E    NS L  G  +GV+   SS    FKP+++DFS              T
Sbjct  106   LSRSGGGRAESNFHNSMLQEG--VGVDEDSSSLIDGFKPMSQDFSLDQLGSSSSSGFPIT  163

Query  1352  STPSATNFAPSYNYPSNllqtlldsdpqp----qpqqplisnqqISYAPPPPAN------  1203
             S+ SA N   SY +PS LLQ++ DS+       Q              PP P +      
Sbjct  164   SSSSAAN---SYGFPSTLLQSIFDSEVSQPQPQQSLFNNNHFSNDLLLPPSPTSSCWPPR  220

Query  1202  ------FRPNLNDFSPPLLKPT-------FPNAAAS-FWNQSPASLNDVRAATFLPSTQS  1065
                    RP+     P  L+P        FPN   + FWN +P    ++   T LP    
Sbjct  221   YSSSSCLRPSAVSL-PKQLQPGGGGGGLHFPNNINTPFWN-TPFMNTNLIPTTLLPRVMI  278

Query  1064  QFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA----SNQEAAFKRPRIETPSPLPTFK  897
               L             + +  E+ + S+S+ KK+    S+ E  FKR RIETPSPLPTFK
Sbjct  279   WML-----------KFQGNTNEDVQDSNSVVKKSGSSMSSCEPVFKRARIETPSPLPTFK  327

Query  896   VRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV---  726
             VRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH+QV+VLS PY+KNG  +   
Sbjct  328   VRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHEQVSVLSTPYMKNGAPMQHQ  387

Query  725   --SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
               S H  ++ EG K +L+S+GLCLVPISSTFPVA ETT DFWTPTFGA+FR
Sbjct  388   QGSDHKMKEAEGAKHDLKSRGLCLVPISSTFPVANETT-DFWTPTFGATFR  437



>ref|XP_011095780.1| PREDICTED: transcription factor bHLH123 [Sesamum indicum]
Length=416

 Score =   240 bits (612),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 187/451 (41%), Positives = 239/451 (53%), Gaps = 69/451 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGAS---PCS-AATINDMGNFAWAnnddhhhhHQLVN  1662
             MAD+F      G G+WW+ +R+ F A    P S + T+N + +F W          ++ +
Sbjct  1     MADEFQ----VGSGNWWDTSRTRFDAGTTPPASISTTLNAIASFGWT---------EMED  47

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
             MK RSS +S G A+ GS V+     +S        + + ++ M+G+GLS   +   DWNQ
Sbjct  48    MKSRSSMDS-GPATGGSLVLQGGHDQSSAAATGGGLGNLNMQMVGLGLS---SQGMDWNQ  103

Query  1481  ALVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTPSATNFAPSYNYPSN  1302
              L  +      QE    +L Y      E S S FK   + FS   P  ++ A S +  S 
Sbjct  104   PLFAS------QEHWRQKL-YAGASPEESSVSDFKQTNRGFSLDQPQFSSQASSNDSNSI  156

Query  1301  llqtlldsdpqpqpqqplisnqqISYAPPPP--------ANFRPNLNDF------SPPLL  1164
               Q L+            +         P P        A   P+ N F      SPP  
Sbjct  157   TSQNLITGFQVDAAAPYGMLLSDNQQHYPYPSSGYCANAAELIPSWNKFPQFLRTSPPKQ  216

Query  1163  KP-------TFPNAAASFWNQS-PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RK  1014
              P        F N AA FWN S P S  D R++ F P+ Q+Q + +        PS   K
Sbjct  217   PPPASGSHLHFTNNAA-FWNASAPPSTTDGRSS-FFPAIQTQNIRTA-------PSFDEK  267

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRI-ETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
                  E R  S+  KK S  EA+ KRPR  ETPS LP FKVRKEK+GDR+TALQQLVSPF
Sbjct  268   PKITSETRDLSTTTKKNST-EASNKRPRSNETPSSLPAFKVRKEKMGDRITALQQLVSPF  326

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQ  672
             GKTDTASVL EAIEYIKFLH+QV+VLS PY+KNG  + QHHQ     +D EG + +LRS+
Sbjct  327   GKTDTASVLSEAIEYIKFLHEQVSVLSTPYMKNGAPI-QHHQNSDKSKDPEGGRQDLRSR  385

Query  671   GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             GLCLVP+SSTFP+  ETT DFWTPTFG SFR
Sbjct  386   GLCLVPVSSTFPMTHETTVDFWTPTFGGSFR  416



>ref|XP_010267864.1| PREDICTED: transcription factor bHLH112-like [Nelumbo nucifera]
Length=468

 Score =   241 bits (615),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 159/211 (75%), Gaps = 18/211 (9%)
 Frame = -3

Query  1175  PPLLKPT----FPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK--LSKPSRK  1014
             PP  +PT    FPN    FWN + A++N+VR + F PS+Q+QFL   F +K   S  + K
Sbjct  264   PPKQQPTNQLHFPNNVP-FWNATAAAMNEVRPSYF-PSSQTQFLTPTFEEKPSCSNLTAK  321

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             SS  EE R S++  KK S+ EA FKRPRIETP P+PTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  322   SS-TEEVRDSATAVKKGSS-EAVFKRPRIETP-PMPTFKVRKEKLGDRITALQQLVSPFG  378

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQ  672
             KTDTASVL+EAIEYIKFLHDQV+VLS PY+KNG  + QH QQ      + +G K +LRS+
Sbjct  379   KTDTASVLYEAIEYIKFLHDQVSVLSTPYMKNGAPM-QHQQQNSNKSKEADGHKPDLRSR  437

Query  671   GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             GLCLVPISSTFPV  ETT+DFWTPTFG ++R
Sbjct  438   GLCLVPISSTFPVTNETTADFWTPTFGGTYR  468


 Score = 85.9 bits (211),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 88/154 (57%), Gaps = 23/154 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G+C G  W NP R+ F  G+SPCS A +ND G+F W          ++V+MK
Sbjct  1     MADEFQT-GICSGNWWNNPTRNGFNGGSSPCSTA-LNDTGSFGWPA--------EMVDMK  50

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHN--MSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
              RS +ES  ++   ++    + P+         + MDST L ++G GLS  S  T DWNQ
Sbjct  51    ARSCEESASASDSSTAFQDTQKPQVTDSVGGGGVLMDST-LQIMGFGLS--SPTTMDWNQ  107

Query  1481  ALV------QTNERAMLQEDRNSRLNYGQEIGVE  1398
             AL+      QTN  ++LQE+ +SR ++ QE G+E
Sbjct  108   ALLRSSGRAQTNFHSVLQEELSSRPSFRQETGME  141



>ref|XP_011097951.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH123-like 
[Sesamum indicum]
Length=438

 Score =   239 bits (609),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 185/474 (39%), Positives = 242/474 (51%), Gaps = 93/474 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF---GASPCS-AATINDMGNFAWAnnddhhhhHQLVN  1662
             MADD       GGG+WW+ +R+ F   G +P S + T+N + +F W          ++V+
Sbjct  1     MADDQFQ---LGGGNWWDTSRNRFDSSGTTPTSISTTLNAIASFGWPT--------EMVD  49

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
              K RSS     SA+  S+V            H   + + +L M+G+GLS   + + DWN 
Sbjct  50    TKSRSS---MDSATPSSAV-----------GHGGVLANQNLQMMGLGLS---SQSMDWNP  92

Query  1481  ALVQTNE-----RAMLQEDRNS----------RLNYGQEIGVECSDSSFKPVAKDFSTST  1347
             AL +  +     RA+LQED +S             +    G    DSS     + FS   
Sbjct  93    ALFRGEKGESSFRALLQEDMSSXXXXRXASQEHWRHKLYSGASSEDSSVNINPRGFSLDQ  152

Query  1346  PSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISY------APPPP--------  1209
             P  ++ A S +                       +    +Y       P PP        
Sbjct  153   PQFSSQASSNDSTITSQTGFQVDSSAAYGLLLSENQHHSAYPNRPMNYPYPPSTYGGVNT  212

Query  1208  ANFRPNLNDF------SPPLLKPTFPNAAAS-----------FWNQS-PASLNDVRAATF  1083
             A   P+ N +      SPP   P  P AA S           FWN S PA++     ++F
Sbjct  213   AELVPSWNKYPQFLRTSPPKQAP--PQAAGSSSHLHFTNNTPFWNASAPAAVMSDARSSF  270

Query  1082  LPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRI-ETPSPLP  906
              P  Q+Q   +   D+  KP  KS++  E R S +  KK S  EA+ KRPR  E P PLP
Sbjct  271   FPGLQTQIPTTSSLDE--KPKIKSTS--EGRDSGTTTKKNS-MEASNKRPRGNENPPPLP  325

Query  905   TFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV  726
              FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+VLS PY+KNG  +
Sbjct  326   AFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVSVLSTPYMKNGAPI  385

Query  725   SQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              QH Q     +D EG + +LRS+GLCLVPISSTFP+  ETT DFWTPTFG +FR
Sbjct  386   -QHQQSSDKSKDSEGPRQDLRSRGLCLVPISSTFPMTHETTVDFWTPTFGGTFR  438



>ref|XP_008224894.1| PREDICTED: transcription factor bHLH112 isoform X2 [Prunus mume]
Length=460

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 267/484 (55%), Gaps = 91/484 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CG  SWWN +R    ASPCS    + MG+F   N         +V++K  
Sbjct  1     MAEEFQ-AGICGS-SWWNTSRHALVASPCSVGFNDHMGSFGCPN--------DMVDIK--  48

Query  1649  SSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTAT-TDWNQALV  1473
             +S  SCG  ++  SV   +    H  + ++ +DST L M+G   S SS++T +D NQAL+
Sbjct  49    ASRSSCGEINN--SVSDHDDDHQHTDSGSVLIDST-LQMIGFDHSSSSSSTPSDLNQALL  105

Query  1472  QTNERAMLQED--RNSRLNYGQEIGVECSDSS----FKPVAKDFS--------------T  1353
              +       E    NS L  G  +GV+   SS    FKP+++DFS              T
Sbjct  106   LSRSGGGRAESNFHNSMLQEG--VGVDEDSSSLIDGFKPMSQDFSLDQLGSSSSSGFPIT  163

Query  1352  STPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnq-------------qISYAPP-  1215
             S+ SA N   SY +PS  LQ++ DS+      Q  + N                S  PP 
Sbjct  164   SSSSAAN---SYGFPSTFLQSIFDSEVSQPQPQQSLFNNNHFSNDLLLPPSPTSSCWPPR  220

Query  1214  --PPANFRPNLNDFSPPLLKPT--------FPNAAAS-FWNQSPASL----NDVRAATFL  1080
               P +  RP+     P  L+P         FPN   + FWN   A+     N +R++  L
Sbjct  221   YSPSSCLRPSAVSL-PKQLQPGGGGGGGLHFPNNINTPFWNTPAATALNHGNGIRSSNGL  279

Query  1079  -PSTQSQFLPSVFSDKLSKPSRKSSNV-------EEARQSSSMAKKA----SNQEAAFKR  936
               S+QSQ      S  + +    S N        E+ + S+S+ KK+    S+ E  FKR
Sbjct  280   FSSSQSQLTAPASSALVHEHKPNSHNFTTKGNTNEDVQDSNSVVKKSGSSMSSCEPVFKR  339

Query  935   PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLS  756
              RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH+Q  VLS
Sbjct  340   ARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHEQ--VLS  397

Query  755   APYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFG  591
              PY+KNG  +     S H  ++ EG K +L+S+GLCLVPISSTFPVA ETT DFWTPTFG
Sbjct  398   TPYMKNGAPMQHQQGSDHKMKEAEGAKHDLKSRGLCLVPISSTFPVANETT-DFWTPTFG  456

Query  590   ASFR  579
             A+FR
Sbjct  457   ATFR  460



>gb|KDP38997.1| hypothetical protein JCGZ_00754 [Jatropha curcas]
Length=444

 Score =   236 bits (603),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 190/481 (40%), Positives = 257/481 (53%), Gaps = 101/481 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWW-NPARSMFGASPCSAATI--NDMGNFAWAnnddhhhhHQLVNM  1659
             MAD++ T+      +WW N +R+ F +   S++++  + + +FAW +        ++V++
Sbjct  1     MADEYNTST-----NWWDNSSRNRFDSGSSSSSSVLNSTLNSFAWPS--------EMVDV  47

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMD-----STHLHMLGIGLSPSSTATT  1494
             K RSS ES  S SD SS+V       H  TH ++       S+ LHM+G+GL   S+   
Sbjct  48    KTRSSVESA-SVSD-SSIVF------HDHTHKLNQQQPQDSSSDLHMMGLGL---SSQPI  96

Query  1493  DWNQALVQTNE-------RAMLQEDRNSRLNYGQE-------IGVECSDSSFKPV-AKDF  1359
             DWNQAL++  +       R+MLQE      NY QE        G E + + +K + ++ F
Sbjct  97    DWNQALLRGGDNKTENSFRSMLQE------NYQQEWRERVFSTGSESAINEYKQISSRGF  150

Query  1358  S------------TSTPS--------ATNFAPSYNYPSNllqtlldsdpqpqpqqplisn  1239
             S            +S+ S        ++ F   Y  PS +LQ LL S      QQ    +
Sbjct  151   SLDHQPQFSPHGGSSSDSTVTCQGLQSSGFQMDYGSPSTMLQGLLLSPDNHHQQQQQTQS  210

Query  1238  qqISYAPPPPANFRPNLNDFSPPLLKPT----------FPNAAASFWNQSP-------AS  1110
                        N+  + N+  P   K T           P++   F N +P        S
Sbjct  211   SLSYQYGSSATNYGISSNELVPSWSKVTNFLRNSPPKQSPHSQLHFSNNAPFWNASASNS  270

Query  1109  LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEA-AFKRP  933
             + DVR+  F  S Q QF  S F +       K  N+ E R SSS   K S  EA   KRP
Sbjct  271   MTDVRSNFFSSSLQPQFPVSNFEE-------KPKNISEVRDSSSTVVKKSGSEAPTTKRP  323

Query  932   RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSA  753
             R ET SP+P FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+VLS 
Sbjct  324   RNETQSPVPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVSVLST  383

Query  752   PYLKNGCSVSQHHQ---QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             PY+K G  +  H Q   +D +G+K +LRS+GLCLVP+SSTFPV  ETT DFWTPTFG ++
Sbjct  384   PYMKGGAPIHNHQQVSDKDPDGQKQDLRSRGLCLVPVSSTFPVTHETTVDFWTPTFGGTY  443

Query  581   R  579
             R
Sbjct  444   R  444



>ref|XP_002280367.3| PREDICTED: transcription factor bHLH123 isoform X1 [Vitis vinifera]
Length=458

 Score =   237 bits (604),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 181/480 (38%), Positives = 244/480 (51%), Gaps = 85/480 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI-NDMGNFAWAnnddhhhhHQLVNMKG  1653
             MAD+F T G+C G +WW+ +R+ + ++   A+T+   +G++AW           +V++K 
Sbjct  1     MADEFQT-GICSG-NWWDSSRNRYESASSPASTVLTSVGSYAW--------QPDMVDIKA  50

Query  1652  -RSSDESCGSASDGSSVVLQELPKSH-------HQTHNMSMDSTHLHMLGIGLSPSSTAT  1497
              RS+     S S  +SVV  +  K                +   +L M+G+GLS   +  
Sbjct  51    TRSASMDSVSVSGTTSVVFPDTQKMQGPDSSSGGGGGGGVLADPNLQMMGLGLS---SQA  107

Query  1496  TDWNQALVQTNER-----AMLQED---RNSRLNYGQE------IGVECSDSS---FKPVA  1368
              DWNQAL+++ +      +MLQ+     NS  N  Q           C DSS   +K V 
Sbjct  108   MDWNQALLRSGKAESSFGSMLQDQDMSSNSNFNADQAQWRQKLFSGSCEDSSGTEYKQVN  167

Query  1367  KDFS-------------TSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqIS  1227
             + FS              ST +      S+   S++  +               +     
Sbjct  168   RGFSLDQPQFSSHSSPGESTVTCQGLPTSFQVDSSVYGSPSTILQGLLGSDHQQNQSSFE  227

Query  1226  YAP---PPPANFRPNLNDFSPPLLK-PTFPNAA---------------ASFWNQSPASLN  1104
               P   P    +  N N+F P   K P F   +               A FWN S A++ 
Sbjct  228   NRPMNYPYLGTYGVNSNEFLPSWSKVPQFLRTSPPKQPSHTQLHFSNNAPFWNASAAAMA  287

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIE  924
                  +F P+ Q QF    F++K         N  E R  SS+AKK+S  E   KRPR E
Sbjct  288   ADSRPSFSPTLQPQFSTPTFNEK-------PKNSSEIRDISSVAKKSSG-ETGTKRPRSE  339

Query  923   TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYL  744
             TPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+ LS PY+
Sbjct  340   TPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVSALSTPYM  399

Query  743   KNGCSVSQHHQQDE-----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             K+G S+ QH Q  E     EG + +LRS+GLCLVP+SSTFPV  ET+ DFWTPTFG +FR
Sbjct  400   KSGASI-QHQQNSEKSKEPEGPRQDLRSRGLCLVPVSSTFPVTHETSVDFWTPTFGGTFR  458



>ref|XP_011096171.1| PREDICTED: transcription factor bHLH112 isoform X1 [Sesamum indicum]
Length=463

 Score =   236 bits (601),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 142/181 (78%), Gaps = 13/181 (7%)
 Frame = -3

Query  1085  FLPSTQS-QFLPSVFSDK---LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETP  918
             FLPS QS QF PS  + K   L   S+K  N  EAR  +S+AKKA N+ A FKRPRIETP
Sbjct  284   FLPSAQSGQFPPSSLNIKIPNLPSFSQKHQN-GEARDLASLAKKAGNEPATFKRPRIETP  342

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PYLKN
Sbjct  343   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSVLSTPYLKN  402

Query  737   GCSVSQHHQ--------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             G   SQ  Q        +D++G   +L+S+GLCLVPISSTFPVA+ET+SDFWTPTFG SF
Sbjct  403   GSPSSQRQQAADYSRVNKDQQGLIQDLKSRGLCLVPISSTFPVASETSSDFWTPTFGGSF  462

Query  581   R  579
             +
Sbjct  463   K  463


 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG-  1653
             MA +    GVCGG +WWNP+R++FG SPCS  T ND+G+F W+N D       +++MK  
Sbjct  1     MASEEFQGGVCGG-NWWNPSRNLFG-SPCSLPT-NDIGSFGWSNYDL------IMDMKAP  51

Query  1652  RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALV  1473
             RS+DES GSA+DG     ++  +       MS+DST L M+GI LS SST   DWNQ  +
Sbjct  52    RSNDESVGSAADG-----RKPQQESAANGTMSVDST-LQMMGINLS-SSTTPDDWNQDFL  104

Query  1472  QTNERA------MLQEDRNSRLNYGQEIGVE  1398
               + R+      +LQ+   S +NY QE  V+
Sbjct  105   HDSGRSDGNYTNILQD---SSMNYRQETRVD  132



>ref|XP_003593403.1| Transcription factor bHLH112 [Medicago truncatula]
 gb|AES63654.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=416

 Score =   232 bits (591),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 244/450 (54%), Gaps = 75/450 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN---PARSMF-----GASPCSAATINDMGNFA-WAnnddhhhh  1677
             MA++F  AG+CG  +WWN     RS+F      +S CS A  ND+GN++ W N       
Sbjct  1     MAEEFH-AGICGE-TWWNINNSTRSVFPLMMNSSSTCSVAA-NDVGNYSTWQN-------  50

Query  1676  HQLVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLG------IGLS  1515
                + +K     E+  + SD              + +N  +    L  L       +G  
Sbjct  51    -DFLGLK-----ETIRTCSD-------------IEVNNFDVSDCSLSFLDPQKPQIMGFD  91

Query  1514  PSSTATTDWNQALVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTPSAT  1335
               S  +++WNQ+L   N+  + +E     L+      V   D  F    ++ ++      
Sbjct  92    LLSPTSSNWNQSLF--NDSQIQKEWSTKNLSSTSGSQVSRMDQEFSLEQQNMNSGLSCGY  149

Query  1334  NFAP---SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP--  1170
                    SYNYPS+L+Q+L D + QP+PQ    ++   +  P   +++  + N+ SP   
Sbjct  150   PIGSVNNSYNYPSSLIQSLFDPELQPEPQPQPQNSLFTN--PSMSSSYSSSSNELSPTWT  207

Query  1169  -LLKPTFPNAAAS---------FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS  1020
              L+K + P    S         FWN S  +LND+RA  F+ S      P+   +K + P+
Sbjct  208   SLMKHSMPKQQLSGLLFSNNTPFWNASADALNDIRAGVFVSSQPQHQSPNFEDNKFNSPN  267

Query  1019  RKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSP  840
                + ++  R  S   K +S  E A KRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSP
Sbjct  268   TLLNKLK--RDKSPETKNSS--ETAVKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSP  323

Query  839   FGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD------EEGRKAELR  678
             FGKTDTASVLHEAIEYIKFLHDQVNVLS PY+K+G  +   HQQD       EG+K +LR
Sbjct  324   FGKTDTASVLHEAIEYIKFLHDQVNVLSTPYMKSGSPI--QHQQDCDNVNESEGKKQDLR  381

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTFGA  588
             SQGLCLVPISSTFP+  ET  DFWTPTFG 
Sbjct  382   SQGLCLVPISSTFPMTNETPVDFWTPTFGG  411



>ref|XP_010240994.1| PREDICTED: transcription factor bHLH123-like [Nelumbo nucifera]
Length=463

 Score =   233 bits (594),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 158/231 (68%), Gaps = 27/231 (12%)
 Frame = -3

Query  1205  NFRPNLNDFSPP------LLKPTFPNAAAS----------FWNQSPASLNDVRAATFLPS  1074
             N R N ND SP       LLK + P   ++          FWN S A++N+VR++ F PS
Sbjct  238   NCRINSNDISPSWPKFSQLLKTSPPKQQSTNQLHFSNKGPFWNASAAAMNEVRSSYF-PS  296

Query  1073  TQSQFLPSVFSDK--LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTF  900
             +Q+Q L   F +K   S  + KSS  E+ R S+S  KK  N E AFKRPRIETP  LPTF
Sbjct  297   SQTQLLTPTFEEKPNCSNLTAKSS-TEDVRDSASAVKKG-NSEPAFKRPRIETP--LPTF  352

Query  899   KVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ  720
             KVRKEKLGDR+TALQQLVSPFGKTDTASVL EAIEYIKFLHDQV+VLS PY+KNG S+  
Sbjct  353   KVRKEKLGDRITALQQLVSPFGKTDTASVLFEAIEYIKFLHDQVSVLSTPYMKNGASIQP  412

Query  719   HHQQDE----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                 D+    E  K +LRS+GLCLVPISST+PV  ET +DFWTPTFG ++R
Sbjct  413   KQNSDKSKEGEAHKPDLRSRGLCLVPISSTYPVTNETAADFWTPTFGGTYR  463


 Score = 91.3 bits (225),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 98/172 (57%), Gaps = 28/172 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFG--ASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD F T GVC G +WWNP R+ F   +SPCS A +ND+G+F W          ++V+MK
Sbjct  1     MADQFQT-GVCSG-NWWNPTRNGFNGNSSPCSTA-LNDIGSFGWP--------TEMVDMK  49

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTH----NMSMDSTHLHMLGIGLSPSSTATTDW  1488
              RS++ES  S  D SS+V  +  K           + MDST L ++G GL  SS  T DW
Sbjct  50    TRSTEES-ASVCD-SSIVFSDTQKQQVADSVSGGGVLMDST-LQIMGFGL--SSPTTVDW  104

Query  1487  NQALVQTNER------AMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFSTS  1350
             NQAL++++ R      +MLQE+ +SR ++ QE  +E S    +   K+FS S
Sbjct  105   NQALLRSSGRGEANFHSMLQEELSSRHSFRQETSMESSQLQKEWSPKNFSVS  156



>gb|EYU27864.1| hypothetical protein MIMGU_mgv1a011041mg [Erythranthe guttata]
Length=294

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 160/212 (75%), Gaps = 9/212 (4%)
 Frame = -3

Query  1205  NFRPNLNDFSPPLLKPTFPNAAASFWNQSPASL--NDVRAATFLPSTQSQFLPSVFSDKL  1032
             N++ N N+F P +  P+F       WN + A L  NDVR++    S+QSQFLPS  S   
Sbjct  89    NYQVNSNEFLP-MENPSFA-KQQQLWNSTAADLSTNDVRSSFLPSSSQSQFLPS--SVHC  144

Query  1031  SKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQ  852
              KP+  S +V+   + +S+ KKASN E +FKRPRIETPSPLPTFKVRKEKLGDR+TALQQ
Sbjct  145   KKPNLPSFSVKHQNEEASVPKKASN-EPSFKRPRIETPSPLPTFKVRKEKLGDRITALQQ  203

Query  851   LVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-QDEEGRKAELRS  675
             LVSPFGKTDTASVLHEAIEYIKFLHDQVN LS+PYLK+  S  Q  Q +D+EG   +L++
Sbjct  204   LVSPFGKTDTASVLHEAIEYIKFLHDQVNELSSPYLKHRPSPVQRLQAEDKEGVMQDLKT  263

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             +GLCLVP++STFPVA +T +DFWTPTFG SF+
Sbjct  264   RGLCLVPVTSTFPVA-QTPADFWTPTFGGSFK  294



>ref|XP_008224896.1| PREDICTED: transcription factor bHLH112 isoform X3 [Prunus mume]
Length=431

 Score =   231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 198/483 (41%), Positives = 250/483 (52%), Gaps = 118/483 (24%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CG  SWWN +R    ASPCS    + MG+F   N         +V++K  
Sbjct  1     MAEEFQ-AGICGS-SWWNTSRHALVASPCSVGFNDHMGSFGCPN--------DMVDIK--  48

Query  1649  SSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALVQ  1470
             +S  SCG                         D    H      +PS     D NQAL+ 
Sbjct  49    ASRSSCG------------------------FD----HSSSSSSTPS-----DLNQALLL  75

Query  1469  TNERAMLQED--RNSRLNYGQEIGVECSDSS----FKPVAKDFS--------------TS  1350
             +       E    NS L  G  +GV+   SS    FKP+++DFS              TS
Sbjct  76    SRSGGGRAESNFHNSMLQEG--VGVDEDSSSLIDGFKPMSQDFSLDQLGSSSSSGFPITS  133

Query  1349  TPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnq-------------qISYAPP--  1215
             + SA N   SY +PS  LQ++ DS+      Q  + N                S  PP  
Sbjct  134   SSSAAN---SYGFPSTFLQSIFDSEVSQPQPQQSLFNNNHFSNDLLLPPSPTSSCWPPRY  190

Query  1214  -PPANFRPNLNDFSPPLLKPT--------FPNAAAS-FWNQSPASL----NDVRAATFL-  1080
              P +  RP+     P  L+P         FPN   + FWN   A+     N +R++  L 
Sbjct  191   SPSSCLRPSAVSL-PKQLQPGGGGGGGLHFPNNINTPFWNTPAATALNHGNGIRSSNGLF  249

Query  1079  PSTQSQFLPSVFSDKLSKPSRKSSNV-------EEARQSSSMAKKA----SNQEAAFKRP  933
              S+QSQ      S  + +    S N        E+ + S+S+ KK+    S+ E  FKR 
Sbjct  250   SSSQSQLTAPASSALVHEHKPNSHNFTTKGNTNEDVQDSNSVVKKSGSSMSSCEPVFKRA  309

Query  932   RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSA  753
             RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH+QV+VLS 
Sbjct  310   RIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHEQVSVLST  369

Query  752   PYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA  588
             PY+KNG  +     S H  ++ EG K +L+S+GLCLVPISSTFPVA ETT DFWTPTFGA
Sbjct  370   PYMKNGAPMQHQQGSDHKMKEAEGAKHDLKSRGLCLVPISSTFPVANETT-DFWTPTFGA  428

Query  587   SFR  579
             +FR
Sbjct  429   TFR  431



>emb|CAN78236.1| hypothetical protein VITISV_016390 [Vitis vinifera]
Length=477

 Score =   231 bits (589),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 181/487 (37%), Positives = 245/487 (50%), Gaps = 85/487 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI-NDMGNFAWAnnddhhhhHQLVNMKG  1653
             MAD+F T G+C G +WW+ +R+ + ++   A+T+   +G++AW           +V++K 
Sbjct  1     MADEFQT-GICSG-NWWDSSRNRYESASSPASTVLTSVGSYAW--------QPDMVDIKA  50

Query  1652  -RSSDESCGSASDGSSVVLQELPKSH-------HQTHNMSMDSTHLHMLGIGLSPSSTAT  1497
              RS+     S S  +SVV  +  K                +   +L M+G+GLS   +  
Sbjct  51    TRSASMDSVSVSGTTSVVFPDTQKMQGPDSSSGGGGGGGVLADPNLQMMGLGLS---SQA  107

Query  1496  TDWNQALVQTNER-----AMLQED---RNSRLNYGQE------IGVECSDSS---FKPVA  1368
              DWNQAL+++ +      +MLQ+     NS  N  Q           C DSS   +K V 
Sbjct  108   MDWNQALLRSGKAESSFGSMLQDQDMSSNSNFNADQAQWRQKLFSGSCEDSSGTEYKQVN  167

Query  1367  KDFS-------------TSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqIS  1227
             + FS              ST +      S+   S++  +               +     
Sbjct  168   RGFSLDQPQFSSHSSPGESTVTCQGLPTSFQVDSSVYGSPSTILQGLLGSDHQQNQSSFE  227

Query  1226  YAP---PPPANFRPNLNDFSPPLLK-PTFPNAA---------------ASFWNQSPASLN  1104
               P   P    +  N N+F P   K P F   +               A FWN S A++ 
Sbjct  228   NRPMNYPYLGTYGVNSNEFLPSWSKVPQFLRTSPPKQPSHTQLHFSNNAPFWNASAAAMA  287

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRKS-------SNVEEARQSSSMAKKASNQEAA  945
                  +F P+ Q QF    F++K       S        N  E R  SS+AKK+S  E  
Sbjct  288   ADSRPSFSPTLQPQFSTPTFNEKPKVLMLISFIYQFFQQNSSEIRDISSVAKKSSG-ETG  346

Query  944   FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVN  765
              KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+
Sbjct  347   TKRPRSETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVS  406

Query  764   VLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTP  600
              LS PY+K+G S+ QH Q  E     EG + +LRS+GLCLVP+SSTFPV  ET+ DFWTP
Sbjct  407   ALSTPYMKSGASI-QHQQNSEKSKEPEGPRQDLRSRGLCLVPVSSTFPVTHETSVDFWTP  465

Query  599   TFGASFR  579
             TFG +F+
Sbjct  466   TFGGTFQ  472



>ref|XP_010644310.1| PREDICTED: transcription factor bHLH123 isoform X2 [Vitis vinifera]
Length=456

 Score =   229 bits (585),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 180/480 (38%), Positives = 242/480 (50%), Gaps = 87/480 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI-NDMGNFAWAnnddhhhhHQLVNMKG  1653
             MAD+F T G+C G +WW+ +R+ + ++   A+T+   +G++AW           +V++K 
Sbjct  1     MADEFQT-GICSG-NWWDSSRNRYESASSPASTVLTSVGSYAW--------QPDMVDIKA  50

Query  1652  -RSSDESCGSASDGSSVVLQELPKSH-------HQTHNMSMDSTHLHMLGIGLSPSSTAT  1497
              RS+     S S  +SVV  +  K                +   +L M+G+GLS   +  
Sbjct  51    TRSASMDSVSVSGTTSVVFPDTQKMQGPDSSSGGGGGGGVLADPNLQMMGLGLS---SQA  107

Query  1496  TDWNQALVQTNER-----AMLQED---RNSRLNYGQE------IGVECSDSS---FKPVA  1368
              DWNQAL+++ +      +MLQ+     NS  N  Q           C DSS   +K V 
Sbjct  108   MDWNQALLRSGKAESSFGSMLQDQDMSSNSNFNADQAQWRQKLFSGSCEDSSGTEYKQVN  167

Query  1367  KDFS-------------TSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqIS  1227
             + FS              ST +      S+   S++  +               +     
Sbjct  168   RGFSLDQPQFSSHSSPGESTVTCQGLPTSFQVDSSVYGSPSTILQGLLGSDHQQNQSSFE  227

Query  1226  YAP---PPPANFRPNLNDFSPPLLK-PTFPNAA---------------ASFWNQSPASLN  1104
               P   P    +  N N+F P   K P F   +               A FWN S A++ 
Sbjct  228   NRPMNYPYLGTYGVNSNEFLPSWSKVPQFLRTSPPKQPSHTQLHFSNNAPFWNASAAAMA  287

Query  1103  DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIE  924
                  +F P+ Q QF    F++K         N  E R  SS+AKK+S  E   KRPR E
Sbjct  288   ADSRPSFSPTLQPQFSTPTFNEK-------PKNSSEIRDISSVAKKSSG-ETGTKRPRSE  339

Query  923   TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYL  744
             TPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+Q   LS PY+
Sbjct  340   TPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQ--ALSTPYM  397

Query  743   KNGCSVSQHHQQDE-----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             K+G S+ QH Q  E     EG + +LRS+GLCLVP+SSTFPV  ET+ DFWTPTFG +FR
Sbjct  398   KSGASI-QHQQNSEKSKEPEGPRQDLRSRGLCLVPVSSTFPVTHETSVDFWTPTFGGTFR  456



>ref|XP_011030917.1| PREDICTED: transcription factor bHLH123 [Populus euphratica]
Length=450

 Score =   229 bits (584),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 139/193 (72%), Gaps = 17/193 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S ++++DVR + F PS Q QF  S F +K         N+ E R S++  KK S
Sbjct  269   APFWNASSSAMSDVRPS-FFPSMQPQFTTSNFDEK-------PKNISEVRDSNTAVKK-S  319

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               EA  KRPR ETPSP P FK RKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  320   GGEAGAKRPRNETPSPSPAFKARKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  379

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATETT  618
             H+QV VLS PY+KNG  V  HHQQ      D EG+K +LRS+GLCLVP+SSTFPV  ETT
Sbjct  380   HEQVTVLSTPYMKNGTPV--HHQQSSEKSRDSEGQKQDLRSRGLCLVPVSSTFPVTHETT  437

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG +FR
Sbjct  438   VDFWTPTFGGTFR  450


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 85/168 (51%), Gaps = 33/168 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA---RSMFGASPCSAATIND--MGNFAWAnnddhhhhHQLV  1665
             MAD++ +       +WW+ +   R+ F ++  S+ T     +G+FAW          ++V
Sbjct  1     MADEYTST------NWWDSSSSSRNRFDSTGSSSTTSGHTSLGSFAWPT--------EMV  46

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWN  1485
             ++KGRSS E+   +            +   Q H+   D   LHM+G+GLS   +   DWN
Sbjct  47    DVKGRSSMETVSVSDSSVVF---HDSQKLQQGHDSPAD---LHMMGLGLS---SPAIDWN  97

Query  1484  QALVQTNE-----RAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS  1356
             QAL++ ++     R+MLQ++ +S  NY QE G+  S + ++   + F+
Sbjct  98    QALLRGDKSESSFRSMLQDNLSSSTNYQQETGIGSSQAQWRSSERVFA  145



>ref|XP_011096172.1| PREDICTED: transcription factor bHLH112 isoform X2 [Sesamum indicum]
Length=461

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 140/181 (77%), Gaps = 15/181 (8%)
 Frame = -3

Query  1085  FLPSTQS-QFLPSVFSDK---LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETP  918
             FLPS QS QF PS  + K   L   S+K  N  EAR  +S+AKKA N+ A FKRPRIETP
Sbjct  284   FLPSAQSGQFPPSSLNIKIPNLPSFSQKHQN-GEARDLASLAKKAGNEPATFKRPRIETP  342

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  VLS PYLKN
Sbjct  343   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ--VLSTPYLKN  400

Query  737   GCSVSQHHQ--------QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
             G   SQ  Q        +D++G   +L+S+GLCLVPISSTFPVA+ET+SDFWTPTFG SF
Sbjct  401   GSPSSQRQQAADYSRVNKDQQGLIQDLKSRGLCLVPISSTFPVASETSSDFWTPTFGGSF  460

Query  581   R  579
             +
Sbjct  461   K  461


 Score = 89.4 bits (220),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 90/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG-  1653
             MA +    GVCGG +WWNP+R++FG SPCS  T ND+G+F W+N D       +++MK  
Sbjct  1     MASEEFQGGVCGG-NWWNPSRNLFG-SPCSLPT-NDIGSFGWSNYDL------IMDMKAP  51

Query  1652  RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALV  1473
             RS+DES GSA+DG     ++  +       MS+DST L M+GI LS SST   DWNQ  +
Sbjct  52    RSNDESVGSAADG-----RKPQQESAANGTMSVDST-LQMMGINLS-SSTTPDDWNQDFL  104

Query  1472  QTNERA------MLQEDRNSRLNYGQEIGVE  1398
               + R+      +LQ+   S +NY QE  V+
Sbjct  105   HDSGRSDGNYTNILQD---SSMNYRQETRVD  132



>ref|XP_006370578.1| ethylene-responsive family protein [Populus trichocarpa]
 gb|ERP67147.1| ethylene-responsive family protein [Populus trichocarpa]
Length=444

 Score =   228 bits (582),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 189/490 (39%), Positives = 254/490 (52%), Gaps = 119/490 (24%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN--PARSMFGASPCSAAT--INDMGNFAWAnnddhhhhHQLVN  1662
             MAD++ +       +WW+   +R+ F ++  S+ T  +N + +FAW          ++ +
Sbjct  1     MADEYTST------NWWDSSASRNRFDSTGSSSTTSGLNSLRSFAWPT--------EMAD  46

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
             +KGRSS E+  S SD SSV   +  K   Q H+ S D   LHM+G+GLS   +   DWNQ
Sbjct  47    VKGRSSMETV-SVSD-SSVAFHDSQK-LQQGHDSSAD---LHMMGLGLS---SQAMDWNQ  97

Query  1481  ALVQTNE-----RAMLQEDRNSRLNYGQEI----------------GV--ECSDSSFKPV  1371
             AL++ ++     R+MLQ++ +S  NY QE                 GV  + S S FK +
Sbjct  98    ALLRGDKSENSFRSMLQDNLSSSTNYQQETAGIGSSQSQWRERVFTGVTGDSSMSEFKQM  157

Query  1370  AKDFSTSTPSATNFAPS------------------------YNYPSNllqtlldsdpqpq  1263
              + FS   P    F+P                         Y  PS ++Q LL SD Q +
Sbjct  158   NRGFSLDQP---QFSPHGSSSDSTVSCQGLQSSFPMDSSSIYGSPSTMVQGLLISDNQAR  214

Query  1262  pqqplisnqqISYAPPPPANFRPNLNDF------SPPLLKPTFPNAAAS----------F  1131
                        +Y     AN+    N+        P  L+ + P   +S          F
Sbjct  215   QSSFENRPMSYAYG----ANYSLGTNELLPSWPKGPQFLRNSPPKQTSSNQLHFSNNTPF  270

Query  1130  WNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQE  951
             WN S +++NDVR + F PS Q QF  S F +K  +      N+ E R S+ +A K S  E
Sbjct  271   WNASASAMNDVRPSYF-PSMQPQFATSNFDEKPKQ------NISEVRDSN-IAVKKSGSE  322

Query  950   AAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  771
             AA KRPR E PS LP+FKVRKEK+GDR+TALQQL      TDTASVL EAIEYIKFLH Q
Sbjct  323   AATKRPRNEIPSSLPSFKVRKEKMGDRITALQQL------TDTASVLSEAIEYIKFLHQQ  376

Query  770   VNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATETTSDF  609
             V V S  Y+K+G  +   HQQ      D EG+K +LRS+GLCLVP+SSTFPV  ET  DF
Sbjct  377   VTVFSTQYMKSGTPI--LHQQSSDKSKDLEGQKQDLRSRGLCLVPVSSTFPVTHETAVDF  434

Query  608   WTPTFGASFR  579
             WTPTFG ++R
Sbjct  435   WTPTFGGTYR  444



>ref|XP_009594898.1| PREDICTED: transcription factor bHLH123-like [Nicotiana tomentosiformis]
Length=416

 Score =   228 bits (580),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 138/191 (72%), Gaps = 15/191 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQF-LPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FWN S A++NDV ++ F  +   Q  +P+V          K+ N  E R  + M+KK S+
Sbjct  235   FWNASAAAMNDVPSSLFPSNLHPQLPIPTV--------DEKTKNTGEIRDINRMSKKTSS  286

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E + KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH
Sbjct  287   -EISNKRPRDETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLH  345

Query  776   DQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSD  612
             DQ+  LSAPY+K+G S  QH Q     +D EGR  +LRS+GLCLVP+SSTFPV  ETT D
Sbjct  346   DQIGALSAPYMKSGSSAMQHQQSNNKSEDAEGRNQDLRSRGLCLVPVSSTFPVTNETTVD  405

Query  611   FWTPTFGASFR  579
             FWTPTFG +FR
Sbjct  406   FWTPTFGGTFR  416



>ref|XP_011086152.1| PREDICTED: transcription factor bHLH112-like [Sesamum indicum]
Length=469

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 143/196 (73%), Gaps = 15/196 (8%)
 Frame = -3

Query  1136  SFWNQSPASLNDVRAATFLPSTQSQFLP--SVFSDKLSKP--SRKSSNVEEARQSSSMAK  969
             SFWN   A+      A  LPSTQ +FLP   + S K + P  S K    E+ +  +S  K
Sbjct  279   SFWNAMAAA----SGANVLPSTQPRFLPPPMINSAKSNLPNISAKHHKEEDPKDLASAVK  334

Query  968   KASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             K SN E +FKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYI
Sbjct  335   KFSN-EPSFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYI  393

Query  788   KFLHDQVNVLSAPYLKNG------CSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVAT  627
             KFLHDQV+VLS PYLKN       C  +    +D+EG   +L+S+GLCLVPISSTFPVA 
Sbjct  394   KFLHDQVSVLSTPYLKNATPPLQRCPQAGDKNKDQEGPIQDLKSRGLCLVPISSTFPVAA  453

Query  626   ETTSDFWTPTFGASFR  579
             ETT+DFWTPTFG SFR
Sbjct  454   ETTADFWTPTFGGSFR  469


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 87/163 (53%), Gaps = 32/163 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA+DF   GVCGG +WWNP R++FG+SPC++A INDMG+F W    +H     +   +  
Sbjct  1     MAEDFQ-GGVCGG-NWWNPQRNLFGSSPCASA-INDMGSFGWL--QNHDLMMDVSTARSI  55

Query  1649  SSDESCGSASDG-SSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATT-DWNQAL  1476
             S D +C +ASDG SSV++Q++ K    T             G G  P   +TT DWNQ L
Sbjct  56    SDDSACSAASDGASSVLIQDVQKPQQPT-------------GDGNMPMFASTTDDWNQDL  102

Query  1475  V-------QTNERAMLQEDRNSRLNY---GQEIGVECSDSSFK  1377
             +       + +   MLQE   + LNY     ++  +C D + K
Sbjct  103   LHDHSGRSEDDYSRMLQE--AAGLNYRLTTTDVVDKCPDQNHK  143



>ref|XP_006449162.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
 gb|ESR62402.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
Length=489

 Score =   228 bits (581),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 153/238 (64%), Gaps = 38/238 (16%)
 Frame = -3

Query  1208  ANFRPNLNDFSPP--------LLKPTFPNAAAS-------------FWNQSPASLNDVRA  1092
             AN+  N N+ SPP         +KP+ P                  FWN +  +LND+  
Sbjct  262   ANYGNNYNEVSPPWPKFAAASFVKPSLPKQQQQQPSGGLHFSNNTPFWNAT--ALNDI--  317

Query  1091  ATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKKASNQEAAFKRPRIETP  918
                  S     L +   +K + P+   K +N EE R S S AKK S+ E AFKRPRIETP
Sbjct  318   -----SRPGGLLAAELGEKRTCPTFTAKYNNNEEVRDSGSAAKKGSS-EPAFKRPRIETP  371

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAI+YIKFLHDQV+VL+ PY+K 
Sbjct  372   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVSVLTTPYMKQ  431

Query  737   GCSVSQ-----HHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             G  + Q     H  +D E  K +L S+GLCLVPISSTFPVA ETT+DFW PTFG +FR
Sbjct  432   GTQIPQQQSCDHKLKDPEAPKQDLNSRGLCLVPISSTFPVANETTADFWNPTFGGTFR  489



>ref|XP_008789835.1| PREDICTED: transcription factor bHLH123-like [Phoenix dactylifera]
Length=459

 Score =   227 bits (578),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 145/192 (76%), Gaps = 9/192 (5%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNV-EEARQSSSMA-KKAS  960
             FWN S AS+++VR   F      QF+   F  K +  +  + ++ E  R SSS A KK+ 
Sbjct  270   FWNASAASMSEVRTG-FPHPMPPQFVSQAFEQKPTCSNLAAKSISERVRDSSSSATKKSG  328

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E+AFKRP+IETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAI+YIKFL
Sbjct  329   SNESAFKRPKIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFL  388

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             HDQV VLS+ YLKNG  + QH Q     QD EG K +LRS+GLCLVPISST+PVA+ETT+
Sbjct  389   HDQVGVLSSQYLKNGHPM-QHQQGSDKSQDGEGPKQDLRSRGLCLVPISSTYPVASETTA  447

Query  614   DFWTPTFGASFR  579
             DFW P FG +FR
Sbjct  448   DFWHPPFGGTFR  459


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 80/157 (51%), Gaps = 27/157 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS---MFGASPCSAATINDM--GNFAWAnnddhhhhHQLV  1665
             MAD+F + G+C GGSWWN ARS      AS   +A I DM  G F+WA         +L 
Sbjct  1     MADEFQS-GICSGGSWWNLARSDGFDGQASVSGSAAIPDMGGGGFSWA-------TAELA  52

Query  1664  NMKGRSSDESCGSASDGSSVV--LQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTD  1491
               K RS +ES GS S  S        LP S        +DST L M G  L   ST + D
Sbjct  53    EPKARSGEESVGSVSGSSVSFQDTHMLPPS--DVGPSVIDST-LQMPGFSL---STPSID  106

Query  1490  WNQALVQTNER------AMLQEDRNSRLNYGQEIGVE  1398
             W QAL++++ R      A+LQED +SR  + Q+  +E
Sbjct  107   WTQALLRSSGRAETSFHAVLQEDLSSRPYFRQDPSME  143



>ref|XP_006851218.1| hypothetical protein AMTR_s00043p00225670 [Amborella trichopoda]
 gb|ERN12799.1| hypothetical protein AMTR_s00043p00225670 [Amborella trichopoda]
Length=455

 Score =   226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 147/192 (77%), Gaps = 12/192 (6%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK--LSKPSRKSSNVEEARQSSSMAKKAS  960
             FWN SP + N +R   + PS Q QF+     +K  +S  + K+ N++EA  S +  KK++
Sbjct  269   FWNASPMA-NSIRPGLYAPSNQ-QFMSQTIEEKPLISNITAKT-NIDEAHDSLADLKKSA  325

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E +FKRPR+ETPSPLPTFKVRKEKLGDR+TALQQ+VSPFGKTDTASVL+EAI+YIKFL
Sbjct  326   S-EPSFKRPRLETPSPLPTFKVRKEKLGDRITALQQIVSPFGKTDTASVLYEAIQYIKFL  384

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             H+QVN LS PY+KNG  + QHHQ     +D EG K +LRS+GLCLVPISST+PV +ET  
Sbjct  385   HEQVNTLSTPYMKNGAPL-QHHQSADKSKDTEGPKQDLRSRGLCLVPISSTYPVTSETAV  443

Query  614   DFWTPTFGASFR  579
             D+WTPTFG ++R
Sbjct  444   DYWTPTFGGTYR  455



>ref|XP_002317553.1| ethylene-responsive family protein [Populus trichocarpa]
 gb|EEE98165.1| ethylene-responsive family protein [Populus trichocarpa]
Length=451

 Score =   226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 137/193 (71%), Gaps = 17/193 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S ++++DVR + F PS Q QF  S F +K         N+ E R S++  KK S
Sbjct  270   APFWNASSSAMSDVRPS-FFPSMQPQFTTSNFDEK-------PKNISEVRDSNTAVKK-S  320

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               EA  KRPR ETPSP P FK RKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  321   GGEAGAKRPRNETPSPSPAFKARKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  380

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATETT  618
             H+QV VL  PY+KNG  +  HHQQ      D EG+K +LRS GLCLVP+SSTFPV  ETT
Sbjct  381   HEQVTVLCTPYMKNGAPI--HHQQSSEKSRDSEGQKQDLRSLGLCLVPVSSTFPVTHETT  438

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG +FR
Sbjct  439   VDFWTPTFGGTFR  451


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 86/168 (51%), Gaps = 33/168 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA---RSMFGASPCSAATIND--MGNFAWAnnddhhhhHQLV  1665
             MAD++ +       +WW+ +   R+ F ++  S+ T     +G+FAW          ++V
Sbjct  1     MADEYTST------NWWDSSSSSRNRFDSTGSSSTTSGHTSLGSFAWPT--------EMV  46

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWN  1485
             ++KGRSS E+   +            +   Q H+ S D   LHM+G+GLS   +   DWN
Sbjct  47    DVKGRSSMETVSVSDSSVVF---HDSQKLQQGHDSSAD---LHMMGLGLS---SPAIDWN  97

Query  1484  QALVQTNE-----RAMLQEDRNSRLNYGQEIGVECSDSSFKPVAKDFS  1356
             QAL++ ++     R+MLQ++ +S  NY QE G+  S + ++   + F+
Sbjct  98    QALLRGDKSENSFRSMLQDNLSSSTNYQQETGIGSSQAQWRSSERVFA  145



>ref|XP_004293560.1| PREDICTED: transcription factor bHLH113-like [Fragaria vesca 
subsp. vesca]
Length=440

 Score =   223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 150/213 (70%), Gaps = 22/213 (10%)
 Frame = -3

Query  1154  FPNAAASFWNQSPASLN-DVRAATFLPS-TQSQFL-PSVFSDKLSKP------SRKSSNV  1002
             F N    FWN   A+LN D+R+    PS +QSQ+  P+  +    KP      ++ ++N 
Sbjct  229   FSNINTPFWNTPAAALNHDIRSTGLFPSLSQSQYTAPTAAAYDEHKPITSGNFTKANTNE  288

Query  1001  EEARQSSSMAKKA-----SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             +    SSS  KK+     S+ E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  289   DVQDSSSSTVKKSGSSFCSSTEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPF  348

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ------QDEEGRKAELRS  675
             GKTDTASVLHEAIEYIKFLHDQV VLS PY+ NG  + QH Q      + E+G K +L+S
Sbjct  349   GKTDTASVLHEAIEYIKFLHDQVGVLSTPYMNNGAPI-QHQQGCDKLKEGEQGGKQDLQS  407

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
             +GLCLVP+SSTFPVA ETT+DFWTPTFGA +FR
Sbjct  408   RGLCLVPVSSTFPVANETTADFWTPTFGATTFR  440



>ref|XP_010057695.1| PREDICTED: transcription factor bHLH112-like [Eucalyptus grandis]
 gb|KCW74873.1| hypothetical protein EUGRSUZ_E03614 [Eucalyptus grandis]
Length=461

 Score =   222 bits (566),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 150/225 (67%), Gaps = 28/225 (12%)
 Frame = -3

Query  1193  NLNDFSPP-------LLKPTFPNAA-----ASFWNQSPASLNDVRAATFLPSTQSQFLPS  1050
             N ND SPP       LLKP+  N        S     P  +N +   T  P       P+
Sbjct  245   NSNDQSPPSFAKLSSLLKPSSVNRQPNRLPVSDIAMGPTPMNSLDWTTASP-------PT  297

Query  1049  VFSDK--LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             ++  K   + P+ K  N ++AR+ +S  KK+S+ E  FKRPRIETPSPLPTFKVRKEKLG
Sbjct  298   IYDKKPSCATPNTKR-NCDDAREVNSAVKKSSSTEPGFKRPRIETPSPLPTFKVRKEKLG  356

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE--  702
             DR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+VLS PY++NG S+      D+  
Sbjct  357   DRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVHVLSTPYMRNGASIQHQQGCDKPK  416

Query  701   ----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                 EG K +L+S+GLCLVPISSTFPV+ ET  DFWTPTFG SFR
Sbjct  417   DYASEGPKQDLKSRGLCLVPISSTFPVSHETPVDFWTPTFGGSFR  461


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 87/179 (49%), Gaps = 29/179 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSM---FGASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MA++F  AG+CG  SWW+  R M    GAS C AA  ND G F W   D        ++ 
Sbjct  1     MAENFQ-AGICGE-SWWSSLRGMPFAGGASICLAAA-NDGGGFGWTAADMA------MSN  51

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHL---HMLGIGLSPSSTATTDW  1488
             K RSS+ +  S SD S V      K+  ++       + L    +LG G   S  AT DW
Sbjct  52    KARSSEHNDFSLSDSSMVFENNHYKAQPRSAVRGCGRSELVVPDLLGTGFGISLPATPDW  111

Query  1487  NQALV-------QTNERAMLQEDRNSRL-------NYGQEIGVECSDSSFKPVAKDFST  1353
             NQAL+       Q++  ++L E+ +SR+       +Y   +  + S + FK + ++FS+
Sbjct  112   NQALLGGGGKFAQSSYGSILNEEMSSRIQKDWSPKSYSSCVVEDSSMNGFKQINQEFSS  170



>ref|XP_009790944.1| PREDICTED: transcription factor bHLH123-like [Nicotiana sylvestris]
Length=423

 Score =   221 bits (563),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 136/192 (71%), Gaps = 17/192 (9%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKKAS  960
             FWN S A++NDV      PST     PS    +L  P+   K+ N+ E R  + M+KK S
Sbjct  242   FWNASAAAMNDV------PST---LFPSNLHPQLPIPTIDEKAKNMGEVRDINKMSKKTS  292

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E   KRPR ETPSP P FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  293   S-ETTNKRPRDETPSPSPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  351

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             HDQ+  L APY+K+G S  QH Q     +D EG+  +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  352   HDQIGALGAPYMKSGSSAMQHQQSSNKSEDAEGQNQDLRSRGLCLVPVSSTFPVTHETTV  411

Query  614   DFWTPTFGASFR  579
             DFWTPTFG +FR
Sbjct  412   DFWTPTFGGTFR  423



>ref|XP_010909853.1| PREDICTED: transcription factor bHLH112 isoform X1 [Elaeis guineensis]
Length=452

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 142/193 (74%), Gaps = 12/193 (6%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLS---KPSRKSSNVEEARQSSSMAKKA  963
             FWN S  + N+  ++ +  ST +Q  P  F  K +    P +  SN E A  SSS A K 
Sbjct  261   FWNPSATATNETTSSLY-SSTPTQIAPHAFKGKTNCNNLPVK--SNSEGAGVSSSNAIKK  317

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S+ E AFK+PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF
Sbjct  318   SSTEQAFKKPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  377

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETT  618
             LH+QV VLSAPY KNG   SQH Q     +D EG K +L+S+GLCLVP+SSTF VA+ET 
Sbjct  378   LHEQVGVLSAPYWKNGHQ-SQHSQNLDKTKDGEGPKLDLKSRGLCLVPMSSTFAVASETP  436

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG ++R
Sbjct  437   VDFWTPTFGGTYR  449


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 79/160 (49%), Gaps = 27/160 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS------MFGAS-PCSAATINDMGNFAWAnnddhhhhHQ  1671
             MA++F T G+C  GSWW+ AR+      M   S  CS       G+F W    D      
Sbjct  1     MAEEFQT-GICSSGSWWSTARTGSFDGPMLSTSVSCSTEFTGIGGSFNWPVAADA-----  54

Query  1670  LVNMKGRSSDESCGSASDGSSVVLQELPK---SHHQTHNMSMDSTHLHMLGIGLSPSSTA  1500
              V  + RSSDES GS S  SS+  Q+  K   S     +  MDST L + G GLS   + 
Sbjct  55    -VEAESRSSDESPGSVSINSSITFQDTHKPQASDPLVADPLMDST-LQIPGFGLS---SP  109

Query  1499  TTDWNQAL------VQTNERAMLQEDRNSRLNYGQEIGVE  1398
             + +W+Q         +TN  A+LQED NSR N+ QE  +E
Sbjct  110   SINWHQPFFTTAGRAETNLHALLQEDMNSRPNHPQEPVIE  149



>ref|XP_010062929.1| PREDICTED: transcription factor bHLH123 [Eucalyptus grandis]
 gb|KCW70079.1| hypothetical protein EUGRSUZ_F03384 [Eucalyptus grandis]
Length=436

 Score =   220 bits (560),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 17/195 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAAT---FLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAK  969
             A FW  S  ++NDVR+ T   + P +Q+QF P  F +K         N+ +     +  K
Sbjct  251   APFWTASATAMNDVRSTTTTTYFPQSQAQFGPPAFDEK-------PKNLTDVANPGAAMK  303

Query  968   KASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             K S  E A KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYI
Sbjct  304   K-SGGEPAGKRPRSETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLTEAIEYI  362

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATE  624
             KFLHDQ++VLS PY+KNG ++ QH Q     +D +G + +LRS+GLCLVP+SST+PV  E
Sbjct  363   KFLHDQISVLSTPYMKNGGAM-QHQQTPDKSEDPDGPRPDLRSRGLCLVPVSSTYPVTHE  421

Query  623   TTSDFWTPTFGASFR  579
             TT DFWTPTFG +FR
Sbjct  422   TTVDFWTPTFGGTFR  436



>ref|XP_003528420.1| PREDICTED: transcription factor bHLH123-like [Glycine max]
 gb|KHN07692.1| Transcription factor bHLH123 [Glycine soja]
Length=495

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 141/197 (72%), Gaps = 15/197 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS-----RKSSNVEEARQSSSMAK  969
             FWN S  +L+D+R  TF  STQSQ+    F D+  KP+         N EE  +S+SMAK
Sbjct  302   FWNASAEALHDIRVGTF-ASTQSQYQRPTFDDE-EKPNFPITLLNRLNSEEILESASMAK  359

Query  968   KASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             K +  E A KRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI
Sbjct  360   K-NVCEPALKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  418

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATET  621
             KFLHDQVNVLS  Y+KNG    Q       +D EG + +L+S+GLCLVPISSTFPVAT  
Sbjct  419   KFLHDQVNVLSTSYMKNGAPTQQQQGCDDLKDSEGPQQDLKSKGLCLVPISSTFPVATGA  478

Query  620   TS--DFWTPTF-GASFR  579
             TS    WTPTF GA  R
Sbjct  479   TSADQLWTPTFRGALLR  495



>ref|XP_009355551.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Pyrus 
x bretschneideri]
Length=455

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 144/206 (70%), Gaps = 18/206 (9%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR + F PS Q QF  + F +K         N+ 
Sbjct  261   PPQSHLQFSNDAP-FWNAPHEAAMKDVRPS-FFPSLQPQFPTARFDEK-------PKNIS  311

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E ++S ++ KK S  EAA KRPR ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  312   EVQESGAVGKK-SGSEAASKRPRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  370

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVNVLS PY+K+G  V QH QQ      D +G K +LRS+GLCLV
Sbjct  371   SVLSEAIEYIKFLHEQVNVLSTPYMKSGA-VIQHQQQNSDKVKDPDGPKQDLRSRGLCLV  429

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG +FR
Sbjct  430   PVSSTFPVTHETTVDFWTPTFGGTFR  455


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 44/194 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T G     +WW+ + R+ F  GASP S++++N +G+F W           +V++
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASP-SSSSLNTLGSFGW--------QPDIVDI  46

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQ  1482
             K RSS +S GS S  SS+V  +  K    T +    S  +LHM+G+GL   S+  TDWNQ
Sbjct  47    KARSSMDS-GSVSGTSSMVFHDTHKLQEGTDSAGGGSDPNLHMMGLGL---SSQATDWNQ  102

Query  1481  ALV----QTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS---FKPVAKDF  1359
             AL     +T+ R++LQE+ NS   N+ QE   +           C DSS   FK + + F
Sbjct  103   ALFRGEKETSFRSILQENMNSNTANFQQESDQQLQWRDKLFAGGCGDSSNNEFKQMTRGF  162

Query  1358  STSTPSATNFAPSY  1317
             S      T F+P Y
Sbjct  163   SL---DQTQFSPRY  173



>ref|XP_009417259.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=437

 Score =   219 bits (559),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 186/465 (40%), Positives = 239/465 (51%), Gaps = 76/465 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNP-ARSMFGA--SPCSAATINDMGN-FAWAnnddhhhhHQLVN  1662
             MA+DF T G+C  G WWNP  R+ F A  S CS A     G  F+WA             
Sbjct  1     MAEDFHT-GICSEGCWWNPKGRASFDAQASTCSTAAAEIEGRAFSWA-------------  46

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQ--THNMSMDSTHLHMLGIGLSPSSTATTDW  1488
                 S  E+ GSA  GSS++ QE  +  H     ++ +DST         S S T +   
Sbjct  47    ----SCGEAAGSAG-GSSMISQETHEVQHSDVCPSLIIDSTTPSFSLSSSSMSWTKSL-L  100

Query  1487  NQALVQTNERAMLQEDRNSRLNYGQE---------IGVECSDSS-FKPV-----------  1371
             N    + +  AMLQED  SR    Q           G E S ++ F  +           
Sbjct  101   NSVRPEGSFHAMLQEDPGSRPCIRQHPPVDSNQVHTGAESSIANPFSDIDHTCFLDHHHH  160

Query  1370  --------AKDFSTSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPP  1215
                      K+FS    ++ +F  SY Y S  + +  +S            +  ++Y   
Sbjct  161   HHHHHFSSGKEFSDVGVASYHFPASYGYSS--VMSQDESGIHDSGVMNRYQSPLVAYQGS  218

Query  1214  PPANFRPNLNDFSPPLLKPT------FPNAAASFWNQSPA-SLNDVRAATFLPSTQSQFL  1056
                  +P+   FS  L  P       F N    FWN S A S+ DV++    P T SQF+
Sbjct  219   SNEQRQPSWAKFSQLLKSPLSKQQSQFTNNTL-FWNASAAASVGDVKSILCSP-TPSQFV  276

Query  1055  --PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEK  882
               P      L+        V+++  SS+   K +  E+A K+PRIETPSPLPTFKVRKEK
Sbjct  277   MQPQTTCGNLAACRISPGGVQDSCSSST---KKTGSESAVKKPRIETPSPLPTFKVRKEK  333

Query  881   LGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHH----  714
             LGDR+TALQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS+PYLK+G  + QH     
Sbjct  334   LGDRITALQQLVSPFGKTDTASVLQEAIEYIKFLHDQVGVLSSPYLKDGHPM-QHQISSK  392

Query  713   QQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              +D +  K +LRS+GLCLVPI+ST+ VA+ETT+DFW PTFG SFR
Sbjct  393   SKDCDETKQDLRSRGLCLVPITSTYLVASETTADFWHPTFGGSFR  437



>ref|XP_003532569.1| PREDICTED: transcription factor bHLH123-like [Glycine max]
Length=501

 Score =   221 bits (563),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 144/196 (73%), Gaps = 13/196 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQF-LPSVFSDKLSKPSR--KSSNVEEARQSSSMAKKA  963
             FWN S  +L+D+R  TF  S+QSQ+  P+   +K + PS      N E+  +S+SM  K 
Sbjct  308   FWNASAEALHDIRVGTF-ASSQSQYHRPTFDGEKPNCPSTLLNKFNSEKTLESASMMTKK  366

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             +  E A KRPRIET SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF
Sbjct  367   NVCEPALKRPRIETSSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  426

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETT  618
             LHDQVNVLS  Y+KNG  + QH Q     +D EG + +L+S+GLCLVPISSTFPVATE T
Sbjct  427   LHDQVNVLSTSYMKNGAPI-QHQQGCDDLKDSEGPQQDLKSKGLCLVPISSTFPVATEAT  485

Query  617   S-DFWTPTF--GASFR  579
             S + WTPTF  GA  R
Sbjct  486   SAELWTPTFRSGALLR  501



>ref|XP_002534446.1| transcription factor, putative [Ricinus communis]
 gb|EEF27938.1| transcription factor, putative [Ricinus communis]
Length=305

 Score =   215 bits (548),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 137/195 (70%), Gaps = 18/195 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAK-KA  963
             A FWN S +S+NDV   +F P  Q QF  S + +K         N+ E R+SSS    K 
Sbjct  121   APFWNASASSMNDV-CPSFFPPLQQQFPTSSYEEK-------PKNISEVRESSSTTTVKK  172

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S  E A KRPR ET S +P FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  173   SGSETATKRPRNETASTVPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  232

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRK-AELRSQGLCLVPISSTFPVATE  624
             LH+QV VLS PY+K+G  +  HHQQ      D EG+K A+LRS+GLCLVP+S TFPV  E
Sbjct  233   LHEQVTVLSTPYMKSGAPI--HHQQSSDKSKDPEGQKQADLRSRGLCLVPVSITFPVTHE  290

Query  623   TTSDFWTPTFGASFR  579
             TT D+WTPTFG +FR
Sbjct  291   TTVDYWTPTFGGTFR  305



>ref|XP_008383961.1| PREDICTED: transcription factor bHLH112 isoform X4 [Malus domestica]
Length=440

 Score =   219 bits (559),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 149/210 (71%), Gaps = 22/210 (10%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLN---DVRAAT-FLPSTQSQFL---PSVFSDKLSKP-------SRK  1014
             N    FWN  +PA+LN    VR++     S+Q+Q+    PS F +K  KP       +  
Sbjct  233   NINTPFWNAPAPAALNPDNTVRSSNDLFSSSQAQYTTPSPSPFHEK--KPNSNNFTKANT  290

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             + +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG
Sbjct  291   NEDVQDSSSSVVKKSSSSAGEPVFKRARIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  350

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQG  669
             KTDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q H  D+     EG K +L+S+G
Sbjct  351   KTDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQHGIDKMREASEGAKQDLQSRG  410

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTFPVA ETT+DFWTPTFGA+FR
Sbjct  411   LCLVPISSTFPVANETTADFWTPTFGATFR  440


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 75/173 (43%), Gaps = 60/173 (35%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CGG SWWN +R +  ASPCS    + MG F +         + +V++K  
Sbjct  1     MAEEFQ-AGICGGNSWWNSSRHVLVASPCSMGFNDHMGGFGYP--------NDMVDIKAT  51

Query  1649  SSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALVQ  1470
              S  SCG            LP S   TH                       +D+NQAL+ 
Sbjct  52    RS--SCGFG----------LPSSLSSTH-----------------------SDFNQALLV  76

Query  1469  TN----------ERAMLQEDR--NSRLNYGQEIGVECSDS---SFKPVAKDFS  1356
             +              MLQED   N++LN    +G E S S    FKP+ +DFS
Sbjct  77    SRSSSGRGESNFHNPMLQEDMGLNAKLNTA-ALGDEESXSIINGFKPMNQDFS  128



>ref|XP_010928675.1| PREDICTED: transcription factor bHLH123-like [Elaeis guineensis]
Length=464

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 9/192 (5%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQ--SSSMAKKAS  960
             FWN S AS+++VR   F     SQ++   F  K +  +  + ++ E  +  SSS +KK+ 
Sbjct  275   FWNASAASMSEVRTG-FCHPMPSQYVSQAFEQKPTCSNLATKSISEGVRDSSSSASKKSG  333

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E++FK+P+IETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFL
Sbjct  334   SNESSFKKPKIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFL  393

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             HDQV VLS+PYLKNG  + QH Q     QD EG K +LRS+GLCLVPISST+PVA+ET +
Sbjct  394   HDQVGVLSSPYLKNGNPM-QHQQGSDKSQDGEGPKQDLRSRGLCLVPISSTYPVASETPA  452

Query  614   DFWTPTFGASFR  579
             DFW P+FG +FR
Sbjct  453   DFWHPSFGGTFR  464


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 77/156 (49%), Gaps = 24/156 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP----CSAATINDM--GNFAWAnnddhhhhHQL  1668
             MADD   +G+C GGSWWN ARS     P    CS A I DM  G F+WA         +L
Sbjct  1     MADDQFQSGICSGGSWWNLARSAGLDGPASVSCSTA-ITDMGGGGFSWA-------TAEL  52

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
                K RS +ES   +  GSSV  Q+ P         S+  + L M    L   ST   DW
Sbjct  53    AEPKARSGEES-AGSVSGSSVSFQDTPNLPPSDVGPSVIDSTLQMPSFSL---STPPIDW  108

Query  1487  NQALVQTNER------AMLQEDRNSRLNYGQEIGVE  1398
              QAL++++ R      AMLQED +SR  + Q+  +E
Sbjct  109   TQALLRSSGRAETSFHAMLQEDLSSRSYFRQDPSIE  144



>ref|XP_010931879.1| PREDICTED: transcription factor bHLH112-like [Elaeis guineensis]
Length=442

 Score =   219 bits (558),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 134/190 (71%), Gaps = 6/190 (3%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS-RKSSNVEEARQSSSMAKKASN  957
             FWN S  +  +     +  ST +   P  F  K S  +    SN E A +S S A K S+
Sbjct  254   FWNPSAIATTETSLGLY-SSTTTDLAPHAFEGKTSCSNVLVQSNSEGAGESRSNATKKSS  312

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E AFK+PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK+LH
Sbjct  313   NEPAFKKPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKYLH  372

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDE----EGRKAELRSQGLCLVPISSTFPVATETTSDF  609
             +QV VLSAPYLKNG  V      DE    EG + +LRS+GLCLVPISSTF V +ET  DF
Sbjct  373   EQVGVLSAPYLKNGHQVQHLQNSDEINGGEGPQLDLRSRGLCLVPISSTFAVVSETPVDF  432

Query  608   WTPTFGASFR  579
             WTPTFG ++R
Sbjct  433   WTPTFGGTYR  442


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 68/142 (48%), Gaps = 21/142 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F T G+   G WW+  R+     P  + +++    F WA          +V  K R
Sbjct  1     MAEEFQT-GIYNSGRWWSTTRTGVFDGPVMSTSVSCSTEFNWA------TAADVVEAKSR  53

Query  1649  SSDESCGSASDGSSVVLQEL---PKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             SSDES GS S+ SS+  Q+    P S     +  +DST L +   GL   S+ + +WNQ 
Sbjct  54    SSDESLGSVSN-SSITFQDTHRPPASDQFAADPIVDST-LQVSDFGL---SSPSVNWNQP  108

Query  1478  LVQTNER------AMLQEDRNS  1431
              + T  R      A LQED +S
Sbjct  109   FLTTGGRAENNLPAFLQEDMSS  130



>ref|XP_008383959.1| PREDICTED: transcription factor bHLH112 isoform X2 [Malus domestica]
Length=480

 Score =   220 bits (560),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 149/210 (71%), Gaps = 22/210 (10%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLN---DVRAAT-FLPSTQSQFL---PSVFSDKLSKP-------SRK  1014
             N    FWN  +PA+LN    VR++     S+Q+Q+    PS F +K  KP       +  
Sbjct  273   NINTPFWNAPAPAALNPDNTVRSSNDLFSSSQAQYTTPSPSPFHEK--KPNSNNFTKANT  330

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             + +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG
Sbjct  331   NEDVQDSSSSVVKKSSSSAGEPVFKRARIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  390

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQG  669
             KTDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q H  D+     EG K +L+S+G
Sbjct  391   KTDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQHGIDKMREASEGAKQDLQSRG  450

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTFPVA ETT+DFWTPTFGA+FR
Sbjct  451   LCLVPISSTFPVANETTADFWTPTFGATFR  480


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 93/189 (49%), Gaps = 52/189 (28%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CGG SWWN +R +  ASPCS    + MG F +         + +V++K  
Sbjct  1     MAEEFQ-AGICGGNSWWNSSRHVLVASPCSMGFNDHMGGFGYP--------NDMVDIKAT  51

Query  1649  SSDESCGSASDGSSVV---------------LQELPKSHHQTHNMSMDSTHLHMLGIGLS  1515
              S  SCG  ++  S                  Q++ K  H       D T L MLG GL 
Sbjct  52    RS--SCGEINNSVSDDHDDGDHSKSIANFDQYQDVQKPDH-------DPT-LQMLGFGL-  100

Query  1514  PSSTATT--DWNQALV--------QTN-ERAMLQEDR--NSRLNYGQEIGVECSDS---S  1383
             PSS ++T  D+NQAL+        ++N    MLQED   N++LN    +G E S S    
Sbjct  101   PSSLSSTHSDFNQALLVRSSSGRGESNFHNPMLQEDMGLNAKLNTA-ALGDEESXSIING  159

Query  1382  FKPVAKDFS  1356
             FKP+ +DFS
Sbjct  160   FKPMNQDFS  168



>ref|XP_008383958.1| PREDICTED: transcription factor bHLH112 isoform X1 [Malus domestica]
Length=481

 Score =   219 bits (559),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 149/210 (71%), Gaps = 22/210 (10%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLN---DVRAAT-FLPSTQSQFL---PSVFSDKLSKP-------SRK  1014
             N    FWN  +PA+LN    VR++     S+Q+Q+    PS F +K  KP       +  
Sbjct  274   NINTPFWNAPAPAALNPDNTVRSSNDLFSSSQAQYTTPSPSPFHEK--KPNSNNFTKANT  331

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             + +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG
Sbjct  332   NEDVQDSSSSVVKKSSSSAGEPVFKRARIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  391

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQG  669
             KTDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q H  D+     EG K +L+S+G
Sbjct  392   KTDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQHGIDKMREASEGAKQDLQSRG  451

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTFPVA ETT+DFWTPTFGA+FR
Sbjct  452   LCLVPISSTFPVANETTADFWTPTFGATFR  481


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 91/190 (48%), Gaps = 53/190 (28%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CGG SWWN +R +  ASPCS    + MG F +         + +V++K  
Sbjct  1     MAEEFQ-AGICGGNSWWNSSRHVLVASPCSMGFNDHMGGFGYP--------NDMVDIKAT  51

Query  1649  SSDESCGSASDGSSVV---------------LQELPKSHHQTHNMSMDSTHLHMLGIGLS  1515
              S  SCG  ++  S                  Q++ K  H       D T L MLG GL 
Sbjct  52    RS--SCGEINNSVSDDHDDGDHSKSIANFDQYQDVQKPDH-------DPT-LQMLGFGL-  100

Query  1514  PSSTATT--DWNQALVQTN----------ERAMLQEDR--NSRLNYGQEIGVECSDS---  1386
             PSS ++T  D+NQAL+ +              MLQED   N++LN    +G E S S   
Sbjct  101   PSSLSSTHSDFNQALLVSRSSSGRGESNFHNPMLQEDMGLNAKLNTA-ALGDEESXSIIN  159

Query  1385  SFKPVAKDFS  1356
              FKP+ +DFS
Sbjct  160   GFKPMNQDFS  169



>ref|XP_008386041.1| PREDICTED: transcription factor bHLH123-like [Malus domestica]
Length=455

 Score =   218 bits (556),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 143/206 (69%), Gaps = 18/206 (9%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR  +F PS Q QF  + F +K         N+ 
Sbjct  261   PPQSHLQFSNDAP-FWNAPHEAAMKDVRP-SFFPSLQPQFPTARFDEK-------PKNIS  311

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E ++S ++ KK S  EAA KRPR E  SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  312   EVQESGAVGKK-SGSEAASKRPRNEASSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  370

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVNVLS PY+K+G  V QH QQ      D +G K +LRS+GLCLV
Sbjct  371   SVLSEAIEYIKFLHEQVNVLSTPYMKSGA-VIQHQQQNSDKVKDPDGPKQDLRSRGLCLV  429

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG +FR
Sbjct  430   PVSSTFPVTHETTVDFWTPTFGGTFR  455


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 44/194 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T G     +WW+ + R+ F  GASP S++++N +G+F W           +V++
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASP-SSSSLNTLGSFGW--------QSDIVDI  46

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQ  1482
             K RSS +S GS S  SS+V  +  K    T +    S  +LHM+G+GL   S+  TDWNQ
Sbjct  47    KARSSMDS-GSVSGTSSMVFHDTHKLQEGTDSAGGGSDPNLHMMGLGL---SSQATDWNQ  102

Query  1481  ALV----QTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS---FKPVAKDF  1359
             AL     +T+ R++LQE+ NS   N+ QE   +           C DSS   FK + + F
Sbjct  103   ALFRGEKETSFRSILQENMNSNTANFQQESDQQLQWRDKLFAGGCGDSSNNEFKQMTRGF  162

Query  1358  STSTPSATNFAPSY  1317
             S      T F+P Y
Sbjct  163   SL---DQTQFSPRY  173



>gb|KHN45735.1| Transcription factor bHLH123 [Glycine soja]
Length=500

 Score =   219 bits (558),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 143/196 (73%), Gaps = 13/196 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQF-LPSVFSDKLSKPSR--KSSNVEEARQSSSMAKKA  963
             FWN S  +L+D+R  TF  S+QSQ+  P+   +K + PS      N E+   S+SM  K 
Sbjct  307   FWNASAEALHDIRVGTF-ASSQSQYHRPTFDGEKPNCPSTLLNKFNSEKTLVSASMMTKK  365

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             +  E A KRPRIET SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF
Sbjct  366   NVCEPALKRPRIETSSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  425

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETT  618
             LHDQVNVLS  Y+KNG  + QH Q     +D EG + +L+S+GLCLVPISSTFPVATE T
Sbjct  426   LHDQVNVLSTSYMKNGAPI-QHQQGCDDLKDSEGPQQDLKSKGLCLVPISSTFPVATEAT  484

Query  617   S-DFWTPTF--GASFR  579
             S + WTPTF  GA  R
Sbjct  485   SAELWTPTFRSGALLR  500



>ref|XP_008810246.1| PREDICTED: transcription factor bHLH112-like [Phoenix dactylifera]
Length=448

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 131/173 (76%), Gaps = 9/173 (5%)
 Frame = -3

Query  1076  STQSQFLPSVFSDK--LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPT  903
             ST +Q  P  F  K   SK   KS N E    SSS A K S  E AFK+PRIETPSPLPT
Sbjct  278   STPTQIAPHAFKGKTNCSKLLVKS-NSEGVGDSSSNAMKKSGNEPAFKKPRIETPSPLPT  336

Query  902   FKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVS  723
             FKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI+YIKFLH+QV VLSAPYLKNG  + 
Sbjct  337   FKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIDYIKFLHEQVGVLSAPYLKNGHQI-  395

Query  722   QHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             QH Q     +D EG K +L+S+GLCLVP+SSTF VA+ET  DFWTPTFG ++R
Sbjct  396   QHSQNLDKTRDGEGSKLDLKSRGLCLVPLSSTFAVASETPVDFWTPTFGGTYR  448


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 78/160 (49%), Gaps = 28/160 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS------MFGAS-PCSAATINDMGNFAWAnnddhhhhHQ  1671
             MA++F   G+C   SWW+ AR+      M   S  CS       G+  WA          
Sbjct  1     MAEEFQ-RGICSSSSWWSTARTSSFDGPMLSTSVSCSTELTGIGGSVNWAVPA------D  53

Query  1670  LVNMKGRSSDESCGSASDGSSVVLQELPK---SHHQTHNMSMDSTHLHMLGIGLSPSSTA  1500
             +V +K RSSDES GS S+ SS+  Q+  K   S     +  MDST L + G GLS   + 
Sbjct  54    MVEVKSRSSDESPGSVSN-SSITFQDTHKPQASDQLVADPIMDST-LQIPGFGLS---SP  108

Query  1499  TTDWNQALV------QTNERAMLQEDRNSRLNYGQEIGVE  1398
             + +W+Q L       +TN  A+LQE  NSR N  QE  +E
Sbjct  109   SINWHQPLFTTSGRSETNLHALLQEGMNSRPNLQQEPAIE  148



>emb|CBI20463.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 155/376 (41%), Positives = 197/376 (52%), Gaps = 66/376 (18%)
 Frame = -3

Query  1544  HLHMLGIGLSPSSTATTDWNQALVQTNER-----AMLQED---RNSRLNYGQE------I  1407
             +L M+G+GLS   +   DWNQAL+++ +      +MLQ+     NS  N  Q        
Sbjct  21    NLQMMGLGLS---SQAMDWNQALLRSGKAESSFGSMLQDQDMSSNSNFNADQAQWRQKLF  77

Query  1406  GVECSDSS---FKPVAKDFS-------------TSTPSATNFAPSYNYPSNllqtlldsd  1275
                C DSS   +K V + FS              ST +      S+   S++  +     
Sbjct  78    SGSCEDSSGTEYKQVNRGFSLDQPQFSSHSSPGESTVTCQGLPTSFQVDSSVYGSPSTIL  137

Query  1274  pqpqpqqplisnqqISYAP---PPPANFRPNLNDFSPPLLK-PTFPNAA-----------  1140
                       +       P   P    +  N N+F P   K P F   +           
Sbjct  138   QGLLGSDHQQNQSSFENRPMNYPYLGTYGVNSNEFLPSWSKVPQFLRTSPPKQPSHTQLH  197

Query  1139  ----ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMA  972
                 A FWN S A++      +F P+ Q QF    F++K         N  E R  SS+A
Sbjct  198   FSNNAPFWNASAAAMAADSRPSFSPTLQPQFSTPTFNEK-------PKNSSEIRDISSVA  250

Query  971   KKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  792
             KK+S  E   KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEY
Sbjct  251   KKSSG-ETGTKRPRSETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEY  309

Query  791   IKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGLCLVPISSTFPVAT  627
             IKFLH+QV+ LS PY+K+G S+ QH Q  E     EG + +LRS+GLCLVP+SSTFPV  
Sbjct  310   IKFLHEQVSALSTPYMKSGASI-QHQQNSEKSKEPEGPRQDLRSRGLCLVPVSSTFPVTH  368

Query  626   ETTSDFWTPTFGASFR  579
             ET+ DFWTPTFG +FR
Sbjct  369   ETSVDFWTPTFGGTFR  384



>gb|KGN49165.1| hypothetical protein Csa_6G516730 [Cucumis sativus]
Length=404

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 169/451 (37%), Positives = 217/451 (48%), Gaps = 87/451 (19%)
 Frame = -3

Query  1820  DFMTAGVCGGGSWWNPARSMF----GASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG  1653
             DF  A VCG  +WWN +RSM     G SPCS      + + +W                 
Sbjct  4     DFQ-APVCGD-NWWNSSRSMLVAVGGLSPCSVG----IADLSWPP---------------  42

Query  1652  RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA--  1479
             +    +  S ++ SS++ Q              D +   M+G  LS SST +  WNQ+  
Sbjct  43    QPPSAATDSVNNNSSMLFQ--------------DYSTFQMMGFALS-SSTTSEHWNQSQD  87

Query  1478  LVQTN--------ERAMLQ-EDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTPSATNFA  1326
             L+ +N        E  + Q  D +  LN        C    F   +  +  S+PS     
Sbjct  88    LLNSNGIPTNFSSENGLKQGNDGDDYLNCSSTNTTNCQGGLFPVESSLYGYSSPSTKLLQ  147

Query  1325  PSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPPLLKPTFPN  1146
                N   +                   +    +  PP   +     N  S  L+KP+ PN
Sbjct  148   --TNLYEDDNSDPHSLFNSTPSITTNSTTFPTNINPPNHLSLSSTPNFSSNYLVKPSLPN  205

Query  1145  AA--------ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR------KSS  1008
                         FWN S        ++  +P    Q + S+  DK +  S+      KS 
Sbjct  206   PQPHLQFTNNTPFWNAS--------SSNSIP----QGIASLLEDKNNPKSQNNTLAFKSV  253

Query  1007  NVEEARQSSSMAKKA--SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             N +   Q     K +  + +   FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG
Sbjct  254   NEDGQDQVKKGDKNSAITTEPTVFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  313

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLK--NGCSVSQHHQQDEEGR----KAELRSQ  672
             KTDTASVLHEAIEYIKFLHDQV+VLS PY+K  NG +  QH Q  E+      K +L+S+
Sbjct  314   KTDTASVLHEAIEYIKFLHDQVSVLSTPYMKSNNGITPVQHQQVSEKANHDSPKQDLKSR  373

Query  671   GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             GLCLVPISSTFPV   TT+DFWTPTFG +FR
Sbjct  374   GLCLVPISSTFPVTNATTTDFWTPTFGGTFR  404



>ref|XP_010112076.1| hypothetical protein L484_002935 [Morus notabilis]
 gb|EXC32536.1| hypothetical protein L484_002935 [Morus notabilis]
Length=476

 Score =   218 bits (554),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 138/194 (71%), Gaps = 16/194 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN   +++ DVRA TF P+ Q QF  + F +K         N+ E R S ++  K S
Sbjct  292   APFWNAPESAMKDVRA-TFFPTLQPQFQTATFDEK-------PKNISEVRDSVAVVGKKS  343

Query  959   NQEAAF-KRPR-IETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
               EAA  KRPR  +TPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIK
Sbjct  344   GGEAASNKRPRNDQTPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIK  403

Query  785   FLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR-----KAELRSQGLCLVPISSTFPVATET  621
             FLH+QV VLS PY+K+G  + QH Q  E+ +     K +LRS+GLCLVP+SSTFPV  ET
Sbjct  404   FLHEQVTVLSTPYMKSGAPI-QHQQNSEKSKDPEDPKQDLRSRGLCLVPVSSTFPVTHET  462

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  463   TVDFWTPTFGGTFR  476


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 95/192 (49%), Gaps = 39/192 (20%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS---MFGASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T+G     +WW+ +RS     G SP S+A +N +G+F W++ +       +V+M
Sbjct  1     MADEFRTSG-----NWWDSSRSNRFEAGTSPSSSA-LNSLGSFGWSSTE------NMVDM  48

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             K RSS +S  S S  S +V  +  K        +    +LHM+G+GLS S     DWNQA
Sbjct  49    KSRSSMDSV-SVSGSSPMVFHDGQKLQGSDSAPTAADPNLHMMGLGLSNSQA--IDWNQA  105

Query  1478  LVQTNE-------RAMLQEDRNSRLNYGQEIGV-----------ECSDSSFKPVAKDFST  1353
             L +  +       R++LQE+ +S  ++ QE G              S S FK + + FS 
Sbjct  106   LFRGEKAAQEGSFRSILQENMSSNASFQQEAGQIQWREKLFSGDHSSSSEFKQMNRGFSL  165

Query  1352  STPSATNFAPSY  1317
                  + F+P Y
Sbjct  166   ---DQSQFSPPY  174



>gb|KEH19696.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=444

 Score =   216 bits (550),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 165/413 (40%), Positives = 212/413 (51%), Gaps = 80/413 (19%)
 Frame = -3

Query  1628  SASDGSSVVLQELP-KSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALVQTNE---  1461
             SAS  SSVV  +   K      + S + ++LHM+G+GLS   +   DWNQA +  NE   
Sbjct  49    SASGSSSVVFHDTTQKLQPSDSSTSNNDSNLHMMGLGLS---SQNIDWNQASILRNEKAS  105

Query  1460  ----RAMLQEDRNSR-LNYGQE-----IGVECS----------------DSSFKPVAKDF  1359
                 R+MLQE+ NS   N+ QE     IGVE S                 + FK V + F
Sbjct  106   EGSFRSMLQENLNSTGTNFEQETSGIGIGVELSHQVNWRQEKLFSNESSSNEFKQVNRGF  165

Query  1358  STSTP--------------SATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYA  1221
             S   P              S  + +  Y  PS L   L     Q QPQ       +    
Sbjct  166   SLDQPQFSPQYSSGDSNMISQMDSSALYGNPSMLQGLLGTETNQIQPQHGNSFENRSMNF  225

Query  1220  PPPPANFRPNLNDFSPPLLKPTFPNAA--------------ASFWNQSPASLNDVRAATF  1083
             P    ++  + N+  P   K +  N                A FWN S  ++ D  ++  
Sbjct  226   PYSSTSYGLSTNELIPSWSKVSHQNQKQHQQPNNQLHFTNNAPFWNASETTIKDASSSFL  285

Query  1082  LPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPT  903
              P T   F              ++ N+ E R SS+M KK S  E A KR + ETPSPLP 
Sbjct  286   PPFTTPNF------------GAQTKNISEGRDSSAMVKK-SGSEPAPKRSKNETPSPLPA  332

Query  902   FKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVS  723
             FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV VLS PY+K+G  + 
Sbjct  333   FKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-  391

Query  722   QHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             QH Q     ++ +G K +LRS+GLCLVP+SSTFP+  E T ++WTPTFG +FR
Sbjct  392   QHQQSSGKSKEADGPKQDLRSRGLCLVPVSSTFPMTHEPTVEYWTPTFGGTFR  444



>ref|XP_004244171.1| PREDICTED: transcription factor bHLH123 [Solanum lycopersicum]
Length=479

 Score =   216 bits (551),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 142/209 (68%), Gaps = 22/209 (11%)
 Frame = -3

Query  1178  SPPLLKPTFPN--AAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSN  1005
             SPPL      +     SFWN + A+  DVR+  FLP   +   P+V          K  +
Sbjct  284   SPPLSHSQLSHFSGGTSFWNATSAAAEDVRSG-FLPQLPTN--PTV--------DEKPKH  332

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
               E R +S++ KK S+ E + KRPR E PSPLP FKVRKEK+GDR+TALQQLVSPFGKTD
Sbjct  333   TGEVRNTSTVTKKNSS-ETSNKRPRNEAPSPLPAFKVRKEKMGDRITALQQLVSPFGKTD  391

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELRSQGL  666
             TASVL EAIEYIKFLHDQVNVLS PY+K+G S+ QH Q        + EG K +LRS+GL
Sbjct  392   TASVLSEAIEYIKFLHDQVNVLSTPYMKSGASI-QHQQNTGDKSNVNPEGGKQDLRSRGL  450

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVP+SSTFPV  ETT DFWTPTFG +FR
Sbjct  451   CLVPVSSTFPVTHETTVDFWTPTFGGTFR  479



>ref|XP_003596544.1| Transcription factor bHLH123 [Medicago truncatula]
 gb|AES66795.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=437

 Score =   214 bits (544),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 182/457 (40%), Positives = 244/457 (53%), Gaps = 84/457 (18%)
 Frame = -3

Query  1790  GSWWNPA-RSM------FGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGRSSDESC  1632
             G+WW+ A R+M        +   S+   N++ +FAW N+        +V +K RSS E+ 
Sbjct  12    GNWWDTASRNMRFNQSGGTSQSSSSTITNNIVDFAWQNS-------DMVEIKPRSSMEN-  63

Query  1631  GSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ-ALVQTNE--  1461
                   SSVV  +  K      + +    +LHM+G+GL   S+ T DWNQ +L++  +  
Sbjct  64    ------SSVVFHDNQKLQQPQDSSTSSDPNLHMMGLGL---SSHTLDWNQPSLIRGEKGT  114

Query  1460  ----RAMLQEDRNS-RLNYGQE--IGV--ECSDSSFKPVAKDFSTSTPSA-TNFAPSYNY  1311
                 R++L+E+ +S R N+ QE  +G+  + + ++F      FS    S  +N   S   
Sbjct  115   ENSFRSILEENLSSTRNNFEQENVMGMCQQVNRNNFSLDQNQFSPQYSSGDSNVITSQCL  174

Query  1310  PSNllqtlldsdpqpqpqqplisnqqISYAPPPPA-----------NFRPNLNDFS----  1176
             P+N           P   Q    N+ +S   P P            N  P  N++S    
Sbjct  175   PTNFQMDSSTLYGTPSILQGSFENRSMSSTFPYPTNNYGLNSNNELNIMPASNNWSNNKV  234

Query  1175  -------PPLLKPT-----FPNAAASFWN--QSPASLNDVRAATFLPSTQSQFLPSVFSD  1038
                     P  +PT     F N    FWN  ++P S+ DVR +TF PS Q QF PS F  
Sbjct  235   PQFFMRTSPPKQPTNNQLHFTNNTP-FWNASEAPNSVKDVR-STFFPSLQPQFSPSNFDS  292

Query  1037  KLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTAL  858
                     S N+ E     S+ KK S  E A KR R ETPS LP FKVRKEK+GDR+TAL
Sbjct  293   -------HSKNISEV----SVVKK-SGSEPAPKRTRNETPSTLPAFKVRKEKMGDRITAL  340

Query  857   QQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGC--SVSQHHQQDE--EGRK  690
             QQLVSPFGKTDTASVL EAIEYIKFLH+QV VLS PY+K+G    + Q+  + +  EG K
Sbjct  341   QQLVSPFGKTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPSEIQQNSGKLKKCEGTK  400

Query  689   AELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              +L+S+GLCLVP+SSTFPV  ETT DFWTPTFG + R
Sbjct  401   QDLKSRGLCLVPVSSTFPVTHETTVDFWTPTFGGTSR  437



>ref|XP_003636605.1| Transcription factor bHLH123 [Medicago truncatula]
Length=436

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 164/409 (40%), Positives = 211/409 (52%), Gaps = 80/409 (20%)
 Frame = -3

Query  1628  SASDGSSVVLQELP-KSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALVQTNERAM  1452
             SAS  SSVV  +   K      + S + ++LHM+G+GLS   +   DWNQA  + + R+M
Sbjct  49    SASGSSSVVFHDTTQKLQPSDSSTSNNDSNLHMMGLGLS---SQNIDWNQA-SEGSFRSM  104

Query  1451  LQEDRNSR-LNYGQE-----IGVECS----------------DSSFKPVAKDFSTSTPSA  1338
             LQE+ NS   N+ QE     IGVE S                 + FK V + FS   P  
Sbjct  105   LQENLNSTGTNFEQETSGIGIGVELSHQVNWRQEKLFSNESSSNEFKQVNRGFSLDQP--  162

Query  1337  TNFAPS-----------------YNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPP  1209
               F+P                  Y  PS L   L     Q QPQ       +    P   
Sbjct  163   -QFSPQYSSGDSNMISQMDSSALYGNPSMLQGLLGTETNQIQPQHGNSFENRSMNFPYSS  221

Query  1208  ANFRPNLNDFSPPLLKPTFPNAA--------------ASFWNQSPASLNDVRAATFLPST  1071
              ++  + N+  P   K +  N                A FWN S  ++ D  ++   P T
Sbjct  222   TSYGLSTNELIPSWSKVSHQNQKQHQQPNNQLHFTNNAPFWNASETTIKDASSSFLPPFT  281

Query  1070  QSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVR  891
                F              ++ N+ E R SS+M KK S  E A KR + ETPSPLP FKVR
Sbjct  282   TPNF------------GAQTKNISEGRDSSAMVKK-SGSEPAPKRSKNETPSPLPAFKVR  328

Query  890   KEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ  711
             KEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV VLS PY+K+G  + QH Q
Sbjct  329   KEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-QHQQ  387

Query  710   -----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                  ++ +G K +LRS+GLCLVP+SSTFP+  E T ++WTPTFG +FR
Sbjct  388   SSGKSKEADGPKQDLRSRGLCLVPVSSTFPMTHEPTVEYWTPTFGGTFR  436



>gb|KEH38833.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=436

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 182/456 (40%), Positives = 244/456 (54%), Gaps = 83/456 (18%)
 Frame = -3

Query  1790  GSWWNPA-RSM------FGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGRSSDESC  1632
             G+WW+ A R+M        +   S+   N++ +FAW N+        +V +K RSS E+ 
Sbjct  12    GNWWDTASRNMRFNQSGGTSQSSSSTITNNIVDFAWQNS-------DMVEIKPRSSMEN-  63

Query  1631  GSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ-ALV-----Q  1470
                   SSVV  +  K      + +    +LHM+G+GL   S+ T DWNQ +L+     +
Sbjct  64    ------SSVVFHDNQKLQQPQDSSTSSDPNLHMMGLGL---SSHTLDWNQPSLIGEKGTE  114

Query  1469  TNERAMLQEDRNS-RLNYGQE--IGV--ECSDSSFKPVAKDFSTSTPSA-TNFAPSYNYP  1308
              + R++L+E+ +S R N+ QE  +G+  + + ++F      FS    S  +N   S   P
Sbjct  115   NSFRSILEENLSSTRNNFEQENVMGMCQQVNRNNFSLDQNQFSPQYSSGDSNVITSQCLP  174

Query  1307  SNllqtlldsdpqpqpqqplisnqqISYAPPPPA-----------NFRPNLNDFS-----  1176
             +N           P   Q    N+ +S   P P            N  P  N++S     
Sbjct  175   TNFQMDSSTLYGTPSILQGSFENRSMSSTFPYPTNNYGLNSNNELNIMPASNNWSNNKVP  234

Query  1175  ------PPLLKPT-----FPNAAASFWN--QSPASLNDVRAATFLPSTQSQFLPSVFSDK  1035
                    P  +PT     F N    FWN  ++P S+ DVR +TF PS Q QF PS F   
Sbjct  235   QFFMRTSPPKQPTNNQLHFTNNTP-FWNASEAPNSVKDVR-STFFPSLQPQFSPSNFDS-  291

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
                    S N+ E     S+ KK S  E A KR R ETPS LP FKVRKEK+GDR+TALQ
Sbjct  292   ------HSKNISEV----SVVKK-SGSEPAPKRTRNETPSTLPAFKVRKEKMGDRITALQ  340

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGC--SVSQHHQQDE--EGRKA  687
             QLVSPFGKTDTASVL EAIEYIKFLH+QV VLS PY+K+G    + Q+  + +  EG K 
Sbjct  341   QLVSPFGKTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPSEIQQNSGKLKKCEGTKQ  400

Query  686   ELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             +L+S+GLCLVP+SSTFPV  ETT DFWTPTFG + R
Sbjct  401   DLKSRGLCLVPVSSTFPVTHETTVDFWTPTFGGTSR  436



>ref|XP_008355967.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Malus 
domestica]
Length=439

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 148/209 (71%), Gaps = 19/209 (9%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLND---VRAAT-FLPSTQSQFL-PSVF--------SDKLSKPSRKS  1011
             N +  FWN  +PA+LN    +R++     S+Q+Q+  PS+         S+  +  +  +
Sbjct  231   NISTPFWNAPTPAALNQDNTIRSSNDLFSSSQAQYTTPSLSPFHEKKPNSNNFTTKANTN  290

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
              +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  291   GDVQDSSSSVVKKSSSSACEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGK  350

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGL  666
             TDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q    D+     EG + +L+S+GL
Sbjct  351   TDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQQGTDKMEEASEGAQQDLQSRGL  410

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT+DFWTP+FGA+FR
Sbjct  411   CLVPISSTFPVANETTADFWTPSFGATFR  439



>ref|XP_008366231.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Malus 
domestica]
Length=454

 Score =   213 bits (543),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 142/206 (69%), Gaps = 18/206 (9%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR  +F PS Q QF  + F +K         N+ 
Sbjct  260   PPHSHLQFSNNAP-FWNAPHEAAMKDVRP-SFFPSLQPQFPTARFDEK-------PKNIS  310

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E ++S ++ KK S  E   KRPR ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  311   EVQESGAVGKK-SGSEVVSKRPRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  369

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVNVLS PY+K+G ++ QH QQ      D +G K +L S+GLCLV
Sbjct  370   SVLSEAIEYIKFLHEQVNVLSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLSSRGLCLV  428

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG ++R
Sbjct  429   PVSSTFPVTHETTVDFWTPTFGGTYR  454


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 97/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPBMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+ +GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMALGL---SSXATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWRDKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|XP_009355552.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Pyrus 
x bretschneideri]
Length=449

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 141/206 (68%), Gaps = 24/206 (12%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR  +F PS Q QF  + F +K            
Sbjct  261   PPQSHLQFSNDAP-FWNAPHEAAMKDVRP-SFFPSLQPQFPTARFDEK------------  306

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
               ++S ++ KK S  EAA KRPR ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  307   -PKESGAVGKK-SGSEAASKRPRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  364

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVNVLS PY+K+G  V QH QQ      D +G K +LRS+GLCLV
Sbjct  365   SVLSEAIEYIKFLHEQVNVLSTPYMKSGA-VIQHQQQNSDKVKDPDGPKQDLRSRGLCLV  423

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG +FR
Sbjct  424   PVSSTFPVTHETTVDFWTPTFGGTFR  449


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 44/194 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF--GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MAD+F T G     +WW+ + R+ F  GASP S++++N +G+F W           +V++
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASP-SSSSLNTLGSFGW--------QPDIVDI  46

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQ  1482
             K RSS +S GS S  SS+V  +  K    T +    S  +LHM+G+GL   S+  TDWNQ
Sbjct  47    KARSSMDS-GSVSGTSSMVFHDTHKLQEGTDSAGGGSDPNLHMMGLGL---SSQATDWNQ  102

Query  1481  ALV----QTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS---FKPVAKDF  1359
             AL     +T+ R++LQE+ NS   N+ QE   +           C DSS   FK + + F
Sbjct  103   ALFRGEKETSFRSILQENMNSNTANFQQESDQQLQWRDKLFAGGCGDSSNNEFKQMTRGF  162

Query  1358  STSTPSATNFAPSY  1317
             S      T F+P Y
Sbjct  163   SL---DQTQFSPRY  173



>ref|XP_006452112.1| hypothetical protein CICLE_v10008228mg [Citrus clementina]
 ref|XP_006475252.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Citrus 
sinensis]
 gb|ESR65352.1| hypothetical protein CICLE_v10008228mg [Citrus clementina]
Length=459

 Score =   213 bits (543),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 138/195 (71%), Gaps = 13/195 (7%)
 Frame = -3

Query  1139  ASFWNQS-PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMA-KK  966
             A FWN S P SLNDVR+  F PS Q+ +    F +K   P    S V +   SSS+A KK
Sbjct  270   APFWNASAPTSLNDVRSPNFFPSLQTPYATQTFDEK---PKHHVSEVRD--NSSSIAVKK  324

Query  965   ASNQEAAFKRPRIETP-SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             +S  E A KR + + P SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYI
Sbjct  325   SSGGEPASKRAKNDQPASPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYI  384

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHH-----QQDEEGRKAELRSQGLCLVPISSTFPVATE  624
             KFLHDQV VLS PY+K+G +   H       +D EG K +LRS+GLCLVP+SSTFPV  E
Sbjct  385   KFLHDQVAVLSTPYMKSGGAPIPHQPNSEKVKDSEGPKQDLRSRGLCLVPVSSTFPVTHE  444

Query  623   TTSDFWTPTFGASFR  579
             TT DFWTPTFG +FR
Sbjct  445   TTVDFWTPTFGGTFR  459



>ref|XP_009377291.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Pyrus 
x bretschneideri]
Length=454

 Score =   213 bits (542),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 142/206 (69%), Gaps = 18/206 (9%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR  +F PS Q QF  + F +K         N+ 
Sbjct  260   PPHSHLQFSNNAP-FWNAPHEAAMKDVRP-SFFPSLQPQFPAARFDEK-------PKNIS  310

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E ++S ++ KK S  E   KRPR ET S LP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  311   EVQESGAVGKK-SGSEVVSKRPRNETSSALPAFKVRKEKMGDRITALQQLVSPFGKTDTA  369

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVN+LS PY+K+G ++ QH QQ      D +G K +LRS+GLCLV
Sbjct  370   SVLSEAIEYIKFLHEQVNILSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLRSRGLCLV  428

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG ++R
Sbjct  429   PVSSTFPVTHETTVDFWTPTFGGTYR  454


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 98/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPDMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+G+GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMGLGL---SSQATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWREKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|XP_010924017.1| PREDICTED: transcription factor bHLH123-like [Elaeis guineensis]
Length=459

 Score =   213 bits (542),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 141/194 (73%), Gaps = 13/194 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLS----KPSRKSSNVEEARQSSSMAKK  966
             FWN S AS+++VR   F P T SQF+   F  K S     P   S  V ++   SS +KK
Sbjct  270   FWNASAASMSEVRTG-FYPPTPSQFVSEAFEQKTSCGNLAPKSNSEGVRDS--CSSASKK  326

Query  965   ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
             + + E  FK+PRIE+P PLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIK
Sbjct  327   SGSSEPTFKKPRIESPLPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIK  386

Query  785   FLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATET  621
              LHDQV  LS PYLKNG  + QH Q     ++ +G K +LRS+GLCLVPIS T+P+A+ET
Sbjct  387   SLHDQVGALSNPYLKNGHRM-QHQQGSDKSKNGDGPKQDLRSRGLCLVPISITYPMASET  445

Query  620   TSDFWTPTFGASFR  579
             T+DFW PTFG +FR
Sbjct  446   TADFWHPTFGGTFR  459


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 75/152 (49%), Gaps = 25/152 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS----MFGASPCSAATINDM--GNFAWAnnddhhhhHQL  1668
             MADDF + G+C GG WWN ARS    +  +  CS A I D+  G F WA         +L
Sbjct  1     MADDFQS-GICSGGRWWNLARSAGSDVRASDSCSTA-ITDVGGGGFCWA-------TAEL  51

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
                K RS +E    ++ GSS+  QE  K       + +  +     G GL   ST + DW
Sbjct  52    AAPKARSGEELA-GSASGSSLSFQETHKPPPSDAGLPLIDSTFQTPGFGL---STPSMDW  107

Query  1487  NQALVQTNER------AMLQEDRNSRLNYGQE  1410
              Q+L++++ R      AMLQED +S   Y +E
Sbjct  108   TQSLLRSSGRGETSFHAMLQEDLSSSRPYFRE  139



>ref|XP_008383960.1| PREDICTED: transcription factor bHLH112 isoform X3 [Malus domestica]
Length=479

 Score =   213 bits (542),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 147/210 (70%), Gaps = 24/210 (11%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLN---DVRAAT-FLPSTQSQFL---PSVFSDKLSKP-------SRK  1014
             N    FWN  +PA+LN    VR++     S+Q+Q+    PS F +K  KP       +  
Sbjct  274   NINTPFWNAPAPAALNPDNTVRSSNDLFSSSQAQYTTPSPSPFHEK--KPNSNNFTKANT  331

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             + +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG
Sbjct  332   NEDVQDSSSSVVKKSSSSAGEPVFKRARIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  391

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQG  669
             KTDTASVLHEAIEYIKFLHDQ  VLS PY+KNG  + Q H  D+     EG K +L+S+G
Sbjct  392   KTDTASVLHEAIEYIKFLHDQ--VLSTPYMKNGAPMQQQHGIDKMREASEGAKQDLQSRG  449

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTFPVA ETT+DFWTPTFGA+FR
Sbjct  450   LCLVPISSTFPVANETTADFWTPTFGATFR  479


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 91/190 (48%), Gaps = 53/190 (28%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  AG+CGG SWWN +R +  ASPCS    + MG F +         + +V++K  
Sbjct  1     MAEEFQ-AGICGGNSWWNSSRHVLVASPCSMGFNDHMGGFGYP--------NDMVDIKAT  51

Query  1649  SSDESCGSASDGSSVV---------------LQELPKSHHQTHNMSMDSTHLHMLGIGLS  1515
              S  SCG  ++  S                  Q++ K  H       D T L MLG GL 
Sbjct  52    RS--SCGEINNSVSDDHDDGDHSKSIANFDQYQDVQKPDH-------DPT-LQMLGFGL-  100

Query  1514  PSSTATT--DWNQALVQTN----------ERAMLQEDR--NSRLNYGQEIGVECSDS---  1386
             PSS ++T  D+NQAL+ +              MLQED   N++LN    +G E S S   
Sbjct  101   PSSLSSTHSDFNQALLVSRSSSGRGESNFHNPMLQEDMGLNAKLNTA-ALGDEESXSIIN  159

Query  1385  SFKPVAKDFS  1356
              FKP+ +DFS
Sbjct  160   GFKPMNQDFS  169



>ref|XP_009803615.1| PREDICTED: transcription factor bHLH112-like [Nicotiana sylvestris]
Length=462

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 132/192 (69%), Gaps = 16/192 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQ  954
             FWN + AS++DVR+   LPS   Q    V          K  +  E +   ++AK+ S  
Sbjct  280   FWNATSASMDDVRSGFHLPSIHQQLPNPV--------DTKPKHTAEDKNIRTIAKR-SGS  330

Query  953   EAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHD  774
             E + KRPR E PS +P FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+
Sbjct  331   ETSNKRPRNEAPSQMPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHE  390

Query  773   QVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             QVNVLS PY+K+G S  QH Q        + EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  391   QVNVLSTPYMKSGASRQQHQQSTGDRSNVNPEGAKQDLRSRGLCLVPVSSTFPVTHETTV  450

Query  614   DFWTPTFGASFR  579
             DFWTPTFG +FR
Sbjct  451   DFWTPTFGGTFR  462



>ref|XP_004294314.1| PREDICTED: transcription factor bHLH123-like [Fragaria vesca 
subsp. vesca]
Length=448

 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 138/198 (70%), Gaps = 17/198 (9%)
 Frame = -3

Query  1154  FPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSS  978
             F N AA FWN    A++ DVR  TF PS Q QF  + F +K         N+ E  Q S 
Sbjct  262   FSNNAA-FWNAPHEAAMKDVRP-TFFPSLQPQFPTARFDEK-------PKNISEVHQDSG  312

Query  977   MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI  798
                K S  EA+ KRPR ET S LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAI
Sbjct  313   AVVKKSGSEAS-KRPRNETSSTLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAI  371

Query  797   EYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPV  633
             EYIKFLH+QV+VLS PY+K+G ++ QH Q     +D EG K +LR +GLCLVP+SSTFP 
Sbjct  372   EYIKFLHEQVSVLSNPYMKSGAAI-QHQQKSDKSKDPEGPKHDLRGRGLCLVPVSSTFPA  430

Query  632   ATETTSDFWTPTFGASFR  579
             A ETT DFWTPTFG +FR
Sbjct  431   AHETTVDFWTPTFGGTFR  448


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 93/183 (51%), Gaps = 30/183 (16%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWN-PARSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD++   G     +WW+  +R+ F   S   ++++N +G+F W           ++ MK
Sbjct  1     MADEYQNTG-----NWWDSTSRNRFETGSSPPSSSLNSLGSFGW--------QPDMIEMK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  + P+    + + S     LHM+G+GL   ++  TDWNQA+
Sbjct  48    SRSSMDS-GSVSGTSSIVFHD-PQKLQGSDSSSGGDPSLHMMGLGL---NSQATDWNQAI  102

Query  1475  -----VQTNERAMLQEDRNSRLNYGQEIG----VECSDSSFKPVAKDFSTS-TPSATNFA  1326
                   +T+ R++LQ++ NS  N+ QE      ++  D  F   + + S   +   T F+
Sbjct  103   FRGEKAETSFRSILQDNMNSNANFQQETHDQQQLQWRDKLFTGSSGEMSRGFSLDQTQFS  162

Query  1325  PSY  1317
             P Y
Sbjct  163   PQY  165



>ref|XP_009369411.1| PREDICTED: transcription factor bHLH112 isoform X2 [Pyrus x bretschneideri]
Length=440

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 146/209 (70%), Gaps = 19/209 (9%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLND---VRAAT-FLPSTQSQFL-PSVF--------SDKLSKPSRKS  1011
             N +  FWN  +PA+LN    +R++     S+Q+Q+  PS+         S+  +  +  +
Sbjct  232   NISTPFWNAPAPAALNQDNTIRSSNDLFSSSQAQYTTPSLSPFHEKKPNSNNFTTKANTN  291

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
               V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  292   GGVQDSSSSVVKKSSSSACEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGK  351

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGL  666
             TDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q    D+     EG + +L+S GL
Sbjct  352   TDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQQGTDKMEEASEGAQQDLQSLGL  411

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT+DFWTP+FGA+FR
Sbjct  412   CLVPISSTFPVANETTADFWTPSFGATFR  440



>ref|XP_010052471.1| PREDICTED: transcription factor bHLH112 isoform X2 [Eucalyptus 
grandis]
Length=392

 Score =   210 bits (534),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 166/444 (37%), Positives = 231/444 (52%), Gaps = 81/444 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS--MFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             M++DF   G+    +WWNP R   +  +SPCS    N +   ++   D      +++ + 
Sbjct  1     MSEDF-EMGI-HSNNWWNPPRDYVLLSSSPCSTREPNGINGRSF--RDCSADMAEIIKV-  55

Query  1655  GRSSDESCGSASDGSSVVLQE-LPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             GRSS+E       G S+  Q+   +  HQ   M+ DST LHM+G  L    +A++DWN A
Sbjct  56    GRSSEE-VNDDDAGRSIAFQDDFVQRSHQIDCMT-DSTSLHMMGFDLF---SASSDWNLA  110

Query  1478  LVQ--------TNERAMLQEDR-NSRLNY--GQEIGVECSDSSFKPVAKDF--STSTPSA  1338
             + Q        T +  + +ED  +S+  Y   Q   V   DSS + +  D+  S   P+ 
Sbjct  111   VPQSSVIDESSTTDSKLQEEDMASSKFKYEKNQAKDVMIDDSSHQ-IQTDYWGSHCAPTC  169

Query  1337  TNFAP-----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSP  1173
                +      SY YPSN ++                            ++  P  +   P
Sbjct  170   HGMSTNGSFTSYAYPSNSIR----------------------------SSLEPEHHQLQP  201

Query  1172  PLLKPTFPNAAASFWNQSPASLNDVRAAT----FLPSTQSQFLPSVFSDKLSKPSRKSSN  1005
                        + F NQ  + L+   ++     F+ ++ +QF+     +K  +PS   ++
Sbjct  202   -----------SPFNNQQFSGLHSNNSSLNESSFINASYAQFVHPALEEK--QPSCPKTS  248

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
              E+A    SMAK     E A KRPR ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD
Sbjct  249   CEDAGNLGSMAKNI-GVEPASKRPRFETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  307

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ--HHQQDEEG-RKAELRSQGLCLVP  654
             TASVLHEA+EYIKFL DQV+VL +PY+ N   V      + D++G  K +LRS+GLCL+P
Sbjct  308   TASVLHEAVEYIKFLQDQVSVLCSPYMGNEAPVEALGKRKDDQQGLSKQDLRSRGLCLMP  367

Query  653   ISSTFPVATETTSDFWTPTFGASF  582
             ISST+PVAT  T  FWTPT   +F
Sbjct  368   ISSTYPVATSATPHFWTPTLEGNF  391



>ref|XP_008439935.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Cucumis 
melo]
Length=404

 Score =   210 bits (535),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 164/445 (37%), Positives = 217/445 (49%), Gaps = 75/445 (17%)
 Frame = -3

Query  1820  DFMTAGVCGGGSWWNPARSMF----GASPCSAATINDMGNFAWAnnddhhhhHQLVNMKG  1653
             DF  A +CG  +WWN +RSM     G SPCS      + + +W                 
Sbjct  4     DFQ-APICGD-NWWNSSRSMLVAVGGLSPCSVG----IADLSWPP---------------  42

Query  1652  RSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA--  1479
             +    +  S ++ SS++ Q              D +   M+G  LS SST +  WNQ+  
Sbjct  43    QPPSAATDSVNNNSSMLFQ--------------DYSTFQMMGFALS-SSTTSEHWNQSQD  87

Query  1478  LVQTN--------ERAMLQ-EDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTPSATNFA  1326
             L+ +N        E  + Q  D +  LN        C    F   +  +  S+PS     
Sbjct  88    LLNSNGIPTNFSSENGLKQGNDGDDYLNCSSTNTTNCQGGLFPVESSLYGYSSPSTKLLQ  147

Query  1325  PSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPPLLKPTF--  1152
                N   +                   +    +  PP   +     N  S  L+KP+   
Sbjct  148   --TNLYEDDNSDPRSLFNSTPSITTNSTTFPTNINPPNHLSLSSTPNFSSNYLVKPSLSN  205

Query  1151  PNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR------KSSNVEEAR  990
             P     F N +P    +  ++  +P    Q + S+  DK +  S+      KS N +   
Sbjct  206   PQPHLQFTNNTP--FWNASSSNSIP----QGIASLLEDKNNPKSQNNTLAFKSMNEDGQD  259

Query  989   QSSSMAKKA--SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
             Q   + K +  + +   FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS
Sbjct  260   QVKKVDKNSAITTEPTVFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  319

Query  815   VLHEAIEYIKFLHDQVNVLSAPYLK--NGCSVSQHHQQDEEGR----KAELRSQGLCLVP  654
             VLHEAIEYIKFLHDQV+VLS PY+K  NG +  QH Q  E+      K +L+S+GLCLVP
Sbjct  320   VLHEAIEYIKFLHDQVSVLSTPYMKNSNGITPVQHQQVSEKANQDSPKQDLKSRGLCLVP  379

Query  653   ISSTFPVATETTSDFWTPTFGASFR  579
             ISSTFPV   + +DFWTPTFG +FR
Sbjct  380   ISSTFPVTNASPTDFWTPTFGGTFR  404



>ref|XP_006360115.1| PREDICTED: transcription factor bHLH123-like [Solanum tuberosum]
Length=445

 Score =   211 bits (537),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 141/209 (67%), Gaps = 22/209 (11%)
 Frame = -3

Query  1178  SPPLLKPTFPNAAAS--FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSN  1005
             SPPL      + +    FWN + A+  DVR+  F+P   +   P+V          K  +
Sbjct  250   SPPLSHSQLSHFSGGTPFWNATSAAAEDVRSG-FVPQLPTN--PTV--------DEKPKH  298

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
               E R  S++ KK+S+ E + KRPR E PSPLP FKVRKEK+GDR+TALQQLVSPFGKTD
Sbjct  299   TGEVRNISTITKKSSS-ETSNKRPRNEAPSPLPAFKVRKEKMGDRITALQQLVSPFGKTD  357

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELRSQGL  666
             TASVL EAIEYIKFLHDQVNVLS PY+K+G S+ QH Q        + EG K +LRS+GL
Sbjct  358   TASVLSEAIEYIKFLHDQVNVLSTPYMKSGASI-QHQQSTGDKSNVNPEGGKQDLRSRGL  416

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVP+SSTFPV  ET  DFWTPTFG +FR
Sbjct  417   CLVPVSSTFPVTHETAVDFWTPTFGGTFR  445



>ref|XP_009369342.1| PREDICTED: transcription factor bHLH112 isoform X1 [Pyrus x bretschneideri]
Length=481

 Score =   211 bits (538),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 146/209 (70%), Gaps = 19/209 (9%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLND---VRAAT-FLPSTQSQFL-PSVF--------SDKLSKPSRKS  1011
             N +  FWN  +PA+LN    +R++     S+Q+Q+  PS+         S+  +  +  +
Sbjct  273   NISTPFWNAPAPAALNQDNTIRSSNDLFSSSQAQYTTPSLSPFHEKKPNSNNFTTKANTN  332

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
               V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  333   GGVQDSSSSVVKKSSSSACEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGK  392

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGL  666
             TDTASVLHEAIEYIKFLHDQV+VLS PY+KNG  + Q    D+     EG + +L+S GL
Sbjct  393   TDTASVLHEAIEYIKFLHDQVSVLSTPYMKNGAPMQQQQGTDKMEEASEGAQQDLQSLGL  452

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT+DFWTP+FGA+FR
Sbjct  453   CLVPISSTFPVANETTADFWTPSFGATFR  481


 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 96/188 (51%), Gaps = 50/188 (27%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMKGR  1650
             MA++F  A +CGG SWW+ +R +  ASPCS    + MG F +         + +V++K  
Sbjct  1     MAEEFQ-ARICGGNSWWSSSRHVLAASPCSVGFNDHMGGFGYP--------NDMVDIKAT  51

Query  1649  SSDESCG----------SASDGSSVV-----LQELPKSHHQTHNMSMDSTHLHMLGIGLS  1515
              S  SCG             D S+ +      Q++ K  H       DST L M+G GLS
Sbjct  52    RS--SCGEINNLVSDDHDGGDHSNSIANFDQYQDVQKPDH-------DST-LQMIGFGLS  101

Query  1514  PSSTAT-TDWNQALV--------QTN-ERAMLQED--RNSRLNYGQEIGVECSDS---SF  1380
              S ++T +D+NQAL+        ++N   +MLQED   N++LN G  +G E S S    F
Sbjct  102   SSLSSTPSDFNQALLLRSGSGRGESNFHNSMLQEDMGMNTKLNTG-ALGDEESSSLINVF  160

Query  1379  KPVAKDFS  1356
             KP+ +DFS
Sbjct  161   KPMNQDFS  168



>ref|XP_009617831.1| PREDICTED: transcription factor bHLH112-like [Nicotiana tomentosiformis]
Length=472

 Score =   211 bits (537),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 135/191 (71%), Gaps = 15/191 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQ  954
             FWN + A++ DVR+  FLPS   Q LP+   D       K  +  E R   ++AKK+S+ 
Sbjct  291   FWNATSAAMEDVRSG-FLPSIHQQ-LPNPTVD------MKPKHTAEVRTIRTIAKKSSS-  341

Query  953   EAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHD  774
             E + KRPR ETPS +P FK RKEK+GDR+T LQQLVSPFGKTDTASVL EAIEYIKFLH+
Sbjct  342   ETSNKRPRNETPSQMPAFKARKEKMGDRITTLQQLVSPFGKTDTASVLSEAIEYIKFLHE  401

Query  773   QVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATETTSD  612
             QVNVLS PY+K+G S+ QH Q  +      E  K +LR +GLCLVP+SSTFPV  ETT D
Sbjct  402   QVNVLSTPYMKSGASMQQHQQTSDKSNVNPEVAKQDLRGRGLCLVPVSSTFPVTHETTVD  461

Query  611   FWTPTFGASFR  579
             FWTPTFG +FR
Sbjct  462   FWTPTFGGTFR  472



>ref|XP_009417260.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=326

 Score =   207 bits (526),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 139/192 (72%), Gaps = 12/192 (6%)
 Frame = -3

Query  1133  FWNQSPA-SLNDVRAATFLPSTQSQFL--PSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             FWN S A S+ DV++    P T SQF+  P      L+        V+++  SS+   K 
Sbjct  140   FWNASAAASVGDVKSILCSP-TPSQFVMQPQTTCGNLAACRISPGGVQDSCSSST---KK  195

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             +  E+A K+PRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  196   TGSESAVKKPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLQEAIEYIKF  255

Query  782   LHDQVNVLSAPYLKNGCSVSQHH----QQDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LHDQV VLS+PYLK+G  + QH      +D +  K +LRS+GLCLVPI+ST+ VA+ETT+
Sbjct  256   LHDQVGVLSSPYLKDGHPM-QHQISSKSKDCDETKQDLRSRGLCLVPITSTYLVASETTA  314

Query  614   DFWTPTFGASFR  579
             DFW PTFG SFR
Sbjct  315   DFWHPTFGGSFR  326



>gb|KHN08360.1| Transcription factor bHLH123 [Glycine soja]
Length=355

 Score =   208 bits (529),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 143/210 (68%), Gaps = 21/210 (10%)
 Frame = -3

Query  1178  SPPLLKPT----FPNAAASFWN-QSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRK  1014
             SPP  +P     F N A  FWN  S  ++ D R+ +F+PS    F  S F         +
Sbjct  157   SPPKQQPNNQLHFTNNAP-FWNANSEPAIKDSRS-SFIPSLHPPFSTSNFD-------VQ  207

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             S N+ E R S  + KK S  EAA KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFG
Sbjct  208   SKNISEVRDSGGVVKK-SGSEAAPKRPRNETPSPLPAFKVRKEKMGDRITALQQLVSPFG  266

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQG  669
             KTDTASVL EAIEYIKFLH+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+G
Sbjct  267   KTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-QHQQSSGKSKESEGPKQDLRSRG  325

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVP+SSTFPV  E T ++WTPTFG ++R
Sbjct  326   LCLVPVSSTFPVTHEPTVEYWTPTFGGTYR  355



>ref|XP_008793684.1| PREDICTED: transcription factor bHLH123-like [Phoenix dactylifera]
Length=310

 Score =   206 bits (524),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 118/147 (80%), Gaps = 6/147 (4%)
 Frame = -3

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
             ++ A +S S   K S+ E A K+PR+ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD
Sbjct  165   LQGAGESRSNTMKKSSNEPALKKPRMETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  224

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCL  660
             TASVLHEAIEYIKFLH+QV VLSAPYLKNG  + QH Q      D EG + +L S+GLCL
Sbjct  225   TASVLHEAIEYIKFLHEQVGVLSAPYLKNGHQM-QHPQNFDETNDGEGPQIDLTSRGLCL  283

Query  659   VPISSTFPVATETTSDFWTPTFGASFR  579
             VPISSTF VA+ET  DFWTPTFG ++R
Sbjct  284   VPISSTFAVASETPVDFWTPTFGGTYR  310



>ref|XP_008439936.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Cucumis 
melo]
Length=402

 Score =   208 bits (530),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 165/448 (37%), Positives = 218/448 (49%), Gaps = 77/448 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF----GASPCSAATINDMGNFAWAnnddhhhhHQLVN  1662
             MA+DF  A +CG  +WWN +RSM     G SPCS      + + +W              
Sbjct  1     MAEDFQ-APICGD-NWWNSSRSMLVAVGGLSPCSVG----IADLSWPP------------  42

Query  1661  MKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQ  1482
                +    +  S ++ SS++ Q              D +   M+G  LS SST +  WNQ
Sbjct  43    ---QPPSAATDSVNNNSSMLFQ--------------DYSTFQMMGFALS-SSTTSEHWNQ  84

Query  1481  A--LVQTN--------ERAMLQ-EDRNSRLNYGQEIGVECSDSSFKPVAKDFSTSTPSAT  1335
             +  L+ +N        E  + Q  D +  LN        C    F   +  +  S+PS  
Sbjct  85    SQDLLNSNGIPTNFSSENGLKQGNDGDDYLNCSSTNTTNCQGGLFPVESSLYGYSSPSTK  144

Query  1334  NFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPPLLKPT  1155
                   N   +                   +    +  PP   +     N  S  L+KP+
Sbjct  145   LLQ--TNLYEDDNSDPRSLFNSTPSITTNSTTFPTNINPPNHLSLSSTPNFSSNYLVKPS  202

Query  1154  F--PNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR------KSSNVE  999
                P     F N +P    +  ++  +P    Q + S+  DK +  S+      KS N +
Sbjct  203   LSNPQPHLQFTNNTP--FWNASSSNSIP----QGIASLLEDKNNPKSQNNTLAFKSMNED  256

Query  998   EARQSSSMAKKA--SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
                Q   + K +  + +   FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD
Sbjct  257   GQDQVKKVDKNSAITTEPTVFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  316

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLK--NGCSVSQHHQQDEEGR----KAELRSQGLC  663
             TASVLHEAIEYIKFLHDQ  VLS PY+K  NG +  QH Q  E+      K +L+S+GLC
Sbjct  317   TASVLHEAIEYIKFLHDQ--VLSTPYMKNSNGITPVQHQQVSEKANQDSPKQDLKSRGLC  374

Query  662   LVPISSTFPVATETTSDFWTPTFGASFR  579
             LVPISSTFPV   + +DFWTPTFG +FR
Sbjct  375   LVPISSTFPVTNASPTDFWTPTFGGTFR  402



>ref|XP_003541039.2| PREDICTED: transcription factor bHLH123-like [Glycine max]
Length=474

 Score =   210 bits (535),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 142/205 (69%), Gaps = 17/205 (8%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWN-QSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP  +  F N A  FWN  S  ++ D R+  F+PS Q  F  S F         +S N+ 
Sbjct  281   PPNNQLHFTNNAP-FWNANSEPAIKDSRS-NFIPSLQPPFPTSNFD-------VQSKNIS  331

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E R SS + KK S  EAA KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  332   EVRDSSGVVKK-SGSEAAPKRPRNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  390

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVP  654
             SVL EAIEYIKFLH+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+GLCLVP
Sbjct  391   SVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-QHQQSSGKSKESEGPKQDLRSRGLCLVP  449

Query  653   ISSTFPVATETTSDFWTPTFGASFR  579
             +SSTFPV  E T ++WTPTFG ++R
Sbjct  450   VSSTFPVTHEPTVEYWTPTFGGTYR  474



>ref|XP_010052470.1| PREDICTED: transcription factor bHLH112 isoform X1 [Eucalyptus 
grandis]
Length=393

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 166/445 (37%), Positives = 231/445 (52%), Gaps = 82/445 (18%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS--MFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             M++DF   G+    +WWNP R   +  +SPCS    N +   ++   D      +++ + 
Sbjct  1     MSEDF-EMGI-HSNNWWNPPRDYVLLSSSPCSTREPNGINGRSF--RDCSADMAEIIKV-  55

Query  1655  GRSSDESCGSASDGSSVVLQE-LPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             GRSS+E       G S+  Q+   +  HQ   M+ DST LHM+G  L    +A++DWN A
Sbjct  56    GRSSEE-VNDDDAGRSIAFQDDFVQRSHQIDCMT-DSTSLHMMGFDLF---SASSDWNLA  110

Query  1478  LVQ--------TNERAMLQEDR-NSRLNY--GQEIGVECSDSSFKPVAKDF--STSTPSA  1338
             + Q        T +  + +ED  +S+  Y   Q   V   DSS + +  D+  S   P+ 
Sbjct  111   VPQSSVIDESSTTDSKLQEEDMASSKFKYEKNQAKDVMIDDSSHQ-IQTDYWGSHCAPTC  169

Query  1337  TNFAP-----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSP  1173
                +      SY YPSN ++                            ++  P  +   P
Sbjct  170   HGMSTNGSFTSYAYPSNSIR----------------------------SSLEPEHHQLQP  201

Query  1172  PLLKPTFPNAAASFWNQSPAS-----LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSS  1008
                        + F NQ   S      + +  ++F+ ++ +QF+     +K  +PS   +
Sbjct  202   -----------SPFNNQQQFSGLHSNNSSLNESSFINASYAQFVHPALEEK--QPSCPKT  248

Query  1007  NVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT  828
             + E+A    SMAK     E A KRPR ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT
Sbjct  249   SCEDAGNLGSMAKNI-GVEPASKRPRFETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT  307

Query  827   DTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ--HHQQDEEG-RKAELRSQGLCLV  657
             DTASVLHEA+EYIKFL DQV+VL +PY+ N   V      + D++G  K +LRS+GLCL+
Sbjct  308   DTASVLHEAVEYIKFLQDQVSVLCSPYMGNEAPVEALGKRKDDQQGLSKQDLRSRGLCLM  367

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISST+PVAT  T  FWTPT   +F
Sbjct  368   PISSTYPVATSATPHFWTPTLEGNF  392



>ref|XP_008777138.1| PREDICTED: transcription factor bHLH123-like [Phoenix dactylifera]
Length=456

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 152/223 (68%), Gaps = 19/223 (9%)
 Frame = -3

Query  1208  ANFRPNLNDFSPPLLKP----TFPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFS  1041
             ANF P     SPP  +P     F N    FWN S AS+++V    + P T SQF+   F 
Sbjct  240   ANF-PQFLKSSPPKQQPGNQLQFSNNTP-FWNASAASMSEVGTGLY-PPTPSQFVSQAFQ  296

Query  1040  DKLS----KPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGD  873
              K S     P   S  V ++   SS +KK+ + E   K+PRIE+P PLPTFKVRKEKLGD
Sbjct  297   QKPSCSNLAPKLNSEGVRDS--CSSPSKKSGSSEPTSKKPRIESPLPLPTFKVRKEKLGD  354

Query  872   RVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----Q  708
             R+TALQQLVSPFGKTDTASVLHEAIE+IKFLHDQV VLS PYLKNG  + QH Q     +
Sbjct  355   RITALQQLVSPFGKTDTASVLHEAIEHIKFLHDQVGVLSTPYLKNGHPM-QHQQGSDKSK  413

Query  707   DEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             + +G K +LRS+GLCLVPIS T+P+A+ETT+DFW PTFG +FR
Sbjct  414   NGDGPKQDLRSRGLCLVPISITYPMASETTADFWHPTFGGTFR  456


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 77/155 (50%), Gaps = 26/155 (17%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFG---ASPCSAATINDMGN--FAWAnnddhhhhHQLV  1665
             MADDF + G+C GG WWN ARS      AS  S+ TI D+G   F+WA         +L 
Sbjct  1     MADDFQS-GICSGGGWWNLARSAGSDVLASVSSSTTITDIGGGGFSWATA-------ELA  52

Query  1664  NMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWN  1485
               K RS +E  GSAS GSS+  Q+  K       + +  +     G GLS      TDW 
Sbjct  53    EPKARSGEELAGSAS-GSSLNFQDTHKLPPPDAGLPLIDSSFQTPGFGLS------TDWT  105

Query  1484  QALVQTNERA------MLQEDRNSRLNYGQEIGVE  1398
             Q L+++  RA      MLQED  SR  + +E  VE
Sbjct  106   QTLLRSGGRAETSFHVMLQEDPRSRAYFREEPSVE  140



>ref|XP_009397158.1| PREDICTED: transcription factor bHLH112-like [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 147/218 (67%), Gaps = 14/218 (6%)
 Frame = -3

Query  1196  PNLNDFSPPLLKP----TFPNAAASFWNQSP-ASLNDVRAATFLPSTQSQFLPSVFSDK-  1035
             P L   SPP   P     F N A  FWN +  AS+++  + +   +  SQ    VF +K 
Sbjct  242   PQLLRSSPPKHHPGNLLQFSNNAP-FWNATATASVSETNSGS-CSTAPSQLDKKVFDEKN  299

Query  1034  LSKPSRKSSNVEEARQSSSMAKKAS-NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTAL  858
             +       +N +  R S S +      Q+ AFK+PRIETPSPLP+FKVRKEKLGDR+TAL
Sbjct  300   IGSNFTDMTNSDGVRDSYSSSSSGKPGQDPAFKKPRIETPSPLPSFKVRKEKLGDRITAL  359

Query  857   QQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGR  693
             QQLVSPFGKTDTASVLHEAIEYIKFLHDQV VLS PYLKNG ++ Q  Q     +D EG 
Sbjct  360   QQLVSPFGKTDTASVLHEAIEYIKFLHDQVGVLSTPYLKNGHAMQQQQQGSNKSKDGEGP  419

Query  692   KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             + +LRS+GLCLVPI+ST+PV + TT+DFW PTFG +FR
Sbjct  420   RPDLRSRGLCLVPIASTYPVTSGTTADFWHPTFGGTFR  457


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (51%), Gaps = 23/154 (15%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGAS-PCSAATINDMGNFA--WAnnddhhhhHQLVNM  1659
             MADDF TAG C GGS WNPARS+     P + + I D+   A  WA         +LV+ 
Sbjct  1     MADDFQTAGTCSGGSVWNPARSITAIDMPAAVSCIADIAGNASSWA-------AAELVDG  53

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW---  1488
             K R  DES  S   GSSV  +   K    T   S+ ++ L +  +G   S+T + DW   
Sbjct  54    KARFCDESSVS---GSSVTFRGSRKVQQATAAPSVINSTLQLPILG---SATPSMDWSTQ  107

Query  1487  ---NQALV-QTNERAMLQEDRNSRLNYGQEIGVE  1398
                N+A   +T+  AML E+ ++R  +GQ   +E
Sbjct  108   GSANRARGDETSFHAMLHEEISARAIFGQYQSIE  141



>ref|XP_007133119.1| hypothetical protein PHAVU_011G153000g [Phaseolus vulgaris]
 gb|ESW05113.1| hypothetical protein PHAVU_011G153000g [Phaseolus vulgaris]
Length=466

 Score =   209 bits (532),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 133/194 (69%), Gaps = 19/194 (10%)
 Frame = -3

Query  1139  ASFWN-QSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A FWN  S  S+ D R++ F+PS Q  F PS F         +S N+ E R S  + K  
Sbjct  285   APFWNANSEPSMKDARSS-FIPSLQPPFSPSNFD-------VQSKNISEVRDSGVVKKSG  336

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S  E A KRPR E PSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  337   S--ETAPKRPRNENPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  394

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATET  621
             LH+QV VLS PY+K G  +  HHQQ        EG K +LRS+GLCLVP+SSTFPV  E 
Sbjct  395   LHEQVTVLSTPYMKTGAPI--HHQQSSGKSKECEGPKQDLRSRGLCLVPVSSTFPVTHEP  452

Query  620   TSDFWTPTFGASFR  579
             T ++WTPTFG ++R
Sbjct  453   TVEYWTPTFGGTYR  466


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 75/150 (50%), Gaps = 37/150 (25%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF---GASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             M+DD   A     G+WW  AR++    G +  S++ + +MGN+AW +           +M
Sbjct  1     MSDDQFQAS----GNWWESARNVRFESGETQSSSSGLTNMGNYAWQH-----------DM  45

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTH------NMSMDSTHLHMLGIGLSPSSTAT  1497
                SS ++  SAS GSSVV  +  +   Q H      N + D  +LHM+G+GL   S+  
Sbjct  46    ARSSSMDN--SASGGSSVVFHDQKQLQVQPHHDSTATNPTNDHPNLHMMGLGL---SSQA  100

Query  1496  TDWNQALVQTNE--------RAMLQEDRNS  1431
              DWNQA +Q           R+MLQE+ +S
Sbjct  101   MDWNQASLQLRGEKGSEGSFRSMLQENLSS  130



>ref|XP_009405924.1| PREDICTED: transcription factor bHLH112-like [Musa acuminata 
subsp. malaccensis]
Length=417

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 171/460 (37%), Positives = 222/460 (48%), Gaps = 86/460 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP----CSAATINDMGN--FAWAnnddhhhhHQL  1668
             MA+D  T G+C GGSWWNP  S    +P    CS A  + +G   F W+           
Sbjct  1     MAEDLQT-GICSGGSWWNPEGSGSFDAPTSMSCSTAMTDMIGGRAFCWSAA---------  50

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPK--SHHQTHNMSMDSTHLHMLGIGLSPSSTATT  1494
                   S D+S GSA  GSS+  QE  +   H     + +DS    +   GL  SS    
Sbjct  51    ------SGDDSAGSAG-GSSIAFQESNRMLQHSDIRPLLIDSA---IPSFGLVSSSM---  97

Query  1493  DWNQALVQTNE------RAMLQEDRNSRLNYGQEI---------GVEC------SDSSFK  1377
             +W + L            AMLQED  SR    Q+          G E       SD +  
Sbjct  98    NWTRPLSYGGRPESSGLHAMLQEDLGSRPYIRQDTPAVSNQARTGAESWTANPSSDMNQN  157

Query  1376  PVAKD--FSTSTPSATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPAN  1203
              + +   FS+   S+     SY +                       +   SY       
Sbjct  158   LLVEQHHFSSGHESSDAGVGSYQF------------MYGNRLMNGYQSPTTSYQGSSNEL  205

Query  1202  FRPNLNDFSPPLLKPTFPNAAAS----------FWNQSPA-SLNDVRAATFLPST-QSQF  1059
             ++P+   FS   LK + P   ++          FWN S A S+ ++R+A   P+T Q   
Sbjct  206   WQPSWAKFSHQFLKSSHPKQQSNNQLQFTNNTPFWNASAATSVGEIRSALCSPATSQFDL  265

Query  1058  LPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKL  879
              P      L+        + ++  SS+M  K  ++ AA K+ R ETPSPLPTFKVRKEKL
Sbjct  266   QPRTIYRNLTA-KMNPEGIHDSCSSSTM--KTGSEPAATKKLRTETPSPLPTFKVRKEKL  322

Query  878   GDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEE  699
             GDR+TALQQ+VSPFGKTDTASVL EAIEYIKFL DQV VLS+PYLK          +D  
Sbjct  323   GDRITALQQIVSPFGKTDTASVLQEAIEYIKFLQDQVGVLSSPYLK-----MSDKSKDCS  377

Query  698   GRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                 +LRS+GLCLVP++ST PVA+ETT+DFW PTFG  FR
Sbjct  378   EPNQDLRSRGLCLVPVASTHPVASETTADFWHPTFGGIFR  417



>ref|XP_004509986.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Cicer 
arietinum]
Length=429

 Score =   208 bits (529),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 135/192 (70%), Gaps = 18/192 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S  ++ D       PS+   FLP   +     P  K  N+ E R SSS+AKK S
Sbjct  251   APFWNASEGTIKDA------PSS---FLPPFATPIFGTPQPK--NISEGRDSSSVAKK-S  298

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               E A KRP+ ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  299   GSEPAPKRPKNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  358

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             H+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+GLCLVP+SSTFP+  E T 
Sbjct  359   HEQVTVLSTPYMKSGAPI-QHQQNSGKSKETEGPKQDLRSRGLCLVPVSSTFPMTHEPTV  417

Query  614   DFWTPTFGASFR  579
             ++WTPTFG +FR
Sbjct  418   EYWTPTFGGTFR  429



>gb|KHN28608.1| Transcription factor bHLH123 [Glycine soja]
Length=474

 Score =   209 bits (531),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 141/205 (69%), Gaps = 17/205 (8%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWN-QSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP  +  F N A  FWN  S  ++ D R+  F+PS Q  F  S F         +S N+ 
Sbjct  281   PPNNQLHFTNNAP-FWNANSEPAIKDSRS-NFIPSLQPPFPTSNFD-------VQSKNIS  331

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
             E R S  + KK S  EAA KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  332   EVRDSGGVVKK-SGSEAAPKRPRNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTA  390

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVP  654
             SVL EAIEYIKFLH+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+GLCLVP
Sbjct  391   SVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-QHQQSSGKSKESEGPKQDLRSRGLCLVP  449

Query  653   ISSTFPVATETTSDFWTPTFGASFR  579
             +SSTFPV  E T ++WTPTFG ++R
Sbjct  450   VSSTFPVTHEPTVEYWTPTFGGTYR  474



>ref|XP_003526151.1| PREDICTED: transcription factor bHLH123-like [Glycine max]
Length=489

 Score =   208 bits (530),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 143/210 (68%), Gaps = 21/210 (10%)
 Frame = -3

Query  1178  SPPLLKPT----FPNAAASFWN-QSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRK  1014
             SPP  +P     F N A  FWN  S  ++ D R+ +F+PS    F  S F         +
Sbjct  291   SPPKQQPNNQLHFTNNAP-FWNANSEPAIKDSRS-SFIPSLHPPFSTSNFD-------VQ  341

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             S N+ E R S  + KK S  EAA KRPR ETPSPLP FKVRKEK+GDR+TALQQLVSPFG
Sbjct  342   SKNISEVRDSGGVVKK-SGSEAAPKRPRNETPSPLPAFKVRKEKMGDRITALQQLVSPFG  400

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQG  669
             KTDTASVL EAIEYIKFLH+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+G
Sbjct  401   KTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-QHQQSSGKSKESEGPKQDLRSRG  459

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVP+SSTFPV  E T ++WTPTFG ++R
Sbjct  460   LCLVPVSSTFPVTHEPTVEYWTPTFGGTYR  489



>ref|XP_004151277.1| PREDICTED: transcription factor bHLH123-like [Cucumis sativus]
Length=433

 Score =   207 bits (526),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 144/224 (64%), Gaps = 37/224 (17%)
 Frame = -3

Query  1175  PPLLKPTFPNAAA--------------SFWNQSPASLNDVRAATFLPSTQSQFLPSVFSD  1038
             PP L+ + P A A              +FWN S   + +VR + F PS  +    + F++
Sbjct  222   PPYLRNSPPKAGAGGNPHSQLQFSNNTAFWNAS--DMKEVRPSYFAPSYNAA---AGFTE  276

Query  1037  KLSKPSRKSSNVEEARQSSSMAKKASN---QEAAFKRPRIETPSPLPTFKVRKEKLGDRV  867
             K       S N+ E   S +  K  ++   Q AA KRPR ETPSPLP FKVRKEK+GDR+
Sbjct  277   K-------SKNISEVGDSVTTKKSGNDNNQQSAAAKRPRNETPSPLPAFKVRKEKMGDRI  329

Query  866   TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV--------SQHHQ  711
             TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+VLS PYLK+G  V        ++   
Sbjct  330   TALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVSVLSTPYLKSGAVVQQQHQQQRNEKSV  389

Query  710   QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             ++ EG K +LRS+GLCLVP+SSTFPV  ETT DFWTPTFG +FR
Sbjct  390   KEGEGGKQDLRSRGLCLVPVSSTFPVTHETTVDFWTPTFGGTFR  433



>emb|CDP05832.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   207 bits (528),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 139/190 (73%), Gaps = 13/190 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQ  954
             FWN S   ++DVR++ F P  Q+Q     F +K SK + +  ++  A++SSS +   SN 
Sbjct  295   FWNASSTGMSDVRSSLF-PPLQTQLPMPNFEEK-SKNASEVRDLPVAKKSSSSSSAPSN-  351

Query  953   EAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHD  774
                 KRPR ETP+P+P FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLHD
Sbjct  352   ----KRPRNETPAPMPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHD  407

Query  773   QVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDF  609
             QVNVLS PY+K+G  + QH Q     +D EG K +LRS+GLCLVP+SSTFPV  ET  D+
Sbjct  408   QVNVLSTPYMKSGAPM-QHQQNPDKSKDPEGPKQDLRSRGLCLVPVSSTFPVTHETAVDY  466

Query  608   WTPTFGASFR  579
             WTPTFG +FR
Sbjct  467   WTPTFGGTFR  476



>gb|KGN56169.1| hypothetical protein Csa_3G088430 [Cucumis sativus]
Length=438

 Score =   207 bits (526),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 144/224 (64%), Gaps = 37/224 (17%)
 Frame = -3

Query  1175  PPLLKPTFPNAAA--------------SFWNQSPASLNDVRAATFLPSTQSQFLPSVFSD  1038
             PP L+ + P A A              +FWN S   + +VR + F PS  +    + F++
Sbjct  227   PPYLRNSPPKAGAGGNPHSQLQFSNNTAFWNAS--DMKEVRPSYFAPSYNAA---AGFTE  281

Query  1037  KLSKPSRKSSNVEEARQSSSMAKKASN---QEAAFKRPRIETPSPLPTFKVRKEKLGDRV  867
             K       S N+ E   S +  K  ++   Q AA KRPR ETPSPLP FKVRKEK+GDR+
Sbjct  282   K-------SKNISEVGDSVTTKKSGNDNNQQSAAAKRPRNETPSPLPAFKVRKEKMGDRI  334

Query  866   TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV--------SQHHQ  711
             TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV+VLS PYLK+G  V        ++   
Sbjct  335   TALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVSVLSTPYLKSGAVVQQQHQQQRNEKSV  394

Query  710   QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             ++ EG K +LRS+GLCLVP+SSTFPV  ETT DFWTPTFG +FR
Sbjct  395   KEGEGGKQDLRSRGLCLVPVSSTFPVTHETTVDFWTPTFGGTFR  438



>ref|XP_004509985.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Cicer 
arietinum]
Length=430

 Score =   206 bits (525),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 135/192 (70%), Gaps = 18/192 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S  ++ D       PS+   FLP   +     P  K  N+ E R SSS+AKK S
Sbjct  252   APFWNASEGTIKDA------PSS---FLPPFATPIFGTPQPK--NISEGRDSSSVAKK-S  299

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               E A KRP+ ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  300   GSEPAPKRPKNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  359

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             H+QV VLS PY+K+G  + QH Q     ++ EG K +LRS+GLCLVP+SSTFP+  E T 
Sbjct  360   HEQVTVLSTPYMKSGAPI-QHQQNSGKSKETEGPKQDLRSRGLCLVPVSSTFPMTHEPTV  418

Query  614   DFWTPTFGASFR  579
             ++WTPTFG +FR
Sbjct  419   EYWTPTFGGTFR  430



>ref|XP_008355969.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Malus 
domestica]
Length=437

 Score =   206 bits (525),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 146/209 (70%), Gaps = 21/209 (10%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLND---VRAAT-FLPSTQSQFL-PSVF--------SDKLSKPSRKS  1011
             N +  FWN  +PA+LN    +R++     S+Q+Q+  PS+         S+  +  +  +
Sbjct  231   NISTPFWNAPTPAALNQDNTIRSSNDLFSSSQAQYTTPSLSPFHEKKPNSNNFTTKANTN  290

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
              +V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  291   GDVQDSSSSVVKKSSSSACEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGK  350

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGL  666
             TDTASVLHEAIEYIKFLHDQ  VLS PY+KNG  + Q    D+     EG + +L+S+GL
Sbjct  351   TDTASVLHEAIEYIKFLHDQ--VLSTPYMKNGAPMQQQQGTDKMEEASEGAQQDLQSRGL  408

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT+DFWTP+FGA+FR
Sbjct  409   CLVPISSTFPVANETTADFWTPSFGATFR  437



>ref|XP_008366237.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Malus 
domestica]
Length=448

 Score =   206 bits (525),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 135/194 (70%), Gaps = 23/194 (12%)
 Frame = -3

Query  1139  ASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A FWN    A++ DVR  +F PS Q QF  + F +K              ++S ++ KK 
Sbjct  271   APFWNAPHEAAMKDVRP-SFFPSLQPQFPTARFDEK-------------PKESGAVGKK-  315

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S  E   KRPR ET SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  316   SGSEVVSKRPRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  375

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATET  621
             LH+QVNVLS PY+K+G ++ QH QQ      D +G K +L S+GLCLVP+SSTFPV  ET
Sbjct  376   LHEQVNVLSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLSSRGLCLVPVSSTFPVTHET  434

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG ++R
Sbjct  435   TVDFWTPTFGGTYR  448


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 97/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPBMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+ +GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMALGL---SSXATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWRDKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|XP_009113124.1| PREDICTED: transcription factor bHLH112-like isoform X4 [Brassica 
rapa]
Length=336

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 139/200 (70%), Gaps = 18/200 (9%)
 Frame = -3

Query  1154  FPNAAAS--FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQS  984
             F N+  S  FW+ S  + LN+    +F+  T SQ +P+   DK       + N +   QS
Sbjct  147   FSNSTNSRPFWSSSSTTNLNNTPHNSFV--TYSQIIPTRLEDK-------TKNQKTKGQS  197

Query  983   SSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHE  804
              S+ K+A + ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E
Sbjct  198   ESL-KRAKDNDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQE  256

Query  803   AIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFP  636
             +IEYIKFLHDQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFP
Sbjct  257   SIEYIKFLHDQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENQELRAHGLCLVPISSTFP  316

Query  635   VATETTSDFWTPTFGA-SFR  579
             VA ETT+DFWTPTFG  SFR
Sbjct  317   VANETTADFWTPTFGGNSFR  336



>ref|XP_009377292.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Pyrus 
x bretschneideri]
Length=448

 Score =   206 bits (524),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 139/206 (67%), Gaps = 24/206 (12%)
 Frame = -3

Query  1175  PPLLKPTFPNAAASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVE  999
             PP     F N A  FWN    A++ DVR  +F PS Q QF  + F +K            
Sbjct  260   PPHSHLQFSNNAP-FWNAPHEAAMKDVRP-SFFPSLQPQFPAARFDEK------------  305

Query  998   EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTA  819
               ++S ++ KK S  E   KRPR ET S LP FKVRKEK+GDR+TALQQLVSPFGKTDTA
Sbjct  306   -PKESGAVGKK-SGSEVVSKRPRNETSSALPAFKVRKEKMGDRITALQQLVSPFGKTDTA  363

Query  818   SVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLV  657
             SVL EAIEYIKFLH+QVN+LS PY+K+G ++ QH QQ      D +G K +LRS+GLCLV
Sbjct  364   SVLSEAIEYIKFLHEQVNILSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLRSRGLCLV  422

Query  656   PISSTFPVATETTSDFWTPTFGASFR  579
             P+SSTFPV  ETT DFWTPTFG ++R
Sbjct  423   PVSSTFPVTHETTVDFWTPTFGGTYR  448


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 98/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPDMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+G+GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMGLGL---SSQATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWREKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|XP_009113123.1| PREDICTED: transcription factor bHLH112-like isoform X3 [Brassica 
rapa]
Length=324

 Score =   202 bits (514),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 135/191 (71%), Gaps = 16/191 (8%)
 Frame = -3

Query  1133  FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FW+ S  + LN+    +F+  T SQ +P+   DK       + N +   QS S+ K+A +
Sbjct  144   FWSSSSTTNLNNTPHNSFV--TYSQIIPTRLEDK-------TKNQKTKGQSESL-KRAKD  193

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E+IEYIKFLH
Sbjct  194   NDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQESIEYIKFLH  253

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETTSDF  609
             DQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFPVA ETT+DF
Sbjct  254   DQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENQELRAHGLCLVPISSTFPVANETTADF  313

Query  608   WTPTFGA-SFR  579
             WTPTFG  SFR
Sbjct  314   WTPTFGGNSFR  324



>ref|XP_003539573.2| PREDICTED: transcription factor bHLH123-like isoform X1 [Glycine 
max]
Length=455

 Score =   206 bits (524),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -3

Query  1139  ASFWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ + DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  273   ATFWNASEAANIKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  324

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  325   GN-EPAPKRTRNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  383

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+QV  LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  384   LHEQVTALSTPYMKSGAPIQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  443

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  444   DFWTPTFGGTPR  455



>ref|XP_006592891.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Glycine 
max]
 gb|KHN27996.1| Transcription factor bHLH123 [Glycine soja]
Length=456

 Score =   206 bits (523),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -3

Query  1139  ASFWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ + DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  274   ATFWNASEAANIKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  325

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  326   GN-EPAPKRTRNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  384

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+QV  LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  385   LHEQVTALSTPYMKSGAPIQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  444

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  445   DFWTPTFGGTPR  456



>emb|CDY61978.1| BnaCnng38940D [Brassica napus]
Length=365

 Score =   203 bits (516),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 135/191 (71%), Gaps = 16/191 (8%)
 Frame = -3

Query  1133  FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FW+ S  + LN+    +F+  T SQ +P+   DK       + N +   QS S+ K+A +
Sbjct  182   FWSSSSTTNLNNTPHNSFV--TTSQIIPTRLEDK-------TKNQKTKGQSESL-KRAKD  231

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E+IEYIKFLH
Sbjct  232   NDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQESIEYIKFLH  291

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETTSDF  609
             DQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFPVA ETT+DF
Sbjct  292   DQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENLELRAHGLCLVPISSTFPVANETTADF  351

Query  608   WTPTFGA-SFR  579
             WTPTFG  SFR
Sbjct  352   WTPTFGGNSFR  362



>ref|XP_010909854.1| PREDICTED: transcription factor bHLH112 isoform X2 [Elaeis guineensis]
Length=448

 Score =   205 bits (522),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 142/228 (62%), Gaps = 47/228 (21%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLS---KPSRKSSNVEEARQSSSMAKKA  963
             FWN S  + N+  ++ +  ST +Q  P  F  K +    P +  SN E A  SSS A K 
Sbjct  225   FWNPSATATNETTSSLY-SSTPTQIAPHAFKGKTNCNNLPVK--SNSEGAGVSSSNAIKK  281

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S+ E AFK+PRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF
Sbjct  282   SSTEQAFKKPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  341

Query  782   LHDQVN-----------------------------------VLSAPYLKNGCSVSQHHQ-  711
             LH+QV                                    VLSAPY KNG   SQH Q 
Sbjct  342   LHEQVGVSLSLNTLLSGKRILPDLSLYKRDLYSLILVISWQVLSAPYWKNGHQ-SQHSQN  400

Query  710   ----QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                 +D EG K +L+S+GLCLVP+SSTF VA+ET  DFWTPTFG ++R
Sbjct  401   LDKTKDGEGPKLDLKSRGLCLVPMSSTFAVASETPVDFWTPTFGGTYR  448



>ref|XP_009113121.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Brassica 
rapa]
Length=362

 Score =   202 bits (515),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 135/191 (71%), Gaps = 16/191 (8%)
 Frame = -3

Query  1133  FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FW+ S  + LN+    +F+  T SQ +P+   DK       + N +   QS S+ K+A +
Sbjct  182   FWSSSSTTNLNNTPHNSFV--TYSQIIPTRLEDK-------TKNQKTKGQSESL-KRAKD  231

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E+IEYIKFLH
Sbjct  232   NDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQESIEYIKFLH  291

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETTSDF  609
             DQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFPVA ETT+DF
Sbjct  292   DQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENQELRAHGLCLVPISSTFPVANETTADF  351

Query  608   WTPTFGA-SFR  579
             WTPTFG  SFR
Sbjct  352   WTPTFGGNSFR  362



>ref|XP_009369478.1| PREDICTED: transcription factor bHLH112 isoform X3 [Pyrus x bretschneideri]
Length=438

 Score =   204 bits (520),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 144/209 (69%), Gaps = 21/209 (10%)
 Frame = -3

Query  1148  NAAASFWNQ-SPASLND---VRAAT-FLPSTQSQFL-PSVF--------SDKLSKPSRKS  1011
             N +  FWN  +PA+LN    +R++     S+Q+Q+  PS+         S+  +  +  +
Sbjct  232   NISTPFWNAPAPAALNQDNTIRSSNDLFSSSQAQYTTPSLSPFHEKKPNSNNFTTKANTN  291

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
               V+++  S      +S  E  FKR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  292   GGVQDSSSSVVKKSSSSACEPVFKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGK  351

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-----EGRKAELRSQGL  666
             TDTASVLHEAIEYIKFLHDQ  VLS PY+KNG  + Q    D+     EG + +L+S GL
Sbjct  352   TDTASVLHEAIEYIKFLHDQ--VLSTPYMKNGAPMQQQQGTDKMEEASEGAQQDLQSLGL  409

Query  665   CLVPISSTFPVATETTSDFWTPTFGASFR  579
             CLVPISSTFPVA ETT+DFWTP+FGA+FR
Sbjct  410   CLVPISSTFPVANETTADFWTPSFGATFR  438



>ref|XP_009113122.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Brassica 
rapa]
Length=360

 Score =   202 bits (514),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 133/191 (70%), Gaps = 18/191 (9%)
 Frame = -3

Query  1133  FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FW+ S  + LN+    +F+  T SQ +P+   DK  K   +S ++          K+A +
Sbjct  182   FWSSSSTTNLNNTPHNSFV--TYSQIIPTRLEDKTKKTKGQSESL----------KRAKD  229

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E+IEYIKFLH
Sbjct  230   NDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQESIEYIKFLH  289

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETTSDF  609
             DQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFPVA ETT+DF
Sbjct  290   DQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENQELRAHGLCLVPISSTFPVANETTADF  349

Query  608   WTPTFGA-SFR  579
             WTPTFG  SFR
Sbjct  350   WTPTFGGNSFR  360



>ref|XP_010111014.1| hypothetical protein L484_004995 [Morus notabilis]
 gb|EXC29542.1| hypothetical protein L484_004995 [Morus notabilis]
Length=484

 Score =   206 bits (523),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = -3

Query  959  NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
            +Q+   KR RIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFL
Sbjct  351  HQQPVLKRARIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFL  410

Query  779  HDQVNVLSAPYLKNGCSVSQHHQQ------DEE-GRKAELRSQGLCLVPISSTFPVATET  621
            HDQV+VLS PY+KNG S  Q  QQ      D+E   K +L+S+GLCLVPISSTFPVA ET
Sbjct  411  HDQVSVLSTPYMKNGASNIQVQQQGSIKPKDQEISPKQDLKSRGLCLVPISSTFPVANET  470

Query  620  TSDFWTPTFGASFR  579
            T+DFWTPTFG +FR
Sbjct  471  TTDFWTPTFGGTFR  484


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 94/192 (49%), Gaps = 44/192 (23%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK-  1656
             MA++F   G+CGG  WW+ +RS+F  ASPCS    +D+  F W         H +V++K 
Sbjct  1     MAEEFQ-GGICGGN-WWSSSRSVFMAASPCSVGLSHDVAGFGWP-------SHDMVDIKL  51

Query  1655  GRSSDESCGSASDGSS-----VVLQELPKSHHQTHN-----------MSMDSTHLHMLGI  1524
              RSS     S  D +S        QE+ K  +Q+H+           + +DST   M+G 
Sbjct  52    ARSSPGDTNSVCDSTSNNNIHSGFQEVQKPQYQSHDNINSVSGSGSSVLIDST-AQMMGF  110

Query  1523  GLSPSSTATTDWNQA---------LVQTNERAMLQEDRNSRLNYGQEIGVECSDSSFKPV  1371
              LS     T+D NQ+             N  +MLQED  ++LNY QEIG+   DSS   +
Sbjct  111   SLS-----TSDLNQSNNNFLNSGRAESNNIYSMLQEDMGTKLNYRQEIGLL--DSSSTQI  163

Query  1370  AKDFSTSTPSAT  1335
              KDFS +  + T
Sbjct  164   PKDFSGNCSTVT  175



>ref|XP_006343407.1| PREDICTED: transcription factor bHLH112-like [Solanum tuberosum]
Length=196

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 117/153 (76%), Gaps = 6/153 (4%)
 Frame = -3

Query  1025  PSRKSSNVEEARQS--SSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQ  852
             PS   S++E   +S  SS+ K  +N E  FKR RIETPSPLPTFKVRKEK+GDR+TALQQ
Sbjct  46    PSLPKSDIEIIGESKLSSITKNNTN-EQTFKRQRIETPSPLPTFKVRKEKMGDRITALQQ  104

Query  851   LVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE--EGRKAELR  678
             LVSPFGKTDTASVL EAIEYI FLH QVNV S  Y+KNG   +QH Q  E  EG K  LR
Sbjct  105   LVSPFGKTDTASVLQEAIEYINFLHGQVNVFSNRYMKNGPP-TQHQQVKELQEGLKQGLR  163

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             S+GLCLVPISSTFP+A ETT +FWTPT G +FR
Sbjct  164   SKGLCLVPISSTFPLAAETTMEFWTPTLGRTFR  196



>ref|XP_006594799.1| PREDICTED: transcription factor bHLH123-like isoform X3 [Glycine 
max]
Length=459

 Score =   205 bits (521),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -3

Query  1139  ASFWNQSPASLN-DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ N DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  277   ATFWNDSEAANNKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  328

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R E+PSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  329   GN-EPAPKRTRNESPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  387

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+QV  LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  388   LHEQVTALSTPYMKSGAPMQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  447

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  448   DFWTPTFGGTSR  459


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 28/141 (20%)
 Frame = -3

Query  1790  GSWWNPARSM---FGASPCSAATINDMG-NFAWAnnddhhhhHQLVNMKGRSSDESCGSA  1623
             G+WW  ARS+    GAS  S++ I ++G NF W           + +MK RSS       
Sbjct  11    GNWWETARSVRYESGASQSSSSAITNIGNNFGW------QQGSDMADMKPRSS-------  57

Query  1622  SDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQALV------QTN  1464
              D SSVV  +   +  Q  + +  +  +LHM+G+GL   S+ T DWNQA +      + +
Sbjct  58    MDSSSVVFHDTQNNKLQQPDSATSTDPNLHMMGLGL---SSQTMDWNQASLLGEKGTENS  114

Query  1463  ERAMLQED-RNSRLNYGQEIG  1404
              R+MLQE+  +SR N+ QE G
Sbjct  115   FRSMLQENLSSSRTNFQQETG  135



>ref|XP_003541866.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Glycine 
max]
 ref|XP_006594798.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Glycine 
max]
 gb|KHN36754.1| Transcription factor bHLH123 [Glycine soja]
Length=460

 Score =   204 bits (520),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 134/192 (70%), Gaps = 14/192 (7%)
 Frame = -3

Query  1139  ASFWNQSPASLN-DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ N DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  278   ATFWNDSEAANNKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  329

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R E+PSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  330   GN-EPAPKRTRNESPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  388

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+QV  LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  389   LHEQVTALSTPYMKSGAPMQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  448

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  449   DFWTPTFGGTSR  460


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 73/142 (51%), Gaps = 29/142 (20%)
 Frame = -3

Query  1790  GSWWNPARSM---FGASPCSAATINDMG-NFAWAnnddhhhhHQLVNMKGRSSDESCGSA  1623
             G+WW  ARS+    GAS  S++ I ++G NF W           + +MK RSS       
Sbjct  11    GNWWETARSVRYESGASQSSSSAITNIGNNFGW------QQGSDMADMKPRSS-------  57

Query  1622  SDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQALVQTNE-----  1461
              D SSVV  +   +  Q  + +  +  +LHM+G+GL   S+ T DWNQA +   E     
Sbjct  58    MDSSSVVFHDTQNNKLQQPDSATSTDPNLHMMGLGL---SSQTMDWNQASLLRGEKGTEN  114

Query  1460  --RAMLQED-RNSRLNYGQEIG  1404
               R+MLQE+  +SR N+ QE G
Sbjct  115   SFRSMLQENLSSSRTNFQQETG  136



>ref|XP_004248340.1| PREDICTED: transcription factor bHLH123-like [Solanum lycopersicum]
Length=386

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 133/192 (69%), Gaps = 15/192 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSM-AKKASN  957
             FWN S AS+NDV ++ F PS       +   D+      K+ N+ + R  + + +KK + 
Sbjct  203   FWNASAASMNDVPSSLF-PSNLHNIPNNTTIDE------KAKNMGDVRDINRIISKKTTT  255

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E + KRPR ET +P P  KVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH
Sbjct  256   IETSNKRPRNETSTPSPIIKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLH  315

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATETTS  615
             DQ+  LSAPY+K+G S+ QH Q D       EGR  +LRS+GLCLVPISSTFPV  ET  
Sbjct  316   DQIGALSAPYMKSGASM-QHLQSDNKSEDIGEGRNKDLRSRGLCLVPISSTFPVTHETNV  374

Query  614   DFWTPTFGASFR  579
             D WTPTFG++FR
Sbjct  375   DLWTPTFGSTFR  386



>emb|CDY12908.1| BnaA09g13660D [Brassica napus]
Length=382

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 135/191 (71%), Gaps = 16/191 (8%)
 Frame = -3

Query  1133  FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FW+ S  + LN+    +F+  T SQ +P+   DK       + N +   QS S+ K+A +
Sbjct  199   FWSSSSTTNLNNTPHNSFV--TYSQIIPTRLEDK-------TKNQKTKGQSESL-KRAKD  248

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              ++A K+ RI TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL E+IEYIKFLH
Sbjct  249   NDSASKKQRISTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQESIEYIKFLH  308

Query  776   DQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETTSDF  609
             DQV VLS PY+K G SV Q HQ+  + +      ELR+ GLCLVPISSTFPVA ETT+DF
Sbjct  309   DQVTVLSTPYMKQGASVQQQHQKSGKSQDGNENQELRAHGLCLVPISSTFPVANETTADF  368

Query  608   WTPTFGA-SFR  579
             WTPTFG  SFR
Sbjct  369   WTPTFGGNSFR  379



>ref|NP_564782.1| transcription factor bHLH112 [Arabidopsis thaliana]
 sp|Q94JL3.1|BH112_ARATH RecName: Full=Transcription factor bHLH112; AltName: Full=Basic 
helix-loop-helix protein 112; Short=AtbHLH112; Short=bHLH 
112; AltName: Full=Transcription factor EN 64; AltName: Full=bHLH 
transcription factor bHLH112 [Arabidopsis thaliana]
 gb|AAK55730.1|AF380649_1 At1g61660/T13M11_21 [Arabidopsis thaliana]
 gb|AAM47380.1| At1g61660/T13M11_21 [Arabidopsis thaliana]
 gb|AEE33867.1| transcription factor bHLH112 [Arabidopsis thaliana]
Length=393

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 139/206 (67%), Gaps = 20/206 (10%)
 Frame = -3

Query  1166  LKPTFPNAAAS--FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEE  996
             L  +F N A S  FWN S  + LN+   + F+ +      P + S +L     K+ N++ 
Sbjct  198   LINSFSNNANSRPFWNSSSTTNLNNTTPSNFVTT------PQIISTRLED---KTKNLKT  248

Query  995   ARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
               QS S+ K+A + E+A K+PR+ TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTAS
Sbjct  249   RAQSESL-KRAKDNESAAKKPRVTTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTAS  307

Query  815   VLHEAIEYIKFLHDQVNVLSAPYLKNGCS------VSQHHQQDEEGRKAELRSQGLCLVP  654
             VL EAIEYIKFLHDQV VLS PY+K G S      +S   +  +E    ELR  GLCLVP
Sbjct  308   VLQEAIEYIKFLHDQVTVLSTPYMKQGASNQQQQQISGKSKSQDENENHELRGHGLCLVP  367

Query  653   ISSTFPVATETTSDFWTPTFGA-SFR  579
             ISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  368   ISSTFPVANETTADFWTPTFGGNNFR  393



>gb|AAM62823.1| unknown [Arabidopsis thaliana]
Length=393

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 139/206 (67%), Gaps = 20/206 (10%)
 Frame = -3

Query  1166  LKPTFPNAAAS--FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEE  996
             L  +F N A S  FWN S  + LN+   + F+ +      P + S +L     K+ N++ 
Sbjct  198   LINSFSNNANSRPFWNSSSTTNLNNTTPSNFVTT------PQIISTRLED---KTKNLKT  248

Query  995   ARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
               QS S+ K+A + E+A K+PR+ TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTAS
Sbjct  249   RAQSESL-KRAKDNESAAKKPRVTTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTAS  307

Query  815   VLHEAIEYIKFLHDQVNVLSAPYLKNGCS------VSQHHQQDEEGRKAELRSQGLCLVP  654
             VL EAIEYIKFLHDQV VLS PY+K G S      +S   +  +E    ELR  GLCLVP
Sbjct  308   VLQEAIEYIKFLHDQVTVLSTPYMKQGASNQQQQQISGKSKSQDENENHELRGHGLCLVP  367

Query  653   ISSTFPVATETTSDFWTPTFGA-SFR  579
             ISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  368   ISSTFPVANETTADFWTPTFGGNNFR  393



>ref|XP_010052472.1| PREDICTED: transcription factor bHLH112 isoform X3 [Eucalyptus 
grandis]
Length=391

 Score =   201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 165/445 (37%), Positives = 229/445 (51%), Gaps = 84/445 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARS--MFGASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             M++DF   G+    +WWNP R   +  +SPCS    N +   ++   D      +++ + 
Sbjct  1     MSEDF-EMGI-HSNNWWNPPRDYVLLSSSPCSTREPNGINGRSF--RDCSADMAEIIKV-  55

Query  1655  GRSSDESCGSASDGSSVVLQE-LPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             GRSS+E       G S+  Q+   +  HQ   M+ DST LHM+G  L    +A++DWN A
Sbjct  56    GRSSEE-VNDDDAGRSIAFQDDFVQRSHQIDCMT-DSTSLHMMGFDLF---SASSDWNLA  110

Query  1478  LVQ--------TNERAMLQEDR-NSRLNY--GQEIGVECSDSSFKPVAKDF--STSTPSA  1338
             + Q        T +  + +ED  +S+  Y   Q   V   DSS + +  D+  S   P+ 
Sbjct  111   VPQSSVIDESSTTDSKLQEEDMASSKFKYEKNQAKDVMIDDSSHQ-IQTDYWGSHCAPTC  169

Query  1337  TNFAP-----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSP  1173
                +      SY YPSN ++                            ++  P  +   P
Sbjct  170   HGMSTNGSFTSYAYPSNSIR----------------------------SSLEPEHHQLQP  201

Query  1172  PLLKPTFPNAAASFWNQSPAS-----LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSS  1008
                        + F NQ   S      + +  ++F+ ++ +QF+     +K  +PS   +
Sbjct  202   -----------SPFNNQQQFSGLHSNNSSLNESSFINASYAQFVHPALEEK--QPSCPKT  248

Query  1007  NVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT  828
             + E+A    SMAK     E A KRPR ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT
Sbjct  249   SCEDAGNLGSMAKNI-GVEPASKRPRFETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKT  307

Query  827   DTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ--HHQQDEEG-RKAELRSQGLCLV  657
             DTASVLHEA+EYIKFL DQ  VL +PY+ N   V      + D++G  K +LRS+GLCL+
Sbjct  308   DTASVLHEAVEYIKFLQDQ--VLCSPYMGNEAPVEALGKRKDDQQGLSKQDLRSRGLCLM  365

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISST+PVAT  T  FWTPT   +F
Sbjct  366   PISSTYPVATSATPHFWTPTLEGNF  390



>gb|EYU19181.1| hypothetical protein MIMGU_mgv1a026531mg [Erythranthe guttata]
Length=468

 Score =   202 bits (514),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 141/194 (73%), Gaps = 16/194 (8%)
 Frame = -3

Query  1139  ASFWN-QSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKK  966
             A FWN  SPAS +++   ++F P+     +P  F +K    S       EAR+SS+  KK
Sbjct  284   APFWNASSPASAMSEAARSSFFPAALQTQIPPSFDEKPKVTS-------EARESSTTTKK  336

Query  965   ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
              + + +  KRPR ETP+PLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL +AIEYIK
Sbjct  337   NNTETSN-KRPRNETPNPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSDAIEYIK  395

Query  785   FLHDQVNVLSAPYLKNGCSVSQHHQ-----QDEEGRKAELRSQGLCLVPISSTFPVATET  621
             FLH+Q++ LS PY+KN  S + HHQ     +D+EG + +LR++GLCLVP+SSTFPVA ET
Sbjct  396   FLHEQISALSDPYMKNPAS-THHHQKSEKSKDQEGPRQDLRNRGLCLVPVSSTFPVAHET  454

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG SFR
Sbjct  455   TVDFWTPTFGGSFR  468



>ref|XP_007149667.1| hypothetical protein PHAVU_005G089000g [Phaseolus vulgaris]
 gb|ESW21661.1| hypothetical protein PHAVU_005G089000g [Phaseolus vulgaris]
Length=458

 Score =   202 bits (513),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 131/192 (68%), Gaps = 14/192 (7%)
 Frame = -3

Query  1139  ASFWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A FWN S A+   D+RA+ F PS Q  F    F         +S N+ E R+  ++ KK+
Sbjct  276   APFWNASEAANFKDIRAS-FFPSLQPPFSTPNFE-------VQSKNISEVRERGTVGKKS  327

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R ETPSP+P FK+RKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  328   GN-EPAPKRTRNETPSPMPAFKMRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  386

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+QV  LS PY+K G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  387   LHEQVTALSTPYMKTGAPIQIQQNSGKCKETEGPKQDLRSRGLCLVPVSSTFPVTHETTV  446

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  447   DFWTPTFGGASR  458


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 88/198 (44%), Gaps = 51/198 (26%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSM---FGASPCSAATINDMGNFAWAnnddhhhhHQLVNM  1659
             MADD   A     G+WW+ AR++      S  S++ I ++GNF W           +  M
Sbjct  1     MADDQFQAS----GNWWDTARNVRYESRTSHSSSSAITNIGNFGW-------QASDMAEM  49

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             K RSS        D SSVV  +         + +    +LH++ +GL   S+   DWNQA
Sbjct  50    KPRSS-------MDSSSVVFHDSQNKLQPPDSTTSTDPNLHIMDLGL---SSQAMDWNQA  99

Query  1478  LVQTNE-------RAMLQED-RNSRLNYGQEIGVECS-------------DSS---FKPV  1371
              +   E       R+MLQE+  +SR N+ QE GVE S             DSS   FK V
Sbjct  100   SLLRGEKGTENSFRSMLQENLSSSRTNFQQETGVELSQQVQWRSEKMFSADSSSNEFKQV  159

Query  1370  AKDFSTSTPSATNFAPSY  1317
              + FS      + F+P Y
Sbjct  160   NRGFSL---DQSKFSPQY  174



>gb|EEC79477.1| hypothetical protein OsI_20507 [Oryza sativa Indica Group]
Length=161

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 7/131 (5%)
 Frame = -3

Query  950  AAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  771
            AA K+PRIE PSP+PTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ
Sbjct  31   AAAKKPRIEAPSPMPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  90

Query  770  VNVLSAPYLKNGCSVSQHHQQDE-------EGRKAELRSQGLCLVPISSTFPVATETTSD  612
            V  LS+PYL+ G  V   HQQ         EG++ +LRS+GLCLVP++ST+ VA+ET ++
Sbjct  91   VASLSSPYLRCGRPVQLQHQQGSHKVNGNCEGKQLDLRSRGLCLVPVASTYTVASETATE  150

Query  611  FWTPTFGASFR  579
            FW PTFG +FR
Sbjct  151  FWHPTFGGTFR  161



>gb|KCW76493.1| hypothetical protein EUGRSUZ_D00881 [Eucalyptus grandis]
Length=335

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 151/382 (40%), Positives = 201/382 (53%), Gaps = 79/382 (21%)
 Frame = -3

Query  1655  GRSSDESCGSASDGSSVVLQE-LPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             GRSS+E       G S+  Q+   +  HQ   M+ DST LHM+G  L    +A++DWN A
Sbjct  8     GRSSEE-VNDDDAGRSIAFQDDFVQRSHQIDCMT-DSTSLHMMGFDLF---SASSDWNLA  62

Query  1478  LVQ--------TNERAMLQEDR-NSRLNY--GQEIGVECSDSSFKPVAKDF--STSTPSA  1338
             + Q        T +  + +ED  +S+  Y   Q   V   DSS + +  D+  S   P+ 
Sbjct  63    VPQSSVIDESSTTDSKLQEEDMASSKFKYEKNQAKDVMIDDSSHQ-IQTDYWGSHCAPTC  121

Query  1337  TNFAP-----SYNYPSNllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSP  1173
                +      SY YPSN ++                            ++  P  +   P
Sbjct  122   HGMSTNGSFTSYAYPSNSIR----------------------------SSLEPEHHQLQP  153

Query  1172  PLLKPTFPNAAASFWNQSPASLNDVRAAT----FLPSTQSQFLPSVFSDKLSKPSRKSSN  1005
                        + F NQ  + L+   ++     F+ ++ +QF+     +K  +PS   ++
Sbjct  154   -----------SPFNNQQFSGLHSNNSSLNESSFINASYAQFVHPALEEK--QPSCPKTS  200

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
              E+A    SMAK     E A KRPR ETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD
Sbjct  201   CEDAGNLGSMAKNI-GVEPASKRPRFETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  259

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEG-RKAELRSQGLCLVPIS  648
             TASVLHEA+EYIKFL DQV+VL +PY+ N   V       E+G  K +LRS+GLCL+PIS
Sbjct  260   TASVLHEAVEYIKFLQDQVSVLCSPYMGNEAPV-------EQGLSKQDLRSRGLCLMPIS  312

Query  647   STFPVATETTSDFWTPTFGASF  582
             ST+PVAT  T  FWTPT   +F
Sbjct  313   STYPVATSATPHFWTPTLEGNF  334



>ref|XP_004970206.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Setaria 
italica]
Length=427

 Score =   200 bits (508),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 137/211 (65%), Gaps = 16/211 (8%)
 Frame = -3

Query  1169  LLKPTFPNAAASFWNQSPASLNDVRAATFLPSTQ----SQFLPSVFSDKLSKPSRKSSNV  1002
             LLKP+ P +A          L    +  +LP       SQ L      + +KPS +SSN 
Sbjct  219   LLKPSVPASAPMQGGGGAPMLQYCLSGGYLPFGGPLPPSQLLLQAL--QTTKPSSRSSNA  276

Query  1001  EE--ARQSSSMAKKASNQE--AAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
                  + +SS A + S  E  AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  277   NSLTVKDASSPATRKSVSESAAAVKRPRIEAPSPLPTFKVRKEKLGDRITALQQLVSPFG  336

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEG------RKAELRSQ  672
             KTDTASVLHEAIEYIKFLHDQV+ LS+PYLKN   + Q  Q+  E        K +LRS+
Sbjct  337   KTDTASVLHEAIEYIKFLHDQVSSLSSPYLKNVIPLQQFQQKGSEKAKDNGETKQDLRSR  396

Query  671   GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             GLCLVP++ST+ VA ET  +FW PTFG +FR
Sbjct  397   GLCLVPVASTYTVAAETVPEFWHPTFGGTFR  427



>ref|XP_003580620.1| PREDICTED: transcription factor bHLH112-like [Brachypodium distachyon]
Length=466

 Score =   201 bits (510),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 139/211 (66%), Gaps = 31/211 (15%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR-KSSNV------EEARQSS  981
             A+FWN +P++          P+     + +V   K S P+  +++N+      E    SS
Sbjct  263   AAFWNNNPSAAAGFGVMMAAPAADQASMRAV---KQSSPAPPRAANLALKTVLEGVGDSS  319

Query  980   SM--AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLH  807
             S+  ++K ++ E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLH
Sbjct  320   SITTSRKKASGEPAFKKPRMETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLH  379

Query  806   EAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ---------------DEEGRKAELRSQ  672
             E IEY+KFLHDQV VLSAPYLKNG   + HH Q                ++G +  L+ +
Sbjct  380   ETIEYVKFLHDQVGVLSAPYLKNG---NHHHHQVPQYLKSSSASPDKPSKDGSEVSLKGR  436

Query  671   GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             GLCLVPISSTF VA+E   DFWTP FGA FR
Sbjct  437   GLCLVPISSTFAVASEVPVDFWTP-FGAGFR  466



>ref|NP_001185284.1| transcription factor bHLH112 [Arabidopsis thaliana]
 gb|AEE33869.1| transcription factor bHLH112 [Arabidopsis thaliana]
Length=390

 Score =   198 bits (503),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 134/206 (65%), Gaps = 23/206 (11%)
 Frame = -3

Query  1166  LKPTFPNAAAS--FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEE  996
             L  +F N A S  FWN S  + LN+   + F+ +      P + S +L   ++       
Sbjct  198   LINSFSNNANSRPFWNSSSTTNLNNTTPSNFVTT------PQIISTRLEDKTK-------  244

Query  995   ARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
              R  S   K+A + E+A K+PR+ TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTAS
Sbjct  245   TRAQSESLKRAKDNESAAKKPRVTTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTAS  304

Query  815   VLHEAIEYIKFLHDQVNVLSAPYLKNGCS------VSQHHQQDEEGRKAELRSQGLCLVP  654
             VL EAIEYIKFLHDQV VLS PY+K G S      +S   +  +E    ELR  GLCLVP
Sbjct  305   VLQEAIEYIKFLHDQVTVLSTPYMKQGASNQQQQQISGKSKSQDENENHELRGHGLCLVP  364

Query  653   ISSTFPVATETTSDFWTPTFGA-SFR  579
             ISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  365   ISSTFPVANETTADFWTPTFGGNNFR  390



>ref|XP_009418757.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=373

 Score =   197 bits (502),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 136/193 (70%), Gaps = 13/193 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEA---RQSSSMAKKA  963
              WN   AS +D+R   F   T S+++      K+   S  ++ +E +   R S S + K 
Sbjct  186   LWN---ASASDMRPV-FRSPTPSKYVMQPSEPKIVCGSTLTAKMESSGGDRDSCSSSTKK  241

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             +  EAA K+PRIET SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  242   TGSEAATKKPRIETHSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLQEAIEYIKF  301

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDEEGR-----KAELRSQGLCLVPISSTFPVATETT  618
             LHDQV VLS+PY KNG  + +  Q  EE +     K +LRS+GLCLVP++ST+PVA+ETT
Sbjct  302   LHDQVGVLSSPYFKNGQPM-KPKQIPEESKDCDEPKQDLRSRGLCLVPVTSTYPVASETT  360

Query  617   SDFWTPTFGASFR  579
             +DFW PT G +FR
Sbjct  361   TDFWHPTLGGTFR  373



>gb|EEE55506.1| hypothetical protein OsJ_03706 [Oryza sativa Japonica Group]
Length=340

 Score =   196 bits (499),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 117/153 (76%), Gaps = 10/153 (7%)
 Frame = -3

Query  1010  SNVEEARQ--SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             SN   A+Q  SS   K  S+  AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  189   SNSGSAQQICSSEGRKSVSDSPAAAKRPRIEVPSPLPTFKVRKEKLGDRITALQQLVSPF  248

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELR  678
             GKTDTASVLHEAIEYIKFLH+QV  LS+PYLKNG  + QH QQ       D E  K +LR
Sbjct  249   GKTDTASVLHEAIEYIKFLHEQVASLSSPYLKNGNPL-QHFQQKGSESTKDAEQPKPDLR  307

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             S+GLCLVP++ST+ VA+ET  +FW PTFG +FR
Sbjct  308   SRGLCLVPVASTYTVASETVPEFWHPTFGGTFR  340



>ref|XP_006592892.1| PREDICTED: transcription factor bHLH123-like isoform X3 [Glycine 
max]
Length=454

 Score =   199 bits (506),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 133/192 (69%), Gaps = 16/192 (8%)
 Frame = -3

Query  1139  ASFWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ + DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  274   ATFWNASEAANIKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  325

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R ETPSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  326   GN-EPAPKRTRNETPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  384

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+Q   LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  385   LHEQ--ALSTPYMKSGAPIQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  442

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  443   DFWTPTFGGTPR  454



>ref|XP_010547083.1| PREDICTED: transcription factor bHLH112 isoform X3 [Tarenaya 
hassleriana]
Length=439

 Score =   198 bits (504),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 134/195 (69%), Gaps = 16/195 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQ  954
             FW  S  +L+++R  +F+ S Q   + + F DK   P    +N+   R S   A K ++ 
Sbjct  251   FWRSSNPNLDNIRTNSFVTSPQ---ISTRFGDK---PLSCHNNIAPKRSSCGQAAKKASD  304

Query  953   EAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHD  774
             E A K+PRI TPSPLPTFKVRKE L D++TALQQLVSPFGKTDTASVL EAIEY+KFLHD
Sbjct  305   EHAAKKPRITTPSPLPTFKVRKENLRDQITALQQLVSPFGKTDTASVLQEAIEYVKFLHD  364

Query  773   QVNVLSAPYLKNGCSVSQHHQ--------QDEEGRKA-ELRSQGLCLVPISSTFPVATET  621
             QV+VL  PYLK G S  Q  Q        +D +G    +L+S+GLCLVPISSTFPVA ET
Sbjct  365   QVSVLCTPYLKQGTSAQQQQQQQQFSDKLKDPQGNGTQDLKSRGLCLVPISSTFPVANET  424

Query  620   TSDFWTPTFGA-SFR  579
             T+DFWTPTFG  +FR
Sbjct  425   TADFWTPTFGGNNFR  439



>ref|XP_009420212.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=437

 Score =   198 bits (503),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 137/210 (65%), Gaps = 9/210 (4%)
 Frame = -3

Query  1196  PNLNDFSPPLLKPTFPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR  1017
             P   + SPP  +  F N    FWN S +S+N+  +  F  +   Q   +  S   SKP  
Sbjct  233   PQFMNASPPKQQLQFSNDTP-FWNPSASSVNEAHS-NFHHAKPPQPFHNENSSH-SKPVV  289

Query  1016  KSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             K+++   AR S    +K S+ E A K+PR ETPSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  290   KTAS--GARGSCPTLEKRSDSEPAAKKPRTETPSPLPTFKVRKEKLGDRITALQQLVSPF  347

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE----EGRKAELRSQG  669
             GKTDTASVLHE IEYIKFLHDQV VLSAPYLK      Q    D+    EGR   LRS+G
Sbjct  348   GKTDTASVLHETIEYIKFLHDQVRVLSAPYLKKDHQTQQTKASDKPKDCEGRNLNLRSRG  407

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCL+PISSTF VA E  +D WTPTF  +FR
Sbjct  408   LCLIPISSTFAVANEIPTDCWTPTFTGTFR  437


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 73/160 (46%), Gaps = 31/160 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP-------CSAATINDMGNFAWAnnddhhhhHQ  1671
             MAD F  AG C  G+WW+   S FG  P       CS    N  G+F WA          
Sbjct  1     MADQFQ-AGSCSSGTWWS---SGFGGGPTMSASASCSTELTNVAGSFNWA------TASD  50

Query  1670  LVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMS---MDSTHLHMLGIGLSPSSTA  1500
             +   K RS DES  S S+ SSV  Q++  S      ++   +DS    M   GL   S+ 
Sbjct  51    MFEPKSRSCDESPVSISN-SSVTFQDIQNSDVSAPVIAAPMLDSVSQAM-DFGL---SSP  105

Query  1499  TTDWNQALVQTNER------AMLQEDRNSRLNYGQEIGVE  1398
             T +W+Q+   ++ R      A+LQED  SR    ++ GVE
Sbjct  106   TVEWSQSFFSSSGRGQNSFHALLQEDVISRPYAQRDWGVE  145



>ref|NP_001044465.2| Os01g0784900 [Oryza sativa Japonica Group]
 dbj|BAD53363.1| bHLH transcription factor-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF06379.2| Os01g0784900 [Oryza sativa Japonica Group]
Length=392

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 117/153 (76%), Gaps = 10/153 (7%)
 Frame = -3

Query  1010  SNVEEARQ--SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             SN   A+Q  SS   K  S+  AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  241   SNSGSAQQICSSEGRKSVSDSPAAAKRPRIEVPSPLPTFKVRKEKLGDRITALQQLVSPF  300

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELR  678
             GKTDTASVLHEAIEYIKFLH+QV  LS+PYLKNG  + QH QQ       D E  K +LR
Sbjct  301   GKTDTASVLHEAIEYIKFLHEQVASLSSPYLKNGNPL-QHFQQKGSESTKDAEQPKPDLR  359

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             S+GLCLVP++ST+ VA+ET  +FW PTFG +FR
Sbjct  360   SRGLCLVPVASTYTVASETVPEFWHPTFGGTFR  392



>ref|XP_009418756.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=374

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 137/196 (70%), Gaps = 18/196 (9%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFL--PS----VFSDKLSKPSRKSSNVEEARQSSSMA  972
              WN   AS +D+R   F   T S+++  PS    V    L+    +SS  +  R S S +
Sbjct  186   LWN---ASASDMRPV-FRSPTPSKYVMQPSEPKIVCGSTLTAKQMESSGGD--RDSCSSS  239

Query  971   KKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  792
              K +  EAA K+PRIET SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVL EAIEY
Sbjct  240   TKKTGSEAATKKPRIETHSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLQEAIEY  299

Query  791   IKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR-----KAELRSQGLCLVPISSTFPVAT  627
             IKFLHDQV VLS+PY KNG  + +  Q  EE +     K +LRS+GLCLVP++ST+PVA+
Sbjct  300   IKFLHDQVGVLSSPYFKNGQPM-KPKQIPEESKDCDEPKQDLRSRGLCLVPVTSTYPVAS  358

Query  626   ETTSDFWTPTFGASFR  579
             ETT+DFW PT G +FR
Sbjct  359   ETTTDFWHPTLGGTFR  374



>ref|XP_006594800.1| PREDICTED: transcription factor bHLH123-like isoform X4 [Glycine 
max]
Length=458

 Score =   198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 133/192 (69%), Gaps = 16/192 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLN-DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A+FWN S A+ N DVR + F PS Q  F    F         +S N+ E R+S ++ KK+
Sbjct  278   ATFWNDSEAANNKDVRPS-FFPSLQPPFSTPNFE-------VQSKNISEVRESGTVVKKS  329

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
              N E A KR R E+PSPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  330   GN-EPAPKRTRNESPSPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  388

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQ----QDEEGRKAELRSQGLCLVPISSTFPVATETTS  615
             LH+Q   LS PY+K+G  +         ++ EG K +LRS+GLCLVP+SSTFPV  ETT 
Sbjct  389   LHEQ--ALSTPYMKSGAPMQIQQNSGKSKEAEGPKQDLRSRGLCLVPVSSTFPVTHETTV  446

Query  614   DFWTPTFGASFR  579
             DFWTPTFG + R
Sbjct  447   DFWTPTFGGTSR  458


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 73/142 (51%), Gaps = 29/142 (20%)
 Frame = -3

Query  1790  GSWWNPARSM---FGASPCSAATINDMG-NFAWAnnddhhhhHQLVNMKGRSSDESCGSA  1623
             G+WW  ARS+    GAS  S++ I ++G NF W           + +MK RSS       
Sbjct  11    GNWWETARSVRYESGASQSSSSAITNIGNNFGW------QQGSDMADMKPRSS-------  57

Query  1622  SDGSSVVLQELPKSHHQTHNMSMDST-HLHMLGIGLSPSSTATTDWNQALVQTNE-----  1461
              D SSVV  +   +  Q  + +  +  +LHM+G+GL   S+ T DWNQA +   E     
Sbjct  58    MDSSSVVFHDTQNNKLQQPDSATSTDPNLHMMGLGL---SSQTMDWNQASLLRGEKGTEN  114

Query  1460  --RAMLQED-RNSRLNYGQEIG  1404
               R+MLQE+  +SR N+ QE G
Sbjct  115   SFRSMLQENLSSSRTNFQQETG  136



>ref|XP_010547092.1| PREDICTED: transcription factor bHLH112 isoform X4 [Tarenaya 
hassleriana]
Length=415

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 14/196 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK-LSKPSRKSSNVEEARQSSSMAKKASN  957
             FW  S  +L+++R  +F+ S Q   + + F DK LS  +  +  +   R S   A K ++
Sbjct  223   FWRSSNPNLDNIRTNSFVTSPQ---ISTRFGDKPLSCHNNIAPKINLQRSSCGQAAKKAS  279

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E A K+PRI TPSPLPTFKVRKE L D++TALQQLVSPFGKTDTASVL EAIEY+KFLH
Sbjct  280   DEHAAKKPRITTPSPLPTFKVRKENLRDQITALQQLVSPFGKTDTASVLQEAIEYVKFLH  339

Query  776   DQVNVLSAPYLKNGCSVSQHHQ--------QDEEGRKA-ELRSQGLCLVPISSTFPVATE  624
             DQV+VL  PYLK G S  Q  Q        +D +G    +L+S+GLCLVPISSTFPVA E
Sbjct  340   DQVSVLCTPYLKQGTSAQQQQQQQQFSDKLKDPQGNGTQDLKSRGLCLVPISSTFPVANE  399

Query  623   TTSDFWTPTFGA-SFR  579
             TT+DFWTPTFG  +FR
Sbjct  400   TTADFWTPTFGGNNFR  415



>ref|XP_004976935.1| PREDICTED: transcription factor bHLH112-like [Setaria italica]
Length=437

 Score =   197 bits (501),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 132/199 (66%), Gaps = 19/199 (10%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S A      A     S +S   PS  + + +  + K+        SS ++KK +
Sbjct  246   APFWNSSAAGFGVPAAVPDQASVRSAVKPSP-APRAATLTLKTVLEGVGESSSIISKKKA  304

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLV+PFGKTDTASVLHE IEYIKFL
Sbjct  305   SGEPAFKKPRLETPSPLPTFKVRKEKLGDRITALQQLVAPFGKTDTASVLHETIEYIKFL  364

Query  779   HDQVNVLSAPYLKNGCSVSQHHQ------------QDEEGRKAELRSQGLCLVPISSTFP  636
             HDQV VLSAPYLKNG     HHQ            +D  G +  L+ +GLCLVPISSTF 
Sbjct  365   HDQVGVLSAPYLKNG----HHHQLPHLKSSSPEKSKDSHG-EISLKGRGLCLVPISSTFA  419

Query  635   VATETTSDFWTPTFGASFR  579
             VA+E   DFWTP FGA+FR
Sbjct  420   VASEVPVDFWTP-FGANFR  437



>gb|EEC71608.1| hypothetical protein OsI_04012 [Oryza sativa Indica Group]
Length=392

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 117/153 (76%), Gaps = 10/153 (7%)
 Frame = -3

Query  1010  SNVEEARQ--SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             SN   A+Q  SS   K  S+  AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  241   SNSGSAQQICSSEGRKSVSDLPAAAKRPRIEAPSPLPTFKVRKEKLGDRITALQQLVSPF  300

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ-------DEEGRKAELR  678
             GKTDTASVLHEAIEYIKFLH+QV  LS+PYLKNG  + QH QQ       D E  K +LR
Sbjct  301   GKTDTASVLHEAIEYIKFLHEQVASLSSPYLKNGNPL-QHFQQKGSESTKDAEQPKPDLR  359

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             S+GLCLVP++ST+ VA+ET  +FW PTFG +FR
Sbjct  360   SRGLCLVPVASTYTVASETVPEFWHPTFGGTFR  392



>ref|XP_006300501.1| hypothetical protein CARUB_v10020420mg [Capsella rubella]
 gb|EOA33399.1| hypothetical protein CARUB_v10020420mg [Capsella rubella]
Length=395

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 123/169 (73%), Gaps = 14/169 (8%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S +L     K+ N++   QS S+ K+A + E+A K+PR+ TPSPLPTFKVRKE L 
Sbjct  231   PQIISTRLED---KTKNLKTRAQSESL-KRAKDNESAAKKPRVTTPSPLPTFKVRKENLR  286

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCS---------VS  723
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G S         +S
Sbjct  287   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASSQQQQQQQQIS  346

Query  722   QHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
                + ++E    ELR+ GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  347   GKSKNEDENENHELRAHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  395



>ref|XP_010694303.1| PREDICTED: transcription factor bHLH123 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   197 bits (502),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 134/194 (69%), Gaps = 15/194 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A +W+ S   LNDVR  TF  S Q+  LP++ + +      K     E R +SSM KK S
Sbjct  309   APYWSTS-TPLNDVRP-TFFSSLQAGQLPNMPTFE-----EKPKTTMEVRDTSSMLKK-S  360

Query  959   NQEAAFKRPRIE-TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
               E   KR R +   S LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  361   GSENNIKRARNDGASSTLPPFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  420

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATET  621
             LH+QV+VLS PYLK+G S  QH Q +E      +G K +LRS+GLCLVP+SSTFPV  ET
Sbjct  421   LHEQVSVLSNPYLKSGGSYQQHQQSNEKAKIDPDGPKQDLRSRGLCLVPVSSTFPVTHET  480

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  481   TVDFWTPTFGGTFR  494



>ref|XP_010547064.1| PREDICTED: transcription factor bHLH112 isoform X1 [Tarenaya 
hassleriana]
Length=443

 Score =   196 bits (498),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 135/196 (69%), Gaps = 14/196 (7%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK-LSKPSRKSSNVEEARQSSSMAKKASN  957
             FW  S  +L+++R  +F+ S Q   + + F DK LS  +  +  +   R S   A K ++
Sbjct  251   FWRSSNPNLDNIRTNSFVTSPQ---ISTRFGDKPLSCHNNIAPKINLQRSSCGQAAKKAS  307

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E A K+PRI TPSPLPTFKVRKE L D++TALQQLVSPFGKTDTASVL EAIEY+KFLH
Sbjct  308   DEHAAKKPRITTPSPLPTFKVRKENLRDQITALQQLVSPFGKTDTASVLQEAIEYVKFLH  367

Query  776   DQVNVLSAPYLKNGCSVSQHHQ--------QDEEGRKA-ELRSQGLCLVPISSTFPVATE  624
             DQV+VL  PYLK G S  Q  Q        +D +G    +L+S+GLCLVPISSTFPVA E
Sbjct  368   DQVSVLCTPYLKQGTSAQQQQQQQQFSDKLKDPQGNGTQDLKSRGLCLVPISSTFPVANE  427

Query  623   TTSDFWTPTFGA-SFR  579
             TT+DFWTPTFG  +FR
Sbjct  428   TTADFWTPTFGGNNFR  443



>gb|EMT01196.1| Transcription factor bHLH112 [Aegilops tauschii]
Length=435

 Score =   196 bits (498),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 135/210 (64%), Gaps = 35/210 (17%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNV------EEARQSSS  978
             A+FWNQS A      AA   P+T +    SV + K   P+ + +N+      E    SSS
Sbjct  238   AAFWNQS-AGFGMGMAAP--PATDNT---SVRAVKQPSPAPRGANLALKTVLEGVGDSSS  291

Query  977   MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI  798
             +  K ++ E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHE I
Sbjct  292   IVAKKASGEPAFKKPRMETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHETI  351

Query  797   EYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----------------EEGRKAELRSQG  669
             EYIKFLHDQV VLSAPYLK+G     HHQ                   ++G +  L+ +G
Sbjct  352   EYIKFLHDQVGVLSAPYLKSG-----HHQHQVPQYLKSSSNGSPDKSCKDGGEVSLKGRG  406

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTF VA++   DFW P FG  FR
Sbjct  407   LCLVPISSTFAVASDVPVDFWNP-FGPQFR  435



>ref|XP_010694302.1| PREDICTED: transcription factor bHLH123 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=495

 Score =   197 bits (502),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 134/194 (69%), Gaps = 15/194 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A +W+ S   LNDVR  TF  S Q+  LP++ + +      K     E R +SSM KK S
Sbjct  310   APYWSTS-TPLNDVRP-TFFSSLQAGQLPNMPTFE-----EKPKTTMEVRDTSSMLKK-S  361

Query  959   NQEAAFKRPRIE-TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
               E   KR R +   S LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  362   GSENNIKRARNDGASSTLPPFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  421

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATET  621
             LH+QV+VLS PYLK+G S  QH Q +E      +G K +LRS+GLCLVP+SSTFPV  ET
Sbjct  422   LHEQVSVLSNPYLKSGGSYQQHQQSNEKAKIDPDGPKQDLRSRGLCLVPVSSTFPVTHET  481

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  482   TVDFWTPTFGGTFR  495



>ref|NP_001055968.1| Os05g0501200 [Oryza sativa Japonica Group]
 gb|AAU90227.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF17882.1| Os05g0501200 [Oryza sativa Japonica Group]
 gb|EEE64263.1| hypothetical protein OsJ_19096 [Oryza sativa Japonica Group]
Length=323

 Score =   192 bits (489),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 117/159 (74%), Gaps = 7/159 (4%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             +S   R   + ++A   S   + +    AA K+PRIE PSP+PTFKVRKEKLGDR+TALQ
Sbjct  165   VSNTDRLHDHHQDAGSPSPATRSSPGSPAAAKKPRIEAPSPMPTFKVRKEKLGDRITALQ  224

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE-------EG  696
             QLVSPFGKTDTASVLHEAIEYIKFLHDQV  LS+PYL+ G  V   HQQ         EG
Sbjct  225   QLVSPFGKTDTASVLHEAIEYIKFLHDQVASLSSPYLRCGRPVQLQHQQGSHKVNGNCEG  284

Query  695   RKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             ++ +LRS+GLCLVP++ST+ VA+ET ++FW PTFG +FR
Sbjct  285   KQLDLRSRGLCLVPVASTYTVASETATEFWHPTFGGTFR  323



>ref|XP_006644815.1| PREDICTED: transcription factor bHLH123-like [Oryza brachyantha]
Length=399

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 123/166 (74%), Gaps = 8/166 (5%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             PS  S+  +  ++ +S   +   SS+  K  S+  AA KRPRIE PSPLPTFKVRKEKLG
Sbjct  235   PSCSSNANTLMAKSNSGSAQHACSSAGRKSVSDSAAAAKRPRIEAPSPLPTFKVRKEKLG  294

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ----  708
             DR+TALQQLVSPFGKTDTASVLHEAIEYIKFLH+QV  LS+PYLKNG  + QH QQ    
Sbjct  295   DRITALQQLVSPFGKTDTASVLHEAIEYIKFLHEQVASLSSPYLKNGNPL-QHFQQKGSE  353

Query  707   --DEEGR-KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                E G  K +LRS+GLCLVP++ST+ VA+ET  +FW PTFG +FR
Sbjct  354   SSKETGEAKPDLRSRGLCLVPVASTYTVASETVPEFWHPTFGGTFR  399



>ref|XP_004487635.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Cicer 
arietinum]
Length=467

 Score =   196 bits (497),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 130/193 (67%), Gaps = 22/193 (11%)
 Frame = -3

Query  1133  FWNQSPA--SLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             FWN S A  S+ DVR++ F PS Q QF    F  +       + N+ E         K S
Sbjct  289   FWNASEAANSIKDVRSS-FFPSLQPQFSTPNFDSQ-------AKNISEVG-----VVKKS  335

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               E A KR R ETPS LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  336   GSEPAPKRTRNETPSTLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  395

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQD------EEGRKAELRSQGLCLVPISSTFPVATETT  618
             H+QV VLS PY+K+G   +Q+ QQ+       EG K +LRS+GLCLVP+SSTFPV  ETT
Sbjct  396   HEQVTVLSTPYMKSGAP-TQNIQQNSGKSKKSEGAKQDLRSRGLCLVPVSSTFPVTHETT  454

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG + R
Sbjct  455   VDFWTPTFGGTSR  467



>ref|XP_004487634.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Cicer 
arietinum]
Length=468

 Score =   196 bits (497),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 130/193 (67%), Gaps = 22/193 (11%)
 Frame = -3

Query  1133  FWNQSPA--SLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             FWN S A  S+ DVR++ F PS Q QF    F  +       + N+ E         K S
Sbjct  290   FWNASEAANSIKDVRSS-FFPSLQPQFSTPNFDSQ-------AKNISEVG-----VVKKS  336

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               E A KR R ETPS LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  337   GSEPAPKRTRNETPSTLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  396

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQD------EEGRKAELRSQGLCLVPISSTFPVATETT  618
             H+QV VLS PY+K+G   +Q+ QQ+       EG K +LRS+GLCLVP+SSTFPV  ETT
Sbjct  397   HEQVTVLSTPYMKSGAP-TQNIQQNSGKSKKSEGAKQDLRSRGLCLVPVSSTFPVTHETT  455

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG + R
Sbjct  456   VDFWTPTFGGTSR  468



>ref|XP_004970205.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Setaria 
italica]
Length=438

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 134/222 (60%), Gaps = 27/222 (12%)
 Frame = -3

Query  1169  LLKPTFPNAAASFWNQSPASLNDVRAATFLPSTQ----SQFLPSVFSDKLSKPSRKSSNV  1002
             LLKP+ P +A          L    +  +LP       SQ L      + +KPS +SSN 
Sbjct  219   LLKPSVPASAPMQGGGGAPMLQYCLSGGYLPFGGPLPPSQLLLQAL--QTTKPSSRSSNA  276

Query  1001  E---------------EARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRV  867
                             +   S +  K  S   AA KRPRIE PSPLPTFKVRKEKLGDR+
Sbjct  277   NSLTVKFLLDFNSGSCQDASSPATRKSVSESAAAVKRPRIEAPSPLPTFKVRKEKLGDRI  336

Query  866   TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEG---  696
             TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV+ LS+PYLKN   + Q  Q+  E    
Sbjct  337   TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVSSLSSPYLKNVIPLQQFQQKGSEKAKD  396

Query  695   ---RKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                 K +LRS+GLCLVP++ST+ VA ET  +FW PTFG +FR
Sbjct  397   NGETKQDLRSRGLCLVPVASTYTVAAETVPEFWHPTFGGTFR  438



>ref|XP_006475253.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Citrus 
sinensis]
Length=441

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 128/190 (67%), Gaps = 21/190 (11%)
 Frame = -3

Query  1139  ASFWNQS-PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMA-KK  966
             A FWN S P SLNDVR+  F PS Q+ +    F +K   P    S V +   SSS+A KK
Sbjct  270   APFWNASAPTSLNDVRSPNFFPSLQTPYATQTFDEK---PKHHVSEVRD--NSSSIAVKK  324

Query  965   ASNQEAAFKRPRIETP-SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             +S  E A KR + + P SPLP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYI
Sbjct  325   SSGGEPASKRAKNDQPASPLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYI  384

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDF  609
             KFLHDQV              +    +D EG K +LRS+GLCLVP+SSTFPV  ETT DF
Sbjct  385   KFLHDQV-------------ANSEKVKDSEGPKQDLRSRGLCLVPVSSTFPVTHETTVDF  431

Query  608   WTPTFGASFR  579
             WTPTFG +FR
Sbjct  432   WTPTFGGTFR  441



>ref|XP_010430180.1| PREDICTED: transcription factor bHLH112 isoform X1 [Camelina 
sativa]
 ref|XP_010430181.1| PREDICTED: transcription factor bHLH112 isoform X2 [Camelina 
sativa]
Length=393

 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 121/168 (72%), Gaps = 13/168 (8%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S ++     K+ N++   QS S+ KKA + E+A K+PR+ TPSPLPTFKVRKE L 
Sbjct  230   PQIISTRIDD---KTKNLKTRAQSESL-KKAKDNESAAKKPRVTTPSPLPTFKVRKENLR  285

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCS--------VSQ  720
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G S        +S 
Sbjct  286   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASTQQQQQQQISG  345

Query  719   HHQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
               +  +     ELR+ GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  346   KSKNQDNNENHELRAHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  393



>ref|XP_010665766.1| PREDICTED: transcription factor bHLH112 [Beta vulgaris subsp. 
vulgaris]
Length=467

 Score =   195 bits (496),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 130/180 (72%), Gaps = 12/180 (7%)
 Frame = -3

Query  1121  SPASLNDVRAATFLPSTQSQFLPSVFSDK----LSKPSRKSSNVEEARQSSSMAKKASNQ  954
             SP +LN++RA+  L S QS+     F+ K     S P++   N EE R+ S      ++Q
Sbjct  280   SPTTLNNIRAS-LLNSLQSRSRGPSFNQKSHSSTSLPNK--VNNEEPRRESKNNTSNNDQ  336

Query  953   EAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHD  774
               A KRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHD
Sbjct  337   PQA-KRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHD  395

Query  773   QVNVLSAPYLKNGCSVSQHH----QQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFW  606
             QV+VLS PYLK G  + Q      + ++E  K ELRS+GLCLVPISST+PVA ET  DFW
Sbjct  396   QVHVLSTPYLKGGNPMQQQDCDKLKDNQEECKQELRSRGLCLVPISSTYPVAQETPVDFW  455


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 75/155 (48%), Gaps = 38/155 (25%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGA---SPCSAATIN---DMGNFAWAnnddhhhhHQL  1668
             M ++F   GVCG  +WWNP  S+F     SPCS A +    DMG+F W N          
Sbjct  1     MGEEFQ-GGVCG--TWWNPPHSLFSGGVSSPCSVAQLGGGFDMGSFGWPNEVIK------  51

Query  1667  VNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDW  1488
                         GS  + ++      P   +      MDS+ L +LG GLSP+S +TTDW
Sbjct  52    ------------GSKFNNNNNNNNNNPTFDNLIFPDQMDSS-LDILGFGLSPTS-STTDW  97

Query  1487  N-QALV------QTNERAMLQED-RNSRL-NYGQE  1410
             N Q L+      + N  ++LQ++  N+RL +YG E
Sbjct  98    NHQNLLCNTGNNEGNFDSILQDNMNNTRLSSYGME  132



>gb|KFK40679.1| hypothetical protein AALP_AA2G027200 [Arabis alpina]
Length=395

 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 132/196 (67%), Gaps = 22/196 (11%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFL--PSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             FW+ SP++         + ST + F+  P + S +L     K+ N++   QS S+ K+A 
Sbjct  211   FWSSSPST-------NLINSTHNSFVTTPQISSTRLED---KNKNLKTRAQSESL-KRAK  259

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
             + E+A K+ R+ TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  260   DNESAAKKQRVATPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTASVLQEAIEYIKFL  319

Query  779   HDQVNVLSAPYLKNGCS--------VSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATE  624
             HDQV VLS PY+K G S        +S   +  +     ELR  GLCLVP+SSTFPVA E
Sbjct  320   HDQVTVLSTPYMKQGVSTQQQQQQQISGKSKNQDVNENHELRGHGLCLVPLSSTFPVANE  379

Query  623   TTSDFWTPTFGA-SFR  579
             TT+DFWTPTFG  +FR
Sbjct  380   TTADFWTPTFGGNNFR  395



>ref|XP_002886524.1| hypothetical protein ARALYDRAFT_475161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62783.1| hypothetical protein ARALYDRAFT_475161 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 119/167 (71%), Gaps = 12/167 (7%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S +L     K+ N++   QS S+ K+  + E+A K+PR+ TPSPLPTFKVRKE L 
Sbjct  235   PQIISTRLED---KTKNLKTRAQSESL-KRTKDSESAAKKPRVTTPSPLPTFKVRKENLR  290

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCS-------VSQH  717
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G S       +S  
Sbjct  291   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASSQQQQQQISGK  350

Query  716   HQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              +  +     ELR  GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  351   SKNQDGNENHELRGHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  397



>ref|NP_001144636.1| uncharacterized protein LOC100277655 [Zea mays]
 gb|ACG41919.1| hypothetical protein [Zea mays]
Length=390

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 118/167 (71%), Gaps = 15/167 (9%)
 Frame = -3

Query  1037  KLSKPSRKSSNVEE--ARQSSS-----MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKL  879
             + +KP+ +SSN     A+   S       K  S   AA KRPRIE PSPLPTFKVRKEKL
Sbjct  224   QAAKPNSRSSNANSPSAKDDCSPPPAATRKSVSEPPAAAKRPRIEAPSPLPTFKVRKEKL  283

Query  878   GDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEE  699
             GDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  LS+PYLKNG  + Q   +  E
Sbjct  284   GDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVASLSSPYLKNGIPMKQFQHKGSE  343

Query  698   GRK-------AELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
               K       A+LRS+GLCLVP++ST+ VA E T +FW PTFG +FR
Sbjct  344   DSKDNGDTKQADLRSRGLCLVPVASTYTVAAE-TPEFWHPTFGGTFR  389



>tpg|DAA57329.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=385

 Score =   189 bits (481),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 120/166 (72%), Gaps = 14/166 (8%)
 Frame = -3

Query  1037  KLSKPSRKSSNVEE--ARQSSS-----MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKL  879
             + +KP+ +SSN     A+   S       K  S   AA KRPRIE PSPLPTFKVRKEKL
Sbjct  220   QAAKPNSRSSNANSPTAKDDCSPPPAATRKSVSEPPAAAKRPRIEAPSPLPTFKVRKEKL  279

Query  878   GDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ-HHQQDE  702
             GDR+TALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  LS+PYLKNG  + Q  H+  E
Sbjct  280   GDRITALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVASLSSPYLKNGIPMKQFQHKGSE  339

Query  701   EGR-----KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             + +     K +LRS+GLCLVP++ST+ VA E T +FW PTFG +FR
Sbjct  340   DSKDNGDTKQDLRSRGLCLVPVASTYTVAAE-TPEFWHPTFGGTFR  384



>ref|XP_004234582.1| PREDICTED: transcription factor bHLH112-like [Solanum lycopersicum]
Length=338

 Score =   188 bits (477),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -3

Query  1025  PSRKSSNVEEARQS--SSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQ  852
             PS    ++EE  +S  SS+ K  +N++   KR RIETPS LPTFKVRKEKLGDR+TALQQ
Sbjct  187   PSLPKFDIEEIGESKLSSITKNNTNEQTN-KRQRIETPSSLPTFKVRKEKLGDRITALQQ  245

Query  851   LVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE--EGRKAELR  678
             LVSPFGKTDTASVL EAIEYI FLHDQVNV S  Y+KNG   +QH Q  E  EG K  LR
Sbjct  246   LVSPFGKTDTASVLQEAIEYINFLHDQVNVFSNRYMKNGPP-TQHQQVKELQEGLKQGLR  304

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTF-GASFR  579
             S+GLCLVPISSTFP+A ETT +FWTPT  G + R
Sbjct  305   SKGLCLVPISSTFPLAAETTMEFWTPTLMGTTVR  338


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 69/140 (49%), Gaps = 30/140 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATINDM---GNFAWAnnddhhhhHQLVNM  1659
             MAD++   GV G   W N  +++F  S  + + ++ +    NFAW N+D      Q ++M
Sbjct  1     MADEYFQDGVYGESLWINSTKNIFSLSSSTNSILDPIIGRYNFAWPNDD------QFLDM  54

Query  1658  KGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQA  1479
             K  S++     +S   S+V QE PK+H+              LGI     ++++ DWN +
Sbjct  55    KNMSNNNDDYYSSSDDSIVFQEFPKNHN--------------LGIN---ENSSSPDWNHS  97

Query  1478  LVQTNERAMLQEDRNSRLNY  1419
             +      +MLQE  NSR NY
Sbjct  98    I----NDSMLQEKLNSRENY  113



>ref|XP_009402586.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=358

 Score =   188 bits (478),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 112/144 (78%), Gaps = 5/144 (3%)
 Frame = -3

Query  1019  RKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSP  840
             R  SN   AR S S  +K S  E A K+PRIETPSPLPTFKVRKEKLGDR+TALQQLVSP
Sbjct  213   RAKSN-SRARDSMSTWEKISTTEPALKKPRIETPSPLPTFKVRKEKLGDRITALQQLVSP  271

Query  839   FGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE----EGRKAELRSQ  672
             FGKTDTASVLHEAI+YIKFLHDQV VLS+P++K+G  + Q    D+    +G + +LRS+
Sbjct  272   FGKTDTASVLHEAIDYIKFLHDQVRVLSSPHMKSGHQIQQVKSLDKPKHRQGPEEDLRSR  331

Query  671   GLCLVPISSTFPVATETTSDFWTP  600
             GLC+VP+S+TF VA ET  DFWTP
Sbjct  332   GLCVVPVSATFAVARETAMDFWTP  355



>ref|XP_010473379.1| PREDICTED: transcription factor bHLH112-like [Camelina sativa]
Length=391

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 119/167 (71%), Gaps = 12/167 (7%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S ++     K+ N++   QS S+ KKA + E+  K+PR+ TPS LPTFKVRKE L 
Sbjct  229   PQIISTRVDD---KTKNLKTRAQSESL-KKAKDNESEAKKPRVTTPSALPTFKVRKENLR  284

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCS-------VSQH  717
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G S       +S  
Sbjct  285   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASSQQQQQQISGK  344

Query  716   HQQDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              +  +     ELR+ GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  345   SKNQDNNENHELRAHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  391



>ref|XP_010418134.1| PREDICTED: transcription factor bHLH112 [Camelina sativa]
Length=400

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 132/202 (65%), Gaps = 27/202 (13%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQ  954
             FW+ S  ++++     F+ +      P + S ++     K+ N++   QS S+ KKA + 
Sbjct  209   FWSSSTTNVSNTTPTNFVAT------PQIISARVDD---KTKNLKTRAQSESL-KKAKDN  258

Query  953   EAAFKRPRIETPSPLPTFKV------RKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  792
             E+A K+PR+ TPSPLPTFKV      RKE L D++T+LQQLVSPFGKTDTASVL EAIEY
Sbjct  259   ESAAKKPRVTTPSPLPTFKVHDHISRRKENLRDQITSLQQLVSPFGKTDTASVLQEAIEY  318

Query  791   IKFLHDQVNVLSAPYLKNGCS----------VSQHHQQDEEGRKAELRSQGLCLVPISST  642
             IKFLHDQV VLS PY+K G S          +S   +  +     ELR+ GLCLVPISST
Sbjct  319   IKFLHDQVTVLSTPYMKQGASSQQQQQQQQQISGKSKNQDNNENHELRAHGLCLVPISST  378

Query  641   FPVATETTSDFWTPTFGA-SFR  579
             FPVA ETT+DFWTPTFG  +FR
Sbjct  379   FPVANETTADFWTPTFGGNNFR  400


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 68/145 (47%), Gaps = 41/145 (28%)
 Frame = -3

Query  1829  MADDFM-TAGVCGGG--SWWNPARSMFG-----ASPCSAATI--NDMGNFAWAnnddhhh  1680
             MA++F  TA +CGGG  +WWN  RS+        SPC  A I  +D G+           
Sbjct  1     MAEEFQATAAICGGGGSAWWNSPRSVMSPSDHFLSPCFGAAITSDDFGS-----------  49

Query  1679  hHQLVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTA  1500
                  N+K R +       +D + V  Q    S      +++DST L M+G+G S  S +
Sbjct  50    ---QENIKSRMT------CTDNNIVFGQREADSDSGGSTVTIDST-LQMMGLGFS--SNS  97

Query  1499  TTDWNQALVQTNERAMLQEDRNSRL  1425
             +TDWNQ +        LQED NS+ 
Sbjct  98    STDWNQTI--------LQEDLNSKF  114



>ref|XP_006655458.1| PREDICTED: transcription factor bHLH123-like [Oryza brachyantha]
Length=367

 Score =   187 bits (476),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 105/135 (78%), Gaps = 6/135 (4%)
 Frame = -3

Query  965  ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
            A   E   K+ RIE PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYIK
Sbjct  233  APAHEPTVKKARIEAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIK  292

Query  785  FLHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATE  624
            FLHDQV  LS+PYL+ G  + Q HQQ      D    K +LRS+GLCLVP++ST+ VA+E
Sbjct  293  FLHDQVASLSSPYLRCGRPMQQQHQQGSHKSKDNGEAKQDLRSRGLCLVPVASTYTVASE  352

Query  623  TTSDFWTPTFGASFR  579
            T ++FW PTFG +FR
Sbjct  353  TATEFWHPTFGGTFR  367



>ref|XP_009384213.1| PREDICTED: transcription factor bHLH103-like [Musa acuminata 
subsp. malaccensis]
Length=351

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = -3

Query  992  RQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASV  813
            R SSS  +K +  E A K+ R ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASV
Sbjct  210  RSSSSTMEKRNGSEPALKKARTETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASV  269

Query  812  LHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAE----LRSQGLCLVPISS  645
            L EAIEYIKFLHDQV VLSAPYLKNG  + Q    D      E    LRS+GLCLVP+SS
Sbjct  270  LQEAIEYIKFLHDQVRVLSAPYLKNGHQMQQVKSLDSSKDSGEQNQDLRSRGLCLVPMSS  329

Query  644  TFPVATETTSDFWTPTFGASFR  579
            TF VA E  +D WTP F  +FR
Sbjct  330  TFAVANEIPADLWTPPFIGTFR  351



>ref|XP_010694304.1| PREDICTED: transcription factor bHLH123 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   191 bits (484),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 130/194 (67%), Gaps = 17/194 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A +W+ S   LNDVR  TF  S Q+  LP+     +     K     E R +SSM KK S
Sbjct  310   APYWSTS-TPLNDVRP-TFFSSLQAGQLPN-----MPTFEEKPKTTMEVRDTSSMLKK-S  361

Query  959   NQEAAFKRPRIE-TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
               E   KR R +   S LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKF
Sbjct  362   GSENNIKRARNDGASSTLPPFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKF  421

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPVATET  621
             LH+Q  VLS PYLK+G S  QH Q +E      +G K +LRS+GLCLVP+SSTFPV  ET
Sbjct  422   LHEQ--VLSNPYLKSGGSYQQHQQSNEKAKIDPDGPKQDLRSRGLCLVPVSSTFPVTHET  479

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  480   TVDFWTPTFGGTFR  493



>ref|XP_010547074.1| PREDICTED: transcription factor bHLH112 isoform X2 [Tarenaya 
hassleriana]
Length=441

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 133/196 (68%), Gaps = 16/196 (8%)
 Frame = -3

Query  1133  FWNQSPASLNDVRAATFLPSTQSQFLPSVFSDK-LSKPSRKSSNVEEARQSSSMAKKASN  957
             FW  S  +L+++R  +F+ S Q   + + F DK LS  +  +  +   R S   A K ++
Sbjct  251   FWRSSNPNLDNIRTNSFVTSPQ---ISTRFGDKPLSCHNNIAPKINLQRSSCGQAAKKAS  307

Query  956   QEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLH  777
              E A K+PRI TPSPLPTFKVRKE L D++TALQQLVSPFGKTDTASVL EAIEY+KFLH
Sbjct  308   DEHAAKKPRITTPSPLPTFKVRKENLRDQITALQQLVSPFGKTDTASVLQEAIEYVKFLH  367

Query  776   DQVNVLSAPYLKNGCSVSQHHQ--------QDEEGRKA-ELRSQGLCLVPISSTFPVATE  624
             DQ  VL  PYLK G S  Q  Q        +D +G    +L+S+GLCLVPISSTFPVA E
Sbjct  368   DQ--VLCTPYLKQGTSAQQQQQQQQFSDKLKDPQGNGTQDLKSRGLCLVPISSTFPVANE  425

Query  623   TTSDFWTPTFGA-SFR  579
             TT+DFWTPTFG  +FR
Sbjct  426   TTADFWTPTFGGNNFR  441



>ref|XP_009402587.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=356

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = -3

Query  1019  RKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSP  840
             R  SN   AR S S  +K S  E A K+PRIETPSPLPTFKVRKEKLGDR+TALQQLVSP
Sbjct  213   RAKSN-SRARDSMSTWEKISTTEPALKKPRIETPSPLPTFKVRKEKLGDRITALQQLVSP  271

Query  839   FGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ--HHQQDEEGRKAELRSQGL  666
             FGKTDTASVLHEAI+YIKFLHDQV VLS+P++K+G  + Q     +  +G + +LRS+GL
Sbjct  272   FGKTDTASVLHEAIDYIKFLHDQVRVLSSPHMKSGHQIQQSLDKPKHRQGPEEDLRSRGL  331

Query  665   CLVPISSTFPVATETTSDFWTP  600
             C+VP+S+TF VA ET  DFWTP
Sbjct  332   CVVPVSATFAVARETAMDFWTP  353



>ref|XP_006652870.1| PREDICTED: transcription factor bHLH112-like [Oryza brachyantha]
Length=437

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 108/145 (74%), Gaps = 5/145 (3%)
 Frame = -3

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
             +E    SSS+  K  N E +FK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTD
Sbjct  292   LEGVGDSSSVITKKGNGEPSFKKPRLETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTD  351

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR----KAELRSQGLCLV  657
             TASVLHE IEYIKFLHDQV  LSAPYLKNG     H +     +    +  L+ +GLCLV
Sbjct  352   TASVLHETIEYIKFLHDQVGALSAPYLKNGAHQVPHLKNSSPDKSKHGEVSLKGRGLCLV  411

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISSTF VA+E   + WTP FGA+F
Sbjct  412   PISSTFAVASEVPVELWTP-FGANF  435



>gb|EMT02903.1| Transcription factor bHLH112 [Aegilops tauschii]
Length=430

 Score =   188 bits (478),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 109/156 (70%), Gaps = 13/156 (8%)
 Frame = -3

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
             S +E    SSS+  K +N E AFK+PR ETPS LPTFKVRKEKLGDR+TALQQLVSPFGK
Sbjct  276   SVLEGVGDSSSIVTKKANSEPAFKKPRTETPSSLPTFKVRKEKLGDRITALQQLVSPFGK  335

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNG------------CSVSQHHQQDEEGRKA  687
             TDTASVLHE IEYIKFLHDQ  VLSAPYLK G             SVS      + G + 
Sbjct  336   TDTASVLHETIEYIKFLHDQAGVLSAPYLKRGHHQHQVPQYLKSSSVSPDKSCKDGGGEV  395

Query  686   ELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
              L+ +GLCLVPISSTF VA++   DFWTP FG  FR
Sbjct  396   SLKGRGLCLVPISSTFAVASDGPVDFWTP-FGGQFR  430



>ref|XP_004487636.1| PREDICTED: transcription factor bHLH123-like isoform X3 [Cicer 
arietinum]
Length=466

 Score =   189 bits (480),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 129/193 (67%), Gaps = 24/193 (12%)
 Frame = -3

Query  1133  FWNQSPA--SLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             FWN S A  S+ DVR++ F PS Q QF    F  +       + N+ E         K S
Sbjct  290   FWNASEAANSIKDVRSS-FFPSLQPQFSTPNFDSQ-------AKNISEVG-----VVKKS  336

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               E A KR R ETPS LP FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFL
Sbjct  337   GSEPAPKRTRNETPSTLPAFKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFL  396

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQD------EEGRKAELRSQGLCLVPISSTFPVATETT  618
             H+Q  VLS PY+K+G   +Q+ QQ+       EG K +LRS+GLCLVP+SSTFPV  ETT
Sbjct  397   HEQ--VLSTPYMKSGAP-TQNIQQNSGKSKKSEGAKQDLRSRGLCLVPVSSTFPVTHETT  453

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG + R
Sbjct  454   VDFWTPTFGGTSR  466



>gb|AAD21412.1| Hypothetical protein [Arabidopsis thaliana]
Length=304

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 133/200 (67%), Gaps = 26/200 (13%)
 Frame = -3

Query  1166  LKPTFPNAAAS--FWNQSPAS-LNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEE  996
             L  +F N A S  FWN S  + LN+   + F+ +      P + S +L     K+ N++ 
Sbjct  127   LINSFSNNANSRPFWNSSSTTNLNNTTPSNFVTT------PQIISTRLED---KTKNLKT  177

Query  995   ARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
               QS S+ K+A + E+A K+PR+ TPSPLPTFKVRKE L D++T+LQQLVSPFGKTDTAS
Sbjct  178   RAQSESL-KRAKDNESAAKKPRVTTPSPLPTFKVRKENLRDQITSLQQLVSPFGKTDTAS  236

Query  815   VLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRSQGLCLVPISSTFP  636
             VL EAIEYIKFLHDQV +       +G S SQ     +E    ELR  GLCLVPISSTFP
Sbjct  237   VLQEAIEYIKFLHDQVTI-------SGKSKSQ-----DENENHELRGHGLCLVPISSTFP  284

Query  635   VATETTSDFWTPTFGA-SFR  579
             VA ETT+DFWTPTFG  +FR
Sbjct  285   VANETTADFWTPTFGGNNFR  304



>gb|KDO75640.1| hypothetical protein CISIN_1g011373mg [Citrus sinensis]
Length=459

 Score =   188 bits (478),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 173/460 (38%), Positives = 225/460 (49%), Gaps = 111/460 (24%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI---NDMGNFAWAnnddhhhhHQLVNM  1659
             MA++F T G+CGG  W NP RS    SPCSAA I   + MG+F W +ND       +V+ 
Sbjct  1     MAEEFQT-GICGGAWWINPTRSS-SLSPCSAAGIGLSDHMGSFLWPSNDHF----HMVDT  54

Query  1658  K-------GRSSDESC-----------GSASDGSSVVLQELPKSHHQTHN-------MSM  1554
             K       G ++ + C             ++D SS+   E    H QT +       + M
Sbjct  55    KTTTLTPAGTATTKFCEESANNNNNNNSVSADTSSMAFTE---KHQQTDSDSGGSSSILM  111

Query  1553  DSTHLHMLGIGLSPSSTATTDWNQALVQTNERA------MLQEDRNSRL--------NYG  1416
             DST L M+ + +  SS+++TD  QAL++ N RA      M  ED NS++        +Y 
Sbjct  112   DST-LQMMSL-VPSSSSSSTDCFQALLRGNGRAENNYRSMRLEDLNSQIQKEWSPSKSYA  169

Query  1415  QEIGV-----EC-SDSSFKPVAKDFSTSTP--------SATNFAP-------SYNYPS--  1305
                G      EC S     PV K  + S P        S    +P       SY Y S  
Sbjct  170   SSAGAGDHHQECFSLDQSHPVIKSATASFPDNCTVSESSCQGLSPGFPVDSASYGYTSAL  229

Query  1304  --NllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP--------LLKPT  1155
               +  +       Q        +    +Y     AN+  N N+ SPP         +KP+
Sbjct  230   LQSYFEPQPQPVQQQSLYSSNNTRSMGNYMST--ANYGNNYNEVSPPWPKFAAASFVKPS  287

Query  1154  FPNAA-----------ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RK  1014
              P                FWN +  +LND+       S     L +   +K + P+   K
Sbjct  288   LPKQQQPSGGLHFSNNTPFWNAT--ALNDI-------SRPGGLLAAALGEKRTCPTFTAK  338

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
              +N EE R S S AKK S+ E AFKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  339   YNNNEEVRDSGSAAKKGSS-EPAFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFG  397

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHH  714
             KTDTASVLHEAI+YIKFLHDQV+VL+ PY+K G  + Q  
Sbjct  398   KTDTASVLHEAIDYIKFLHDQVSVLATPYMKQGTQIPQQQ  437



>ref|XP_006467939.1| PREDICTED: transcription factor bHLH112-like isoform X2 [Citrus 
sinensis]
Length=448

 Score =   188 bits (478),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 173/460 (38%), Positives = 225/460 (49%), Gaps = 111/460 (24%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASPCSAATI---NDMGNFAWAnnddhhhhHQLVNM  1659
             MA++F T G+CGG  W NP RS    SPCSAA I   + MG+F W +ND       +V+ 
Sbjct  1     MAEEFQT-GICGGAWWINPTRSS-SLSPCSAAGIGLSDHMGSFLWPSNDHF----HMVDT  54

Query  1658  K-------GRSSDESC-----------GSASDGSSVVLQELPKSHHQTHN-------MSM  1554
             K       G ++ + C             ++D SS+   E    H QT +       + M
Sbjct  55    KTTTLTPAGTATTKFCEESANNNNNNNSVSADTSSMAFTE---KHQQTDSDSGGSSSILM  111

Query  1553  DSTHLHMLGIGLSPSSTATTDWNQALVQTNERA------MLQEDRNSRL--------NYG  1416
             DST L M+ + +  SS+++TD  QAL++ N RA      M  ED NS++        +Y 
Sbjct  112   DST-LQMMSL-VPSSSSSSTDCFQALLRGNGRAENNYRSMRLEDLNSQIQKEWSPSKSYA  169

Query  1415  QEIGV-----EC-SDSSFKPVAKDFSTSTP--------SATNFAP-------SYNYPS--  1305
                G      EC S     PV K  + S P        S    +P       SY Y S  
Sbjct  170   SSAGAGDHHQECFSLDQSHPVIKSATASFPDNCTVSESSCQGLSPGFPVDSASYGYTSAL  229

Query  1304  --NllqtlldsdpqpqpqqplisnqqISYAPPPPANFRPNLNDFSPP--------LLKPT  1155
               +  +       Q        +    +Y     AN+  N N+ SPP         +KP+
Sbjct  230   LQSYFEPQPQPVQQQSLYSSNNTRSMGNYMST--ANYGNNYNEVSPPWPKFAAASFVKPS  287

Query  1154  FPNAA-----------ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RK  1014
              P                FWN +  +LND+       S     L +   +K + P+   K
Sbjct  288   LPKQQQPSGGLHFSNNTPFWNAT--ALNDI-------SRPGGLLAAALGEKRTCPTFTAK  338

Query  1013  SSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
              +N EE R S S AKK S+ E AFKRPRIETPSPLPTFKVRKEKLGDR+TALQQLVSPFG
Sbjct  339   YNNNEEVRDSGSAAKKGSS-EPAFKRPRIETPSPLPTFKVRKEKLGDRITALQQLVSPFG  397

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHH  714
             KTDTASVLHEAI+YIKFLHDQV+VL+ PY+K G  + Q  
Sbjct  398   KTDTASVLHEAIDYIKFLHDQVSVLATPYMKQGTQIPQQQ  437



>emb|CDY29448.1| BnaC05g32220D [Brassica napus]
Length=461

 Score =   187 bits (476),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 131/198 (66%), Gaps = 18/198 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQ---SQFLPSVFSDKLSKPS--RKSSNVEEARQSSSM  975
             A+FWN  PA+     A    P+     S FLP++   +L +PS   +  +V E R SSS 
Sbjct  271   ATFWN--PAAT----AGNVGPTQHDASSNFLPAIRPPQLHRPSFEEQPKSVSEIRDSSSS  324

Query  974   -AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI  798
               K+    + A KR + E  SP P FKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAI
Sbjct  325   DVKRGGGDQPAAKRAKSEAASPSPAFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAI  384

Query  797   EYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPV  633
             EYIKFLH QV+ LS PY+K+G S+ QH Q D     +   + +LRS+GLCLVP+SSTFPV
Sbjct  385   EYIKFLHQQVSALSNPYMKSGASL-QHQQSDHPKELDVSEEPDLRSRGLCLVPVSSTFPV  443

Query  632   ATETTSDFWTPTFGASFR  579
               +TT DFWTPTFG +FR
Sbjct  444   THDTTVDFWTPTFGGTFR  461



>ref|XP_003567189.1| PREDICTED: transcription factor bHLH123 [Brachypodium distachyon]
Length=392

 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 109/145 (75%), Gaps = 7/145 (5%)
 Frame = -3

Query  992  RQSSSMAKKAS-NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTAS  816
            R SS  A+K   +  AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTAS
Sbjct  248  RASSPAARKNEPDSPAAAKRPRIEAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTAS  307

Query  815  VLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR------KAELRSQGLCLVP  654
            VLHEA EYIKFLHDQV  L+ PYLKN   + Q  Q+  E        K +LRS+GLCLVP
Sbjct  308  VLHEANEYIKFLHDQVASLTYPYLKNVNQMQQFQQKGSENAKEAGEPKKDLRSRGLCLVP  367

Query  653  ISSTFPVATETTSDFWTPTFGASFR  579
            +++T+ VA+ET  +FW PTFG +FR
Sbjct  368  VATTYTVASETMPEFWHPTFGGTFR  392



>emb|CDY19619.1| BnaA05g20270D [Brassica napus]
Length=461

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 130/198 (66%), Gaps = 18/198 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQ---SQFLPSVFSDKLSKPS--RKSSNVEEARQSSSM  975
             A+FWN  PA+     A    P+     S F PS+   +L +PS   +  +V E R SSS 
Sbjct  271   ATFWN--PAAT----AGNVGPTQHDASSNFFPSIQPPQLHRPSFEEQPKSVSEIRDSSSS  324

Query  974   -AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI  798
               K+    + A KR + E  SP P FKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAI
Sbjct  325   DVKRGGGDQPAAKRAKSEAASPSPAFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAI  384

Query  797   EYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPV  633
             EYIKFLH QV+ LS PY+K+G S+ QH Q D     +   + +LRS+GLCLVP+SSTFPV
Sbjct  385   EYIKFLHQQVSALSTPYMKSGASL-QHQQSDHPKELDVSEEPDLRSRGLCLVPVSSTFPV  443

Query  632   ATETTSDFWTPTFGASFR  579
               +TT DFWTPTFG +FR
Sbjct  444   THDTTVDFWTPTFGGTFR  461



>ref|XP_006391984.1| hypothetical protein EUTSA_v10023487mg [Eutrema salsugineum]
 gb|ESQ29270.1| hypothetical protein EUTSA_v10023487mg [Eutrema salsugineum]
Length=416

 Score =   185 bits (470),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 117/166 (70%), Gaps = 13/166 (8%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S +L   ++K      AR  S   K+A + E+A K+PR+ TPSPLPTFKVRKE L 
Sbjct  257   PQMISTRLEDKTKK------ARGQSESLKRAKDNESASKKPRVTTPSPLPTFKVRKENLR  310

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK-----NGCSVSQHHQ  711
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K               
Sbjct  311   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASIQQQQQISGKS  370

Query  710   QDEEGR-KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
             ++++G    ELR+ GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  371   KNQDGSDNQELRAHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  416


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 67/140 (48%), Gaps = 32/140 (23%)
 Frame = -3

Query  1859  YQINRKRSAVMADDFM-TAGVCGGGS--WWNPARSMFG-----ASPCSAATI--NDMGNF  1710
             + +    S  MA++F  TA +CGGGS  WWN  RS+        SPC  A I  ND G+ 
Sbjct  16    FALQLSDSVYMAEEFQATAAICGGGSGAWWNSPRSVMSPSDHFLSPCFGAAITSNDFGS-  74

Query  1709  AWAnnddhhhhHQLVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHML  1530
                         Q  N+K R       + +D + V  Q    S      +++DST L M+
Sbjct  75    ------------QENNLKSRM------NCTDNNIVFGQREADSDSGGSTVTIDST-LQMM  115

Query  1529  GIGLSPSSTATTDWNQALVQ  1470
             G+G   SS +++DWNQ ++Q
Sbjct  116   GLGF--SSNSSSDWNQTILQ  133



>ref|XP_006391985.1| hypothetical protein EUTSA_v10023487mg [Eutrema salsugineum]
 gb|ESQ29271.1| hypothetical protein EUTSA_v10023487mg [Eutrema salsugineum]
Length=418

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 118/166 (71%), Gaps = 11/166 (7%)
 Frame = -3

Query  1055  PSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLG  876
             P + S +L   ++     ++AR  S   K+A + E+A K+PR+ TPSPLPTFKVRKE L 
Sbjct  257   PQMISTRLEDKTKN----QKARGQSESLKRAKDNESASKKPRVTTPSPLPTFKVRKENLR  312

Query  875   DRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK-----NGCSVSQHHQ  711
             D++T+LQQLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K               
Sbjct  313   DQITSLQQLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGASIQQQQQISGKS  372

Query  710   QDEEGR-KAELRSQGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
             ++++G    ELR+ GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  373   KNQDGSDNQELRAHGLCLVPISSTFPVANETTADFWTPTFGGNNFR  418


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 66/140 (47%), Gaps = 32/140 (23%)
 Frame = -3

Query  1859  YQINRKRSAVMADDFM-TAGVCGGGS--WWNPARSMFG-----ASPCSAATI--NDMGNF  1710
             + +    S  MA++F  TA +CGGGS  WWN  RS+        SPC  A I  ND G  
Sbjct  16    FALQLSDSVYMAEEFQATAAICGGGSGAWWNSPRSVMSPSDHFLSPCFGAAITSNDFG--  73

Query  1709  AWAnnddhhhhHQLVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHML  1530
                         Q  N+K R       + +D + V  Q    S      +++DST L M+
Sbjct  74    -----------SQENNLKSRM------NCTDNNIVFGQREADSDSGGSTVTIDST-LQMM  115

Query  1529  GIGLSPSSTATTDWNQALVQ  1470
             G+G   SS +++DWNQ ++Q
Sbjct  116   GLGF--SSNSSSDWNQTILQ  133



>ref|XP_010466266.1| PREDICTED: transcription factor bHLH123 [Camelina sativa]
Length=460

 Score =   186 bits (471),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 130/197 (66%), Gaps = 16/197 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPS--TQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSS-M  975
             A+FWN  PA+  +       PS    S F P++   ++  PS   +  N+ E R SS+  
Sbjct  270   ATFWN--PAATGNAGPP---PSHDASSNFFPALQPPQIHAPSFDEQPKNISEIRDSSNNE  324

Query  974   AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
              K+    + A KR + ET SP P FKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIE
Sbjct  325   VKRGGGDQPAAKRAKSETASPSPAFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIE  384

Query  794   YIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPVA  630
             YIKFLH QV+ LS PY+K+G S+ QH Q D     E   + +LRS+GLCLVP+SSTFPV 
Sbjct  385   YIKFLHQQVSALSNPYMKSGASL-QHQQSDHPKELEVSEEPDLRSRGLCLVPVSSTFPVT  443

Query  629   TETTSDFWTPTFGASFR  579
              +TT DFWTPTFG +FR
Sbjct  444   HDTTVDFWTPTFGGTFR  460



>ref|XP_009104936.1| PREDICTED: transcription factor bHLH112 isoform X3 [Brassica 
rapa]
 ref|XP_009104943.1| PREDICTED: transcription factor bHLH112 isoform X4 [Brassica 
rapa]
Length=378

 Score =   183 bits (465),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     ++ R  S   K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  228   LIIPPRVDDKTKKTRGQSESLKRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  287

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  288   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNDNQELRA  345

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  346   HGLCLVPISSTFPVANETTADFWTPTFGGNNFR  378



>emb|CDY49037.1| BnaA01g22830D [Brassica napus]
Length=378

 Score =   183 bits (465),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     ++ R  S   K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  228   LIIPPRVDDKTKKTRGQSESLKRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  287

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  288   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNDNQELRA  345

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  346   HGLCLVPISSTFPVANETTADFWTPTFGGNNFR  378



>emb|CAJ86024.1| B0808H03.1 [Oryza sativa Indica Group]
 emb|CAH68071.1| H0105C05.9 [Oryza sativa Indica Group]
Length=440

 Score =   184 bits (468),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 8/145 (6%)
 Frame = -3

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
             +E    SSS+  K   +E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTD
Sbjct  298   MEGVGDSSSVITK---KETAFKKPRLETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTD  354

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD--EEGRKAE--LRSQGLCLV  657
             TASVLHE IEYIKFLHDQV  LSAPYLKNG     H +    ++ +  E  L+ +GLCLV
Sbjct  355   TASVLHETIEYIKFLHDQVGALSAPYLKNGAHQVPHLKNSSPDKSKHGEISLKGRGLCLV  414

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISSTF VA+E   + WTP FGA+F
Sbjct  415   PISSTFAVASEVPVELWTP-FGANF  438



>emb|CDM84514.1| unnamed protein product [Triticum aestivum]
Length=386

 Score =   183 bits (464),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 7/131 (5%)
 Frame = -3

Query  950  AAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  771
            AA KRPRIE PSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEA EYIKFLHDQ
Sbjct  256  AAAKRPRIEAPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEANEYIKFLHDQ  315

Query  770  VNVLSAPYLKNGCSVSQHHQ------QDEEGR-KAELRSQGLCLVPISSTFPVATETTSD  612
            V  L+ PYLKN   + Q  Q      +D+ G  K +LRS+GLCLVP+++T+ VA+ET  +
Sbjct  316  VASLTYPYLKNVNPLQQFQQKGSENAKDDGGEPKKDLRSRGLCLVPVATTYTVASETVPE  375

Query  611  FWTPTFGASFR  579
            FW PTFG +FR
Sbjct  376  FWYPTFGGTFR  386



>ref|NP_001053983.1| Os04g0631600 [Oryza sativa Japonica Group]
 emb|CAD41686.1| OSJNBb0015D13.17 [Oryza sativa Japonica Group]
 dbj|BAF15897.1| Os04g0631600 [Oryza sativa Japonica Group]
 gb|EAZ32097.1| hypothetical protein OsJ_16289 [Oryza sativa Japonica Group]
Length=437

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 8/145 (6%)
 Frame = -3

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
             +E    SSS+  K   +E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTD
Sbjct  295   MEGVGDSSSVITK---KETAFKKPRLETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTD  351

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD--EEGRKAE--LRSQGLCLV  657
             TASVLHE IEYIKFLHDQV  LSAPYLKNG     H +    ++ +  E  L+ +GLCLV
Sbjct  352   TASVLHETIEYIKFLHDQVGALSAPYLKNGAHQVPHLKNSSPDKSKHGEISLKGRGLCLV  411

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISSTF VA+E   + WTP FGA+F
Sbjct  412   PISSTFAVASEVPVELWTP-FGANF  435



>ref|XP_009104922.1| PREDICTED: transcription factor bHLH112 isoform X1 [Brassica 
rapa]
Length=396

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     ++ R  S   K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  228   LIIPPRVDDKTKKTRGQSESLKRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  287

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  288   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNDNQELRA  345

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  346   HGLCLVPISSTFPVANETTADFWTPTFGGNNFR  378



>gb|EAY95687.1| hypothetical protein OsI_17552 [Oryza sativa Indica Group]
Length=439

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 110/145 (76%), Gaps = 8/145 (6%)
 Frame = -3

Query  1004  VEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTD  825
             +E    SSS+  K   +E AFK+PR+ETPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTD
Sbjct  297   MEGVGDSSSVITK---KETAFKKPRLETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTD  353

Query  824   TASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD--EEGRKAE--LRSQGLCLV  657
             TASVLHE IEYIKFLHDQV  LSAPYLKNG     H +    ++ +  E  L+ +GLCLV
Sbjct  354   TASVLHETIEYIKFLHDQVGALSAPYLKNGAHQVPHLKNSSPDKSKHGEISLKGRGLCLV  413

Query  656   PISSTFPVATETTSDFWTPTFGASF  582
             PISSTF VA+E   + WTP FGA+F
Sbjct  414   PISSTFAVASEVPVELWTP-FGANF  437



>emb|CDY25292.1| BnaC01g29610D [Brassica napus]
Length=374

 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     ++ R  S   K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  224   LIIPPRGDDKTKKTRGQSESLKRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  283

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  284   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNGNQELRA  341

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFG  591
              GLCLVPISSTFPVA ETT+DFWTPTFG
Sbjct  342   HGLCLVPISSTFPVANETTADFWTPTFG  369



>ref|XP_002447167.1| hypothetical protein SORBIDRAFT_06g029680 [Sorghum bicolor]
 gb|EES11495.1| hypothetical protein SORBIDRAFT_06g029680 [Sorghum bicolor]
Length=454

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 110/152 (72%), Gaps = 20/152 (13%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLH  807
            SS + KK +N E AFK+ R+ETPSPLPTFKVRKEKLGDRVTALQQLV+PFGKTDTASVLH
Sbjct  307  SSIITKKKANGEPAFKKSRLETPSPLPTFKVRKEKLGDRVTALQQLVAPFGKTDTASVLH  366

Query  806  EAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ-------------QDEEGRKAE--LRSQ  672
            E IEYIKFLHDQV VLSAPYLKN    + HHQ             +D+     E  L+ +
Sbjct  367  ETIEYIKFLHDQVGVLSAPYLKN----NGHHQVPHLKSSSPDKSNKDDNSHAGEVSLKGR  422

Query  671  GLCLVPISSTFPVATETTSDF-WTPTFGASFR  579
            GLCLVPISSTF VA+E   DF W+  F A+FR
Sbjct  423  GLCLVPISSTFAVASEVPVDFVWSTPFAANFR  454



>ref|XP_009420210.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=464

 Score =   184 bits (466),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 137/237 (58%), Gaps = 36/237 (15%)
 Frame = -3

Query  1196  PNLNDFSPPLLKPTFPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSR  1017
             P   + SPP  +  F N    FWN S +S+N+  +  F  +   Q   +  S   SKP  
Sbjct  233   PQFMNASPPKQQLQFSNDTP-FWNPSASSVNEAHS-NFHHAKPPQPFHNENSSH-SKPVV  289

Query  1016  KSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             K+++   AR S    +K S+ E A K+PR ETPSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  290   KTAS--GARGSCPTLEKRSDSEPAAKKPRTETPSPLPTFKVRKEKLGDRITALQQLVSPF  347

Query  836   GKTDTASVLHEAIEYIKFLHDQV---------------------------NVLSAPYLKN  738
             GKTDTASVLHE IEYIKFLHDQV                            VLSAPYLK 
Sbjct  348   GKTDTASVLHETIEYIKFLHDQVRVSLSTLSFRQTDNLSSSPTSHTSNVLQVLSAPYLKK  407

Query  737   GCSVSQHHQQDE----EGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                  Q    D+    EGR   LRS+GLCL+PISSTF VA E  +D WTPTF  +FR
Sbjct  408   DHQTQQTKASDKPKDCEGRNLNLRSRGLCLIPISSTFAVANEIPTDCWTPTFTGTFR  464


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 73/160 (46%), Gaps = 31/160 (19%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPARSMFGASP-------CSAATINDMGNFAWAnnddhhhhHQ  1671
             MAD F  AG C  G+WW+   S FG  P       CS    N  G+F WA          
Sbjct  1     MADQFQ-AGSCSSGTWWS---SGFGGGPTMSASASCSTELTNVAGSFNWA------TASD  50

Query  1670  LVNMKGRSSDESCGSASDGSSVVLQELPKSHHQTHNMS---MDSTHLHMLGIGLSPSSTA  1500
             +   K RS DES  S S+ SSV  Q++  S      ++   +DS    M   GL   S+ 
Sbjct  51    MFEPKSRSCDESPVSISN-SSVTFQDIQNSDVSAPVIAAPMLDSVSQAM-DFGL---SSP  105

Query  1499  TTDWNQALVQTNER------AMLQEDRNSRLNYGQEIGVE  1398
             T +W+Q+   ++ R      A+LQED  SR    ++ GVE
Sbjct  106   TVEWSQSFFSSSGRGQNSFHALLQEDVISRPYAQRDWGVE  145



>ref|XP_010544250.1| PREDICTED: transcription factor bHLH123-like [Tarenaya hassleriana]
Length=429

 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/193 (54%), Positives = 130/193 (67%), Gaps = 15/193 (8%)
 Frame = -3

Query  1136  SFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMA-KK  966
             +FWN + A+ +DV +  F P+   Q      S ++  PS   K  +V E R  S++A K+
Sbjct  245   TFWNPT-AAAHDV-SPRFFPAAALQ------SPEIQAPSFEEKPKSVPEIRDPSTVAAKR  296

Query  965   ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
             +   + A KR + E  SP PTFKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIK
Sbjct  297   SGGGQPAAKRSKNEAASPSPTFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIK  356

Query  785   FLHDQVNVLSAPYLKNGCSVSQH----HQQDEEGRKAELRSQGLCLVPISSTFPVATETT  618
             FLH QV  LS+PYLK G S+ Q       +D E  + +LRS+GLCLVP+SSTFPV  +TT
Sbjct  357   FLHQQVAALSSPYLKTGASLQQQQICDQSKDLEEPEQDLRSRGLCLVPVSSTFPVTHDTT  416

Query  617   SDFWTPTFGASFR  579
              DFWTPTFG SFR
Sbjct  417   VDFWTPTFGGSFR  429



>ref|XP_009104950.1| PREDICTED: transcription factor bHLH112 isoform X5 [Brassica 
rapa]
Length=377

 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 110/153 (72%), Gaps = 4/153 (3%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     +   QS S+ K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  228   LIIPPRVDDKTKTRGQSESL-KRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  286

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  287   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNDNQELRA  344

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  345   HGLCLVPISSTFPVANETTADFWTPTFGGNNFR  377



>ref|XP_009405008.1| PREDICTED: transcription factor bHLH112-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   180 bits (457),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 103/138 (75%), Gaps = 7/138 (5%)
 Frame = -3

Query  971  KKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  792
            +K +  E A K+PRIE  SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY
Sbjct  227  EKKAGSEPAGKKPRIEKQSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  286

Query  791  IKFLHDQVNVLSAPYLKNGCSVSQ-------HHQQDEEGRKAELRSQGLCLVPISSTFPV  633
            IKFLHDQV V SAPYL N   + Q          +D EG+  +LRS+GLCLVPISSTF V
Sbjct  287  IKFLHDQVRVSSAPYLTNSQQMQQVNATKSLDKTKDCEGQHQDLRSRGLCLVPISSTFAV  346

Query  632  ATETTSDFWTPTFGASFR  579
            A E  +D W+ TF  +FR
Sbjct  347  ANEIPTDLWSTTFIGTFR  364



>ref|XP_010545555.1| PREDICTED: transcription factor bHLH123 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545556.1| PREDICTED: transcription factor bHLH123 isoform X1 [Tarenaya 
hassleriana]
Length=453

 Score =   182 bits (462),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 127/192 (66%), Gaps = 21/192 (11%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S AS N      F P+ Q+Q + +   D+  KP +    + +        K++ 
Sbjct  278   APFWNPSDASPN------FFPALQTQPIQTPNFDE--KPKKNVPEIPDP-------KRSG  322

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               + A KR + ET SP PTFKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIKFL
Sbjct  323   GDQPAAKRSKNETVSPSPTFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIKFL  382

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAE-----LRSQGLCLVPISSTFPVATETTS  615
             H QV  LS+PY+K+G S+ QH Q  ++ R  E     LRS+GLCLVP+SSTFP+  +TT 
Sbjct  383   HQQVTALSSPYIKSGPSL-QHPQNRDQSRDREEPEQDLRSRGLCLVPVSSTFPITHDTTV  441

Query  614   DFWTPTFGASFR  579
             DFWTPTFG SFR
Sbjct  442   DFWTPTFGGSFR  453



>ref|XP_009104927.1| PREDICTED: transcription factor bHLH112 isoform X2 [Brassica 
rapa]
Length=395

 Score =   181 bits (458),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 110/153 (72%), Gaps = 4/153 (3%)
 Frame = -3

Query  1034  LSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQ  855
             L  P R     +   QS S+ K+    E A K+ R+ TPSPLP FKVRKE L D++T+LQ
Sbjct  228   LIIPPRVDDKTKTRGQSESL-KRGKYNEPASKKQRVTTPSPLPNFKVRKENLRDQITSLQ  286

Query  854   QLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRS  675
             QLVSPFGKTDTASVL EAIEYIKFLHDQV VLS PY+K G  +  H QQ +     ELR+
Sbjct  287   QLVSPFGKTDTASVLQEAIEYIKFLHDQVTVLSTPYMKQGAPI--HQQQQDGNDNQELRA  344

Query  674   QGLCLVPISSTFPVATETTSDFWTPTFGA-SFR  579
              GLCLVPISSTFPVA ETT+DFWTPTFG  +FR
Sbjct  345   HGLCLVPISSTFPVANETTADFWTPTFGGNNFR  377



>ref|XP_006406363.1| hypothetical protein EUTSA_v10020666mg [Eutrema salsugineum]
 gb|ESQ47816.1| hypothetical protein EUTSA_v10020666mg [Eutrema salsugineum]
Length=469

 Score =   182 bits (463),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 128/203 (63%), Gaps = 26/203 (13%)
 Frame = -3

Query  1139  ASFWNQSPASLNDV-------RAATFLPSTQS--QFLPSVFSDKLSKPSRKSSNVEEARQ  987
             A+FWN  PA+  +         ++ F P+ Q   Q  P  F  +  K      ++ E R 
Sbjct  277   ATFWN--PAATGNAGQLPPHDASSNFFPALQQPPQIHPQSFDQQRPK------SISEIRD  328

Query  986   SSS-MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVL  810
             SSS   K+    + A KR + E  SP P  KVRKEK+GDR+ ALQQLVSPFGKTD ASVL
Sbjct  329   SSSSEVKRGGGDQPAAKRAKSEAASPSPALKVRKEKMGDRIAALQQLVSPFGKTDAASVL  388

Query  809   HEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAE------LRSQGLCLVPIS  648
              EAIEYIKFLH QV+ LS PY+K+G S+  HHQQ +  ++ E      LRS+GLCLVP+S
Sbjct  389   SEAIEYIKFLHQQVSALSNPYMKSGASL--HHQQSDHPKELEVSEEPDLRSRGLCLVPVS  446

Query  647   STFPVATETTSDFWTPTFGASFR  579
             STFPV  +TT DFWTPTFG +FR
Sbjct  447   STFPVTHDTTVDFWTPTFGGTFR  469



>ref|XP_009145606.1| PREDICTED: transcription factor bHLH123 isoform X2 [Brassica 
rapa]
Length=461

 Score =   182 bits (462),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 129/198 (65%), Gaps = 18/198 (9%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQ---SQFLPSVFSDKLSKPS--RKSSNVEEARQSSSM  975
             A+FWN  PA+     A    P+     S F P++   +L +PS   +  +V E R SSS 
Sbjct  271   ATFWN--PAAT----AGNVGPTQHDASSNFFPAIQPPQLHRPSFEEQPKSVSEIRDSSSS  324

Query  974   -AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI  798
               K+    + A KR + E  SP P FKVRKEK+GDR+ ALQQLVSPFGKT  ASVL EAI
Sbjct  325   DVKRGGGDQPAAKRAKSEAASPSPAFKVRKEKMGDRIAALQQLVSPFGKTAEASVLSEAI  384

Query  797   EYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPV  633
             EYIKFLH QV+ LS PY+K+G S+ QH Q D     +   + +LRS+GLCLVP+SSTFPV
Sbjct  385   EYIKFLHQQVSALSNPYMKSGASL-QHQQSDHPKELDVSEEPDLRSRGLCLVPVSSTFPV  443

Query  632   ATETTSDFWTPTFGASFR  579
               +TT DFWTPTFG +FR
Sbjct  444   THDTTVDFWTPTFGGTFR  461



>ref|XP_010545557.1| PREDICTED: transcription factor bHLH123 isoform X2 [Tarenaya 
hassleriana]
Length=452

 Score =   182 bits (461),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 126/192 (66%), Gaps = 22/192 (11%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKAS  960
             A FWN S AS N      F P+ Q+Q + +   D+      K  NV E        K++ 
Sbjct  278   APFWNPSDASPN------FFPALQTQPIQTPNFDE------KPKNVPEIPD----PKRSG  321

Query  959   NQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFL  780
               + A KR + ET SP PTFKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIKFL
Sbjct  322   GDQPAAKRSKNETVSPSPTFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIKFL  381

Query  779   HDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAE-----LRSQGLCLVPISSTFPVATETTS  615
             H QV  LS+PY+K+G S+ QH Q  ++ R  E     LRS+GLCLVP+SSTFP+  +TT 
Sbjct  382   HQQVTALSSPYIKSGPSL-QHPQNRDQSRDREEPEQDLRSRGLCLVPVSSTFPITHDTTV  440

Query  614   DFWTPTFGASFR  579
             DFWTPTFG SFR
Sbjct  441   DFWTPTFGGSFR  452



>ref|XP_008668450.1| PREDICTED: uncharacterized protein LOC100383774 isoform X1 [Zea 
mays]
 tpg|DAA35867.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=463

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 108/153 (71%), Gaps = 21/153 (14%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLH  807
            SS + KK +N E A K+PR+ETPSPLPTFKVRKEKLGDR+TALQQLV+PFGKTDTASVLH
Sbjct  315  SSIITKKKANGEPALKKPRLETPSPLPTFKVRKEKLGDRITALQQLVAPFGKTDTASVLH  374

Query  806  EAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ----------------QDEEGRKAELRS  675
            E IEYIKFLHDQV VLSAPYLKN    + HHQ                 D    +  L+ 
Sbjct  375  ETIEYIKFLHDQVGVLSAPYLKN----NGHHQVLRHLKSSSPDKSSKDDDSHASEISLKG  430

Query  674  QGLCLVPISSTFPVATETTSDF-WTPTFGASFR  579
            +GLCLVPISSTF VA+E   DF W+  F A+FR
Sbjct  431  RGLCLVPISSTFAVASEVPVDFVWSTPFAANFR  463



>ref|XP_006297611.1| hypothetical protein CARUB_v10013632mg, partial [Capsella rubella]
 gb|EOA30509.1| hypothetical protein CARUB_v10013632mg, partial [Capsella rubella]
Length=467

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 119/173 (69%), Gaps = 10/173 (6%)
 Frame = -3

Query  1067  SQFLPSVFSDKLSKPS--RKSSNVEEARQSSS--MAKKASNQEAAFKRPRIETPSPLPTF  900
             S F P++   ++  PS   +S N+ E R SS+  + +     + A KR + E  SP P  
Sbjct  295   SNFFPALQPPQIHAPSFDEQSKNISETRDSSNNEVKRGGGGDQPAAKRAKSEAASPSPAL  354

Query  899   KVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV--  726
             KVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIKFLH QV+ LS PY+K+G S+  
Sbjct  355   KVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIKFLHQQVSALSNPYMKSGASLQH  414

Query  725   --SQHHQ--QDEEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
               S HHQ  + E   + +LRS+GLCLVP+SSTFPV  +TT DFWTPTFG +FR
Sbjct  415   QQSDHHQPNEVEVSEEPDLRSRGLCLVPVSSTFPVTHDTTVDFWTPTFGGTFR  467



>ref|XP_009135702.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Brassica 
rapa]
Length=428

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 10/194 (5%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKK  966
             A+FWN  PA+       T   ++ S F P++   ++  PS  ++ S  +     S+  KK
Sbjct  238   ATFWN--PAATAGNVGPTHHDAS-SNFFPALQPPQIHAPSFDKQKSITKVPDSRSNEVKK  294

Query  965   ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
                 + A KR + E PSP P  KVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIK
Sbjct  295   GGADQPAAKRAKSEAPSPSPASKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIK  354

Query  785   FLHDQVNVLSAPYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATET  621
             FLH QV+ LS PY+K+G S+     S HH++ E   + +LRS+GLCLVP+SS FPV  +T
Sbjct  355   FLHQQVSALSNPYMKSGASLQHQQMSHHHKELEVSEEPDLRSRGLCLVPVSSIFPVTQDT  414

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  415   TVDFWTPTFGGTFR  428



>ref|XP_008668451.1| PREDICTED: uncharacterized protein LOC100383774 isoform X2 [Zea 
mays]
Length=461

 Score =   181 bits (459),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 108/153 (71%), Gaps = 21/153 (14%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLH  807
            SS + KK +N E A K+PR+ETPSPLPTFKVRKEKLGDR+TALQQLV+PFGKTDTASVLH
Sbjct  313  SSIITKKKANGEPALKKPRLETPSPLPTFKVRKEKLGDRITALQQLVAPFGKTDTASVLH  372

Query  806  EAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQ----------------QDEEGRKAELRS  675
            E IEYIKFLHDQV VLSAPYLKN    + HHQ                 D    +  L+ 
Sbjct  373  ETIEYIKFLHDQVGVLSAPYLKN----NGHHQVLRHLKSSSPDKSSKDDDSHASEISLKG  428

Query  674  QGLCLVPISSTFPVATETTSDF-WTPTFGASFR  579
            +GLCLVPISSTF VA+E   DF W+  F A+FR
Sbjct  429  RGLCLVPISSTFAVASEVPVDFVWSTPFAANFR  461



>ref|XP_009135703.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Brassica 
rapa]
Length=427

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 127/194 (65%), Gaps = 10/194 (5%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKK  966
             A+FWN  PA+       T   ++ S F P++   ++  PS  ++ S  +     S+  KK
Sbjct  237   ATFWN--PAATAGNVGPTHHDAS-SNFFPALQPPQIHAPSFDKQKSITKVPDSRSNEVKK  293

Query  965   ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
                 + A KR + E PSP P  KVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEYIK
Sbjct  294   GGADQPAAKRAKSEAPSPSPASKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEYIK  353

Query  785   FLHDQVNVLSAPYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVATET  621
             FLH QV+ LS PY+K+G S+     S HH++ E   + +LRS+GLCLVP+SS FPV  +T
Sbjct  354   FLHQQVSALSNPYMKSGASLQHQQMSHHHKELEVSEEPDLRSRGLCLVPVSSIFPVTQDT  413

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG +FR
Sbjct  414   TVDFWTPTFGGTFR  427



>ref|XP_004972712.1| PREDICTED: transcription factor bHLH123-like [Setaria italica]
Length=417

 Score =   179 bits (454),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 106/150 (71%), Gaps = 5/150 (3%)
 Frame = -3

Query  1016  KSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
             KS+        S +AKKA+      K+ R  TPSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  269   KSAPEGAGDSGSIIAKKANTDPTPLKKARTGTPSPLPTFKVRKEKLGDRITALQQLVSPF  328

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR----KAELRSQG  669
             GKTDTASVLHE IEYIKFLH+QV  LSAPYLKN   V       + G     K +L  +G
Sbjct  329   GKTDTASVLHETIEYIKFLHEQVGSLSAPYLKNRQQVPHLKISRDGGEAAAAKGDLTGRG  388

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVPISSTF VA+ET  DFW+P FGA+FR
Sbjct  389   LCLVPISSTFAVASETPVDFWSP-FGAAFR  417



>ref|XP_004961600.1| PREDICTED: transcription factor bHLH112-like [Setaria italica]
Length=345

 Score =   177 bits (448),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 101/133 (76%), Gaps = 9/133 (7%)
 Frame = -3

Query  950  AAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQ  771
            AA K+ RI TPSP+PTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAIEYI+FLHDQ
Sbjct  213  AAAKKLRIATPSPMPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIEYIRFLHDQ  272

Query  770  VNVLSAPYLKNG---------CSVSQHHQQDEEGRKAELRSQGLCLVPISSTFPVATETT  618
            V  LS+PYL+ G              +H +D    K +LRS+GLCLVP++ST+ VA+ET 
Sbjct  273  VASLSSPYLRCGRPVQVQQLQQQQVSYHAKDGGEAKEDLRSRGLCLVPVASTYAVASETA  332

Query  617  SDFWTPTFGASFR  579
             +FW P FG +FR
Sbjct  333  PEFWHPNFGGTFR  345



>emb|CDY32387.1| BnaC03g41710D [Brassica napus]
Length=428

 Score =   179 bits (454),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 129/196 (66%), Gaps = 14/196 (7%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS----RKSSNVEEARQSSSMA  972
             A+FWN  PA+       T   ++ S F P++   ++  PS    +  + V ++R  S+  
Sbjct  238   ATFWN--PAATAGNVGPTHHDAS-SNFFPALQPPQIHAPSFDEQKSITKVPDSR--SNEV  292

Query  971   KKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEY  792
             K+    + A KR + E PSP P  KVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIEY
Sbjct  293   KRGGADQPAAKRAKSEAPSPSPASKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIEY  352

Query  791   IKFLHDQVNVLSAPYLKNGCSV-----SQHHQQDEEGRKAELRSQGLCLVPISSTFPVAT  627
             IKFLH QV+ LS PY+K+G S+     S HH++ E   + +LRS+GLCLVP+SS FPV  
Sbjct  353   IKFLHQQVSALSNPYMKSGASLQHQQMSDHHKELEVSEEPDLRSRGLCLVPVSSIFPVTQ  412

Query  626   ETTSDFWTPTFGASFR  579
             +TT DFWTPTFG +FR
Sbjct  413   DTTVDFWTPTFGGTFR  428



>ref|XP_002445156.1| hypothetical protein SORBIDRAFT_07g004980 [Sorghum bicolor]
 gb|EES14651.1| hypothetical protein SORBIDRAFT_07g004980 [Sorghum bicolor]
Length=411

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 121/194 (62%), Gaps = 16/194 (8%)
 Frame = -3

Query  1133  FWNQSPASL-NDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASN  957
             FWN S  S  +    AT L     +  P+ F         KS+  E A  SS++  K +N
Sbjct  225   FWNPSAGSFASAAEGATSLLPPSGKSRPANFG-------VKSALDEGAGDSSNIIAKRTN  277

Query  956   QEAA---FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIK  786
                     K+ R  TPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHE IEYIK
Sbjct  278   TAPTPPPLKKSRTGTPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHETIEYIK  337

Query  785   FLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETT  618
             FLH+QV  LSAPYLKN   V  H    + G  A    EL  +GLCLVPISSTF VA+ET 
Sbjct  338   FLHEQVGSLSAPYLKNRQQVPHHKVLRDGGEAAAANGELTGRGLCLVPISSTFAVASETP  397

Query  617   SDFWTPTFG-ASFR  579
              DFWTP  G A+FR
Sbjct  398   LDFWTPFGGPAAFR  411



>ref|XP_009110325.1| PREDICTED: transcription factor bHLH123-like isoform X2 [Brassica 
rapa]
Length=434

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 16/197 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLN-----DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSM  975
             A+FWN +  + N        ++ + P+ Q    P + +    +  +  S +++   SSS 
Sbjct  244   ATFWNPTATAGNVGPTHHDASSNYFPALQP---PQIHAPSFDEQPKGMSEIKDL--SSSE  298

Query  974   AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
              K+A   + A KR + E  SP P FKV+KEK+ DR+ ALQQLVSPFGKTD ASVL EAIE
Sbjct  299   VKRAGGDQPAAKRAKSEAASPSPPFKVKKEKMSDRIAALQQLVSPFGKTDQASVLSEAIE  358

Query  794   YIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPVA  630
             YIKFLH QV+ LS PY+ +G S+ QH Q D     E  ++ +LRSQGLCLVP+SSTFPV 
Sbjct  359   YIKFLHQQVSALSNPYMNSGASL-QHQQSDHPKELEVSKEPDLRSQGLCLVPVSSTFPVT  417

Query  629   TETTSDFWTPTFGASFR  579
              +TT DFWTPTFG +FR
Sbjct  418   HDTTVDFWTPTFGGTFR  434



>emb|CDY55587.1| BnaA01g36370D [Brassica napus]
Length=435

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 16/197 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLN-----DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSM  975
             A+FWN +  + N        ++ + P+ Q    P + +    +  +  S +++   SSS 
Sbjct  245   ATFWNPTATAGNVGPTHHDASSNYFPALQP---PQIHAPSFDEQPKGMSEIKDL--SSSE  299

Query  974   AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
              K+A   + A KR + E  SP P FKV+KEK+ DR+ ALQQLVSPFGKTD ASVL EAIE
Sbjct  300   VKRAGGDQPAAKRAKSEAASPSPPFKVKKEKMSDRIAALQQLVSPFGKTDQASVLSEAIE  359

Query  794   YIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPVA  630
             YIKFLH QV+ LS PY+ +G S+ QH Q D     E  ++ +LRSQGLCLVP+SSTFPV 
Sbjct  360   YIKFLHQQVSALSNPYMNSGASL-QHQQSDHPKELEVSKEPDLRSQGLCLVPVSSTFPVT  418

Query  629   TETTSDFWTPTFGASFR  579
              +TT DFWTPTFG +FR
Sbjct  419   HDTTVDFWTPTFGGTFR  435



>ref|XP_009110318.1| PREDICTED: transcription factor bHLH123-like isoform X1 [Brassica 
rapa]
Length=435

 Score =   177 bits (448),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 127/197 (64%), Gaps = 16/197 (8%)
 Frame = -3

Query  1139  ASFWNQSPASLN-----DVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSM  975
             A+FWN +  + N        ++ + P+ Q    P + +    +  +  S +++   SSS 
Sbjct  245   ATFWNPTATAGNVGPTHHDASSNYFPALQP---PQIHAPSFDEQPKGMSEIKDL--SSSE  299

Query  974   AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
              K+A   + A KR + E  SP P FKV+KEK+ DR+ ALQQLVSPFGKTD ASVL EAIE
Sbjct  300   VKRAGGDQPAAKRAKSEAASPSPPFKVKKEKMSDRIAALQQLVSPFGKTDQASVLSEAIE  359

Query  794   YIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPVA  630
             YIKFLH QV+ LS PY+ +G S+ QH Q D     E  ++ +LRSQGLCLVP+SSTFPV 
Sbjct  360   YIKFLHQQVSALSNPYMNSGASL-QHQQSDHPKELEVSKEPDLRSQGLCLVPVSSTFPVT  418

Query  629   TETTSDFWTPTFGASFR  579
              +TT DFWTPTFG +FR
Sbjct  419   HDTTVDFWTPTFGGTFR  435



>dbj|BAK01805.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96198.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   174 bits (441),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -3

Query  947  AFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQV  768
            A K+PR ETPSP+PTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAI YI+FLH+QV
Sbjct  210  AAKKPRTETPSPMPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIGYIRFLHEQV  269

Query  767  NVLSAPYLKNGCSVSQHHQQDEEGR-KAELRSQGLCLVPISSTFPVATETTSDFWTPTFG  591
              LS+PY  +G    QH Q  ++G  K +LRS+GLCLVP++ST+ +A++T  + W PTFG
Sbjct  270  ASLSSPYFISGPMHLQHKQGSDDGEAKEDLRSRGLCLVPVASTYTMASDTAPELWHPTFG  329

Query  590  ASFR  579
             +F 
Sbjct  330  GTFH  333



>ref|NP_001152376.1| DNA binding protein [Zea mays]
 gb|ACG47311.1| DNA binding protein [Zea mays]
Length=455

 Score =   177 bits (449),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 109/148 (74%), Gaps = 12/148 (8%)
 Frame = -3

Query  986  SSSMAKKASNQEAA--FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASV  813
            SS + KK +N E A  FK+ R++TPSPLPTFKVRKEK+GDRVTALQQLV+PFGKTDTASV
Sbjct  308  SSIITKKKANGELAPAFKKSRLQTPSPLPTFKVRKEKVGDRVTALQQLVAPFGKTDTASV  367

Query  812  LHEAIEYIKFLHDQVNVLSAPYLK-NGCSV------SQHHQQDEEGRKAE--LRSQGLCL  660
            LHE IEYIKFLHDQV VLSAPYLK NG  V      S    +D+     E  L+ +GLCL
Sbjct  368  LHETIEYIKFLHDQVGVLSAPYLKNNGHQVPYLKRSSPDRSEDDSSHAGERSLKGRGLCL  427

Query  659  VPISSTFPVATETTSDF-WTPTFGASFR  579
            VPISSTF VA+E   DF W+  F ASFR
Sbjct  428  VPISSTFAVASEVPVDFGWSTAFAASFR  455



>ref|XP_002440027.1| hypothetical protein SORBIDRAFT_09g024720 [Sorghum bicolor]
 gb|EES18457.1| hypothetical protein SORBIDRAFT_09g024720 [Sorghum bicolor]
Length=344

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 133/201 (66%), Gaps = 11/201 (5%)
 Frame = -3

Query  1169  LLKPTFPNAAASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEAR  990
             + KPTF      F++ S  +  D+ AA  + +T+   L       L + + KS    E  
Sbjct  151   MTKPTF--RQQEFFDSSTRNFGDMPAAPPMTTTKPLLL-----QALEQKAFKSHKEPEQD  203

Query  989   QSSSMAKKASNQEA-AFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASV  813
               SS  +   +  A A K+PR+ TPSPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASV
Sbjct  204   ACSSATRSVPSSPAPAKKKPRVATPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASV  263

Query  812   LHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR-KAELRSQGLCLVPI-SSTF  639
             LHEAIEYI+FLHDQV  LS+PYL+ G  V Q  QQ + G  K +LRS+GLCLVP+ S+T+
Sbjct  264   LHEAIEYIRFLHDQVASLSSPYLRCGRPVQQLQQQQDGGEAKEDLRSRGLCLVPVASTTY  323

Query  638   PVAT-ETTSDFWTPTFGASFR  579
              VAT ET  +FW PTFG + +
Sbjct  324   AVATSETAPEFWPPTFGGTLQ  344



>gb|KFK39385.1| hypothetical protein AALP_AA3G238100 [Arabis alpina]
Length=438

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 101/138 (73%), Gaps = 7/138 (5%)
 Frame = -3

Query  974  AKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
             K+   ++ A KR + E  SP P FKVRKEK+GDR+ ALQQLVSPFGKTD ASVL EAIE
Sbjct  302  VKRGGGEQPAAKRAKSEAASPSPAFKVRKEKMGDRIAALQQLVSPFGKTDAASVLSEAIE  361

Query  794  YIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE------EGRKAELRSQGLCLVPISSTFPV  633
            YIKFLH QV+ LS PY+K+G S+ QH Q D          + +LRS+GLCLVP+SSTFPV
Sbjct  362  YIKFLHQQVSALSNPYMKSGASL-QHQQSDHTKDLEVSSEEPDLRSRGLCLVPVSSTFPV  420

Query  632  ATETTSDFWTPTFGASFR  579
              +TT DFWTPTFG +FR
Sbjct  421  THDTTVDFWTPTFGGTFR  438



>ref|XP_003566069.1| PREDICTED: transcription factor bHLH123-like [Brachypodium distachyon]
Length=318

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 108/155 (70%), Gaps = 13/155 (8%)
 Frame = -3

Query  1007  NVEEARQSSSMAKK---ASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPF  837
              V +   SSS  K+    +    A K+PRI+TPSPLPTFKVRKEKLGDR+TALQQLVSPF
Sbjct  165   QVHQDACSSSATKRNGAGAGSPVASKKPRIDTPSPLPTFKVRKEKLGDRITALQQLVSPF  224

Query  836   GKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGR-------KAELR  678
             GKTDTASVLHEAI YIKFLHDQV  LS+PYL + C  +   Q   +G        K +LR
Sbjct  225   GKTDTASVLHEAIGYIKFLHDQVASLSSPYLSS-CGRALQDQHQLQGSIKVDGKAKEDLR  283

Query  677   SQGLCLVPISSTFPVATETTSDFWTPTF--GASFR  579
             S+GLCLVP++ST+ VA E   +FW PTF  G +FR
Sbjct  284   SRGLCLVPVASTYTVANEAAPEFWNPTFGVGGTFR  318



>ref|NP_188700.1| transcription factor bHLH123 [Arabidopsis thaliana]
 sp|Q8GXT3.1|BH123_ARATH RecName: Full=Transcription factor bHLH123; AltName: Full=Basic 
helix-loop-helix protein 123; Short=AtbHLH123; Short=bHLH 
123; AltName: Full=Transcription factor EN 63; AltName: Full=bHLH 
transcription factor bHLH123 [Arabidopsis thaliana]
 dbj|BAC42685.1| putative bHLH transcription factor bHLH123 [Arabidopsis thaliana]
 gb|AAP40407.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76406.1| transcription factor bHLH123 [Arabidopsis thaliana]
Length=454

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 109/150 (73%), Gaps = 9/150 (6%)
 Frame = -3

Query  1007  NVEEARQSSS--MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             N+ E R SSS  + +  ++ + A KR + E  SP P FK RKEK+GDR+ ALQQLVSPFG
Sbjct  307   NISEIRDSSSNEVKRGGNDHQPAAKRAKSEAASPSPAFK-RKEKMGDRIAALQQLVSPFG  365

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQG  669
             KTD ASVL EAIEYIKFLH QV+ LS PY+K+G S+ QH Q D     E   + +LRS+G
Sbjct  366   KTDAASVLSEAIEYIKFLHQQVSALSNPYMKSGASL-QHQQSDHSTELEVSEEPDLRSRG  424

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVP+SSTFPV  +TT DFWTPTFG +FR
Sbjct  425   LCLVPVSSTFPVTHDTTVDFWTPTFGGTFR  454



>emb|CDX82232.1| BnaA03g35890D [Brassica napus]
Length=438

 Score =   173 bits (439),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 108/162 (67%), Gaps = 15/162 (9%)
 Frame = -3

Query  1049  VFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDR  870
             ++ D    P  KS+ V          K+    + A KR + E PSP P  KVRKEK+GDR
Sbjct  287   IYHDITKVPDSKSNEV----------KRGGADQPAAKRAKSEAPSPSPASKVRKEKMGDR  336

Query  869   VTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSV-----SQHHQQD  705
             + ALQQLVSPFGKTD ASVL EAIEY KFLH QV+ LS PY+K+G S+     S HH++ 
Sbjct  337   IAALQQLVSPFGKTDAASVLSEAIEYTKFLHQQVSALSNPYMKSGASLQHQQMSDHHKEL  396

Query  704   EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             E   + +LRS+GLCLVP+SS FPV  +TT DFWTPTFG +FR
Sbjct  397   EVSEEPDLRSRGLCLVPVSSIFPVTQDTTVDFWTPTFGGTFR  438



>dbj|BAB02240.1| unnamed protein product [Arabidopsis thaliana]
Length=516

 Score =   174 bits (440),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 109/150 (73%), Gaps = 9/150 (6%)
 Frame = -3

Query  1007  NVEEARQSSS--MAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFG  834
             N+ E R SSS  + +  ++ + A KR + E  SP P FK RKEK+GDR+ ALQQLVSPFG
Sbjct  369   NISEIRDSSSNEVKRGGNDHQPAAKRAKSEAASPSPAFK-RKEKMGDRIAALQQLVSPFG  427

Query  833   KTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQG  669
             KTD ASVL EAIEYIKFLH QV+ LS PY+K+G S+ QH Q D     E   + +LRS+G
Sbjct  428   KTDAASVLSEAIEYIKFLHQQVSALSNPYMKSGASL-QHQQSDHSTELEVSEEPDLRSRG  486

Query  668   LCLVPISSTFPVATETTSDFWTPTFGASFR  579
             LCLVP+SSTFPV  +TT DFWTPTFG +FR
Sbjct  487   LCLVPVSSTFPVTHDTTVDFWTPTFGGTFR  516



>emb|CDY43070.1| BnaCnng10760D [Brassica napus]
Length=437

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 125/195 (64%), Gaps = 13/195 (7%)
 Frame = -3

Query  1139  ASFWNQSPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSM-AK  969
             A+FWN  P +  +V       S  S + P++   ++  PS   + + + E + SSS   K
Sbjct  248   ATFWN--PTAAGNVGPTHHDAS--SNYFPALQPPQIHAPSFDEQPNGMSEIKDSSSSEVK  303

Query  968   KASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             +    + A KR + E  SP P  KV+KEK+ DR+ ALQQLVSPFGKTD ASVL EAIEYI
Sbjct  304   RVGGDQPAAKRAKSEATSPSPPLKVKKEKMSDRIAALQQLVSPFGKTDQASVLSEAIEYI  363

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHHQQD-----EEGRKAELRSQGLCLVPISSTFPVATE  624
             KFLH QV+ LS PY+ +G S+ QH Q D     E  ++ +LRSQGLCLVP+SSTFPV  +
Sbjct  364   KFLHQQVSALSNPYMNSGASL-QHQQSDHPKELEVSKEPDLRSQGLCLVPVSSTFPVTHD  422

Query  623   TTSDFWTPTFGASFR  579
             TT DFWT TFG +FR
Sbjct  423   TTVDFWTTTFGGTFR  437



>gb|EAZ05804.1| hypothetical protein OsI_28041 [Oryza sativa Indica Group]
Length=444

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 103/151 (68%), Gaps = 18/151 (12%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETPSPLPT-FKVRKEKLGDRVTALQQLVSPFGKTDTASVL  810
            SS + KKA       K+ R  TPS LPT FKVRKEKLGDRVTALQQLVSPFGKTDTASVL
Sbjct  297  SSIITKKAKADSTPLKKSRTGTPSALPTTFKVRKEKLGDRVTALQQLVSPFGKTDTASVL  356

Query  809  HEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEG--------------RKAELRSQ  672
            HE IEYIKFLHDQV  LSAPYLKN   V   H ++  G               K +L  +
Sbjct  357  HETIEYIKFLHDQVGALSAPYLKNRQQVP--HLKNSTGVDNDGGGGGEATAASKRDLTGR  414

Query  671  GLCLVPISSTFPVATETTSDFWTPTFGASFR  579
            GLCLVPISSTF VA+ET  DFWTP FGA+FR
Sbjct  415  GLCLVPISSTFAVASETPVDFWTP-FGAAFR  444



>ref|XP_006362967.1| PREDICTED: transcription factor bHLH123-like [Solanum tuberosum]
Length=106

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 7/107 (7%)
 Frame = -3

Query  881  LGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQD-  705
            +GDR+T LQQLVSPFGKTDTASVL EAIEYIKFLHDQ+ VLSAPY+++G S+ QH Q D 
Sbjct  1    MGDRITTLQQLVSPFGKTDTASVLSEAIEYIKFLHDQIGVLSAPYMESGASM-QHLQSDI  59

Query  704  -----EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
                  EGR  +LRS+GLCLVPISSTFPV  ET  D WTPTFG++FR
Sbjct  60   KSEDVREGRNKDLRSRGLCLVPISSTFPVTHETNVDLWTPTFGSTFR  106



>ref|XP_010538175.1| PREDICTED: transcription factor bHLH103 isoform X2 [Tarenaya 
hassleriana]
Length=314

 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = -3

Query  944  FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVN  765
             KRPRI+TPSPLP+F+VR EKLGDR+TALQQLVSPFGK DTASVL+EA+EYIKFLH QV 
Sbjct  190  LKRPRIDTPSPLPSFRVRNEKLGDRITALQQLVSPFGKNDTASVLNEAVEYIKFLHGQVA  249

Query  764  VLSAPYLKNGCSVSQHHQQDEE--GRKAELRSQGLCLVPISSTFPVATETT-SDFWTPTF  594
            VLS PY+K+G SV Q  Q  ++   ++ +LR +GLCL+PISSTF VA++   SDFW   F
Sbjct  250  VLSNPYMKSGASVHQVQQSSDKTASQREDLRRRGLCLMPISSTFLVASQMNPSDFWNLPF  309

Query  593  GASFR  579
              +F+
Sbjct  310  CVNFK  314



>ref|XP_010538167.1| PREDICTED: transcription factor bHLH103 isoform X1 [Tarenaya 
hassleriana]
Length=316

 Score =   163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = -3

Query  944  FKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVN  765
             KRPRI+TPSPLP+F+VR EKLGDR+TALQQLVSPFGK DTASVL+EA+EYIKFLH QV 
Sbjct  190  LKRPRIDTPSPLPSFRVRNEKLGDRITALQQLVSPFGKNDTASVLNEAVEYIKFLHGQVA  249

Query  764  VLSAPYLKNGCSVSQHHQQDEEGRKA----ELRSQGLCLVPISSTFPVATETT-SDFWTP  600
            VLS PY+K+G SV Q  Q+    + A    +LR +GLCL+PISSTF VA++   SDFW  
Sbjct  250  VLSNPYMKSGASVHQVQQEQSSDKTASQREDLRRRGLCLMPISSTFLVASQMNPSDFWNL  309

Query  599  TFGASFR  579
             F  +F+
Sbjct  310  PFCVNFK  316



>ref|XP_006449161.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
 gb|ESR62401.1| hypothetical protein CICLE_v10015039mg [Citrus clementina]
Length=461

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 116/188 (62%), Gaps = 33/188 (18%)
 Frame = -3

Query  1208  ANFRPNLNDFSPP--------LLKPTFPNAAAS-------------FWNQSPASLNDVRA  1092
             AN+  N N+ SPP         +KP+ P                  FWN +  +LND+  
Sbjct  262   ANYGNNYNEVSPPWPKFAAASFVKPSLPKQQQQQPSGGLHFSNNTPFWNAT--ALNDI--  317

Query  1091  ATFLPSTQSQFLPSVFSDKLSKPS--RKSSNVEEARQSSSMAKKASNQEAAFKRPRIETP  918
                  S     L +   +K + P+   K +N EE R S S AKK S+ E AFKRPRIETP
Sbjct  318   -----SRPGGLLAAELGEKRTCPTFTAKYNNNEEVRDSGSAAKKGSS-EPAFKRPRIETP  371

Query  917   SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKN  738
             SPLPTFKVRKEKLGDR+TALQQLVSPFGKTDTASVLHEAI+YIKFLHDQV+VL+ PY+K 
Sbjct  372   SPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVSVLTTPYMKQ  431

Query  737   GCSVSQHH  714
             G  + Q  
Sbjct  432   GTQIPQQQ  439



>ref|NP_001191254.1| uncharacterized protein LOC100533153 [Zea mays]
 gb|ACN25980.1| unknown [Zea mays]
Length=168

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 109/167 (65%), Gaps = 27/167 (16%)
 Frame = -3

Query  1016  KSSNVEEARQSSSMA---KKASNQEAAFKRPRIETPSPLP-TFKVRKEKLGDRVTALQQL  849
             KS+ +E AR  SS     K +++     K+ R  TPSPLP TFKVRKEKLGDR+TALQQL
Sbjct  8     KSALLEGARGDSSSITANKTSTDPTPRLKKSRTGTPSPLPATFKVRKEKLGDRITALQQL  67

Query  848   VSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKA------  687
             VSPFGKTDTASVLHE IEYIKFLHDQV  LS PYLK      ++ QQ+    K       
Sbjct  68    VSPFGKTDTASVLHETIEYIKFLHDQVGSLSVPYLK------KNRQQEVPPHKVLWDGGG  121

Query  686   -------ELRSQGLCLVPISSTFPVATETTS----DFWTPTFGASFR  579
                    EL  +GLCLVPISSTF VA+ETT+    DFWTP  G +FR
Sbjct  122   EAAGANGELTGRGLCLVPISSTFAVASETTTTPPLDFWTPFGGPAFR  168



>gb|KGN64594.1| hypothetical protein Csa_1G070590 [Cucumis sativus]
Length=359

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 118/181 (65%), Gaps = 14/181 (8%)
 Frame = -3

Query  1079  PSTQSQFL---PSVFSDKLS-KPSRKSSNVEEARQSSSMAKKA--SNQEAAFKRPRIET-  921
             P  Q+Q L   P  FS+ +  K   K    +E  +  S  ++   S + A  KRPR +  
Sbjct  179   PMFQTQLLHPPPLNFSNGIIPKCPTKLMGCDEVVEDWSRVERENESKEIAIIKRPRSDNL  238

Query  920   PSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLK  741
             PSPLPTFKVRKEKLGD++TALQQLVSPFGKTDTASVLHEAIEYIKFLH+Q+ VLS PY++
Sbjct  239   PSPLPTFKVRKEKLGDKITALQQLVSPFGKTDTASVLHEAIEYIKFLHNQIRVLSTPYME  298

Query  740   NGCS------VSQHHQQD-EEGRKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASF  582
              G        +S+   ++  E  K +LRS+GLCLV I ST  +A     +FW+PTFG +F
Sbjct  299   IGDQNQEPKIISEEELKNTNENMKEDLRSRGLCLVTIPSTVALANGNILNFWSPTFGGTF  358

Query  581   R  579
             R
Sbjct  359   R  359



>gb|KEH19697.1| BHLH transcription factor-like protein [Medicago truncatula]
Length=402

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 176/364 (48%), Gaps = 75/364 (21%)
 Frame = -3

Query  1628  SASDGSSVVLQELP-KSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQALVQTNE---  1461
             SAS  SSVV  +   K      + S + ++LHM+G+GLS   +   DWNQA +  NE   
Sbjct  49    SASGSSSVVFHDTTQKLQPSDSSTSNNDSNLHMMGLGLS---SQNIDWNQASILRNEKAS  105

Query  1460  ----RAMLQEDRNSR-LNYGQE-----IGVECS----------------DSSFKPVAKDF  1359
                 R+MLQE+ NS   N+ QE     IGVE S                 + FK V + F
Sbjct  106   EGSFRSMLQENLNSTGTNFEQETSGIGIGVELSHQVNWRQEKLFSNESSSNEFKQVNRGF  165

Query  1358  STSTP--------------SATNFAPSYNYPSNllqtlldsdpqpqpqqplisnqqISYA  1221
             S   P              S  + +  Y  PS L   L     Q QPQ       +    
Sbjct  166   SLDQPQFSPQYSSGDSNMISQMDSSALYGNPSMLQGLLGTETNQIQPQHGNSFENRSMNF  225

Query  1220  PPPPANFRPNLNDFSPPLLKPTFPNAA--------------ASFWNQSPASLNDVRAATF  1083
             P    ++  + N+  P   K +  N                A FWN S  ++ D  ++  
Sbjct  226   PYSSTSYGLSTNELIPSWSKVSHQNQKQHQQPNNQLHFTNNAPFWNASETTIKDASSSFL  285

Query  1082  LPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPT  903
              P T   F              ++ N+ E R SS+M KK S  E A KR + ETPSPLP 
Sbjct  286   PPFTTPNF------------GAQTKNISEGRDSSAMVKK-SGSEPAPKRSKNETPSPLPA  332

Query  902   FKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVS  723
             FKVRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIKFLH+QV VLS PY+K+G  + 
Sbjct  333   FKVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKFLHEQVTVLSTPYMKSGAPI-  391

Query  722   QHHQ  711
             QH Q
Sbjct  392   QHQQ  395



>ref|XP_003571405.1| PREDICTED: transcription factor bHLH112-like [Brachypodium distachyon]
Length=390

 Score =   161 bits (408),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 100/148 (68%), Gaps = 13/148 (9%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETP-SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVL  810
            SS +  K ++     K+ R  TP SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVL
Sbjct  244  SSCVVTKKTSSGPTAKKARTGTPPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVL  303

Query  809  HEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQ----------DEEGRKAELRSQGLCL  660
            HE IEYIKFLHDQV   SAPYLKN      H +            EE    +L  +GLCL
Sbjct  304  HETIEYIKFLHDQVGAHSAPYLKNRQQQVPHSKSSSTDKKDNNGGEEAAARDLTGRGLCL  363

Query  659  VPISSTFPVATET-TSDFWTPTFGASFR  579
            VPISSTF VA+ET   D+W P FGA+FR
Sbjct  364  VPISSTFAVASETPVVDYWNP-FGAAFR  390



>gb|EPS73915.1| hypothetical protein M569_00841, partial [Genlisea aurea]
Length=114

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 7/114 (6%)
 Frame = -3

Query  899  KVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQ  720
            +VRKEK+GDR+TALQQLVSPFGKTDTASVL EAIEYIK+LH+QVNVLS+PY+K      Q
Sbjct  1    QVRKEKMGDRITALQQLVSPFGKTDTASVLSEAIEYIKYLHEQVNVLSSPYMKVASPTQQ  60

Query  719  HHQQDE------EGRKAELRSQGLCLVPISSTFPVATET-TSDFWTPTFGASFR  579
            H  Q +         + +LRS+GLCLVP+SSTFP+A E+   DFWTPTFG++ R
Sbjct  61   HMHQKQVRATTRSNEETDLRSRGLCLVPVSSTFPMANESGVVDFWTPTFGSNLR  114



>ref|XP_008441703.1| PREDICTED: transcription factor bHLH112-like isoform X1 [Cucumis 
melo]
Length=359

 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  971  KKASNQEAAFKRPRIE-TPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIE  795
            +  S + A  KRPR + + SPLPTFKVRKEKLGD++TALQQLVSPFGKTDTASVLHEAIE
Sbjct  221  ENESKEIAIIKRPRSDNSSSPLPTFKVRKEKLGDKITALQQLVSPFGKTDTASVLHEAIE  280

Query  794  YIKFLHDQVNVLSAPYLKNG-------CSVSQHHQQDEEGRKAELRSQGLCLVPISSTFP  636
            YIKFLH+Q+ VLS PY++ G         + +  +   E  K +LRS+GLCLV I ST  
Sbjct  281  YIKFLHNQIRVLSTPYMEIGDHNQEPKIIIEEELKNTNENMKEDLRSRGLCLVTIPSTVA  340

Query  635  VATETTSDFWTPTFGASFR  579
            +A     +FW+PTFG +FR
Sbjct  341  LANGNILNFWSPTFGGTFR  359



>gb|KDO74385.1| hypothetical protein CISIN_1g043722mg, partial [Citrus sinensis]
Length=437

 Score =   161 bits (408),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 118/195 (61%), Gaps = 35/195 (18%)
 Frame = -3

Query  1139  ASFWNQS-PASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMA-KK  966
             A FWN S P SLNDVR+  F PS Q+ +    F +K   P    S V +   SSS+A KK
Sbjct  270   APFWNASAPTSLNDVRSPNFFPSLQTPYATQTFDEK---PKHHVSEVRD--NSSSIAVKK  324

Query  965   ASNQEAAFKRPRIETP-SPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYI  789
             +S  E A KR + + P SPLP FKVRKEK+GDR+TALQQLVSPFGK              
Sbjct  325   SSGGEPASKRAKNDQPASPLPAFKVRKEKMGDRITALQQLVSPFGK--------------  370

Query  788   KFLHDQVNVLSAPYLKNGCSVSQHH-----QQDEEGRKAELRSQGLCLVPISSTFPVATE  624
                     VLS PY+K+G +   H       +D EG K +LRS+GLCLVP+SSTFPV  E
Sbjct  371   --------VLSTPYMKSGGAPIPHQPNSEKVKDSEGPKQDLRSRGLCLVPVSSTFPVTHE  422

Query  623   TTSDFWTPTFGASFR  579
             TT DFWTPTFG +FR
Sbjct  423   TTVDFWTPTFGGTFR  437



>ref|XP_008366245.1| PREDICTED: transcription factor bHLH123-like isoform X3 [Malus 
domestica]
Length=432

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 117/194 (60%), Gaps = 39/194 (20%)
 Frame = -3

Query  1139  ASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A FWN    A++ DVR  +F PS Q QF  + F +K         N+ E ++S ++ KK 
Sbjct  271   APFWNAPHEAAMKDVRP-SFFPSLQPQFPTARFDEK-------PKNISEVQESGAVGKK-  321

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S  E   KRPR ET SPLP FKVRKEK+GDR+TALQQLVSPFGK                
Sbjct  322   SGSEVVSKRPRNETSSPLPAFKVRKEKMGDRITALQQLVSPFGK----------------  365

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATET  621
                   VLS PY+K+G ++ QH QQ      D +G K +L S+GLCLVP+SSTFPV  ET
Sbjct  366   ------VLSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLSSRGLCLVPVSSTFPVTHET  418

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG ++R
Sbjct  419   TVDFWTPTFGGTYR  432


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 97/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPBMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+ +GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMALGL---SSXATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWRDKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|NP_001175413.1| Os08g0179400 [Oryza sativa Japonica Group]
 gb|EAZ41720.1| hypothetical protein OsJ_26257 [Oryza sativa Japonica Group]
 dbj|BAH94141.1| Os08g0179400 [Oryza sativa Japonica Group]
Length=467

 Score =   160 bits (405),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 103/176 (59%), Gaps = 43/176 (24%)
 Frame = -3

Query  986  SSSMAKKASNQEAAFKRPRIETPSPLPT-------------------------FKVRKEK  882
            SS + KKA       K+ R  TPSPLPT                         F VRKEK
Sbjct  295  SSIITKKAKADSTPLKKSRTGTPSPLPTTFKACVYIYIIFNLSQMVIDFLPIKFHVRKEK  354

Query  881  LGDRVTALQQLVSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDE  702
            LGDRVTALQQLVSPFGKTDTASVLHE IEYIKFLHDQV  LSAPYLKN   V   H ++ 
Sbjct  355  LGDRVTALQQLVSPFGKTDTASVLHETIEYIKFLHDQVGALSAPYLKNRQQVP--HLKNS  412

Query  701  EG---------------RKAELRSQGLCLVPISSTFPVATETTSDFWTPTFGASFR  579
             G                K +L  +GLCLVPISSTF VA+ET  DFWTP FGA+FR
Sbjct  413  TGVDNDGGGGGGEATAASKRDLTGRGLCLVPISSTFAVASETPVDFWTP-FGAAFR  467



>ref|NP_001170271.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACN36443.1| unknown [Zea mays]
 gb|AFW78570.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=394

 Score =   159 bits (401),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 108/160 (68%), Gaps = 15/160 (9%)
 Frame = -3

Query  1013  SSNVEEARQ---SSSMAKKASNQEAAFKRPRI-ETPSPLPTFKVRKEKLGDRVTALQQLV  846
             S + E  RQ   SS+    A    A  K+PR+  TPSPLPTFKVRKEKLGDR+TALQQLV
Sbjct  235   SHHKERTRQHDASSATTASAPGSPAPAKKPRVVATPSPLPTFKVRKEKLGDRITALQQLV  294

Query  845   SPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNG-----CSVSQHHQQDEEG--RKA  687
             SPFGKTDTASVLHEAIEYI+FLHDQV  LS+PYL  G         +   +D+ G   K 
Sbjct  295   SPFGKTDTASVLHEAIEYIRFLHDQVASLSSPYLGCGRPVVQQIQQRRQAKDDGGAAAKE  354

Query  686   ELRSQGLCLVPISS--TFPVAT--ETTSDFWTPTFGASFR  579
             +LRS+GLCLVP++S  T+ VA   ET  +FW P FG + R
Sbjct  355   DLRSRGLCLVPVASTTTYAVAAGGETAPEFWLPNFGGTLR  394



>ref|XP_009377293.1| PREDICTED: transcription factor bHLH123-like isoform X3 [Pyrus 
x bretschneideri]
Length=432

 Score =   159 bits (402),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 117/194 (60%), Gaps = 39/194 (20%)
 Frame = -3

Query  1139  ASFWNQ-SPASLNDVRAATFLPSTQSQFLPSVFSDKLSKPSRKSSNVEEARQSSSMAKKA  963
             A FWN    A++ DVR  +F PS Q QF  + F +K         N+ E ++S ++ KK 
Sbjct  271   APFWNAPHEAAMKDVRP-SFFPSLQPQFPAARFDEK-------PKNISEVQESGAVGKK-  321

Query  962   SNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGKTDTASVLHEAIEYIKF  783
             S  E   KRPR ET S LP FKVRKEK+GDR+TALQQLVSPFGK                
Sbjct  322   SGSEVVSKRPRNETSSALPAFKVRKEKMGDRITALQQLVSPFGK----------------  365

Query  782   LHDQVNVLSAPYLKNGCSVSQHHQQ------DEEGRKAELRSQGLCLVPISSTFPVATET  621
                   +LS PY+K+G ++ QH QQ      D +G K +LRS+GLCLVP+SSTFPV  ET
Sbjct  366   ------ILSTPYMKSGTAI-QHQQQMSDKSKDPDGPKQDLRSRGLCLVPVSSTFPVTHET  418

Query  620   TSDFWTPTFGASFR  579
             T DFWTPTFG ++R
Sbjct  419   TVDFWTPTFGGTYR  432


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 98/192 (51%), Gaps = 41/192 (21%)
 Frame = -3

Query  1829  MADDFMTAGVCGGGSWWNPA-RSMF-GASPCSAATINDMGNFAWAnnddhhhhHQLVNMK  1656
             MAD+F T G     +WW+ + R+ F   +   ++++N +G+F W           +V++K
Sbjct  1     MADEFQTPG-----NWWDSSSRTRFETGASPPSSSLNSLGSFGW--------QPDMVDIK  47

Query  1655  GRSSDESCGSASDGSSVVLQELPKSHHQTHNMSMDSTHLHMLGIGLSPSSTATTDWNQAL  1476
              RSS +S GS S  SS+V  +  K    + + S    +LHM+G+GL   S+  TDWNQAL
Sbjct  48    ARSSMDS-GSVSGTSSMVFHDTHKLQEGSDSASGGDPNLHMMGLGL---SSQATDWNQAL  103

Query  1475  -----VQTNERAMLQEDRNSRL-NYGQEIGVE-----------CSDSS--FKPVAKDFST  1353
                   +T+ R++LQE+ NS   N+ QE   +           C DSS  FK + + FS 
Sbjct  104   FRGEKAETSFRSILQENMNSSTANFQQESDQQLQWREKLFAGGCGDSSNEFKQMNRGFSL  163

Query  1352  STPSATNFAPSY  1317
                  T F+P Y
Sbjct  164   ---DQTQFSPQY  172



>ref|XP_008662298.1| PREDICTED: uncharacterized protein LOC100502402 isoform X1 [Zea 
mays]
 gb|AFW56880.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=426

 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 109/167 (65%), Gaps = 27/167 (16%)
 Frame = -3

Query  1016  KSSNVEEARQSSSMA---KKASNQEAAFKRPRIETPSPLP-TFKVRKEKLGDRVTALQQL  849
             KS+ +E AR  SS     K +++     K+ R  TPSPLP TFKVRKEKLGDR+TALQQL
Sbjct  266   KSALLEGARGDSSSITANKTSTDPTPRLKKSRTGTPSPLPATFKVRKEKLGDRITALQQL  325

Query  848   VSPFGKTDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKA------  687
             VSPFGKTDTASVLHE IEYIKFLHDQV  LS PYLK      ++ QQ+    K       
Sbjct  326   VSPFGKTDTASVLHETIEYIKFLHDQVGSLSVPYLK------KNRQQEVPPHKVLWDGGG  379

Query  686   -------ELRSQGLCLVPISSTFPVATETTS----DFWTPTFGASFR  579
                    EL  +GLCLVPISSTF VA+ETT+    DFWTP  G +FR
Sbjct  380   EAAGANGELTGRGLCLVPISSTFAVASETTTTPPLDFWTPFGGPAFR  426



>ref|XP_006849290.1| hypothetical protein AMTR_s00167p00019840 [Amborella trichopoda]
 gb|ERN10871.1| hypothetical protein AMTR_s00167p00019840 [Amborella trichopoda]
Length=159

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 96/139 (69%), Gaps = 2/139 (1%)
 Frame = -3

Query  1010  SNVEEARQSSSMAKKASNQEAAFKRPRIETPSPLPTFKVRKEKLGDRVTALQQLVSPFGK  831
             +++E  + S S+          FK+P++++ + +P  KVRKEKLG+R+TALQQLVSP+GK
Sbjct  16    ASIEHKKHSGSVEHGNGEAGVQFKKPKVDSSASVP-LKVRKEKLGERITALQQLVSPYGK  74

Query  830   TDTASVLHEAIEYIKFLHDQVNVLSAPYLKNGCSVSQHHQQDEEGRKAELRSQGLCLVPI  651
             TDTASVLHEA+ YI+FLHDQV VLS PYL+     S   +  EE  K +LRS+GLCLVP+
Sbjct  75    TDTASVLHEAMGYIRFLHDQVQVLSTPYLQR-IPPSSLREAGEEESKYDLRSRGLCLVPV  133

Query  650   SSTFPVATETTSDFWTPTF  594
             S T  VA+   +DFW P  
Sbjct  134   SCTLHVASSNGADFWAPAM  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208