BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20594_g1_i2 len=2041 path=[735:0-502 126:503-565 @1299@!:566-1475
277:1476-1691 493:1692-2040]

Length=2041
                                                                      Score     E

ref|XP_009764521.1|  PREDICTED: ras GTPase-activating protein-bin...    399   4e-128   
ref|XP_006365663.1|  PREDICTED: ras GTPase-activating protein-bin...    386   5e-123   
ref|XP_009620581.1|  PREDICTED: ras GTPase-activating protein-bin...    378   6e-120   
ref|XP_006338359.1|  PREDICTED: ras GTPase-activating protein-bin...    372   6e-118   
ref|XP_010316213.1|  PREDICTED: ras GTPase-activating protein-bin...    370   5e-117   
ref|XP_004232159.1|  PREDICTED: ras GTPase-activating protein-bin...    370   8e-117   
ref|XP_011085688.1|  PREDICTED: ras GTPase-activating protein-bin...    369   2e-116   
ref|XP_006338360.1|  PREDICTED: ras GTPase-activating protein-bin...    366   2e-115   
ref|XP_011098753.1|  PREDICTED: ras GTPase-activating protein-bin...    361   3e-113   
ref|XP_010317135.1|  PREDICTED: ras GTPase-activating protein-bin...    358   6e-113   
ref|XP_004233930.1|  PREDICTED: ras GTPase-activating protein-bin...    358   3e-112   
ref|XP_010317134.1|  PREDICTED: ras GTPase-activating protein-bin...    342   4e-106   
ref|XP_007032760.1|  Nuclear transport factor 2 family protein wi...    338   9e-105   
ref|XP_007032761.1|  Nuclear transport factor 2 family protein wi...    333   1e-102   
ref|XP_002527619.1|  Ras-GTPase-activating protein-binding protei...    328   8e-101   Ricinus communis
ref|XP_010105383.1|  Putative G3BP-like protein                         326   2e-99    
ref|XP_002324119.2|  hypothetical protein POPTR_0017s13030g             321   4e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011000072.1|  PREDICTED: putative G3BP-like protein              320   2e-97    
gb|KDP27249.1|  hypothetical protein JCGZ_19948                         318   6e-97    
gb|KHG02028.1|  Putative G3BP-like protein                              313   4e-95    
ref|XP_006482760.1|  PREDICTED: ras GTPase-activating protein-bin...    312   1e-94    
gb|EYU34602.1|  hypothetical protein MIMGU_mgv1a006211mg                311   1e-94    
ref|XP_006585784.1|  PREDICTED: ras GTPase-activating protein-bin...    309   2e-93    
ref|XP_006585781.1|  PREDICTED: ras GTPase-activating protein-bin...    310   2e-93    
ref|XP_006431303.1|  hypothetical protein CICLE_v10011679mg             306   2e-92    
ref|XP_007215342.1|  hypothetical protein PRUPE_ppa005348mg             306   3e-92    
ref|XP_006431304.1|  hypothetical protein CICLE_v10011679mg             304   1e-91    
ref|XP_008230886.1|  PREDICTED: ras GTPase-activating protein-bin...    304   2e-91    
ref|XP_010089638.1|  Putative G3BP-like protein                         303   2e-91    
ref|XP_006585783.1|  PREDICTED: ras GTPase-activating protein-bin...    303   9e-91    
gb|KHN14035.1|  Putative G3BP-like protein                              299   3e-89    
ref|XP_010315778.1|  PREDICTED: putative G3BP-like protein              290   4e-88    
ref|XP_004489526.1|  PREDICTED: ras GTPase-activating protein-bin...    295   5e-88    
ref|XP_004306069.1|  PREDICTED: putative G3BP-like protein-like         296   7e-88    
ref|XP_010258034.1|  PREDICTED: putative G3BP-like protein              294   2e-87    
gb|KEH21657.1|  ras GTPase-activating binding-like protein              289   1e-85    
ref|XP_010260138.1|  PREDICTED: ras GTPase-activating protein-bin...    288   2e-85    
ref|XP_007139478.1|  hypothetical protein PHAVU_008G032800g             296   4e-85    
ref|XP_007139477.1|  hypothetical protein PHAVU_008G032800g             295   6e-85    
gb|ACU19575.1|  unknown                                                 286   6e-85    Glycine max [soybeans]
ref|XP_006600586.1|  PREDICTED: ras GTPase-activating protein-bin...    285   1e-84    
ref|XP_008379436.1|  PREDICTED: ras GTPase-activating protein-bin...    285   3e-84    
ref|XP_010660605.1|  PREDICTED: ras GTPase-activating protein-bin...    283   1e-83    
ref|XP_007155227.1|  hypothetical protein PHAVU_003G184000g             283   2e-83    
ref|XP_003524604.1|  PREDICTED: ras GTPase-activating protein-bin...    283   2e-83    
ref|XP_009365922.1|  PREDICTED: ras GTPase-activating protein-bin...    282   3e-83    
gb|KEH21658.1|  ras GTPase-activating binding-like protein              282   4e-83    
ref|XP_009365886.1|  PREDICTED: ras GTPase-activating protein-bin...    282   4e-83    
ref|XP_010660607.1|  PREDICTED: ras GTPase-activating protein-bin...    281   4e-83    
ref|XP_007209111.1|  hypothetical protein PRUPE_ppa005346mg             279   3e-82    
gb|EPS71512.1|  hypothetical protein M569_03247                         279   4e-82    
ref|XP_008374641.1|  PREDICTED: putative G3BP-like protein isofor...    279   6e-82    
gb|KEH32036.1|  ras GTPase-activating binding-like protein              278   6e-82    
ref|XP_008357785.1|  PREDICTED: ras GTPase-activating protein-bin...    278   7e-82    
gb|KHG21577.1|  Putative G3BP-like protein                              278   1e-81    
gb|KDP31359.1|  hypothetical protein JCGZ_11735                         278   2e-81    
ref|XP_008453282.1|  PREDICTED: ras GTPase-activating protein-bin...    276   4e-81    
emb|CBI21211.3|  unnamed protein product                                282   7e-81    
ref|XP_009346023.1|  PREDICTED: putative G3BP-like protein isofor...    275   1e-80    
ref|XP_010528411.1|  PREDICTED: ras GTPase-activating protein-bin...    274   2e-80    
ref|XP_006374412.1|  nuclear transport factor 2 family protein          272   3e-80    
ref|XP_010695230.1|  PREDICTED: ras GTPase-activating protein-bin...    273   6e-80    
ref|XP_011006569.1|  PREDICTED: putative G3BP-like protein isofor...    273   1e-79    
ref|XP_008374643.1|  PREDICTED: putative G3BP-like protein isofor...    272   2e-79    
ref|XP_008240007.1|  PREDICTED: ras GTPase-activating protein-bin...    272   2e-79    
ref|XP_010315752.1|  PREDICTED: putative G3BP-like protein              265   3e-79    
ref|XP_004169646.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...    271   5e-79    
ref|XP_009338199.1|  PREDICTED: ras GTPase-activating protein-bin...    270   8e-79    
ref|XP_009338177.1|  PREDICTED: ras GTPase-activating protein-bin...    270   9e-79    
ref|XP_002514643.1|  RNA binding protein, putative                      270   1e-78    Ricinus communis
ref|XP_004138199.1|  PREDICTED: ras GTPase-activating protein-bin...    270   1e-78    
ref|XP_008240008.1|  PREDICTED: ras GTPase-activating protein-bin...    270   1e-78    
ref|XP_011006568.1|  PREDICTED: putative G3BP-like protein isofor...    269   4e-78    
ref|XP_009346030.1|  PREDICTED: putative G3BP-like protein isofor...    268   4e-78    
gb|KDO72776.1|  hypothetical protein CISIN_1g0125641mg                  264   5e-78    
ref|XP_011006566.1|  PREDICTED: putative G3BP-like protein isofor...    268   6e-78    
ref|XP_008367558.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...    268   7e-78    
ref|XP_007037585.1|  RNA binding protein, putative isoform 1            267   9e-78    
ref|XP_007037586.1|  RNA binding protein, putative isoform 2            265   6e-77    
ref|XP_009338191.1|  PREDICTED: ras GTPase-activating protein-bin...    264   2e-76    
ref|XP_009338207.1|  PREDICTED: ras GTPase-activating protein-bin...    263   3e-76    
gb|KEH32035.1|  ras GTPase-activating binding-like protein              260   4e-76    
ref|XP_004299295.1|  PREDICTED: ras GTPase-activating protein-bin...    262   1e-75    
gb|KEH32034.1|  ras GTPase-activating binding-like protein              258   3e-75    
ref|XP_010660608.1|  PREDICTED: putative G3BP-like protein isofor...    259   3e-75    
gb|KHG02603.1|  Putative G3BP-like protein                              257   6e-74    
ref|XP_010546208.1|  PREDICTED: ras GTPase-activating protein-bin...    256   2e-73    
ref|XP_007037587.1|  RNA binding protein, putative isoform 3            250   2e-72    
ref|XP_010663446.1|  PREDICTED: putative G3BP-like protein isofor...    253   2e-72    
emb|CDP19749.1|  unnamed protein product                                253   9e-72    
gb|KHG13524.1|  nxt3                                                    250   3e-71    
ref|XP_006848484.1|  hypothetical protein AMTR_s00013p00254870          250   3e-71    
ref|XP_010522574.1|  PREDICTED: ras GTPase-activating protein-bin...    248   2e-70    
emb|CAN77669.1|  hypothetical protein VITISV_038107                     258   2e-70    Vitis vinifera
ref|XP_009136424.1|  PREDICTED: ras GTPase-activating protein-bin...    246   6e-70    
ref|XP_009136423.1|  PREDICTED: ras GTPase-activating protein-bin...    246   6e-70    
ref|XP_010663448.1|  PREDICTED: putative G3BP-like protein isofor...    246   8e-70    
emb|CBI15315.3|  unnamed protein product                                247   1e-69    
gb|KHN13549.1|  Putative G3BP-like protein                              247   6e-69    
ref|XP_002864713.1|  nuclear transport factor 2 family protein          244   7e-69    
ref|XP_010443914.1|  PREDICTED: ras GTPase-activating protein-bin...    244   7e-69    
gb|KDO65713.1|  hypothetical protein CISIN_1g012356mg                   243   2e-68    
ref|XP_006477682.1|  PREDICTED: ras GTPase-activating protein-bin...    243   2e-68    
ref|XP_010456883.1|  PREDICTED: ras GTPase-activating protein-bin...    242   2e-68    
ref|XP_010037242.1|  PREDICTED: ras GTPase-activating protein-bin...    242   3e-68    
ref|XP_008791326.1|  PREDICTED: ras GTPase-activating protein-bin...    242   3e-68    
ref|XP_006440772.1|  hypothetical protein CICLE_v10020038mg             242   4e-68    
ref|XP_010939185.1|  PREDICTED: putative G3BP-like protein isofor...    241   5e-68    
emb|CDY02179.1|  BnaA03g39880D                                          242   6e-68    
ref|NP_200906.2|  nuclear transport factor 2 and RNA recognition ...    240   1e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483757.1|  PREDICTED: ras GTPase-activating protein-bin...    240   1e-67    
ref|XP_009136425.1|  PREDICTED: ras GTPase-activating protein-bin...    239   2e-67    
ref|XP_010030762.1|  PREDICTED: ras GTPase-activating protein-bin...    239   2e-67    
ref|XP_010037241.1|  PREDICTED: ras GTPase-activating protein-bin...    239   3e-67    
ref|XP_010246715.1|  PREDICTED: ras GTPase-activating protein-bin...    239   4e-67    
ref|XP_010246716.1|  PREDICTED: ras GTPase-activating protein-bin...    239   6e-67    
ref|XP_006394546.1|  hypothetical protein EUTSA_v100055271mg            237   1e-66    
ref|XP_010030774.1|  PREDICTED: putative G3BP-like protein isofor...    237   1e-66    
ref|XP_008810750.1|  PREDICTED: ras GTPase-activating protein-bin...    236   7e-66    
ref|XP_008792919.1|  PREDICTED: ras GTPase-activating protein-bin...    235   1e-65    
ref|XP_010274054.1|  PREDICTED: ras GTPase-activating protein-bin...    235   1e-65    
ref|XP_006484219.1|  PREDICTED: ras GTPase-activating protein-bin...    234   2e-65    
ref|NP_851235.1|  nuclear transport factor 2 and RNA recognition ...    233   4e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483758.1|  PREDICTED: ras GTPase-activating protein-bin...    233   4e-65    
ref|XP_006845877.1|  hypothetical protein AMTR_s00154p00067340          231   1e-64    
ref|XP_009130140.1|  PREDICTED: ras GTPase-activating protein-bin...    231   2e-64    
emb|CDY42844.1|  BnaAnng06690D                                          231   2e-64    
gb|AAM62628.1|  ras-GTPase-activating protein SH3-domain binding ...    231   4e-64    Arabidopsis thaliana [mouse-ear cress]
emb|CDY23092.1|  BnaC07g30950D                                          231   6e-64    
gb|KHG13523.1|  nxt3                                                    230   1e-63    
ref|XP_008792920.1|  PREDICTED: ras GTPase-activating protein-bin...    229   3e-63    
emb|CDY47006.1|  BnaC02g41910D                                          228   3e-63    
ref|XP_010936467.1|  PREDICTED: putative G3BP-like protein              229   4e-63    
emb|CAN80261.1|  hypothetical protein VITISV_043950                     238   4e-63    Vitis vinifera
ref|XP_004247060.1|  PREDICTED: putative G3BP-like protein              228   8e-63    
ref|XP_009130141.1|  PREDICTED: ras GTPase-activating protein-bin...    225   4e-62    
gb|KDO65714.1|  hypothetical protein CISIN_1g012356mg                   223   4e-62    
ref|XP_009799393.1|  PREDICTED: putative G3BP-like protein isofor...    226   4e-62    
ref|XP_009111969.1|  PREDICTED: ras GTPase-activating protein-bin...    224   8e-62    
gb|KCW83734.1|  hypothetical protein EUGRSUZ_B00605                     220   2e-61    
gb|ABR16060.1|  unknown                                                 223   3e-61    Picea sitchensis
emb|CDP03910.1|  unnamed protein product                                220   4e-61    
ref|XP_008661434.1|  PREDICTED: uncharacterized protein LOC100193...    223   1e-60    
ref|XP_006352678.1|  PREDICTED: putative G3BP-like protein-like i...    221   2e-60    
ref|XP_006352679.1|  PREDICTED: putative G3BP-like protein-like i...    221   2e-60    
ref|XP_009799392.1|  PREDICTED: putative G3BP-like protein isofor...    221   2e-60    
ref|XP_007049693.1|  Nuclear transport factor 2 family protein wi...    219   3e-60    
gb|EMT20814.1|  Ras GTPase-activating protein-binding protein 1         223   3e-60    
ref|XP_010649833.1|  PREDICTED: ras GTPase-activating protein-bin...    221   3e-60    
ref|XP_009775381.1|  PREDICTED: putative G3BP-like protein isofor...    220   4e-60    
ref|XP_009390807.1|  PREDICTED: ras GTPase-activating protein-bin...    219   6e-60    
ref|XP_009799394.1|  PREDICTED: putative G3BP-like protein isofor...    219   8e-60    
ref|XP_009775385.1|  PREDICTED: putative G3BP-like protein isofor...    219   9e-60    
ref|XP_007049692.1|  Nuclear transport factor 2 family protein wi...    219   1e-59    
gb|KHG08250.1|  Putative G3BP-like protein                              218   2e-59    
ref|XP_009111970.1|  PREDICTED: ras GTPase-activating protein-bin...    218   2e-59    
gb|KCW48428.1|  hypothetical protein EUGRSUZ_K02132                     217   4e-59    
ref|XP_010036786.1|  PREDICTED: ras GTPase-activating protein-bin...    216   1e-58    
ref|XP_009775384.1|  PREDICTED: putative G3BP-like protein isofor...    215   2e-58    
ref|XP_009614846.1|  PREDICTED: putative G3BP-like protein isofor...    215   2e-58    
ref|XP_004505359.1|  PREDICTED: ras GTPase-activating protein-bin...    214   3e-58    
ref|XP_004505357.1|  PREDICTED: ras GTPase-activating protein-bin...    214   3e-58    
ref|XP_008777906.1|  PREDICTED: LOW QUALITY PROTEIN: ras GTPase-a...    214   7e-58    
ref|XP_008792921.1|  PREDICTED: ras GTPase-activating protein-bin...    213   1e-57    
emb|CDX87195.1|  BnaC09g05100D                                          214   1e-57    
ref|XP_004242411.1|  PREDICTED: putative G3BP-like protein isofor...    213   2e-57    
ref|XP_008789695.1|  PREDICTED: ras GTPase-activating protein-bin...    212   3e-57    
ref|XP_006352680.1|  PREDICTED: putative G3BP-like protein-like i...    212   4e-57    
ref|XP_006352681.1|  PREDICTED: putative G3BP-like protein-like i...    212   4e-57    
ref|XP_010323092.1|  PREDICTED: putative G3BP-like protein isofor...    211   5e-57    
gb|KHN42950.1|  Putative G3BP-like protein                              208   7e-57    
ref|XP_009614845.1|  PREDICTED: putative G3BP-like protein isofor...    211   8e-57    
ref|XP_009775383.1|  PREDICTED: putative G3BP-like protein isofor...    211   8e-57    
ref|XP_009614849.1|  PREDICTED: putative G3BP-like protein isofor...    210   1e-56    
gb|EYU44203.1|  hypothetical protein MIMGU_mgv1a010963mg                205   2e-56    
ref|XP_009415829.1|  PREDICTED: putative G3BP-like protein              210   2e-56    
ref|XP_010907890.1|  PREDICTED: ras GTPase-activating protein-bin...    209   6e-56    
ref|XP_008351895.1|  PREDICTED: putative G3BP-like protein              205   7e-56    
ref|XP_009412729.1|  PREDICTED: putative G3BP-like protein isofor...    207   2e-55    
ref|XP_009404225.1|  PREDICTED: ras GTPase-activating protein-bin...    206   3e-55    
gb|AES79079.2|  nuclear transport factor 2 and RNA recognition mo...    208   3e-55    
dbj|BAE71310.1|  putative ras-GTPase-activating protein SH3-domai...    206   4e-55    Trifolium pratense [peavine clover]
ref|XP_009614848.1|  PREDICTED: putative G3BP-like protein isofor...    206   4e-55    
ref|XP_004505360.1|  PREDICTED: ras GTPase-activating protein-bin...    206   4e-55    
dbj|BAE71222.1|  putative ras-GTPase-activating protein SH3-domai...    205   5e-55    Trifolium pratense [peavine clover]
ref|XP_004505358.1|  PREDICTED: ras GTPase-activating protein-bin...    205   6e-55    
gb|KDP26351.1|  hypothetical protein JCGZ_17509                         206   6e-55    
ref|XP_009372228.1|  PREDICTED: putative G3BP-like protein              206   7e-55    
ref|XP_009614851.1|  PREDICTED: putative G3BP-like protein isofor...    205   8e-55    
ref|XP_009628137.1|  PREDICTED: putative G3BP-like protein isofor...    202   9e-55    
ref|XP_008805144.1|  PREDICTED: ras GTPase-activating protein-bin...    204   1e-54    
ref|XP_009799395.1|  PREDICTED: putative G3BP-like protein isofor...    202   1e-54    
gb|AFK42895.1|  unknown                                                 204   2e-54    
ref|XP_009628139.1|  PREDICTED: putative G3BP-like protein isofor...    201   2e-54    
ref|XP_010323093.1|  PREDICTED: putative G3BP-like protein isofor...    204   4e-54    
gb|KEH22794.1|  nuclear transport factor 2 and RNA recognition mo...    204   4e-54    
ref|XP_007157833.1|  hypothetical protein PHAVU_002G102000g             202   6e-54    
ref|XP_008382599.1|  PREDICTED: putative G3BP-like protein              203   7e-54    
ref|XP_003607810.1|  Ras GTPase-activating protein-binding protein      202   8e-54    
gb|AES90007.2|  ras-GTPase-activating protein-binding protein, pu...    202   9e-54    
ref|XP_010323094.1|  PREDICTED: putative G3BP-like protein isofor...    202   9e-54    
ref|XP_006280786.1|  hypothetical protein CARUB_v10026755mg             198   1e-53    
ref|XP_009614847.1|  PREDICTED: putative G3BP-like protein isofor...    202   1e-53    
ref|XP_009395104.1|  PREDICTED: putative G3BP-like protein isofor...    201   2e-53    
ref|XP_010939187.1|  PREDICTED: putative G3BP-like protein isofor...    201   2e-53    
ref|XP_009395103.1|  PREDICTED: putative G3BP-like protein isofor...    201   2e-53    
ref|XP_010913086.1|  PREDICTED: ras GTPase-activating protein-bin...    201   2e-53    
ref|XP_009614850.1|  PREDICTED: putative G3BP-like protein isofor...    201   3e-53    
ref|XP_009395101.1|  PREDICTED: putative G3BP-like protein isofor...    201   3e-53    
ref|XP_009395099.1|  PREDICTED: putative G3BP-like protein isofor...    201   3e-53    
ref|XP_009766788.1|  PREDICTED: putative G3BP-like protein              201   3e-53    
ref|XP_004231668.1|  PREDICTED: putative G3BP-like protein              193   3e-53    
ref|XP_009628136.1|  PREDICTED: putative G3BP-like protein isofor...    198   3e-53    
ref|XP_009588969.1|  PREDICTED: putative G3BP-like protein isofor...    201   3e-53    
ref|XP_009412730.1|  PREDICTED: putative G3BP-like protein isofor...    201   4e-53    
ref|XP_009628138.1|  PREDICTED: putative G3BP-like protein isofor...    197   5e-53    
gb|KCW64878.1|  hypothetical protein EUGRSUZ_G02443                     197   9e-53    
ref|XP_002273770.2|  PREDICTED: ras GTPase-activating protein-bin...    199   1e-52    Vitis vinifera
ref|XP_004515039.1|  PREDICTED: ras GTPase-activating protein-bin...    199   1e-52    
ref|XP_002312286.1|  nuclear transport factor 2 family protein          198   2e-52    Populus trichocarpa [western balsam poplar]
ref|XP_002303062.2|  hypothetical protein POPTR_0002s24800g             196   2e-52    Populus trichocarpa [western balsam poplar]
ref|XP_003556630.1|  PREDICTED: ras GTPase-activating protein-bin...    198   3e-52    
ref|XP_007045848.1|  Nuclear transport factor 2 family protein wi...    197   3e-52    
ref|XP_002447622.1|  hypothetical protein SORBIDRAFT_06g009000          199   3e-52    Sorghum bicolor [broomcorn]
gb|KHN20516.1|  Putative G3BP-like protein                              198   3e-52    
ref|XP_008235434.1|  PREDICTED: putative G3BP-like protein              199   4e-52    
ref|XP_003622861.1|  Ras GTPase-activating protein-binding protein      199   5e-52    
tpg|DAA38277.1|  TPA: hypothetical protein ZEAMMB73_017117              197   6e-52    
tpg|DAA38278.1|  TPA: RNA-binding protein-like protein                  197   6e-52    
ref|XP_010906167.1|  PREDICTED: putative G3BP-like protein              196   7e-52    
emb|CAN80553.1|  hypothetical protein VITISV_024360                     198   8e-52    Vitis vinifera
ref|XP_007045847.1|  Nuclear transport factor 2 family protein wi...    198   9e-52    
gb|EPS67084.1|  hypothetical protein M569_07690                         197   9e-52    
ref|XP_002453867.1|  hypothetical protein SORBIDRAFT_04g020120          197   1e-51    Sorghum bicolor [broomcorn]
gb|ABK92852.1|  unknown                                                 196   1e-51    Populus trichocarpa [western balsam poplar]
ref|NP_001150471.1|  LOC100284101                                       197   1e-51    Zea mays [maize]
ref|XP_007200288.1|  hypothetical protein PRUPE_ppa004427mg             197   2e-51    
ref|XP_009372036.1|  PREDICTED: putative G3BP-like protein              196   2e-51    
ref|XP_008372510.1|  PREDICTED: putative G3BP-like protein              196   2e-51    
ref|XP_010066841.1|  PREDICTED: ras GTPase-activating protein-bin...    195   2e-51    
ref|XP_011089065.1|  PREDICTED: putative G3BP-like protein              196   2e-51    
gb|KDO70352.1|  hypothetical protein CISIN_1g037095mg                   192   2e-51    
gb|EYU40628.1|  hypothetical protein MIMGU_mgv1a005146mg                195   6e-51    
ref|XP_009588970.1|  PREDICTED: putative G3BP-like protein isofor...    194   6e-51    
ref|XP_009379993.1|  PREDICTED: ras GTPase-activating protein-bin...    194   6e-51    
gb|AFW62474.1|  hypothetical protein ZEAMMB73_312737                    192   7e-51    
ref|XP_006386880.1|  hypothetical protein POPTR_0002s24800g             195   8e-51    
gb|AFW62473.1|  hypothetical protein ZEAMMB73_312737                    192   9e-51    
gb|EYU40629.1|  hypothetical protein MIMGU_mgv1a005146mg                194   9e-51    
gb|KDO65984.1|  hypothetical protein CISIN_1g012554mg                   193   1e-50    
ref|XP_006479227.1|  PREDICTED: putative G3BP-like protein-like i...    193   2e-50    
ref|XP_006443553.1|  hypothetical protein CICLE_v10020020mg             193   2e-50    
ref|XP_003574989.1|  PREDICTED: ras GTPase-activating protein-bin...    192   4e-50    
ref|XP_006652193.1|  PREDICTED: ras GTPase-activating protein-bin...    191   5e-50    
ref|XP_010527259.1|  PREDICTED: putative G3BP-like protein              191   8e-50    
ref|XP_009356418.1|  PREDICTED: putative G3BP-like protein isofor...    191   9e-50    
ref|XP_002532732.1|  RNA binding protein, putative                      191   1e-49    Ricinus communis
ref|XP_009356417.1|  PREDICTED: putative G3BP-like protein isofor...    191   1e-49    
ref|NP_001052571.1|  Os04g0372800                                       191   2e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009356416.1|  PREDICTED: putative G3BP-like protein isofor...    191   2e-49    
ref|XP_008243840.1|  PREDICTED: putative G3BP-like protein isofor...    190   2e-49    
ref|XP_010091585.1|  Ras GTPase-activating protein-binding protein 1    190   4e-49    
gb|KDP41314.1|  hypothetical protein JCGZ_15721                         189   5e-49    
ref|XP_006602481.1|  PREDICTED: putative G3BP-like protein-like         189   5e-49    
ref|XP_009379994.1|  PREDICTED: ras GTPase-activating protein-bin...    188   7e-49    
ref|XP_008243839.1|  PREDICTED: putative G3BP-like protein isofor...    187   1e-48    
ref|XP_011018725.1|  PREDICTED: putative G3BP-like protein              187   2e-48    
ref|XP_010680681.1|  PREDICTED: ras GTPase-activating protein-bin...    187   2e-48    
ref|XP_008389403.1|  PREDICTED: putative G3BP-like protein              187   2e-48    
ref|XP_002512069.1|  RNA binding protein, putative                      187   3e-48    Ricinus communis
ref|XP_004240453.1|  PREDICTED: putative G3BP-like protein isofor...    187   3e-48    
ref|XP_004975345.1|  PREDICTED: ras GTPase-activating protein-bin...    187   4e-48    
emb|CAH66639.1|  OSIGBa0140A01.7                                        187   4e-48    Oryza sativa [red rice]
ref|XP_007222932.1|  hypothetical protein PRUPE_ppa005250mg             186   5e-48    
ref|NP_001136675.1|  RNA-binding protein-like protein                   186   6e-48    Zea mays [maize]
ref|XP_008661435.1|  PREDICTED: uncharacterized protein LOC100193...    186   6e-48    
gb|ACG28035.1|  RNA-binding protein-like                                186   7e-48    Zea mays [maize]
ref|XP_004952523.1|  PREDICTED: ras GTPase-activating protein-bin...    184   3e-47    
gb|ACN36219.1|  unknown                                                 184   3e-47    Zea mays [maize]
ref|XP_006479228.1|  PREDICTED: putative G3BP-like protein-like i...    181   4e-47    
ref|XP_006586220.1|  PREDICTED: putative G3BP-like protein-like i...    183   4e-47    
gb|ACU24631.1|  unknown                                                 182   7e-47    
ref|XP_003532266.1|  PREDICTED: putative G3BP-like protein-like i...    182   8e-47    
gb|KHN10959.1|  Putative G3BP-like protein                              182   1e-46    
ref|XP_002863091.1|  nuclear transport factor 2 family protein          182   2e-46    
ref|XP_010321792.1|  PREDICTED: putative G3BP-like protein isofor...    182   2e-46    
ref|XP_006647284.1|  PREDICTED: ras GTPase-activating protein-bin...    182   2e-46    
ref|XP_011024610.1|  PREDICTED: ras GTPase-activating protein-bin...    182   3e-46    
gb|EMS54179.1|  Putative G3BP-like protein                              183   4e-46    
ref|XP_006437916.1|  hypothetical protein CICLE_v10031630mg             178   1e-45    
ref|XP_010550898.1|  PREDICTED: ras GTPase-activating protein-bin...    179   1e-45    
ref|XP_006297519.1|  hypothetical protein CARUB_v10013543mg             179   2e-45    
gb|KCW48430.1|  hypothetical protein EUGRSUZ_K02132                     175   3e-45    
ref|XP_003525548.1|  PREDICTED: putative G3BP-like protein-like         172   3e-45    
ref|XP_010239775.1|  PREDICTED: ras GTPase-activating protein-bin...    178   3e-45    
ref|XP_008361761.1|  PREDICTED: putative G3BP-like protein              177   5e-45    
ref|NP_001169085.1|  uncharacterized protein LOC100382927               174   7e-45    
ref|XP_010550897.1|  PREDICTED: putative G3BP-like protein isofor...    176   2e-44    
dbj|BAB02073.1|  RNA-binding protein-like                               176   2e-44    
ref|NP_189151.2|  nuclear transport factor 2 and RNA recognition ...    176   3e-44    
ref|NP_001189969.1|  nuclear transport factor 2 and RNA recogniti...    177   4e-44    
ref|XP_001755584.1|  predicted protein                                  173   4e-44    
gb|EYU19424.1|  hypothetical protein MIMGU_mgv1a026410mg                173   6e-44    
ref|XP_010466935.1|  PREDICTED: putative G3BP-like protein              174   9e-44    
ref|XP_011011822.1|  PREDICTED: ras GTPase-activating protein-bin...    173   1e-43    
ref|XP_011011831.1|  PREDICTED: ras GTPase-activating protein-bin...    173   1e-43    
ref|XP_004290176.1|  PREDICTED: ras GTPase-activating protein-bin...    172   5e-43    
ref|XP_010696261.1|  PREDICTED: ras GTPase-activating protein-bin...    171   6e-43    
ref|XP_007140674.1|  hypothetical protein PHAVU_008G132300g             170   2e-42    
ref|XP_006428670.1|  hypothetical protein CICLE_v10013743mg             168   2e-42    
ref|XP_010513961.1|  PREDICTED: putative G3BP-like protein              169   3e-42    
gb|EAZ23132.1|  hypothetical protein OsJ_06818                          169   3e-42    
dbj|BAD23032.1|  putative Ras-GTPase-activating protein binding p...    169   3e-42    
ref|XP_011011794.1|  PREDICTED: putative G3BP-like protein isofor...    168   6e-42    
ref|XP_011011813.1|  PREDICTED: ras GTPase-activating protein-bin...    168   6e-42    
ref|XP_002315000.2|  nuclear transport factor 2 family protein          167   2e-41    
gb|EAY85942.1|  hypothetical protein OsI_07304                          167   2e-41    
ref|XP_010488625.1|  PREDICTED: putative G3BP-like protein isofor...    167   2e-41    
ref|XP_006418656.1|  hypothetical protein EUTSA_v10002500mg             167   3e-41    
ref|XP_004298368.1|  PREDICTED: putative G3BP-like protein-like         166   4e-41    
ref|XP_009102429.1|  PREDICTED: putative G3BP-like protein              166   6e-41    
ref|XP_010488626.1|  PREDICTED: putative G3BP-like protein isofor...    165   1e-40    
emb|CDX77365.1|  BnaA07g05030D                                          164   2e-40    
ref|XP_010551370.1|  PREDICTED: putative G3BP-like protein              163   2e-40    
ref|XP_006395686.1|  hypothetical protein EUTSA_v10005515mg             160   1e-39    
dbj|BAB10698.1|  RNA-binding protein-like                               161   2e-39    
ref|XP_009416658.1|  PREDICTED: putative G3BP-like protein              158   3e-39    
ref|NP_199676.2|  nuclear transport factor 2 and RNA recognition ...    159   9e-39    
ref|NP_001050377.1|  Os03g0418800                                       159   9e-39    
ref|XP_006305927.1|  hypothetical protein CARUB_v10011148mg             158   1e-38    
gb|EMT06304.1|  Putative G3BP-like protein                              160   1e-38    
emb|CDY00813.1|  BnaCnng00130D                                          159   1e-38    
ref|XP_006650201.1|  PREDICTED: putative G3BP-like protein-like         159   1e-38    
gb|EEC75482.1|  hypothetical protein OsI_12070                          159   2e-38    
gb|AFW88122.1|  hypothetical protein ZEAMMB73_005917                    158   4e-38    
ref|NP_001168649.1|  hypothetical protein                               158   5e-38    
ref|XP_010523494.1|  PREDICTED: ras GTPase-activating protein-bin...    155   9e-38    
ref|XP_010262451.1|  PREDICTED: putative G3BP-like protein isofor...    155   3e-37    
ref|XP_010527973.1|  PREDICTED: ras GTPase-activating protein-bin...    154   3e-37    
ref|XP_010262452.1|  PREDICTED: putative G3BP-like protein isofor...    154   4e-37    
ref|XP_010502383.1|  PREDICTED: ras GTPase-activating protein-bin...    153   5e-37    
ref|XP_010425163.1|  PREDICTED: putative G3BP-like protein              152   7e-37    
ref|XP_010482117.1|  PREDICTED: ras GTPase-activating protein-bin...    152   1e-36    
ref|XP_010514133.1|  PREDICTED: ras GTPase-activating protein-bin...    151   2e-36    
ref|XP_010529091.1|  PREDICTED: ras GTPase-activating protein-bin...    150   2e-36    
ref|XP_009152158.1|  PREDICTED: putative G3BP-like protein isofor...    150   4e-36    
ref|XP_009152157.1|  PREDICTED: putative G3BP-like protein isofor...    149   6e-36    
ref|XP_007162596.1|  hypothetical protein PHAVU_001G164600g             150   9e-36    
ref|XP_009586843.1|  PREDICTED: putative G3BP-like protein              149   9e-36    
ref|XP_010493700.1|  PREDICTED: ras GTPase-activating protein-bin...    149   1e-35    
dbj|BAK04969.1|  predicted protein                                      150   2e-35    
ref|XP_010442306.1|  PREDICTED: ras GTPase-activating protein-bin...    149   2e-35    
ref|XP_010442307.1|  PREDICTED: ras GTPase-activating protein-bin...    148   2e-35    
ref|XP_009151663.1|  PREDICTED: putative G3BP-like protein isofor...    149   3e-35    
ref|XP_009800179.1|  PREDICTED: putative G3BP-like protein              147   3e-35    
ref|XP_010442302.1|  PREDICTED: ras GTPase-activating protein-bin...    148   4e-35    
ref|XP_006657926.1|  PREDICTED: putative G3BP-like protein-like         149   4e-35    
ref|XP_009151662.1|  PREDICTED: putative G3BP-like protein isofor...    148   4e-35    
emb|CDX86290.1|  BnaA06g30070D                                          148   7e-35    
ref|XP_008235596.1|  PREDICTED: putative G3BP-like protein              147   9e-35    
ref|XP_002526545.1|  Ras-GTPase-activating protein-binding protei...    147   1e-34    
ref|XP_002863913.1|  nuclear transport factor 2 family protein          147   1e-34    
gb|EPS68058.1|  hypothetical protein M569_06714                         144   2e-34    
ref|XP_001752762.1|  predicted protein                                  148   4e-34    
emb|CBI37186.3|  unnamed protein product                                145   5e-34    
ref|XP_006391039.1|  hypothetical protein EUTSA_v10018584mg             144   9e-34    
ref|XP_002467686.1|  hypothetical protein SORBIDRAFT_01g032380          146   1e-33    
emb|CDY02983.1|  BnaC07g22440D                                          143   1e-33    
emb|CDX85353.1|  BnaC07g26640D                                          144   1e-33    
ref|XP_011083065.1|  PREDICTED: ras GTPase-activating protein-bin...    143   2e-33    
ref|XP_007145355.1|  hypothetical protein PHAVU_007G232200g             143   2e-33    
gb|KCW60208.1|  hypothetical protein EUGRSUZ_H02916                     142   2e-33    
ref|XP_010458834.1|  PREDICTED: putative G3BP-like protein              142   3e-33    
ref|XP_002887226.1|  hypothetical protein ARALYDRAFT_894705             142   3e-33    
gb|AGT16624.1|  hypothetical protein SHCRBa_261_H05_F_170               145   3e-33    
ref|NP_001030964.1|  nuclear transport factor 2 and RNA recogniti...    142   3e-33    
ref|NP_001189508.1|  nuclear transport factor 2 and RNA recogniti...    142   3e-33    
ref|XP_008353086.1|  PREDICTED: ras GTPase-activating protein-bin...    141   4e-33    
gb|KHG05970.1|  nxt3                                                    142   4e-33    
ref|XP_010495547.1|  PREDICTED: putative G3BP-like protein              142   5e-33    
gb|KHG02545.1|  Ras GTPase-activating-binding protein 2                 141   7e-33    
ref|XP_003521311.1|  PREDICTED: ras GTPase-activating protein-bin...    141   9e-33    
ref|XP_010023838.1|  PREDICTED: putative G3BP-like protein              141   1e-32    
ref|XP_003555730.1|  PREDICTED: putative G3BP-like protein-like         141   2e-32    
gb|EAZ04627.1|  hypothetical protein OsI_26774                          142   2e-32    
ref|XP_009105467.1|  PREDICTED: ras GTPase-activating protein-bin...    140   2e-32    
ref|NP_001060210.1|  Os07g0603100                                       142   2e-32    
gb|KHN14011.1|  Putative G3BP-like protein                              140   3e-32    
ref|XP_008224038.1|  PREDICTED: putative G3BP-like protein              140   3e-32    
ref|XP_004497787.1|  PREDICTED: putative G3BP-like protein-like         140   3e-32    
ref|XP_003554301.1|  PREDICTED: putative G3BP-like protein-like i...    140   3e-32    
ref|XP_006386908.1|  hypothetical protein POPTR_0002s25880g             140   3e-32    
ref|NP_001189507.1|  nuclear transport factor 2 and RNA recogniti...    139   4e-32    
ref|NP_178462.3|  nuclear transport factor 2 and RNA recognition ...    139   5e-32    
ref|XP_006300919.1|  hypothetical protein CARUB_v10021291mg             139   5e-32    
ref|XP_008785151.1|  PREDICTED: putative G3BP-like protein              139   7e-32    
ref|XP_010476397.1|  PREDICTED: putative G3BP-like protein              138   8e-32    
ref|XP_009792497.1|  PREDICTED: cold-inducible RNA-binding protei...    132   8e-32    
ref|XP_007227714.1|  hypothetical protein PRUPE_ppa005170mg             138   1e-31    
ref|XP_006280474.1|  hypothetical protein CARUB_v10026409mg             138   1e-31    
ref|XP_006576961.1|  PREDICTED: ras GTPase-activating protein-bin...    138   1e-31    
ref|XP_004984008.1|  PREDICTED: ras GTPase-activating protein-bin...    140   1e-31    
ref|XP_009382201.1|  PREDICTED: putative G3BP-like protein isofor...    137   1e-31    
ref|XP_009413570.1|  PREDICTED: ras GTPase-activating protein-bin...    137   1e-31    
ref|XP_002876890.1|  RNA binding protein                                137   2e-31    
ref|XP_011024483.1|  PREDICTED: putative G3BP-like protein              137   2e-31    
ref|XP_002528349.1|  Ras-GTPase-activating protein-binding protei...    137   2e-31    
ref|XP_004493824.1|  PREDICTED: ras GTPase-activating protein-bin...    137   2e-31    
ref|XP_010940714.1|  PREDICTED: putative G3BP-like protein              137   2e-31    
gb|KHN10778.1|  Putative G3BP-like protein                              137   2e-31    
ref|XP_010264868.1|  PREDICTED: putative G3BP-like protein              137   3e-31    
ref|XP_006489618.1|  PREDICTED: putative G3BP-like protein-like i...    137   3e-31    
ref|XP_006489616.1|  PREDICTED: putative G3BP-like protein-like i...    137   3e-31    
ref|XP_002272650.2|  PREDICTED: putative G3BP-like protein isofor...    137   3e-31    
emb|CDY54146.1|  BnaCnng26260D                                          137   3e-31    
ref|XP_010415559.1|  PREDICTED: ras GTPase-activating protein-bin...    137   3e-31    
ref|XP_006854458.1|  hypothetical protein AMTR_s00039p00228400          137   3e-31    
gb|KHG04260.1|  Putative G3BP-like protein                              137   3e-31    
gb|EYU46398.1|  hypothetical protein MIMGU_mgv1a006578mg                136   4e-31    
ref|XP_010934232.1|  PREDICTED: ras GTPase-activating protein-bin...    137   4e-31    
ref|XP_010547109.1|  PREDICTED: putative G3BP-like protein              137   4e-31    
ref|XP_010934231.1|  PREDICTED: putative G3BP-like protein isofor...    137   4e-31    
emb|CDY36405.1|  BnaC05g10060D                                          135   4e-31    
ref|XP_006604512.1|  PREDICTED: putative G3BP-like protein-like i...    136   4e-31    
ref|XP_002320609.1|  hypothetical protein POPTR_0014s18730g             136   5e-31    
ref|XP_009105468.1|  PREDICTED: ras GTPase-activating protein-bin...    136   5e-31    
ref|XP_011073720.1|  PREDICTED: putative G3BP-like protein isofor...    136   5e-31    
gb|KHN41527.1|  Putative G3BP-like protein                              136   5e-31    
ref|NP_001242133.1|  uncharacterized protein LOC100795457               136   6e-31    
ref|XP_006660402.1|  PREDICTED: ras GTPase-activating protein-bin...    135   6e-31    
ref|XP_001752767.1|  predicted protein                                  138   7e-31    
emb|CDX95953.1|  BnaA07g27780D                                          136   8e-31    
ref|XP_006588452.1|  PREDICTED: uncharacterized protein LOC100795...    136   8e-31    
ref|XP_009767923.1|  PREDICTED: putative G3BP-like protein isofor...    135   1e-30    
emb|CAN77842.1|  hypothetical protein VITISV_015564                     137   1e-30    
ref|NP_563932.1|  nuclear transport factor 2 family protein with ...    135   1e-30    
ref|XP_008438457.1|  PREDICTED: putative G3BP-like protein              135   1e-30    
ref|XP_006420348.1|  hypothetical protein CICLE_v10004887mg             135   1e-30    
ref|XP_006420347.1|  hypothetical protein CICLE_v10004887mg             135   1e-30    
gb|KDP26467.1|  hypothetical protein JCGZ_17625                         135   2e-30    
ref|XP_009792498.1|  PREDICTED: cold-inducible RNA-binding protei...    129   2e-30    
ref|XP_009148658.1|  PREDICTED: putative G3BP-like protein isofor...    134   2e-30    
ref|XP_002890018.1|  nuclear transport factor 2 family protein          134   2e-30    
ref|XP_006292578.1|  hypothetical protein CARUB_v10018815mg             134   3e-30    
ref|NP_177085.1|  nuclear transport factor 2 and RNA recognition ...    133   5e-30    
gb|AFK38327.1|  unknown                                                 133   5e-30    
ref|XP_011073721.1|  PREDICTED: putative G3BP-like protein isofor...    133   7e-30    
ref|XP_010235890.1|  PREDICTED: putative G3BP-like protein              134   7e-30    
ref|XP_008459963.1|  PREDICTED: putative G3BP-like protein              132   9e-30    
ref|XP_010091801.1|  Putative G3BP-like protein                         132   9e-30    
ref|XP_009148659.1|  PREDICTED: putative G3BP-like protein isofor...    132   9e-30    
ref|XP_006403158.1|  hypothetical protein EUTSA_v10003207mg             132   9e-30    
ref|XP_002314507.2|  hypothetical protein POPTR_0010s07600g             132   1e-29    
ref|XP_009357968.1|  PREDICTED: putative G3BP-like protein              132   2e-29    
ref|XP_004134037.1|  PREDICTED: putative G3BP-like protein-like         132   2e-29    
ref|XP_008789423.1|  PREDICTED: putative G3BP-like protein              132   2e-29    
ref|XP_009767924.1|  PREDICTED: putative G3BP-like protein isofor...    132   2e-29    
emb|CDY40904.1|  BnaC06g30420D                                          131   2e-29    
gb|KFK31676.1|  hypothetical protein AALP_AA6G144700                    131   2e-29    
ref|XP_003625374.1|  Ras GTPase-activating protein-binding protein      131   3e-29    
ref|XP_009382199.1|  PREDICTED: putative G3BP-like protein isofor...    131   3e-29    
gb|EYU43770.1|  hypothetical protein MIMGU_mgv1a005935mg                131   3e-29    
ref|XP_009351021.1|  PREDICTED: putative G3BP-like protein              131   4e-29    
gb|ACA35266.1|  nuclear transport family protein                        132   4e-29    
ref|XP_011041445.1|  PREDICTED: putative G3BP-like protein              131   4e-29    
ref|XP_009370459.1|  PREDICTED: putative G3BP-like protein              130   5e-29    
ref|XP_009127713.1|  PREDICTED: putative G3BP-like protein              130   5e-29    
ref|XP_010684875.1|  PREDICTED: ras GTPase-activating protein-bin...    129   9e-29    
ref|XP_011091343.1|  PREDICTED: putative G3BP-like protein isofor...    129   9e-29    
ref|XP_011091342.1|  PREDICTED: putative G3BP-like protein isofor...    129   1e-28    
ref|XP_009590589.1|  PREDICTED: putative G3BP-like protein isofor...    129   1e-28    
gb|KDO36678.1|  hypothetical protein CISIN_1g021044mg                   126   2e-28    
ref|XP_006443738.1|  hypothetical protein CICLE_v10020094mg             128   3e-28    
emb|CDO99318.1|  unnamed protein product                                128   3e-28    
ref|XP_003556340.1|  PREDICTED: putative G3BP-like protein-like i...    128   3e-28    
ref|XP_004242375.1|  PREDICTED: putative G3BP-like protein isofor...    128   3e-28    
gb|EMS68232.1|  Putative G3BP-like protein                              130   4e-28    
ref|XP_007201353.1|  hypothetical protein PRUPE_ppa007717mg             126   4e-28    
ref|XP_004247793.1|  PREDICTED: putative G3BP-like protein              128   4e-28    
ref|XP_004296532.1|  PREDICTED: putative G3BP-like protein-like         127   4e-28    
ref|XP_006443735.1|  hypothetical protein CICLE_v10020094mg             127   4e-28    
ref|XP_010920289.1|  PREDICTED: putative G3BP-like protein              127   5e-28    
emb|CDY50308.1|  BnaA02g14660D                                          127   5e-28    
ref|XP_008372392.1|  PREDICTED: putative G3BP-like protein              127   5e-28    
ref|XP_010323068.1|  PREDICTED: putative G3BP-like protein isofor...    127   5e-28    
ref|XP_004289985.1|  PREDICTED: putative G3BP-like protein-like         127   6e-28    
ref|XP_009101751.1|  PREDICTED: putative G3BP-like protein              126   1e-27    
ref|XP_006340888.1|  PREDICTED: putative G3BP-like protein-like         126   1e-27    
ref|XP_009590590.1|  PREDICTED: putative G3BP-like protein isofor...    126   1e-27    
gb|KDP33322.1|  hypothetical protein JCGZ_12871                         126   1e-27    
gb|ACU19155.1|  unknown                                                 121   1e-27    
gb|KCW47691.1|  hypothetical protein EUGRSUZ_K01428                     125   2e-27    
gb|KDO60354.1|  hypothetical protein CISIN_1g0010602mg                  127   2e-27    
gb|EMT08159.1|  Putative G3BP-like protein                              125   3e-27    
ref|XP_010036156.1|  PREDICTED: putative G3BP-like protein              125   3e-27    
gb|ACN29319.1|  unknown                                                 124   5e-27    
tpg|DAA63399.1|  TPA: RNA binding protein                               124   5e-27    
gb|AEP33645.1|  RNA-binding Ras-GAP SH3 binding protein                 124   6e-27    
gb|EMS62478.1|  Putative G3BP-like protein                              125   6e-27    
tpg|DAA63400.1|  TPA: hypothetical protein ZEAMMB73_693462              124   6e-27    



>ref|XP_009764521.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Nicotiana 
sylvestris]
Length=461

 Score =   399 bits (1025),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/328 (61%), Positives = 249/328 (76%), Gaps = 7/328 (2%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   + IND I SLDY+NY AEIKTADAQ S+  GVIVLVTGCLTGKDNL+RKFTQTFFL
Sbjct  55    VTTMKNINDMICSLDYKNYKAEIKTADAQESHKDGVIVLVTGCLTGKDNLRRKFTQTFFL  114

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP  1132
             APQDKGYFVLNDVFRYV+++E D+ ++++NG +D P+ + +   PDPEPA V D  N + 
Sbjct  115   APQDKGYFVLNDVFRYVQENETDTVSEIINGTEDAPSEVLT---PDPEPAQVVDPPNLDQ  171

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A S  EEVKN+  K+H+SLED +QV DE+EI+V+ ESH NENQ   + ES  S  Q+DAP
Sbjct  172   ADSYAEEVKNIEEKVHDSLEDGRQVGDEREIVVEAESHFNENQNHPNTESENSVAQEDAP  231

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRM---KTEKQS-ASMvaqvpvpeapapiaPSTAI  784
             K SYASI+SSQ  KGPTKIYVPTN SRM   K  KQ  A++     +  +       T +
Sbjct  232   KKSYASIVSSQTKKGPTKIYVPTNTSRMAPAKAVKQPVAAVAQTPAIEASNPTAPNGTNV  291

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              E+ + ++EAEGHSIYVRNLP ++TVA+L+A FKK+GPIK GG+QVRSNRQQGFCFGFVE
Sbjct  292   PETNDTEDEAEGHSIYVRNLPLDVTVAQLDAEFKKFGPIKQGGVQVRSNRQQGFCFGFVE  351

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F  ++SM++AIQ SPI IG RQAVVE+K
Sbjct  352   FEDVSSMHSAIQASPITIGGRQAVVEMK  379


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 42/55 (76%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA QT  P     PSAQ+VGNAFVEQYY I HHSP+ VYRFYQ+SSVLSRPD  G
Sbjct  1     MATQTAAP-----PSAQVVGNAFVEQYYQIQHHSPELVYRFYQDSSVLSRPDSKG  50



>ref|XP_006365663.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Solanum tuberosum]
Length=460

 Score =   386 bits (991),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 243/322 (75%), Gaps = 7/322 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN  I SLDY+NY AEIKTADAQ+S+  GVIVLVTGCLTG+D LKRKF QTFFLAPQDKG
Sbjct  61    INTLICSLDYKNYKAEIKTADAQDSFKDGVIVLVTGCLTGRDKLKRKFAQTFFLAPQDKG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE++E D+ ++++NG +D  + + +   PDPEP HV D  N + A +  E
Sbjct  121   YFVLNDVFRYVEENEIDTVSEVINGTEDVQSEVLT---PDPEPTHVVDPPNLDQAGTHAE  177

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             EV++V  K ++SLED +QV+DE+EI+V+TESH NE+Q   + ES  S  Q+DAPK SYAS
Sbjct  178   EVQHVEEKANDSLEDRRQVADEREIVVETESHFNEDQNPTNTESANSVAQEDAPKKSYAS  237

Query  933   ILSSQMNKGPTKIYVPTNASRM---KTEKQS-ASMvaqvpvpeapapiaPSTAIDESKNA  766
             I+SSQ  KGPTKIYVPTN SRM   K EKQ  A++        +         + E+ +A
Sbjct  238   IVSSQTKKGPTKIYVPTNTSRMAPPKAEKQPVAAVAQTAAPEASNPTTPSGIDVPEANDA  297

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
             + EAEG+SIYVRNLP ++TVA+LEA FK YGPIK GG+QVRSNRQQGFCFGFVEF  ++S
Sbjct  298   EVEAEGYSIYVRNLPLDVTVAQLEAEFKTYGPIKQGGVQVRSNRQQGFCFGFVEFEDVSS  357

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AIQ SPI++G RQ VVE+K
Sbjct  358   MNSAIQASPIIMGARQTVVEMK  379


 Score = 87.4 bits (215),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT  P     PSAQ+VGNAFVEQYY I HHSP+ VYRFYQ+SSVLSRPD DG
Sbjct  1     MAMQTVAP-----PSAQVVGNAFVEQYYQIQHHSPESVYRFYQDSSVLSRPDADG  50



>ref|XP_009620581.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Nicotiana 
tomentosiformis]
Length=461

 Score =   378 bits (971),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 244/322 (76%), Gaps = 7/322 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IND I SLDY+NY AEIKTADAQ S+  GVIVLVTGCLTGKDNL+RKFTQTFFLAPQDKG
Sbjct  61    INDMICSLDYKNYKAEIKTADAQESHKDGVIVLVTGCLTGKDNLRRKFTQTFFLAPQDKG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+++E D+ ++++ G +D P+ + +   PDPEPA V D  N + A S  E
Sbjct  121   YFVLNDVFRYVQENETDTVSEIIIGTEDVPSEVLT---PDPEPAQVVDPPNLDQAGSYAE  177

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             EVKNV  ++H+SLED +QV DE+EI+V+ ESH NENQ  A+ ES  S  Q+DAPK SYAS
Sbjct  178   EVKNVEEEVHDSLEDGRQVGDEREIVVEAESHFNENQNHANTESENSVAQEDAPKKSYAS  237

Query  933   ILSSQMNKGPTKIYVPTNASRM---KTEKQS-ASMvaqvpvpeapapiaPSTAIDESKNA  766
             I+SSQ  KGPTKIYVPTN SRM   K  KQ  A++        +         + E+ + 
Sbjct  238   IVSSQTKKGPTKIYVPTNTSRMAPAKAVKQPVAAVAQTPAPEASNPTAHNGANVPETNDT  297

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
             ++EAEGHSIYVRNLP ++TVA+L+  FKK+GPIK GG+QVRSNRQQGFCFGFVEF  ++S
Sbjct  298   EDEAEGHSIYVRNLPLDVTVAQLDGEFKKFGPIKQGGVQVRSNRQQGFCFGFVEFEDVSS  357

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             M++AIQ SP+ IG RQAVVE+K
Sbjct  358   MHSAIQASPVTIGGRQAVVEMK  379


 Score = 81.6 bits (200),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA QT  P     PSAQ+VGNAFVEQYY I HHSP+ VYRFYQ+SSVLSRPD +G
Sbjct  1     MATQTAAP-----PSAQVVGNAFVEQYYQIQHHSPELVYRFYQDSSVLSRPDSNG  50



>ref|XP_006338359.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Solanum tuberosum]
Length=452

 Score =   372 bits (956),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 211/356 (59%), Positives = 249/356 (70%), Gaps = 19/356 (5%)
 Frame = -2

Query  1566  HYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQNS  1399
             H+S  L  R   +D +VL   N   +M      + IND I SL Y+NY AEIKTADAQ S
Sbjct  30    HHSPELVYRFY-LDSSVLSRPNSNGVMTSVTTMKNINDMICSLGYKNYKAEIKTADAQQS  88

Query  1398  YNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNG  1219
             Y  GVIVLVTGCLTGKDN++++FTQTFFLAPQDKGYFVLNDV RY EQ+E D++++MVNG
Sbjct  89    YKDGVIVLVTGCLTGKDNMRKQFTQTFFLAPQDKGYFVLNDVLRYAEQNETDNSSEMVNG  148

Query  1218  VDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEI  1039
             V D   V P P  PDPE  HV +  N    SS  E+++ V   +H SLE+EK V DE+EI
Sbjct  149   VKD---VAPVPLTPDPEAVHVLEPPNHRQPSSHAEDIQIVEEVVHGSLENEKLVGDEREI  205

Query  1038  LVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM---  868
             +V  ES++N        E  TS  ++DAPK SYASI+SSQ  KGPTKIYVP+N SRM   
Sbjct  206   MVGAESYIN-------AEPATSVSREDAPKKSYASIVSSQTKKGPTKIYVPSN-SRMAPA  257

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAV  688
             KTEKQ    VAQ P PE+    A      ESK+AQ  AEGHSIY+RNLP N+TVA+LE  
Sbjct  258   KTEKQPVKSVAQAPGPESSIHTASGGNASESKDAQYRAEGHSIYIRNLPLNVTVAQLEVE  317

Query  687   FKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FK++GPIK GGIQVRSNRQQGFCFGFVEF  LNSMN+AIQ SP+ IG  QA VEIK
Sbjct  318   FKRFGPIKQGGIQVRSNRQQGFCFGFVEFEDLNSMNSAIQASPVTIGGLQADVEIK  373


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM+TT  A    P+AQ++GNAFVEQYY I HHSP+ VYRFY +SSVLSRP+ +G
Sbjct  1     MAMETT--AIPSAPAAQVIGNAFVEQYYQIQHHSPELVYRFYLDSSVLSRPNSNG  53



>ref|XP_010316213.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum lycopersicum]
 ref|XP_010316214.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum lycopersicum]
 ref|XP_010316215.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum lycopersicum]
 ref|XP_010316216.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum lycopersicum]
Length=449

 Score =   370 bits (950),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 211/356 (59%), Positives = 245/356 (69%), Gaps = 19/356 (5%)
 Frame = -2

Query  1566  HYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQNS  1399
             H+S  L  R   +D +VL   N   +M      + IND I SL Y+NY AEIKTADAQ S
Sbjct  30    HHSPELVYRFC-LDSSVLSRPNSNGVMTSVTTMKNINDMICSLGYKNYKAEIKTADAQQS  88

Query  1398  YNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNG  1219
             Y  GVIVLVTGCLTGKDN +++FTQTFFLAPQDKGYFVLNDV RY EQ E D++++MVN 
Sbjct  89    YKDGVIVLVTGCLTGKDNTRKQFTQTFFLAPQDKGYFVLNDVLRYAEQVETDNSSEMVNA  148

Query  1218  VDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEI  1039
             V D   V P P  PDPEP HV    N    SS  E++K V   +H SLE+EK V DE+EI
Sbjct  149   VKD---VAPVPLTPDPEPVHVLQPSNHRQPSSHAEDIKIVEEVVHGSLENEKVVGDEREI  205

Query  1038  LVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM---  868
             +V  ESH+N        E  TS  ++DAPK SYASI+SSQ  KGP KIYVP+N SRM   
Sbjct  206   MVGAESHIN-------AEPATSVSREDAPKKSYASIVSSQTKKGPAKIYVPSN-SRMAPA  257

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAV  688
             KTEKQ    VAQ PVPE+    A      ESK+AQ  AEGHSIY+RNLP N+TVA+LE  
Sbjct  258   KTEKQPVKSVAQAPVPESSIHTASGGNASESKDAQYRAEGHSIYIRNLPLNVTVAQLEVE  317

Query  687   FKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FK++GPI  GGIQVRSNRQQGFCFGFVEF  LNSMN+AIQ SP+ IG  QA +EIK
Sbjct  318   FKRFGPIMQGGIQVRSNRQQGFCFGFVEFEDLNSMNSAIQASPVTIGGLQAELEIK  373


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM+TT  A    P+AQ++GNAFVEQYY I HHSP+ VYRF  +SSVLSRP+ +G
Sbjct  1     MAMETT--AIPSAPAAQVIGNAFVEQYYQIQHHSPELVYRFCLDSSVLSRPNSNG  53



>ref|XP_004232159.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Solanum lycopersicum]
Length=454

 Score =   370 bits (949),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 211/356 (59%), Positives = 245/356 (69%), Gaps = 19/356 (5%)
 Frame = -2

Query  1566  HYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQNS  1399
             H+S  L  R   +D +VL   N   +M      + IND I SL Y+NY AEIKTADAQ S
Sbjct  35    HHSPELVYRFC-LDSSVLSRPNSNGVMTSVTTMKNINDMICSLGYKNYKAEIKTADAQQS  93

Query  1398  YNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNG  1219
             Y  GVIVLVTGCLTGKDN +++FTQTFFLAPQDKGYFVLNDV RY EQ E D++++MVN 
Sbjct  94    YKDGVIVLVTGCLTGKDNTRKQFTQTFFLAPQDKGYFVLNDVLRYAEQVETDNSSEMVNA  153

Query  1218  VDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEI  1039
             V D   V P P  PDPEP HV    N    SS  E++K V   +H SLE+EK V DE+EI
Sbjct  154   VKD---VAPVPLTPDPEPVHVLQPSNHRQPSSHAEDIKIVEEVVHGSLENEKVVGDEREI  210

Query  1038  LVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM---  868
             +V  ESH+N        E  TS  ++DAPK SYASI+SSQ  KGP KIYVP+N SRM   
Sbjct  211   MVGAESHIN-------AEPATSVSREDAPKKSYASIVSSQTKKGPAKIYVPSN-SRMAPA  262

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAV  688
             KTEKQ    VAQ PVPE+    A      ESK+AQ  AEGHSIY+RNLP N+TVA+LE  
Sbjct  263   KTEKQPVKSVAQAPVPESSIHTASGGNASESKDAQYRAEGHSIYIRNLPLNVTVAQLEVE  322

Query  687   FKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FK++GPI  GGIQVRSNRQQGFCFGFVEF  LNSMN+AIQ SP+ IG  QA +EIK
Sbjct  323   FKRFGPIMQGGIQVRSNRQQGFCFGFVEFEDLNSMNSAIQASPVTIGGLQAELEIK  378


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM+TT  A    P+AQ++GNAFVEQYY I HHSP+ VYRF  +SSVLSRP+ +G
Sbjct  6     MAMETT--AIPSAPAAQVIGNAFVEQYYQIQHHSPELVYRFCLDSSVLSRPNSNG  58



>ref|XP_011085688.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Sesamum indicum]
Length=456

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 205/357 (57%), Positives = 252/357 (71%), Gaps = 13/357 (4%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +   LM      + INDKI SLDY+NY AEIKTADAQ+
Sbjct  29    LHHSPELVYRFYQ-DTSVLSRPDPNGLMTTVTTMKSINDKICSLDYKNYKAEIKTADAQD  87

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             S+  GVIVLVTGCLTGKDNLKRKF QTFFLAPQDKGY+VLNDVFRYVE+ E D  A +V 
Sbjct  88    SFKEGVIVLVTGCLTGKDNLKRKFAQTFFLAPQDKGYYVLNDVFRYVEESEPDITAAVV-  146

Query  1221  GVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKE  1042
             GV+D P+   S    DPEPA V D    +  +SD +E + +  K +  + DE+  S +++
Sbjct  147   GVNDTPS---STLTQDPEPAQVVDPPKPDHVTSDVQEFETIEEKDNNQVIDERPASQDRD  203

Query  1041  ILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM--  868
             I+V+  SHLNEN  S + ES +S  Q+DAPK SYASI+SSQ  KGPTK+YVP N++R+  
Sbjct  204   IVVEAGSHLNENHASVATESASSTSQEDAPKKSYASIVSSQTKKGPTKVYVPANSARVAS  263

Query  867   -KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEA  691
              KTEKQS +  A+    EA A   P  A  ES +AQ+E EGHSIY+RNLP N+TVA+LEA
Sbjct  264   PKTEKQSVNQAAEASGSEASAHHTPVVA-PESNDAQDEVEGHSIYIRNLPLNVTVAQLEA  322

Query  690   VFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              FKK+GPIK  G+QVRSN+QQGFCFGFVEF   +SM +AI+ SPI IGDRQA VEIK
Sbjct  323   EFKKFGPIKQNGVQVRSNKQQGFCFGFVEFQEFSSMQSAIKASPITIGDRQAAVEIK  379


 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT +P   P  SAQ+VGNAFVEQYY ILHHSP+ VYRFYQ++SVLSRPDP+G
Sbjct  1     MAMQTASPQQAP--SAQVVGNAFVEQYYHILHHSPELVYRFYQDTSVLSRPDPNG  53



>ref|XP_006338360.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum tuberosum]
Length=450

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 248/356 (70%), Gaps = 21/356 (6%)
 Frame = -2

Query  1566  HYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQNS  1399
             H+S  L  R   +D +VL   N   +M      + IND I SL Y+NY AEIKTADAQ S
Sbjct  30    HHSPELVYRFY-LDSSVLSRPNSNGVMTSVTTMKNINDMICSLGYKNYKAEIKTADAQQS  88

Query  1398  YNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNG  1219
             Y  GVIVLVTGCLTGKDN++++FTQTFFLAPQDKGYFVLNDV RY EQ+E D++++MVNG
Sbjct  89    YKDGVIVLVTGCLTGKDNMRKQFTQTFFLAPQDKGYFVLNDVLRYAEQNETDNSSEMVNG  148

Query  1218  VDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEI  1039
             V D   V P P  PD  P HV +  N    SS  E+++ V   +H SLE+EK V DE+EI
Sbjct  149   VKD---VAPVPLTPD--PVHVLEPPNHRQPSSHAEDIQIVEEVVHGSLENEKLVGDEREI  203

Query  1038  LVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM---  868
             +V  ES++N        E  TS  ++DAPK SYASI+SSQ  KGPTKIYVP+N SRM   
Sbjct  204   MVGAESYIN-------AEPATSVSREDAPKKSYASIVSSQTKKGPTKIYVPSN-SRMAPA  255

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAV  688
             KTEKQ    VAQ P PE+    A      ESK+AQ  AEGHSIY+RNLP N+TVA+LE  
Sbjct  256   KTEKQPVKSVAQAPGPESSIHTASGGNASESKDAQYRAEGHSIYIRNLPLNVTVAQLEVE  315

Query  687   FKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FK++GPIK GGIQVRSNRQQGFCFGFVEF  LNSMN+AIQ SP+ IG  QA VEIK
Sbjct  316   FKRFGPIKQGGIQVRSNRQQGFCFGFVEFEDLNSMNSAIQASPVTIGGLQADVEIK  371


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM+TT  A    P+AQ++GNAFVEQYY I HHSP+ VYRFY +SSVLSRP+ +G
Sbjct  1     MAMETT--AIPSAPAAQVIGNAFVEQYYQIQHHSPELVYRFYLDSSVLSRPNSNG  53



>ref|XP_011098753.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Sesamum indicum]
 ref|XP_011098754.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Sesamum indicum]
 ref|XP_011098755.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Sesamum indicum]
 ref|XP_011098756.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Sesamum indicum]
Length=469

 Score =   361 bits (927),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/357 (57%), Positives = 251/357 (70%), Gaps = 12/357 (3%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +    M      + INDKI SLDY+NY AEIKTADAQ+
Sbjct  29    LHHSPELVFRFYQ-DTSVLSRPDADGFMTTVTTMKSINDKICSLDYKNYKAEIKTADAQD  87

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             SY  GVIVLVTGCLTGKDN++RKFTQTFFLAPQDKGY+VLNDVFRYVE+ E D ++ +V 
Sbjct  88    SYKDGVIVLVTGCLTGKDNVRRKFTQTFFLAPQDKGYYVLNDVFRYVEESEPDISSGVVL  147

Query  1221  GVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKE  1042
             GV++ P+   S    DPE A V D  NAN A+S  EEV+ +  K  + + DE+Q S +++
Sbjct  148   GVNETPS---SSLGQDPELAQVVDPPNANDATSTPEEVETIEEKTSDQVIDERQASSDRD  204

Query  1041  ILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASR---  871
             ILV+ ESHL+EN  S   ES  SA Q+D PK SYASI+SSQ  KGPTK+YVP N ++   
Sbjct  205   ILVEAESHLDENHESVVAESVPSASQEDLPKKSYASIVSSQAKKGPTKVYVPANPAKGTS  264

Query  870   MKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEA  691
              KTE Q  +   +    EA AP+ P  A  ES++A++E EGHSIY+RNLP N TVA+LEA
Sbjct  265   AKTESQPVNPATEASDTEAEAPVPPDNA-QESEDAEDEVEGHSIYIRNLPLNATVAQLEA  323

Query  690   VFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              FKK+G IK  G+QVRSN+QQGFCFGFVEF   +SM +AI+ SP+ IGDRQA VEIK
Sbjct  324   EFKKFGTIKPNGVQVRSNKQQGFCFGFVEFQEFSSMQSAIKASPVTIGDRQAAVEIK  380


 Score = 84.3 bits (207),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M T T    P PSAQ+VGNAFVEQYY ILHHSP+ V+RFYQ++SVLSRPD DG
Sbjct  1     MATETANLPPAPSAQVVGNAFVEQYYHILHHSPELVFRFYQDTSVLSRPDADG  53



>ref|XP_010317135.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X3 [Solanum lycopersicum]
Length=408

 Score =   358 bits (919),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 247/337 (73%), Gaps = 14/337 (4%)
 Frame = -2

Query  1518  VLQHLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLK  1339
             +LQHL          IN  I SLDY+NY AEI+TADAQ+S+   V+VLVTGCLTG+D LK
Sbjct  1     MLQHL-------LPNINTLICSLDYKNYKAEIRTADAQDSFKDAVVVLVTGCLTGRDKLK  53

Query  1338  RKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAH  1159
             RKF QTFFLAPQDKGYFVLNDVFRYVE +E D+ ++++NG +D  + + +   PDPEP H
Sbjct  54    RKFAQTFFLAPQDKGYFVLNDVFRYVEDNEIDTVSEVLNGTEDVQSEVLT---PDPEPTH  110

Query  1158  VPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
             V D  + + A S  EEV++V  K ++S  D +QV+DE+EI+V+T S+ NE+Q   + ES 
Sbjct  111   VVDPPDLDQAGSPAEEVQHVEEKANDSSVDGRQVADEREIVVETGSYFNEDQHPTNTESV  170

Query  978   TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapa  808
              S  Q+ APK SYASI+SSQ  KGPTKIYVPTN SR+   K  KQ  ++VAQ   PE+  
Sbjct  171   NSVAQEYAPKKSYASIVSSQTKKGPTKIYVPTNTSRVAPPKAVKQPVAVVAQNAAPESSN  230

Query  807   piaPSTA-IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             P   S   + E+ +A++EAEG+SIYVRNLP ++TVA+LEA FK YGPIK GG+QVRSNRQ
Sbjct  231   PTTTSGIDVPEANDAEDEAEGYSIYVRNLPLDVTVAQLEAEFKTYGPIKQGGVQVRSNRQ  290

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  ++SMN+AI  SPI++G RQ V+E+K
Sbjct  291   QGFCFGFVEFEDMSSMNSAIHASPIIMGARQVVIEMK  327



>ref|XP_004233930.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Solanum lycopersicum]
Length=460

 Score =   358 bits (918),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 242/322 (75%), Gaps = 7/322 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN  I SLDY+NY AEI+TADAQ+S+   V+VLVTGCLTG+D LKRKF QTFFLAPQDKG
Sbjct  61    INTLICSLDYKNYKAEIRTADAQDSFKDAVVVLVTGCLTGRDKLKRKFAQTFFLAPQDKG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE +E D+ ++++NG +D  + + +   PDPEP HV D  + + A S  E
Sbjct  121   YFVLNDVFRYVEDNEIDTVSEVLNGTEDVQSEVLT---PDPEPTHVVDPPDLDQAGSPAE  177

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             EV++V  K ++S  D +QV+DE+EI+V+T S+ NE+Q   + ES  S  Q+ APK SYAS
Sbjct  178   EVQHVEEKANDSSVDGRQVADEREIVVETGSYFNEDQHPTNTESVNSVAQEYAPKKSYAS  237

Query  933   ILSSQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTA-IDESKNA  766
             I+SSQ  KGPTKIYVPTN SR+   K  KQ  ++VAQ   PE+  P   S   + E+ +A
Sbjct  238   IVSSQTKKGPTKIYVPTNTSRVAPPKAVKQPVAVVAQNAAPESSNPTTTSGIDVPEANDA  297

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
             ++EAEG+SIYVRNLP ++TVA+LEA FK YGPIK GG+QVRSNRQQGFCFGFVEF  ++S
Sbjct  298   EDEAEGYSIYVRNLPLDVTVAQLEAEFKTYGPIKQGGVQVRSNRQQGFCFGFVEFEDMSS  357

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AI  SPI++G RQ V+E+K
Sbjct  358   MNSAIHASPIIMGARQVVIEMK  379



>ref|XP_010317134.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Solanum lycopersicum]
Length=451

 Score =   342 bits (876),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 237/322 (74%), Gaps = 16/322 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN  I SLDY+NY AEI+TADAQ+S+   V+VLVTGCLTG+D LKRKF QTFFLAPQDKG
Sbjct  61    INTLICSLDYKNYKAEIRTADAQDSFKDAVVVLVTGCLTGRDKLKRKFAQTFFLAPQDKG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE +E D+ ++++NG +D  + + +P+ PD + A  P            E
Sbjct  121   YFVLNDVFRYVEDNEIDTVSEVLNGTEDVQSEVLTPD-PDLDQAGSP-----------AE  168

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             EV++V  K ++S  D +QV+DE+EI+V+T S+ NE+Q   + ES  S  Q+ APK SYAS
Sbjct  169   EVQHVEEKANDSSVDGRQVADEREIVVETGSYFNEDQHPTNTESVNSVAQEYAPKKSYAS  228

Query  933   ILSSQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTA-IDESKNA  766
             I+SSQ  KGPTKIYVPTN SR+   K  KQ  ++VAQ   PE+  P   S   + E+ +A
Sbjct  229   IVSSQTKKGPTKIYVPTNTSRVAPPKAVKQPVAVVAQNAAPESSNPTTTSGIDVPEANDA  288

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
             ++EAEG+SIYVRNLP ++TVA+LEA FK YGPIK GG+QVRSNRQQGFCFGFVEF  ++S
Sbjct  289   EDEAEGYSIYVRNLPLDVTVAQLEAEFKTYGPIKQGGVQVRSNRQQGFCFGFVEFEDMSS  348

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AI  SPI++G RQ V+E+K
Sbjct  349   MNSAIHASPIIMGARQVVIEMK  370


 Score = 81.3 bits (199),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT     V  PSAQ+VGN FVEQYY I HHSP+ VYRFYQ+SSVLSRPD +G
Sbjct  1     MAMQT-----VAQPSAQVVGNTFVEQYYQIQHHSPESVYRFYQDSSVLSRPDANG  50



>ref|XP_007032760.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
 ref|XP_007032762.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
 ref|XP_007032763.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
 gb|EOY03686.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
 gb|EOY03688.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
 gb|EOY03689.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 1 [Theobroma cacao]
Length=455

 Score =   338 bits (867),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 218/325 (67%), Gaps = 5/325 (2%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q IN+KI SLDY N+  EI TADAQ SY  GV VLVTGC TGKDNLKRKF Q+FFL
Sbjct  58    VTTMQGINEKILSLDYPNHKTEINTADAQKSYKEGVTVLVTGCQTGKDNLKRKFAQSFFL  117

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP  1132
             APQD GYFVLNDVFRYVE  E   N K VNGV+D P V   P  P+ EP  V D    +P
Sbjct  118   APQDNGYFVLNDVFRYVEDGEPLENHK-VNGVNDAPRV---PSTPESEPTQVLDPSAPDP  173

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A++  EE +NV   + E    E+Q+ +EKE + +++SH N N  S  +EST+S+ Q+D P
Sbjct  174   ATALVEENQNVAEHVDEPSGQERQLVNEKEAVSESQSHSNGNDISIVVESTSSSAQEDTP  233

Query  951   KMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K SYASI+   +   GPT++YVPTN  R+  +K               A +  S    ES
Sbjct  234   KKSYASIVKVPKGGSGPTRVYVPTNTPRVTPKKAENQSPVSAATAPPEASLPTSVDAPES  293

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
              N  EE EGHSIY+RNLPFN+T  +LE  F K+GPIK GG+QVR+N+QQG+CFGFVEF  
Sbjct  294   NNIPEEVEGHSIYIRNLPFNVTPIQLEQEFNKFGPIKQGGVQVRNNKQQGYCFGFVEFLS  353

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
             L+SMN+AIQ SPI IGDRQAVVEIK
Sbjct  354   LSSMNDAIQASPIAIGDRQAVVEIK  378


 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA++T TP   P  SAQ+VG+AFVEQYY IL +SP+  +RFY +SSVLSRPD +G
Sbjct  1     MALETATPPATP--SAQVVGHAFVEQYYHILCNSPELAHRFYHDSSVLSRPDSNG  53



>ref|XP_007032761.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 2 [Theobroma cacao]
 gb|EOY03687.1| Nuclear transport factor 2 family protein with RNA binding domain 
isoform 2 [Theobroma cacao]
Length=457

 Score =   333 bits (854),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 179/327 (55%), Positives = 218/327 (67%), Gaps = 7/327 (2%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q IN+KI SLDY N+  EI TADAQ SY  GV VLVTGC TGKDNLKRKF Q+FFL
Sbjct  58    VTTMQGINEKILSLDYPNHKTEINTADAQKSYKEGVTVLVTGCQTGKDNLKRKFAQSFFL  117

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP  1132
             APQD GYFVLNDVFRYVE  E   N K VNGV+D P V   P  P+ EP  V D    +P
Sbjct  118   APQDNGYFVLNDVFRYVEDGEPLENHK-VNGVNDAPRV---PSTPESEPTQVLDPSAPDP  173

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A++  EE +NV   + E    E+Q+ +EKE + +++SH N N  S  +EST+S+ Q+D P
Sbjct  174   ATALVEENQNVAEHVDEPSGQERQLVNEKEAVSESQSHSNGNDISIVVESTSSSAQEDTP  233

Query  951   KMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K SYASI+   +   GPT++YVPTN  R+  +K               A +  S    ES
Sbjct  234   KKSYASIVKVPKGGSGPTRVYVPTNTPRVTPKKAENQSPVSAATAPPEASLPTSVDAPES  293

Query  774   KNAQEEA--EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              N  EE   EGHSIY+RNLPFN+T  +LE  F K+GPIK GG+QVR+N+QQG+CFGFVEF
Sbjct  294   NNIPEEVTVEGHSIYIRNLPFNVTPIQLEQEFNKFGPIKQGGVQVRNNKQQGYCFGFVEF  353

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
               L+SMN+AIQ SPI IGDRQAVVEIK
Sbjct  354   LSLSSMNDAIQASPIAIGDRQAVVEIK  380


 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA++T TP   P  SAQ+VG+AFVEQYY IL +SP+  +RFY +SSVLSRPD +G
Sbjct  1     MALETATPPATP--SAQVVGHAFVEQYYHILCNSPELAHRFYHDSSVLSRPDSNG  53



>ref|XP_002527619.1| Ras-GTPase-activating protein-binding protein, putative [Ricinus 
communis]
 gb|EEF34758.1| Ras-GTPase-activating protein-binding protein, putative [Ricinus 
communis]
Length=462

 Score =   328 bits (841),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 226/321 (70%), Gaps = 6/321 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL++++Y AEIKTADAQ SY  GV VLVTGCL GKDNLKRKF Q+FFLAPQD
Sbjct  62    QGINEKILSLNFQDYKAEIKTADAQKSYKEGVTVLVTGCLMGKDNLKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GYFVLNDVFRYVE +E    +  VNG ++ PTV   P  PD EP+HVPD    +PA   
Sbjct  122   NGYFVLNDVFRYVEDNEP-LESHPVNGSNNTPTV---PSIPDSEPSHVPDPSAPDPAILA  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              ++  NV  K  + +  EK++  EKE++V+++SH N    S  +ES +SA Q+D PK SY
Sbjct  178   MDQ-DNVAEKASDPVNSEKEIVYEKEVVVESQSHSNGTDVSIVVESPSSAAQEDIPKKSY  236

Query  939   ASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQ  763
             ASI+  ++ + GPTK+YVPT   ++  +K     V   PV E  A +       ES NA+
Sbjct  237   ASIVKVARGSSGPTKVYVPTRTVKVSPKKPETHSVPIAPVTEPEASMPSGNETPESSNAE  296

Query  762   EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
             +E EGHS+YVRNLP+N+T A+LE  F+K+GPIK  G+QVR N+QQG+CFGFVEF  L+SM
Sbjct  297   KEVEGHSVYVRNLPYNMTTAQLEVEFEKFGPIKQEGVQVRYNKQQGYCFGFVEFLSLSSM  356

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
             N+AIQ SP++IG RQAV+EIK
Sbjct  357   NSAIQASPMIIGGRQAVIEIK  377


 Score = 78.2 bits (191),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 4/56 (7%)
 Frame = -2

Query  1884  MAMQ-TTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  ++PAT   PSAQ+VGNAFVEQYY ILH SP+ V+RFYQ++SV+SRPD DG
Sbjct  1     MALQPASSPAT---PSAQVVGNAFVEQYYHILHTSPELVFRFYQDTSVISRPDADG  53



>ref|XP_010105383.1| Putative G3BP-like protein [Morus notabilis]
 gb|EXC04479.1| Putative G3BP-like protein [Morus notabilis]
Length=488

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 262/446 (59%), Gaps = 54/446 (12%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmdvss*VQAIKL  1663
             SA++VGNAFV QYY ILHHSP+ V+RFYQ+SS LSRPD  G                +  
Sbjct  7     SAEVVGNAFVGQYYKILHHSPELVHRFYQDSSSLSRPDATG---------------TMAT  51

Query  1662  LSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVLQHLNFFFLML  1483
             ++ +K + F                     + H  G   + +       L   NF     
Sbjct  52    VTTMKASIF---------------------TFHILGCACSSMFGFGFKFLVSENFI----  86

Query  1482  YQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQ  1303
                IN+KI SL YE+Y AEI TADAQ SY  GVIVLVTGCLTG DN+++KFTQTFFLAPQ
Sbjct  87    --AINEKILSLKYEDYTAEITTADAQESYEKGVIVLVTGCLTGTDNIRKKFTQTFFLAPQ  144

Query  1302  DKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             DKGY+VLNDVFR+VE+ +    N+  VNG+ +    +     P+P   H PD+   +PA+
Sbjct  145   DKGYYVLNDVFRFVEESKVLQVNSVPVNGISENAQEVSLAAEPEPT-THSPDNPVVDPAN  203

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                EE  N G ++++  +DE     E E+ V+  SH + N++   ++S     Q+D PK 
Sbjct  204   PSEEEDPNDGAEVYDPSDDEDSSVVEDEV-VEPPSHSSWNRSLPVVDSAPE-TQEDIPKK  261

Query  945   SYASILSSQMNKGPTKIYVPTNA----SRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
             SYASI+  + +  PT  YVP  A    +   T++QS++  +    P         +   E
Sbjct  262   SYASIV-MKASTTPTPAYVPNRAVVRTTTTNTDQQSSN--SAKHAPVVGVSAPSGSGAPE  318

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S +A EE EGHSIYVRNLP++ TV +LE  FKK+GPIK  GIQVRS++ QGFCFGFVEF 
Sbjct  319   SDSAHEETEGHSIYVRNLPYDATVEQLEEEFKKFGPIKRDGIQVRSSK-QGFCFGFVEFE  377

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L+SMN+A+Q SP+ IGDRQAVVE K
Sbjct  378   SLSSMNSALQASPLTIGDRQAVVEEK  403



>ref|XP_002324119.2| hypothetical protein POPTR_0017s13030g [Populus trichocarpa]
 gb|EEF04252.2| hypothetical protein POPTR_0017s13030g [Populus trichocarpa]
Length=458

 Score =   321 bits (823),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 231/326 (71%), Gaps = 16/326 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+++  AEIKTADAQ SY  GV VLVTGC TGKDN+KRKF Q+FFLAPQD
Sbjct  62    QGINEKILSLDFKDCKAEIKTADAQISYKDGVTVLVTGCFTGKDNVKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GYFVLNDVFRYV+ +E+   + + +GVD  P V   P  PD EPAHVPD    +P  S 
Sbjct  122   SGYFVLNDVFRYVDDNES-LESHLGHGVDSNPIV---PSIPDQEPAHVPDPSAPDPLPSV  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE K +  K +ES + EKQ+ +++EI+V+  S  +EN     +ES +S IQ+DAPK SY
Sbjct  178   VEEHKKLAEKANESSDHEKQLVNDREIIVEDLS--DENNVPVVVESVSSMIQEDAPKKSY  235

Query  939   ASILSSQMNKG---PTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDE  778
             ASI+  ++ KG   P K+Y+P N ++M   +TE QS    +  PV E    +  S    E
Sbjct  236   ASIV--KVAKGSLLPIKVYLPANTTKMVPKRTENQSEK--SVAPVLEPETSVPSSNDAPE  291

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             + +AQEE EGHSIY+RNLPFN+TV++LEA F+K+GPIK GG+QVR NRQQG+CFGFVEFH
Sbjct  292   TSSAQEEVEGHSIYIRNLPFNLTVSQLEAEFEKFGPIKEGGVQVRYNRQQGYCFGFVEFH  351

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
               NSMN+AI+ SP+ IG RQ VVE+K
Sbjct  352   SPNSMNSAIEASPMTIGGRQIVVEMK  377


 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT + AT+P  SAQ+VGNAFVEQYY IL  SP+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTASNATLP--SAQVVGNAFVEQYYYILLTSPESVHRFYQDSSVLSRPDANG  53



>ref|XP_011000072.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
 ref|XP_011000073.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
 ref|XP_011000074.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
 ref|XP_011015023.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
 ref|XP_011015024.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
 ref|XP_011015025.1| PREDICTED: putative G3BP-like protein [Populus euphratica]
Length=458

 Score =   320 bits (819),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 182/326 (56%), Positives = 230/326 (71%), Gaps = 16/326 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+++  AEIKTADAQ SY  GV VLVTGC TGKDN+KRKF Q+FFLAPQD
Sbjct  62    QGINEKILSLDFKDCKAEIKTADAQISYKDGVTVLVTGCFTGKDNVKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GYFVLNDVFRYV+ +E+   + + +GVD  P V   P  PD E AHVPD    +P  S 
Sbjct  122   SGYFVLNDVFRYVDDNES-LESHLGHGVDSNPIV---PSIPDQESAHVPDPSAPDPLPSV  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE K +  K +ES + EKQ+ +E+EI+V  E H +E+  S  +ES +S IQ+DAPK SY
Sbjct  178   VEEHKKLAEKANESSDHEKQLVNEREIIV--EDHSDEHDVSVVVESVSSMIQEDAPKKSY  235

Query  939   ASILSSQMNKG---PTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDE  778
             ASI+  ++ KG   P K+Y+P N ++M   +TE QS    +  PV E    +  S    E
Sbjct  236   ASIV--KVAKGSLLPIKVYLPANTTKMVPKRTENQSEK--SVAPVLEPETSVPSSNDAPE  291

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             + +AQEE EGHSIY+RNLPFN+TV++LEA F+K+GPIK  G+QVR NRQQG+CFGFVEFH
Sbjct  292   TSSAQEEVEGHSIYIRNLPFNLTVSQLEAEFEKFGPIKERGVQVRYNRQQGYCFGFVEFH  351

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
               NSMN+AI+ SPI IG RQ VVE+K
Sbjct  352   SPNSMNSAIEASPITIGGRQTVVEMK  377


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT +  T+P  SAQ+VGNAFVEQYY IL  SP+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTASNPTLP--SAQVVGNAFVEQYYYILLSSPESVHRFYQDSSVLSRPDANG  53



>gb|KDP27249.1| hypothetical protein JCGZ_19948 [Jatropha curcas]
Length=457

 Score =   318 bits (814),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 222/321 (69%), Gaps = 6/321 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL++++Y AEIKTADAQ SY  GV VLVTGCL GKDNLKRKF Q+FFLAPQD
Sbjct  59    QGINEKILSLNFKDYKAEIKTADAQKSYKEGVTVLVTGCLMGKDNLKRKFAQSFFLAPQD  118

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GYFVLNDVF +V+ DE   N   VN +D  PTV   P  PD EP+HVPD    +PA+  
Sbjct  119   NGYFVLNDVFTFVKDDEPLEN-NPVNNIDSAPTV---PSNPDSEPSHVPDPSAPDPAALV  174

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E  K    + ++ ++ + +   EKE++V+T+S  N N  S  +ES +S  Q+D PK SY
Sbjct  175   VEHDKQAVEEANDPVDSDIERVYEKEVVVETQSDSNWNNDSVVVESASSIAQEDIPKKSY  234

Query  939   ASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQ  763
             ASI+  ++ + GPTK+Y+PTNA ++  +K   + V   P     A +  S    ES NAQ
Sbjct  235   ASIVKVARGSTGPTKVYIPTNAVKVAPKKLETNSVLVAPATGPEASVPSSNETPESSNAQ  294

Query  762   EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
             E+ EGHSIY+RNLP++ T  +LE  FKK+GPIK GG+QVR NRQQG+CFGFVEFH  +SM
Sbjct  295   ED-EGHSIYIRNLPYSTTSDQLEGEFKKFGPIKPGGVQVRFNRQQGYCFGFVEFHSASSM  353

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
             N+AI+ SP+ IG RQAV+E+K
Sbjct  354   NSAIEASPMTIGGRQAVIEMK  374


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT+T      PSA++VGNAFVEQYY ILH SP+ VYRFYQ+SSVLSRPD +G
Sbjct  1     MALQTST-----SPSAEVVGNAFVEQYYHILHTSPEVVYRFYQDSSVLSRPDANG  50



>gb|KHG02028.1| Putative G3BP-like protein [Gossypium arboreum]
Length=455

 Score =   313 bits (802),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 212/331 (64%), Gaps = 25/331 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S DY N+ AEI TADAQ SY  GV VLVTGCLTGKDN+KRKF Q+FFLAPQD
Sbjct  62    QGINEKILSFDYTNHKAEINTADAQKSYQEGVTVLVTGCLTGKDNMKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTV----------IPSPEAPDPEPAHVPD  1150
              GYFVLNDV RYV   E     K VNGV+D P V          +  P APDP  A V  
Sbjct  122   NGYFVLNDVLRYVGDSEPLEKHK-VNGVNDAPRVPPTPEPEPTQVSEPSAPDPATALV--  178

Query  1149  SLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
                        EE +NV  K++E  + EKQ+ DE E +V  +S+ N +  +  +E  +S+
Sbjct  179   -----------EENQNVAEKVYEPSDQEKQLVDEDEAVVKPQSNSNGDDITVVVEPASSS  227

Query  969   IQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
              Q+D+ K SYASI+   + + GPT++Y+P+N +++  +K               A    S
Sbjct  228   AQEDSAKKSYASIVKVPKGSPGPTRVYLPSNTTKVTPKKTEKQPPISAAPATPEASAPSS  287

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                 E+ N  EE EGHSIY+RNLPFN+T  +LE  FKK+GPIK GG+QVR+N+QQG+CFG
Sbjct  288   ADAPENDNIPEEVEGHSIYIRNLPFNVTATQLEQEFKKFGPIKQGGVQVRNNKQQGYCFG  347

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF  LNSMN+AIQ SPI IG+RQAVVEIK
Sbjct  348   FVEFLSLNSMNDAIQASPITIGERQAVVEIK  378


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 45/56 (80%), Gaps = 4/56 (7%)
 Frame = -2

Query  1884  MAMQTTT-PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA++  T PAT   PSAQ+VGNAFVEQYY IL++SP+  +RFY +SSV+SRPD +G
Sbjct  1     MALEIATRPAT---PSAQVVGNAFVEQYYHILYNSPELAHRFYHDSSVISRPDSNG  53



>ref|XP_006482760.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482761.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Citrus sinensis]
 ref|XP_006482762.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X3 [Citrus sinensis]
Length=460

 Score =   312 bits (799),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 217/319 (68%), Gaps = 7/319 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY+NY AEIKTADAQNS+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  61    INQKILSLDYKNYKAEIKTADAQNSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+  E  S     N +DD P    +P  PD +  HVPD    +P +S  E
Sbjct  121   YFVLNDVFRYVDDGEV-SEKYPANSIDDAPA---APSIPDIDHTHVPDPPAPDPVTSHVE  176

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E +N+  +++E  E E+Q+  E+E +V+++S+  E   SA +ES +S+  +DAPK SYAS
Sbjct  177   EDQNISERVYEPSEQERQLVTEREAVVESQSYAVETDASAMVESASSSALEDAPKKSYAS  236

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEE  757
             I+  ++   GPTK+YVPTN  ++ T+K     +     P +      ST   ES NA EE
Sbjct  237   IVRVAKGGSGPTKVYVPTNTVKVTTKKTENQPIKSEKPPSSETSAPVSTDAPESSNAHEE  296

Query  756   AEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNN  577
              EGHSIY+RNLP  +TVA LE  FKK+GP+K GGIQVR N+  G+CFGFVEF   +SM+N
Sbjct  297   VEGHSIYIRNLPDTMTVASLEVEFKKFGPVKQGGIQVRHNK--GYCFGFVEFQSSSSMDN  354

Query  576   AIQDSPIMIGDRQAVVEIK  520
             AIQ SPI IG ++A VE K
Sbjct  355   AIQASPITIGGQEAFVEKK  373


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+ T TP     PSAQ+VGNAFVEQYY ILH +P+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALHTATP-----PSAQVVGNAFVEQYYHILHSTPELVFRFYQDSSVLSRPDSNG  50



>gb|EYU34602.1| hypothetical protein MIMGU_mgv1a006211mg [Erythranthe guttata]
 gb|EYU34603.1| hypothetical protein MIMGU_mgv1a006211mg [Erythranthe guttata]
Length=452

 Score =   311 bits (798),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/357 (53%), Positives = 242/357 (68%), Gaps = 12/357 (3%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +   LM      + IND I SLDY+NY A IKTADAQN
Sbjct  27    LHHSPELVYRFYQ-DSSVLSRPDSSGLMTTVTTMESINDTICSLDYKNYKAVIKTADAQN  85

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             S+N GVIVLVTGCLTGKDN++ KF QTFFLAPQDKGY+VLNDVFRYV++ + +  A +  
Sbjct  86    SFNEGVIVLVTGCLTGKDNMQTKFVQTFFLAPQDKGYYVLNDVFRYVDESDPEIRAVVPI  145

Query  1221  GVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKE  1042
              V+D P+   S    D EP  V D L  +  +   EE+K +  K ++ + DE+ V D ++
Sbjct  146   VVNDIPS---STMTQDQEPPQVVDPLKPDDTTPHMEEIKTIEEKENDKVVDERPVIDNRD  202

Query  1041  ILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM--  868
             I+++TE HL EN  S + E  T A Q+DAPK SYASILSSQ  K PTK+Y+P N +R+  
Sbjct  203   IVMETEVHLKENHASVAEERVTLASQEDAPKKSYASILSSQTKKAPTKVYIPANTARVSS  262

Query  867   -KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEA  691
              KTEKQS + V +    EA AP+AP  A  ES ++Q+E +GHSIYVRNLP N TVA+LEA
Sbjct  263   AKTEKQSINPVTEALTSEASAPLAPVNA-PESDDSQDEVDGHSIYVRNLPPNATVAQLEA  321

Query  690   VFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              F+K+GPIK  GIQ++SN+  GFC+GFVEF   +SM +AI+ SPIMI D +  VEIK
Sbjct  322   EFQKFGPIKQNGIQIKSNQPTGFCYGFVEFQEFSSMQSAIKASPIMIEDHKVSVEIK  378


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P PSAQ+VGNAFVEQYY ILHHSP+ VYRFYQ+SSVLSRPD  G
Sbjct  8     PTPSAQVVGNAFVEQYYHILHHSPELVYRFYQDSSVLSRPDSSG  51



>ref|XP_006585784.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X4 [Glycine max]
 ref|XP_006585785.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X5 [Glycine max]
 ref|XP_006585786.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X6 [Glycine max]
 ref|XP_006585787.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X7 [Glycine max]
 ref|XP_006585788.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X8 [Glycine max]
 ref|XP_006585789.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X9 [Glycine max]
 ref|XP_006585790.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X10 [Glycine max]
 ref|XP_006585791.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X11 [Glycine max]
 ref|XP_006585792.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X12 [Glycine max]
Length=462

 Score =   309 bits (792),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 212/320 (66%), Gaps = 7/320 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE D   S    V G  D   V  +PE    EP+HV DS    P +S   
Sbjct  124   YFVLNDVFRYVE-DHEPSELPPVTGDGDSAAVTVTPEL---EPSHVADSCAPEPTNSHVN  179

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             + + V    +E S   E+Q+  E E  V++    N N  S + E  +SA QDDAPK SYA
Sbjct  180   KGQTVAENAYELSNNHERQIPVENEGNVESHFQSNGNDDSQATELASSA-QDDAPKKSYA  238

Query  936   SILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+  Q     PTK+YVPTN  +    K  + +V  V   E P     S +  ES +A E
Sbjct  239   SIVKVQKGSSVPTKVYVPTNTLKSGPNKTESKVVESVESTEVPEAALESVSNPESSDAHE  298

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EGHSIY+RNLP N+TVA+LE  FKK+GPIK GGIQVR+N+QQG+CFGFVEF  LNSMN
Sbjct  299   EVEGHSIYIRNLPLNVTVAQLELEFKKFGPIKPGGIQVRNNKQQGYCFGFVEFLSLNSMN  358

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SP+ IG RQAVVEIK
Sbjct  359   SAIQASPVPIGGRQAVVEIK  378


 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSP  VYRFYQ+SSV+SRPD  G
Sbjct  1     MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPGSVYRFYQDSSVISRPDSSG  53



>ref|XP_006585781.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006585782.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Glycine max]
Length=487

 Score =   310 bits (793),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 212/320 (66%), Gaps = 7/320 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  89    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  148

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE D   S    V G  D   V  +PE    EP+HV DS    P +S   
Sbjct  149   YFVLNDVFRYVE-DHEPSELPPVTGDGDSAAVTVTPEL---EPSHVADSCAPEPTNSHVN  204

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             + + V    +E S   E+Q+  E E  V++    N N  S + E  +SA QDDAPK SYA
Sbjct  205   KGQTVAENAYELSNNHERQIPVENEGNVESHFQSNGNDDSQATELASSA-QDDAPKKSYA  263

Query  936   SILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+  Q     PTK+YVPTN  +    K  + +V  V   E P     S +  ES +A E
Sbjct  264   SIVKVQKGSSVPTKVYVPTNTLKSGPNKTESKVVESVESTEVPEAALESVSNPESSDAHE  323

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EGHSIY+RNLP N+TVA+LE  FKK+GPIK GGIQVR+N+QQG+CFGFVEF  LNSMN
Sbjct  324   EVEGHSIYIRNLPLNVTVAQLELEFKKFGPIKPGGIQVRNNKQQGYCFGFVEFLSLNSMN  383

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SP+ IG RQAVVEIK
Sbjct  384   SAIQASPVPIGGRQAVVEIK  403


 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSP  VYRFYQ+SSV+SRPD  G
Sbjct  26    MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPGSVYRFYQDSSVISRPDSSG  78



>ref|XP_006431303.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 ref|XP_006431306.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 gb|ESR44543.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 gb|ESR44546.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
Length=460

 Score =   306 bits (784),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 215/319 (67%), Gaps = 7/319 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY+NY AEIKTADAQNS+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  61    INQKILSLDYKNYKAEIKTADAQNSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+  E        N +DD P    +P  PD +  HVPD    +P +S  E
Sbjct  121   YFVLNDVFRYVDDGEVLEKYP-ANSIDDAPA---APSIPDIDHTHVPDPPAPDPVTSHVE  176

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E +N+  +++E  E E+Q+  E+E +V+++S+  E   SA +ES +S+  +DAPK SYAS
Sbjct  177   EDQNISERVYEPSEQERQLVTEREAVVESQSYAVETDASAMVESASSSALEDAPKKSYAS  236

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEE  757
             I+   +   GPTK+YVPTN  ++ T+K     +     P +      ST   ES NA EE
Sbjct  237   IVRVVKGGSGPTKVYVPTNTVKVTTKKTENQPIKSENPPSSETSAPVSTDAPESSNAHEE  296

Query  756   AEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNN  577
              EGHSIY+RNLP  +TVA LE  FKK+GP+K GGIQVR N+  G+CFGFVEF   +S++N
Sbjct  297   VEGHSIYIRNLPDTMTVASLEVEFKKFGPVKQGGIQVRHNK--GYCFGFVEFQSSSSVDN  354

Query  576   AIQDSPIMIGDRQAVVEIK  520
             AIQ SPI IG ++A VE K
Sbjct  355   AIQASPITIGGQEAFVEKK  373


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+ T TP     PSAQ+VGNAFVEQYY ILH +P+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALHTATP-----PSAQVVGNAFVEQYYHILHSTPELVFRFYQDSSVLSRPDSNG  50



>ref|XP_007215342.1| hypothetical protein PRUPE_ppa005348mg [Prunus persica]
 gb|EMJ16541.1| hypothetical protein PRUPE_ppa005348mg [Prunus persica]
Length=465

 Score =   306 bits (783),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 219/323 (68%), Gaps = 8/323 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y  Y AEIKTADAQ SY  GV VLVTGCLT KDNLKRKF Q+FFLAPQD
Sbjct  62    QGINEKILSLNYNEYKAEIKTADAQKSYKDGVTVLVTGCLTSKDNLKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              G+FVLNDVFR+VE  E   N   VNGV+D  TV+ +    DPEP HVPD    +  ++ 
Sbjct  122   NGFFVLNDVFRFVEDGELFEN-HSVNGVNDATTVLSNQ---DPEPNHVPDPPAPDLETTQ  177

Query  1119  TEEVKNVGI-KIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
              EE   +GI K +++ + E+Q ++EKE   +  S+ N N  S ++E T++  Q+DAPK S
Sbjct  178   VEE-NQIGIEKAYDTSDHERQSANEKESDAEPPSYSNGNDVSVAVEPTSTTAQEDAPKKS  236

Query  942   YASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapia-PSTAIDESKN  769
             YASI+   + + GP K+YVPTN  R+  +K   ++ A  P    P   A  ST+  ES +
Sbjct  237   YASIVKVPKGSPGPNKVYVPTNTIRVAPKKVENNLPASAPPASVPEASAPTSTSTPESND  296

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
               EE EG+S+Y+RNLP N+T  +LE  FKK+GPIK GGIQVR+ + QG+CFGFVEF   +
Sbjct  297   TNEEVEGYSVYIRNLPLNVTADQLEEEFKKFGPIKQGGIQVRNKKLQGYCFGFVEFLSAS  356

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             SMN+AIQ SPI  G RQAV+EIK
Sbjct  357   SMNSAIQASPISFGGRQAVIEIK  379


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P   P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTAIPP--PTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSVLSRPDSNG  53



>ref|XP_006431304.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 ref|XP_006431305.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 gb|ESR44544.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
 gb|ESR44545.1| hypothetical protein CICLE_v10011679mg [Citrus clementina]
Length=449

 Score =   304 bits (778),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/319 (52%), Positives = 210/319 (66%), Gaps = 18/319 (6%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY+NY AEIKTADAQNS+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  61    INQKILSLDYKNYKAEIKTADAQNSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+  E        N +DD P    +P  PD            +P +S  E
Sbjct  121   YFVLNDVFRYVDDGEVLEKYP-ANSIDDAPA---APSIPD-----------IDPVTSHVE  165

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E +N+  +++E  E E+Q+  E+E +V+++S+  E   SA +ES +S+  +DAPK SYAS
Sbjct  166   EDQNISERVYEPSEQERQLVTEREAVVESQSYAVETDASAMVESASSSALEDAPKKSYAS  225

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEE  757
             I+   +   GPTK+YVPTN  ++ T+K     +     P +      ST   ES NA EE
Sbjct  226   IVRVVKGGSGPTKVYVPTNTVKVTTKKTENQPIKSENPPSSETSAPVSTDAPESSNAHEE  285

Query  756   AEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNN  577
              EGHSIY+RNLP  +TVA LE  FKK+GP+K GGIQVR N+  G+CFGFVEF   +S++N
Sbjct  286   VEGHSIYIRNLPDTMTVASLEVEFKKFGPVKQGGIQVRHNK--GYCFGFVEFQSSSSVDN  343

Query  576   AIQDSPIMIGDRQAVVEIK  520
             AIQ SPI IG ++A VE K
Sbjct  344   AIQASPITIGGQEAFVEKK  362


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+ T TP     PSAQ+VGNAFVEQYY ILH +P+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALHTATP-----PSAQVVGNAFVEQYYHILHSTPELVFRFYQDSSVLSRPDSNG  50



>ref|XP_008230886.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Prunus mume]
 ref|XP_008230887.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Prunus mume]
 ref|XP_008230888.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Prunus mume]
Length=465

 Score =   304 bits (778),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 215/321 (67%), Gaps = 8/321 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y  Y AEIKTADAQ SY  GV VLVTGCLT KDNLKRKF Q+FFLAPQD G
Sbjct  64    INEKILSLNYNEYKAEIKTADAQKSYKEGVTVLVTGCLTSKDNLKRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFR+VE  E   N   VNGV+D  TV+      DPEP HVPD    +  ++  E
Sbjct  124   FFVLNDVFRFVEDGELFEN-HSVNGVNDATTVL---SNQDPEPNHVPDPPAPDLETTQVE  179

Query  1113  EVKNVGI-KIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             E   +GI K +++ + E+Q ++EKE   +  S+ N N    ++E T++  Q+DAPK SYA
Sbjct  180   E-NQIGIEKAYDTSDHERQSANEKESDAEPPSYSNGNDVPVAVEPTSTTAQEDAPKKSYA  238

Query  936   SILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe-apapiaPSTAIDESKNAQ  763
             SI+   + + GP K+YVPTN  R+  +K   ++ A  P      A    ST+  ES +  
Sbjct  239   SIVKVPKGSPGPNKVYVPTNTVRVAPKKAENNLPASAPPASVPEASAPTSTSTQESNDTN  298

Query  762   EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
             EE EG+S+Y+RNLP N+T  +LE  FKK+GPIK GGIQVR+ + QG+CFGFVEF   +SM
Sbjct  299   EEVEGYSVYIRNLPLNVTADQLEEEFKKFGPIKQGGIQVRNKKLQGYCFGFVEFLSASSM  358

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
             N+AIQ SPI  G RQAV+EIK
Sbjct  359   NSAIQASPISFGGRQAVIEIK  379


 Score = 81.3 bits (199),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT+ P   P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTSIPP--PTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSVLSRPDSNG  53



>ref|XP_010089638.1| Putative G3BP-like protein [Morus notabilis]
 gb|EXB38109.1| Putative G3BP-like protein [Morus notabilis]
Length=465

 Score =   303 bits (777),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 189/358 (53%), Positives = 238/358 (66%), Gaps = 15/358 (4%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +   +M      Q IN+KI S DY+ Y AEI+TADAQ 
Sbjct  29    LHHSPELVYRFYQ-DSSVLSRPDANGVMTSVTTMQDINEKILSFDYKEYKAEIETADAQK  87

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             SY  GV VLVTG LTGKDNLKRKF Q+FFLAPQD GYFVLNDVFRYVE  E   N + VN
Sbjct  88    SYKDGVTVLVTGSLTGKDNLKRKFAQSFFLAPQDNGYFVLNDVFRYVEDGEILEN-RPVN  146

Query  1221  GVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKE  1042
             GVDD   V   P   DPEP HVPD    +P +   E  KN+  K +++LE+E+Q   E+ 
Sbjct  147   GVDDATKV---PITVDPEPTHVPDPPTPDPVTVHQELDKNIVEKGYDALENERQFVHEEA  203

Query  1041  ILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRM-  868
              +V+  SH + N     +ES +  I +DAPK SYASI+  ++ + G TK+YVPTN +++ 
Sbjct  204   SVVEPPSHSHGNDVPVEVESVSMMIPEDAPKKSYASIVKVAKGSPGLTKVYVPTNTAKVP  263

Query  867   --KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELE  694
               KTE QS        VPEA AP + ST    + N  EE EGHSIY++NLPF++T A+LE
Sbjct  264   PKKTENQSHGSPVPASVPEASAPSSTSTPESSNDN--EEVEGHSIYIKNLPFSVTAAQLE  321

Query  693   AVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             A FKK+GPIK  G+QVR+N+QQG+CFGFVEF  L+SM++A+Q SPI IG RQAVVEIK
Sbjct  322   AEFKKFGPIKPDGVQVRNNKQQGYCFGFVEFQSLSSMDSALQASPITIGGRQAVVEIK  379


 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT +P T P  SAQ+VGNAFVEQYY ILHHSP+ VYRFYQ+SSVLSRPD +G
Sbjct  1     MALQTASPPTAP--SAQVVGNAFVEQYYHILHHSPELVYRFYQDSSVLSRPDANG  53



>ref|XP_006585783.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X3 [Glycine max]
Length=486

 Score =   303 bits (775),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 211/320 (66%), Gaps = 8/320 (3%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  89    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  148

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE D   S    V G  D   V  +PE    EP+HV DS    P +S   
Sbjct  149   YFVLNDVFRYVE-DHEPSELPPVTGDGDSAAVTVTPEL---EPSHVADSCAPEPTNSHVN  204

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             + + V    +E S   E+Q+  E E  V++    N N  S + E  +SA QDDAPK SYA
Sbjct  205   KGQTVAENAYELSNNHERQIPVENEGNVESHFQSNGNDDSQATELASSA-QDDAPKKSYA  263

Query  936   SILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+  Q     PTK+YVPTN  +    K  + +V  V   E P     S +  ES +A E
Sbjct  264   SIVKVQKGSSVPTKVYVPTNTLKSGPNKTESKVVESVESTEVPEAALESVSNPESSDAHE  323

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EGHSIY+RNLP N+TVA+LE  FKK+GPIK GGIQVR+N+ QG+CFGFVEF  LNSMN
Sbjct  324   EVEGHSIYIRNLPLNVTVAQLELEFKKFGPIKPGGIQVRNNK-QGYCFGFVEFLSLNSMN  382

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SP+ IG RQAVVEIK
Sbjct  383   SAIQASPVPIGGRQAVVEIK  402


 Score = 88.6 bits (218),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSP  VYRFYQ+SSV+SRPD  G
Sbjct  26    MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPGSVYRFYQDSSVISRPDSSG  78



>gb|KHN14035.1| Putative G3BP-like protein [Glycine soja]
Length=490

 Score =   299 bits (765),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 213/345 (62%), Gaps = 29/345 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPE----------------------A  1180
             YFVLNDVFRYVE D   S    V G  D   V  +PE                       
Sbjct  124   YFVLNDVFRYVE-DHEPSELPPVTGDGDAAAVTVTPELGKIIIQKIVSSLSKFIQELHSC  182

Query  1179  PDP---EPAHVPDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLN  1012
               P   EP+HV DS    P +S   + + V    +E S   E+Q+  E E  V++    N
Sbjct  183   CSPFFTEPSHVADSCAPEPTNSHVNKGQTVAENAYELSNNHERQIPVENEGNVESHFQSN  242

Query  1011  ENQTSASLESTTSAIQDDAPKMSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMva  835
              N  S + E  +SA QDDAPK SYASI+  Q     PTK+YVPTN  +    K  + +V 
Sbjct  243   GNDDSQATELASSA-QDDAPKKSYASIVKVQKGSSVPTKVYVPTNTLKSGPNKTESKVVE  301

Query  834   qvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGG  655
              V   E P     S +  ES +A EE EGHSIY+RNLP N+TVA+LE  FKK+GPIK GG
Sbjct  302   SVESTEVPEAALESVSNPESSDAHEEVEGHSIYIRNLPLNVTVAQLELEFKKFGPIKPGG  361

Query  654   IQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             IQVR+N+QQG+CFGFVEF  LNSMN+AIQ SP+ IG RQAVVEIK
Sbjct  362   IQVRNNKQQGYCFGFVEFLSLNSMNSAIQASPVPIGGRQAVVEIK  406


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSP  VYRFYQ+SSV+SRPD  G
Sbjct  1     MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPGSVYRFYQDSSVISRPDSSG  53



>ref|XP_010315778.1| PREDICTED: putative G3BP-like protein [Solanum lycopersicum]
Length=315

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/304 (51%), Positives = 203/304 (67%), Gaps = 24/304 (8%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             L+L ++ N  I SLDY+NY AEIK+ADAQ+S+  GV+ LVTGCLTGKD LKRKF QTFFL
Sbjct  9     LLLSRKFNTLICSLDYKNYKAEIKSADAQDSFKDGVVNLVTGCLTGKDKLKRKFAQTFFL  68

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP  1132
             APQDKGYFVLNDVFRYVE +E D+ ++++NG +D  + + +    DPEP HV D LN + 
Sbjct  69    APQDKGYFVLNDVFRYVEDNEIDTVSEVLNGTEDVQSEVLT---LDPEPTHVVDPLNLDQ  125

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A S  EEV++V  K ++SL D +Q+++E+ I+V+  S+ NE+Q   + ES  S  Q+DAP
Sbjct  126   ARSHAEEVQHVEEKANDSLVDRRQIANERVIVVEIGSYFNEDQHLTNTESANSVAQEDAP  185

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             K SYASI   Q+     +   P  ++   T +                       + ES 
Sbjct  186   KKSYASIDVKQLVAAVAQNAAPGASNPTTTSE---------------------IDVPESN  224

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             + +EEAEG+SIYVRNLP ++TVA+LEA FK Y PIK GG+QVRSNRQQ F FGFVEF  +
Sbjct  225   DVEEEAEGYSIYVRNLPLDVTVAQLEAEFKTYRPIKQGGVQVRSNRQQRFIFGFVEFEDM  284

Query  591   NSMN  580
             +SMN
Sbjct  285   SSMN  288



>ref|XP_004489526.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Cicer arietinum]
 ref|XP_004489527.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Cicer arietinum]
Length=469

 Score =   295 bits (755),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 209/324 (65%), Gaps = 14/324 (4%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I++KI SL+++ Y AEIKTADAQ S+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    ISEKILSLNFKEYKAEIKTADAQKSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFRYVE D   S    VNG DD   V   PE   PEP++V D    +PA+S  +
Sbjct  124   FFVLNDVFRYVE-DREPSELNPVNGDDDAIAVTVIPE---PEPSYVADPPAPDPANSRAK  179

Query  1113  EVKNVGIKIHESLE-----DEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             E     + I  + E      EK +  E E + + +   NEN  S + E  +S  Q+DAPK
Sbjct  180   EGH---VAIENAYEPPSNHHEKLIVSENEDIAELDFQSNENDDSQAAE-ISSLSQEDAPK  235

Query  948   MSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
              SYASI+   + N    K+YVPTN  +  T K  +  V  V     P     S    ES 
Sbjct  236   KSYASIVKVPKGNLVSAKVYVPTNMVKKATNKTESQAVESVESAAVPEAAPDSVGNPESN  295

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +  EE EGHSIY+RNLP N+TVA+LE  FKK+GPIK G IQVR+N+QQG+CFGFVEF  L
Sbjct  296   DTNEEVEGHSIYIRNLPLNVTVAQLEVEFKKFGPIKPGCIQVRNNKQQGYCFGFVEFLSL  355

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             NSMNNAIQ SPI IG RQAV+EIK
Sbjct  356   NSMNNAIQASPIAIGGRQAVIEIK  379


 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SA++VGNAFVEQYY ILH SP+ VYRFYQESSV+SRPD +G
Sbjct  1     MALQTATPPTTP--SAEVVGNAFVEQYYHILHQSPELVYRFYQESSVISRPDSNG  53



>ref|XP_004306069.1| PREDICTED: putative G3BP-like protein-like [Fragaria vesca subsp. 
vesca]
Length=510

 Score =   296 bits (757),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 215/322 (67%), Gaps = 6/322 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IND+I S DY+ Y AEI+TADAQNSY  GV VLVTGCLT KDNLKRKF Q+FFLAPQ+
Sbjct  62    QGINDQILSFDYKEYKAEIETADAQNSYKDGVTVLVTGCLTSKDNLKRKFAQSFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              G+FVLNDVFRYVE  E   N   VNGV+D  +V+ + E   PEP +VPD    +  ++ 
Sbjct  122   NGFFVLNDVFRYVEDGELLKN-HSVNGVNDATSVLLNQE---PEPTYVPDPPAPDLETAP  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE +NV  K  ++ + ++Q ++EKE  ++  S+ N +  S  +ES ++  Q+D  K SY
Sbjct  178   VEEDQNVVEKAFDTSDQDRQSANEKESGIERPSYSNGDNVSVVVESASTTAQEDGQKKSY  237

Query  939   ASILS-SQMNKGPTKIYVPTNASRMKTEKQSASM-vaqvpvpeapapiaPSTAIDESKNA  766
             ASI+  ++ + GP K+YVPTN  ++  +K   S+  +        A    S+   E++  
Sbjct  238   ASIVKVAKGSSGPNKVYVPTNTVKVAPKKMENSLPGSAASASVPEASAPTSSTTIENRET  297

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
              EEAEG+SIY+ NLP ++T  +LE  FKK+GPIK GGIQVR+ + QG+CFGFVEF  L+S
Sbjct  298   NEEAEGYSIYISNLPLSVTADQLEVEFKKFGPIKEGGIQVRNKKLQGYCFGFVEFQSLSS  357

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AIQ SPI IG  QA +EIK
Sbjct  358   MNSAIQASPITIGGLQATIEIK  379


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P  +P  SAQ+V NAF+ QYY ILHH+PD VYRFYQ+SSV+SRPD DG
Sbjct  1     MALQTVIPPAIP--SAQVVANAFIAQYYHILHHNPDNVYRFYQDSSVMSRPDADG  53



>ref|XP_010258034.1| PREDICTED: putative G3BP-like protein [Nelumbo nucifera]
Length=477

 Score =   294 bits (752),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 175/327 (54%), Positives = 226/327 (69%), Gaps = 12/327 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLDY++Y AEI+TADAQ+SY  GVIVLVTGCLTGKDN++RKFTQ+FFLAPQD
Sbjct  62    QAINEKILSLDYKDYKAEIQTADAQDSYENGVIVLVTGCLTGKDNVRRKFTQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADS-NAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDVFRYV+++EA   N   VNGV    +        DPEPAHVPD    + A+S
Sbjct  122   KGYYVLNDVFRYVDENEAQVINPVSVNGVGASASA--DSLTSDPEPAHVPDHPALDQATS  179

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
               EE  N G ++ +  ++E+    E+E++V+   H ++++   + ES +S + +DAPK S
Sbjct  180   LPEEDLNDGEEVCDPSDNEEGSVIEEEVVVEPPDHSSQSEVHPAPESASSTVPEDAPKKS  239

Query  942   YASILSSQMNKG---PTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAID  781
             YASI+  ++ KG   PT +YVP+NA R     T++QS    A   V E   P +  TA +
Sbjct  240   YASIV--KVMKGSTTPTAVYVPSNAVRTASANTDQQSYGSAAPASVSETSVPSSY-TAPE  296

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              S  A EE EGHSIY+RNLP N TVA+LE  FKK+G IK  GIQVRSN+ QGFCFGFVEF
Sbjct  297   SSSTAPEEVEGHSIYIRNLPLNATVAQLEEEFKKFGHIKPNGIQVRSNKGQGFCFGFVEF  356

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
               L+SM +AI+ SP++IG RQA VE K
Sbjct  357   ELLSSMQSAIEASPVIIGGRQAFVEEK  383


 Score = 82.0 bits (201),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA QT +PA  P  SAQ+VGNAFVEQYY ILH SP+ VYRFY +SS+LSRP+P+G
Sbjct  1     MATQTASPAHAP--SAQVVGNAFVEQYYHILHQSPELVYRFYHDSSMLSRPEPNG  53



>gb|KEH21657.1| ras GTPase-activating binding-like protein [Medicago truncatula]
Length=476

 Score =   289 bits (739),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 212/328 (65%), Gaps = 15/328 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ S+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFRYVE D   S    VNG DD P  +      +PEP H+ D    +PA+S  +
Sbjct  124   FFVLNDVFRYVE-DPEPSEPHPVNG-DDGPIAVTV--TSEPEPIHIADPSPTDPANSHVK  179

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             E + V    +E S   E Q+  E E  V+ +   NEN  S + E  TS  Q+DAPK SYA
Sbjct  180   ERQIVADNAYEPSNHPETQIVAENEDTVEPDFQSNENVDSQAAE-ITSLSQEDAPKKSYA  238

Query  936   SILSS-QMNKGPTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTAID----  781
             SI+   + N  P K+YVPT   +     T K++ +      V        P  A D    
Sbjct  239   SIVKVLKGNLVPAKVYVPTKTVKNVPTNTVKKATNRTENKVVESVEPAAVPDAAPDNVGN  298

Query  780   -ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              ES ++ EE EGHSIY+RNLP N+TVA+LE  F+K+GPIK G IQVR+N+QQG+CFGFVE
Sbjct  299   PESNDSNEEVEGHSIYIRNLPLNVTVAQLETEFQKFGPIKPGCIQVRNNKQQGYCFGFVE  358

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             +  +NSMNNAIQ SPI IG RQAVVEIK
Sbjct  359   YLSVNSMNNAIQASPIPIGGRQAVVEIK  386


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P T P P  ++VGNAFVEQYY ILHHSP+ VYRFYQESSV+SRPD +G
Sbjct  1     MALQTAAPPTTPSP--EMVGNAFVEQYYHILHHSPELVYRFYQESSVISRPDSNG  53



>ref|XP_010260138.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Nelumbo 
nucifera]
 ref|XP_010260147.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Nelumbo 
nucifera]
Length=463

 Score =   288 bits (736),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/328 (52%), Positives = 214/328 (65%), Gaps = 15/328 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDK+ SLDY++Y AEI+T DAQ+SY  GVIVLVTGCLTGKDN+++KFTQ FFLAPQ+
Sbjct  62    QAINDKVLSLDYKDYKAEIETVDAQDSYKDGVIVLVTGCLTGKDNVRKKFTQLFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADS-NAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLNDVFR+V+Q+EA + N   VN V    +   S    +PEP HVPD     P +S
Sbjct  122   KGYFVLNDVFRFVDQNEAQAINPVSVNDVGVGASA--SSLTQEPEPTHVPDRPVLYPTTS  179

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
              TEE  N G ++  S  +E+    E EI+V+   H ++N+     ES  + + +DAPK S
Sbjct  180   HTEEDLNNGKEVCNSSGNEEGSDVEVEIMVEAPEHSSQNEAGPPPESXPT-VPEDAPKKS  238

Query  942   YASILSSQMNKGPTK----IYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTAI  784
             YASI+  +  KG T     +YV TN+ R     T++Q  S  +  P  +  A        
Sbjct  239   YASIV--KFTKGSTASTTMVYVATNSVREAPANTDQQ--SYGSAAPALDPEASAPSVNVA  294

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              +S NA EE EGHSIY+R+LP N    +LE VFKK+GPIK  GIQVRSN+ QGFCFGFVE
Sbjct  295   SDSSNAPEEVEGHSIYIRSLPLNAMPEQLEEVFKKFGPIKPNGIQVRSNKNQGFCFGFVE  354

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F  L+SM +AI+ SPIMIG RQA VE K
Sbjct  355   FELLSSMQSAIEASPIMIGGRQAFVEEK  382


 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT +PA  P  SAQ+VGNAFVEQYYLILHHSP+ VYRFYQ+SSV SRP+P+G
Sbjct  1     MAMQTASPAHAP--SAQVVGNAFVEQYYLILHHSPELVYRFYQDSSVFSRPEPNG  53



>ref|XP_007139478.1| hypothetical protein PHAVU_008G032800g [Phaseolus vulgaris]
 gb|ESW11472.1| hypothetical protein PHAVU_008G032800g [Phaseolus vulgaris]
Length=781

 Score =   296 bits (757),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 208/324 (64%), Gaps = 15/324 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDN++RKF Q+FFLAPQD G
Sbjct  369   INEKIVSLNFKEFKAEIKTADAQKSYQEGVTVLVTGCLTGKDNMRRKFAQSFFLAPQDNG  428

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE DE  S    VNG  D   V   PE   PE +HV DS    PA   T 
Sbjct  429   YFVLNDVFRYVEDDEP-SELPPVNGDGDAAAVKIIPE---PESSHVADS----PAPDSTN  480

Query  1113  EVKNVGIKIHE-----SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
              + N G  + E     S   E+Q+  E E  V++    N N  S + E   S  Q+DAPK
Sbjct  481   SIVNKGQIVVEKAYAPSNHHERQIPAENEDNVESHFQSNGNDDSQATE-VDSLAQEDAPK  539

Query  948   MSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
              SYASI+  Q     PTK+YVPTN  +  + K  + +   V   E P   + S    ES 
Sbjct  540   QSYASIVKVQKGSSVPTKVYVPTNTLKSGSNKTESLVAEPVESSEVPEAASDSVNDPESS  599

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV +LE  FKK+G IK  GIQVR+N+QQG+CFGFVEF  L
Sbjct  600   DAHEEVEGHSIYIRNLPLNVTVGQLEVEFKKFGSIKPDGIQVRNNKQQGYCFGFVEFLSL  659

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             NSMN+AIQ SPI IG RQAVVEIK
Sbjct  660   NSMNSAIQASPIPIGGRQAVVEIK  683


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = -2

Query  1887  RMAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSPD VYRFYQ+SSV+SRPD +G
Sbjct  305   QMALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPDLVYRFYQDSSVISRPDSNG  358



>ref|XP_007139477.1| hypothetical protein PHAVU_008G032800g [Phaseolus vulgaris]
 gb|ESW11471.1| hypothetical protein PHAVU_008G032800g [Phaseolus vulgaris]
Length=793

 Score =   295 bits (756),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 208/324 (64%), Gaps = 15/324 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDN++RKF Q+FFLAPQD G
Sbjct  369   INEKIVSLNFKEFKAEIKTADAQKSYQEGVTVLVTGCLTGKDNMRRKFAQSFFLAPQDNG  428

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE DE  S    VNG  D   V   PE   PE +HV DS    PA   T 
Sbjct  429   YFVLNDVFRYVEDDEP-SELPPVNGDGDAAAVKIIPE---PESSHVADS----PAPDSTN  480

Query  1113  EVKNVGIKIHE-----SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
              + N G  + E     S   E+Q+  E E  V++    N N  S + E   S  Q+DAPK
Sbjct  481   SIVNKGQIVVEKAYAPSNHHERQIPAENEDNVESHFQSNGNDDSQATE-VDSLAQEDAPK  539

Query  948   MSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
              SYASI+  Q     PTK+YVPTN  +  + K  + +   V   E P   + S    ES 
Sbjct  540   QSYASIVKVQKGSSVPTKVYVPTNTLKSGSNKTESLVAEPVESSEVPEAASDSVNDPESS  599

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV +LE  FKK+G IK  GIQVR+N+QQG+CFGFVEF  L
Sbjct  600   DAHEEVEGHSIYIRNLPLNVTVGQLEVEFKKFGSIKPDGIQVRNNKQQGYCFGFVEFLSL  659

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             NSMN+AIQ SPI IG RQAVVEIK
Sbjct  660   NSMNSAIQASPIPIGGRQAVVEIK  683


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 2/56 (4%)
 Frame = -2

Query  1887  RMAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSPD VYRFYQ+SSV+SRPD +G
Sbjct  305   QMALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPDLVYRFYQDSSVISRPDSNG  358



>gb|ACU19575.1| unknown [Glycine max]
Length=461

 Score =   286 bits (733),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 202/320 (63%), Gaps = 10/320 (3%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYVE D   S    V G  D   V  +PE   PEP+H  DS   +P +S   
Sbjct  124   YFVLNDVFRYVE-DHEPSELPPVTGDGDAAAVTVTPE---PEPSHFADSSAPDPTNSHVN  179

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             + + V    +E S   E+Q+  E    V+     N N  S + E  +SA +    K SYA
Sbjct  180   KGQTVAENAYEPSNHHERQIPVENVDNVEPHFQSNGNDDSQATELASSAQE----KKSYA  235

Query  936   SILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+  Q      TK+YVPTN  +    K    +V  V   E       S    ES +A E
Sbjct  236   SIVKVQKEGSVATKVYVPTNTLKSGPNKTENKVVESVESTEVSEAALDSVNNPESSDAHE  295

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EGHSIY+RNLP N+T A+LE  FKK+GPIK GGIQVR+N+QQG+CFGFVEF  LNSMN
Sbjct  296   EVEGHSIYIRNLPLNVTAAQLELEFKKFGPIKPGGIQVRNNKQQGYCFGFVEFLSLNSMN  355

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SP+ IG RQAVVEIK
Sbjct  356   SAIQASPVPIGGRQAVVEIK  375


 Score = 90.1 bits (222),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSPD VYRFYQ+SSV+SRPD  G
Sbjct  1     MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPDLVYRFYQDSSVISRPDSSG  53



>ref|XP_006600586.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006600587.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Glycine max]
 gb|KHN18364.1| Putative G3BP-like protein [Glycine soja]
Length=460

 Score =   285 bits (730),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/324 (50%), Positives = 222/324 (69%), Gaps = 13/324 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q I++KI SL YE+Y AEIKTADAQ S+ GGVIVLVTGCLTGKDN++RKF+QTFFLAPQ+
Sbjct  62    QEIHEKIISLKYEDYTAEIKTADAQESHKGGVIVLVTGCLTGKDNVRRKFSQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDVFR++E+ D    N+  V+ +++    +  PE+ D    H P  L  + A+ 
Sbjct  122   KGYYVLNDVFRFIEENDTPQINSSSVSVINENAEAVHEPESED---LHAPKHLVEDNATL  178

Query  1122  DTEEVKNVGIKI-HESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                E  N G ++ H   E+E  V DE+  + +  + L++N    +++ +TSA+ DDAP+ 
Sbjct  179   AEGENLNNGAEVYHPQDEEEGSVIDEE--VAEPPTDLSQNDI-VTVDDSTSAVLDDAPRR  235

Query  945   SYASI-LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST-AIDESK  772
             SYA+I + S +  G   +YVP+ A+R+ + K S            P  +APS+ +   S 
Sbjct  236   SYAAIVMKSHVASG--HVYVPSRAARIASAKSSEQWPTTAKSTPVPEALAPSSDSAPGSS  293

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +  EEAEGHSIY+RNLPFN TV +LE VFKK+GPIKHGGIQVRS++  GFCFGFVEF  L
Sbjct  294   DVHEEAEGHSIYIRNLPFNATVEQLEEVFKKFGPIKHGGIQVRSSK-HGFCFGFVEFEEL  352

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +SM++A++ SPI +G+RQAVVE K
Sbjct  353   SSMHSALEASPITVGERQAVVEEK  376


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM  T P T P  SAQ+VGNAFVEQYY ILH SP+ V+RFYQ+SS L+R D +G
Sbjct  1     MAMPETIPPTTP--SAQVVGNAFVEQYYHILHQSPELVHRFYQDSSFLTRSDSNG  53



>ref|XP_008379436.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Malus domestica]
 ref|XP_008379437.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Malus domestica]
Length=460

 Score =   285 bits (728),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 209/322 (65%), Gaps = 8/322 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y  Y AEIKTADAQ SY  GV VLVTGCLTGKDNLKRKF Q+FFLAPQD
Sbjct  62    QGINEKILSLNYNKYKAEIKTADAQKSYEDGVTVLVTGCLTGKDNLKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              G+FVLNDVFR+VE  +   N   VN V+D  T++ S    DPE  HVPD    +  ++ 
Sbjct  122   NGFFVLNDVFRFVEDGDLLEN-HSVNEVNDAATILSS---QDPEXTHVPDPPAPDLETTQ  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE        +++ + E+Q + E +   +  S+ N N  + ++E  ++  Q+D+ K SY
Sbjct  178   VEENPIXVEXTYDTSDHERQYTTESD--XEPPSYSNGNDVTVAVEXASTTAQEDSSKKSY  235

Query  939   ASILS-SQMNKGPTKIYVPTNASRMKTEKQSASM-vaqvpvpeapapiaPSTAIDESKNA  766
             ASI+   + + GP+K+YVPTN  R+ ++K   ++     P          ST+  ES + 
Sbjct  236   ASIVKVPKGSPGPSKVYVPTNTVRVASKKAETNLPGPTAPASVPEXSAPTSTSALESSDT  295

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
              EE EG+SIY+RNLP N+T  +L+  FKK+GPIK GG+QVR+ + QG CFGFVEF   +S
Sbjct  296   NEEVEGYSIYIRNLPLNVTTDQLQEEFKKFGPIKQGGVQVRNKKLQGHCFGFVEFESSSS  355

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AIQ SPI IG RQAV+EIK
Sbjct  356   MNSAIQASPITIGGRQAVIEIK  377


 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q     + P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SS+LSRPD +G
Sbjct  1     MALQNAI--SRPTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSILSRPDSNG  53



>ref|XP_010660605.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Vitis vinifera]
 ref|XP_010660606.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Vitis vinifera]
Length=459

 Score =   283 bits (723),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 223/324 (69%), Gaps = 10/324 (3%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S +++N   EI T D+Q+SY GGVIVLVTGCL  KD  ++KFTQ+FFLAPQ 
Sbjct  62    QGINEKILSSEFKNRKTEIMTTDSQSSYEGGVIVLVTGCLMTKDKRRKKFTQSFFLAPQY  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLNDV RY+   EA      +NG +D P V  +     P   H PD    +PA+S 
Sbjct  122   NGYYVLNDVLRYIVDGEALETIP-INGTNDSPAVSLNQ---GPGHTHDPDPPVPDPATSV  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E+ + V  K+++ LE+E+Q+ +E+E   +T+SH  EN  S   ES++S+ Q+DAPK SY
Sbjct  178   VEDDEIVIEKVYDPLENEEQLVNEEEDFTETQSHPIENDDSTIAESSSSSAQEDAPKKSY  237

Query  939   ASILS-SQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             ASI+   + + G TK+YVPT  +++   KTE QS  + A  PVPE+      S    ES 
Sbjct  238   ASIVKVMKGSSGSTKVYVPTKTTKVTPAKTENQSPGLAAPAPVPESSVTS--SINAPESS  295

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV++LEA F+K+GPIK GG+QVRSN+QQ +CFGFVEF  L
Sbjct  296   DAPEEVEGHSIYIRNLPLNVTVSQLEAEFQKFGPIKQGGVQVRSNKQQAYCFGFVEFLSL  355

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +SM++AIQ SPI+IGD QAVVEIK
Sbjct  356   SSMHSAIQASPIIIGDHQAVVEIK  379


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT  P  +P PSA++VGNAFVEQYY +LH SP+ V+RFY++SSV+S PD +G
Sbjct  1     MAMQTENPQ-LP-PSAEVVGNAFVEQYYYVLHRSPELVFRFYRDSSVMSWPDSNG  53



>ref|XP_007155227.1| hypothetical protein PHAVU_003G184000g [Phaseolus vulgaris]
 gb|ESW27221.1| hypothetical protein PHAVU_003G184000g [Phaseolus vulgaris]
Length=463

 Score =   283 bits (723),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 212/325 (65%), Gaps = 13/325 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q I++KI SL YE+Y AEIKTADAQ S+ GGVIVLVTGCLTGKDN+KRKF+QTFFLAPQ+
Sbjct  62    QEIHEKIISLKYEDYTAEIKTADAQESHKGGVIVLVTGCLTGKDNVKRKFSQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADS-NAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLNDVFRY+E ++A   N+   N + +    +  PE+   E  H P  L  +PA+S
Sbjct  122   KGYFVLNDVFRYIEVNDAPQLNSASGNVITENTETLHEPES---EETHSPKHLVEDPATS  178

Query  1122  ---DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
                + E   N G   H   E+E  V DE+  + +  + L++N    ++  +TSA QDDAP
Sbjct  179   TLVEDENHSNGGEVYHPQDEEEGSVIDEE--VAEPPTDLSQNDI-VTVHDSTSAAQDDAP  235

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapap-iaPSTAIDES  775
             K SYA I+  + N     +YVP  A+R+ + K S            P      S +   S
Sbjct  236   KRSYAFIV-MKSNVASGHVYVPRQAARVASAKSSEQWPTTAKSTPVPESFAPISDSAPGS  294

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
              +  EEAEGHSIY+RNLPF+ TV +LE VFKK+GPIKH GIQVRS++  GFCFGFVEF  
Sbjct  295   SDLHEEAEGHSIYIRNLPFSATVEQLEEVFKKFGPIKHDGIQVRSSK-HGFCFGFVEFEE  353

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
             L+SM +A++ SPI +G+RQAVVE K
Sbjct  354   LSSMQSALEASPITVGERQAVVEEK  378


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM  T P T P  SAQ+VGNAFVEQYY ILH SP+ V+RFYQ+SS L+R D +G
Sbjct  1     MAMPETIPLTTP--SAQVVGNAFVEQYYHILHQSPNLVHRFYQDSSFLTRSDNNG  53



>ref|XP_003524604.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Glycine max]
 gb|KHN48749.1| Putative G3BP-like protein [Glycine soja]
Length=462

 Score =   283 bits (723),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 221/326 (68%), Gaps = 15/326 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q I++KI SL YE+Y AEIKTADAQ S+ GGVIVLVTGCLTGKDN++RKF+QTFFLAPQ+
Sbjct  62    QEIHEKIISLKYEDYTAEIKTADAQESHKGGVIVLVTGCLTGKDNVRRKFSQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDVFR++E+ D    N+  V+ +++    +  PE+ D    H    L  + A+ 
Sbjct  122   KGYYVLNDVFRFIEENDTPQLNSSTVSVINENAEAVHEPESED---LHALKHLVEDTATL  178

Query  1122  DTEEVKNVGIKI-HESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                E  N G ++ H   E+E  V DE+  + +  + L++N    +++ +TSA+ DDAP+ 
Sbjct  179   AEGENLNNGAEVYHPQDEEEGSVIDEE--VAEPPTDLSQNDI-VTVDDSTSAVPDDAPRR  235

Query  945   SYASI-LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE---  778
             SYA+I + S +  G   +YVP+ A+R+   K S  +         PAP A + + D    
Sbjct  236   SYAAIVMKSHVASG--HVYVPSRAARIAYAKSSEQLPTTANAKSTPAPEALAPSSDNASG  293

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S +  EEAEGHSIY+RNLPFN TV +LE VFKK+GPIKHGGIQVRS++  GFCFGFVEF 
Sbjct  294   SSDVHEEAEGHSIYIRNLPFNATVEQLEEVFKKFGPIKHGGIQVRSSK-HGFCFGFVEFE  352

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L+SM++A++ SPI +G+RQAVVE K
Sbjct  353   ELSSMHSALEASPITVGERQAVVEEK  378


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAM  T P T P  SAQ+VGNAFVEQYY ILH SP+ V+RFYQ+SS L+R D +G
Sbjct  1     MAMPETIPPTTP--SAQVVGNAFVEQYYHILHQSPELVHRFYQDSSFLTRSDSNG  53



>ref|XP_009365922.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Pyrus x bretschneideri]
Length=462

 Score =   282 bits (721),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 207/320 (65%), Gaps = 8/320 (3%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y  Y AEI TADAQ S+  GV VLVTGCLTGKDNLKRKF Q+FFLAPQD G
Sbjct  64    INEKILSLNYNEYKAEIMTADAQKSFQEGVTVLVTGCLTGKDNLKRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFR+VE  +   N   VN V+D  TV+ S    DPEP HVPD    +  ++  E
Sbjct  124   FFVLNDVFRFVEDGQLFEN-HSVNEVNDATTVLSSQ---DPEPTHVPDPPAPDLETTQVE  179

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E   V  K +++   ++Q + E ++   + S+ N +  +  L+S T+  Q+D PK SYAS
Sbjct  180   ENLIVVEKTYDTSGHDRQSAKESDVEPPSYSNGNNDPVAVELDSMTA--QEDTPKKSYAS  237

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapia-PSTAIDESKNAQE  760
             I+   + + GP K+YVPTN  R   +    S+         P   A  ST+  ES +  E
Sbjct  238   IVRVPKGSPGPNKVYVPTNTVREAPKVAETSLPGPTAPASVPEASAPTSTSALESGDTNE  297

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EG+S+Y+RNLP N+T  +LE  FKK+GPIK GG+QVR+ + QG CFGFVEF   +SMN
Sbjct  298   EVEGYSVYIRNLPLNVTSDQLEEEFKKFGPIKQGGVQVRNKKLQGHCFGFVEFESSSSMN  357

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SPI IG RQAV+EIK
Sbjct  358   SAIQASPITIGGRQAVIEIK  377


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P   P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTAIPP--PTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSVLSRPDSNG  53



>gb|KEH21658.1| ras GTPase-activating binding-like protein [Medicago truncatula]
Length=475

 Score =   282 bits (722),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 211/328 (64%), Gaps = 16/328 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ S+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFRYVE D   S    VNG DD P  +      +PEP H+ D    +PA+S  +
Sbjct  124   FFVLNDVFRYVE-DPEPSEPHPVNG-DDGPIAVTV--TSEPEPIHIADPSPTDPANSHVK  179

Query  1113  EVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             E + V    +E S   E Q+  E E  V+ +   NEN  S + E  TS  Q+DAPK SYA
Sbjct  180   ERQIVADNAYEPSNHPETQIVAENEDTVEPDFQSNENVDSQAAE-ITSLSQEDAPKKSYA  238

Query  936   SILSS-QMNKGPTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTAID----  781
             SI+   + N  P K+YVPT   +     T K++ +      V        P  A D    
Sbjct  239   SIVKVLKGNLVPAKVYVPTKTVKNVPTNTVKKATNRTENKVVESVEPAAVPDAAPDNVGN  298

Query  780   -ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              ES ++ EE EGHSIY+RNLP N+TVA+LE  F+K+GPIK G IQVR+N+ QG+CFGFVE
Sbjct  299   PESNDSNEEVEGHSIYIRNLPLNVTVAQLETEFQKFGPIKPGCIQVRNNK-QGYCFGFVE  357

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             +  +NSMNNAIQ SPI IG RQAVVEIK
Sbjct  358   YLSVNSMNNAIQASPIPIGGRQAVVEIK  385


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P T P P  ++VGNAFVEQYY ILHHSP+ VYRFYQESSV+SRPD +G
Sbjct  1     MALQTAAPPTTPSP--EMVGNAFVEQYYHILHHSPELVYRFYQESSVISRPDSNG  53



>ref|XP_009365886.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Pyrus x bretschneideri]
Length=462

 Score =   282 bits (721),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 207/320 (65%), Gaps = 8/320 (3%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y  Y AEI TADAQ S+  GV VLVTGCLTGKDNLKRKF Q+FFLAPQD G
Sbjct  64    INEKILSLNYNEYKAEIMTADAQKSFQEGVTVLVTGCLTGKDNLKRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLNDVFR+VE  +   N   VN V+D  TV+ S    DPEP HVPD    +  ++  E
Sbjct  124   FFVLNDVFRFVEDGQLFEN-HSVNEVNDATTVLSSQ---DPEPTHVPDPPAPDLETTQVE  179

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E   V  K +++   ++Q + E ++   + S+ N +  +  L+S T+  Q+D PK SYAS
Sbjct  180   ENLIVVEKTYDTSGHDRQSAKESDVEPPSYSNGNNDPVAVELDSMTA--QEDTPKKSYAS  237

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapia-PSTAIDESKNAQE  760
             I+   + + GP K+YVPTN  R   +    S+         P   A  ST+  ES +  E
Sbjct  238   IVRVPKGSPGPNKVYVPTNTVREAPKVAETSLPGPTAPASVPEASAPTSTSALESGDTNE  297

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E EG+S+Y+RNLP N+T  +LE  FKK+GPIK GG+QVR+ + QG CFGFVEF   +SMN
Sbjct  298   EVEGYSVYIRNLPLNVTSDQLEEEFKKFGPIKQGGVQVRNKKLQGHCFGFVEFESSSSMN  357

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AIQ SPI IG RQAV+EIK
Sbjct  358   SAIQASPITIGGRQAVIEIK  377


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT  P   P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SSVLSRPD +G
Sbjct  1     MALQTAIPP--PTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSVLSRPDSNG  53



>ref|XP_010660607.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Vitis vinifera]
Length=457

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 223/324 (69%), Gaps = 12/324 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S +++N   EI T D+Q+SY GGVIVLVTGCL  KD  ++KFTQ+FFLAPQ 
Sbjct  62    QGINEKILSSEFKNRKTEIMTTDSQSSYEGGVIVLVTGCLMTKDKRRKKFTQSFFLAPQY  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLNDV RY+   EA      +NG +D P V     + +    H PD    +PA+S 
Sbjct  122   NGYYVLNDVLRYIVDGEALETIP-INGTNDSPAV-----SLNQGHTHDPDPPVPDPATSV  175

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E+ + V  K+++ LE+E+Q+ +E+E   +T+SH  EN  S   ES++S+ Q+DAPK SY
Sbjct  176   VEDDEIVIEKVYDPLENEEQLVNEEEDFTETQSHPIENDDSTIAESSSSSAQEDAPKKSY  235

Query  939   ASILS-SQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             ASI+   + + G TK+YVPT  +++   KTE QS  + A  PVPE+      S    ES 
Sbjct  236   ASIVKVMKGSSGSTKVYVPTKTTKVTPAKTENQSPGLAAPAPVPESSVTS--SINAPESS  293

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV++LEA F+K+GPIK GG+QVRSN+QQ +CFGFVEF  L
Sbjct  294   DAPEEVEGHSIYIRNLPLNVTVSQLEAEFQKFGPIKQGGVQVRSNKQQAYCFGFVEFLSL  353

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +SM++AIQ SPI+IGD QAVVEIK
Sbjct  354   SSMHSAIQASPIIIGDHQAVVEIK  377


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT  P  +P PSA++VGNAFVEQYY +LH SP+ V+RFY++SSV+S PD +G
Sbjct  1     MAMQTENPQ-LP-PSAEVVGNAFVEQYYYVLHRSPELVFRFYRDSSVMSWPDSNG  53



>ref|XP_007209111.1| hypothetical protein PRUPE_ppa005346mg [Prunus persica]
 gb|EMJ10310.1| hypothetical protein PRUPE_ppa005346mg [Prunus persica]
Length=465

 Score =   279 bits (714),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 219/336 (65%), Gaps = 16/336 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I+ KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMATVTTMQAISQKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N  +VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLQTNNVLVNGINES-----APEAILTAEPEPTHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  + A+S  EE  N G ++ +  ++++    E+EI V+  +H ++NQ  A ++ T 
Sbjct  167   PDHLVVDRATSFEEEDLNNGPEVCDPSDNDEGSVIEEEI-VEPPAHSSQNQGLADVDPTP  225

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASR-MKTEKQSASMvaqvpvpeapa  808
                   Q+D PK SYASI+  + N   + + VPT   R +       S+    P P   A
Sbjct  226   DPAPETQEDVPKKSYASIV-MKSNAASSPVRVPTRTVRTISANTDHQSLGFAQPAPAPVA  284

Query  807   piaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQ  628
                   A  ES NA EEAEGHSI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++ Q
Sbjct  285   SAPSGDAAPESSNAHEEAEGHSIHVRNLPYDATVEQLEKEFKKFGPIKRDGIQVRSSK-Q  343

Query  627   GFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  344   GFCFGFVEFETLSSMQSALEASPITIGDRPAVIEEK  379


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  +PA+ P  SAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSR D +G
Sbjct  1     MQEASPASAP--SAQLVGNAFVEQYYHILHESPQLVHRFYQDSSSLSRTDVNG  51



>gb|EPS71512.1| hypothetical protein M569_03247 [Genlisea aurea]
Length=450

 Score =   279 bits (713),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 225/358 (63%), Gaps = 13/358 (4%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLM----LYQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +   LM      + IN+ I SLDY+NY AEIKTADAQ+
Sbjct  31    LHHSPELAHRFYQ-DNSVLSRPSPDGLMRTVTTMKSINETICSLDYKNYKAEIKTADAQD  89

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             S+  GV++LVTG LTG D+ KRKFTQTFFLAPQD GYFVLNDVFRYVE    D   ++++
Sbjct  90    SFRDGVVLLVTGSLTGNDHQKRKFTQTFFLAPQDTGYFVLNDVFRYVE----DGGPEIIS  145

Query  1221  G--VDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDE  1048
             G  + D+ +          EPA V D    +  ++  E ++    + +  + D K    +
Sbjct  146   GFGIRDDGSSPSGASNQVQEPAQVIDPPKTDFPAALMEVIEAAEEQRNGHVIDGKPPIQD  205

Query  1047  KEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRM  868
             K I+ + +S  +EN ++A  E+  SA ++DAPK SYASI+SSQ  +GP KIYVPTN++R 
Sbjct  206   KAIVPEPDSQASENHSAADSEAVISASEEDAPKKSYASIVSSQTKRGPMKIYVPTNSARA  265

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAID--ESKNAQEEAEGHSIYVRNLPFNITVAELE  694
                  +A    Q  V +A    +   A    E+ +  +E EGHSIY+RNLP N TV +LE
Sbjct  266   AAAAAAAKAENQSFVNQATEVSSSIAAKPPAETHDVADEDEGHSIYIRNLPINATVNQLE  325

Query  693   AVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             A FKK+GPIK  GIQVR NRQQGFCFGFVEF  L+SM +AI+ SPI IGDR AVVE K
Sbjct  326   AEFKKFGPIKPDGIQVRGNRQQGFCFGFVEFLELSSMQSAIEASPITIGDRPAVVEAK  383


 Score = 82.0 bits (201),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA    T  + P PSAQ+VGNAFVEQYY ILHHSP+  +RFYQ++SVLSRP PDG
Sbjct  1     MASANPTQESNPSPSAQVVGNAFVEQYYHILHHSPELAHRFYQDNSVLSRPSPDG  55



>ref|XP_008374641.1| PREDICTED: putative G3BP-like protein isoform X1 [Malus domestica]
 ref|XP_008374642.1| PREDICTED: putative G3BP-like protein isoform X1 [Malus domestica]
Length=470

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 214/337 (64%), Gaps = 15/337 (4%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I++KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMTTVTTMQAISEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  ++   VNGV++      +PEA    DPEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTDTASVNGVNES-----APEAIVTADPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
             PD L  +PA+   EE  N G ++ + S  DE  V +++ +  +  +  ++N+  A +E T
Sbjct  167   PDHLVVDPATPSEEEDLNNGAEVCDPSDNDEGSVVEDELVEPEPPALASQNRGLAEVEPT  226

Query  978   ---TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapa  808
                    Q+DAPK SYASIL  +    P ++ V      +       S     P P   A
Sbjct  227   PDPAPETQEDAPKKSYASILLEKSTASPVRV-VSRTVRTVSANSDHQSAGPAKPFPAPEA  285

Query  807   piaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                   A  ES N  EEA EG+SI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++Q
Sbjct  286   SAPIGDAAPESSNTHEEAPEGYSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSKQ  345

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  346   QGFCFGFVEFESLSSMQSALEASPITIGDRLAVIEEK  382


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSRPD  G
Sbjct  1     MQEATPA--PAPSAQLVGNAFVEQYYHILHQSPQLVHRFYQDSSSLSRPDTKG  51



>gb|KEH32036.1| ras GTPase-activating binding-like protein [Medicago truncatula]
Length=461

 Score =   278 bits (712),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 223/327 (68%), Gaps = 17/327 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+ I SL+YE+  AEIKTADAQ SY  GVIVLVTGCLTGKDN++RKF+QTFFLAPQD
Sbjct  62    QAINETIVSLNYEDCTAEIKTADAQESYEKGVIVLVTGCLTGKDNVRRKFSQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEAD--SNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGY+VLNDVFRY+E+++A   S+A +   +++    +  PE+ D  P+   + L  +PA+
Sbjct  122   KGYYVLNDVFRYIEENDAPQLSSASINTVINENAEAVHIPESEDINPS---EHLVEDPAT  178

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTS----ASLESTTSAIQDD  958
             S  +E  N G +++  ++++     E+ +++D E     N  S     +++  TSA+QDD
Sbjct  179   SAVDENPNNGDEVYYPMDNK-----EEGLVIDEEVAAPPNDPSENDIVTIQDPTSAVQDD  233

Query  957   APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST-AID  781
             A K SYASI+  + N    ++YVP+ A+R+ + K +    A       P  +APS+ +  
Sbjct  234   ARKTSYASIV-MKSNTASGRVYVPSRAARVASAKSNEQRHATTKSTPGPEALAPSSDSAP  292

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              + +  EEAEGHSIY+RNLPFN T+  LE VFKK+GPIKHGG+QVRS++  GFCFGFVE+
Sbjct  293   RTSDVPEEAEGHSIYIRNLPFNATIELLEEVFKKFGPIKHGGVQVRSSK-HGFCFGFVEY  351

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
               L+S+ NA++ SPI +G+RQAV+E K
Sbjct  352   EELSSVQNALKASPITVGERQAVIEEK  378


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQ  1756
             MA+Q   P+T P P  Q+VGNAFVEQYY ILH SPD V+RFYQ
Sbjct  1     MAVQEANPSTTPSP--QVVGNAFVEQYYHILHQSPDLVHRFYQ  41



>ref|XP_008357785.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Malus domestica]
Length=460

 Score =   278 bits (712),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 206/322 (64%), Gaps = 8/322 (2%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN K   L Y  Y AEIKTADAQ SY  GV VLVTGCLTGKDNLKRKF Q+FFLAPQD
Sbjct  62    QVINXKXJXLXYNKYXAEIKTADAQKSYEDGVTVLVTGCLTGKDNLKRKFAQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              G+FVLNDVFR+VE  +   N   VN V+D  T++ S    DPE  HVPD    +  ++ 
Sbjct  122   NGFFVLNDVFRFVEDGDLLEN-HSVNEVNDAATILSSQ---DPEXTHVPDPPAPDLETTQ  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE        +++ + E+Q + E +   +  S+ N N  + ++E  ++  Q+D+ K SY
Sbjct  178   VEENPIXVEXTYDTSDHERQYTTESD--XEPPSYSNGNDVTVAVEXASTTAQEDSSKKSY  235

Query  939   ASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapia-PSTAIDESKNA  766
             ASI+   + + GP+K+YVPTN  R+ ++K   ++         P   A  ST+  ES + 
Sbjct  236   ASIVKVPKGSPGPSKVYVPTNTVRVASKKAETNLPGPTAPASVPEXSAPTSTSALESSDT  295

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
              EE EG+SIY+RNLP N+T  +L+  FKK+GPIK GG+QVR+ + QG CFGFVEF   +S
Sbjct  296   NEEVEGYSIYIRNLPLNVTTDQLQEEFKKFGPIKQGGVQVRNKKLQGHCFGFVEFESSSS  355

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             MN+AIQ SPI IG RQAV+EIK
Sbjct  356   MNSAIQASPITIGGRQAVIEIK  377


 Score = 75.5 bits (184),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q     + P PSAQLVGNAF+EQYY ILH++P  V+RFYQ+SS+LSRPD +G
Sbjct  1     MALQNAI--SRPTPSAQLVGNAFIEQYYHILHNNPGLVHRFYQDSSILSRPDSNG  53



>gb|KHG21577.1| Putative G3BP-like protein [Gossypium arboreum]
Length=468

 Score =   278 bits (711),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 218/331 (66%), Gaps = 10/331 (3%)
 Frame = -2

Query  1509  HLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKF  1330
             H N   +   Q IN+K+ SL+YE+Y AEIKTADAQ+S+  GVIVLVTGCLTGKDN++RKF
Sbjct  52    HGNMTTVTTMQAINEKVLSLNYEDYTAEIKTADAQDSFEKGVIVLVTGCLTGKDNVRRKF  111

Query  1329  TQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPD  1150
             TQTFFLAPQDKGYFVLND+FRYVE+ E   N+  VNG++++ +   S   P+PEP H  D
Sbjct  112   TQTFFLAPQDKGYFVLNDIFRYVEEKEL-QNSVPVNGINEQAST--SALTPEPEPTH--D  166

Query  1149  SLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
             +L  +P +   +E  N   ++ +  + E+    E E+ V+ ++  + N+T   ++S    
Sbjct  167   NLAEDPLTYPEDEDVNNDAEVFDPSDKEEGSVIEDEV-VEPQNITSPNETVVVVDSPPVV  225

Query  969   IQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
             ++ DAPK SYASI+   + N     +YVPTN  R+   K+  S+V+  P       +  S
Sbjct  226   LE-DAPKKSYASIVKVMKSNTASAPVYVPTNNVRV-APKEPHSIVSAKPALATEVALPNS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                 ES N  EEAEGHSIYVRNLP+  T A+LE  FKK+GPIK  GIQVRSN+ QGF FG
Sbjct  284   DNAPESSNDNEEAEGHSIYVRNLPYTATPAQLEVAFKKFGPIKRNGIQVRSNK-QGFTFG  342

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +S+ +A++ SPI IGDRQA VE K
Sbjct  343   FVEFENASSVQSALEASPITIGDRQAAVEEK  373


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ   PA  P  SAQ+VGNAFVEQYY ILH SP+ V+RFYQ+SS LSRPD  G
Sbjct  1     MAMQEGNPAGTP--SAQVVGNAFVEQYYHILHQSPNLVHRFYQDSSCLSRPDMHG  53



>gb|KDP31359.1| hypothetical protein JCGZ_11735 [Jatropha curcas]
Length=479

 Score =   278 bits (711),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/336 (49%), Positives = 215/336 (64%), Gaps = 20/336 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEIKTADAQ SY  GVIVLVTGCLTGKDN+K+KF+QTFFLAPQD
Sbjct  62    QAINDKILSLNYEDYTAEIKTADAQESYEKGVIVLVTGCLTGKDNVKKKFSQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDE--PTVIPSPEAP------------DPEPA  1162
             KGYFVLNDVFR+V +DE+ +N  + NGV++   PT   +                + +P 
Sbjct  122   KGYFVLNDVFRFVGEDESLANDFLTNGVNENAMPTTSTTQTGWGDIVEGGWHDIVEGDPH  181

Query  1161  HVPDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLE  985
              V + L  +P +   EE  N G ++ + S ++E  V D + +   T+S  NE  T  S++
Sbjct  182   EVTNHLTVDPTTPSEEEDLNNGAEVCDPSDKEEGSVIDVEVVEQQTDSIHNEILT--SVD  239

Query  984   STTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEK-QSASMvaqvpvpeapa  808
             +  +A++ DAPK SYASIL       P+  Y  T  ++      Q     +  P     A
Sbjct  240   AAPAALE-DAPKKSYASILKVMKGTTPSSDYTATTHAKAAPANFQKPLPNSIKPAYAPEA  298

Query  807   piaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQ  628
                 S    ES +  EEAEG+SIYVRNLPFN T A+L+ +FKK+GPIKHGGIQVRSN+ Q
Sbjct  299   VAPSSGGAPESSDVHEEAEGYSIYVRNLPFNATTAQLDEIFKKFGPIKHGGIQVRSNK-Q  357

Query  627   GFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFCFGFVEF  L+SM +A++ SPI +GDRQA+VE K
Sbjct  358   GFCFGFVEFETLSSMQSALEASPINVGDRQAIVEEK  393


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q T PA+ P  SAQ+VGNAFVEQYY ILH SP  V++FYQ+SS+LSRPD DG
Sbjct  1     MATQETAPASPP--SAQVVGNAFVEQYYHILHQSPGLVHKFYQDSSLLSRPDADG  53



>ref|XP_008453282.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Cucumis 
melo]
Length=472

 Score =   276 bits (707),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 210/325 (65%), Gaps = 12/325 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +Y AEI TADAQ+S+  GVIVLVTGCLTGKDNL+RKF+QTFFLAPQD
Sbjct  63    QAINDKIISLNYGDYTAEIITADAQDSHEKGVIVLVTGCLTGKDNLRRKFSQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDV RYVE+ E+  SN+   + + D    + S   P+PEP+HVP+ L   P ++
Sbjct  123   KGYYVLNDVLRYVEETESIRSNSSSGDAIKDNTVTVTS--TPEPEPSHVPNHLTVEPPTA  180

Query  1122  -DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
              + E++ NV      S  DE  V +E+ ++     H +E++   +        Q+DAPK 
Sbjct  181   LEEEDMNNVPEVCDPSSNDEGSVIEEEVVV--EVPHPSEHEVVVTAVDAAPVAQEDAPKK  238

Query  945   SYASILS-SQMNKGPTKIYVPTNASRM--KTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             SYASI+   +   GP  +YVPT   R          S+    P P      A    + ES
Sbjct  239   SYASIVKVPKTVSGP--VYVPTTTVRAPPPANPDHQSIGLVKPAPVPDVSAANGDNLPES  296

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
              N  EEAEGHSIYVRNLPF+ TV +LE  FKK+GPIK  GIQVRSN+ QGFCFGFVEF  
Sbjct  297   SNLHEEAEGHSIYVRNLPFDATVDQLEEEFKKFGPIKRDGIQVRSNK-QGFCFGFVEFEQ  355

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
             L+S++ A++ SP+ IGDRQAVVE K
Sbjct  356   LSSVHGALEASPVTIGDRQAVVEEK  380


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  1860  ATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             ++ P PSAQ+VGNAFV QYY ILHHSP  V+RFYQ++S+LSRPD +G
Sbjct  8     SSSPTPSAQVVGNAFVGQYYHILHHSPQLVHRFYQDTSLLSRPDSNG  54



>emb|CBI21211.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   282 bits (722),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 223/324 (69%), Gaps = 10/324 (3%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S +++N   EI T D+Q+SY GGVIVLVTGCL  KD  ++KFTQ+FFLAPQ 
Sbjct  60    QGINEKILSSEFKNRKTEIMTTDSQSSYEGGVIVLVTGCLMTKDKRRKKFTQSFFLAPQY  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLNDV RY+   EA      +NG +D P V  +     P   H PD    +PA+S 
Sbjct  120   NGYYVLNDVLRYIVDGEALETIP-INGTNDSPAVSLNQ---GPGHTHDPDPPVPDPATSV  175

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E+ + V  K+++ LE+E+Q+ +E+E   +T+SH  EN  S   ES++S+ Q+DAPK SY
Sbjct  176   VEDDEIVIEKVYDPLENEEQLVNEEEDFTETQSHPIENDDSTIAESSSSSAQEDAPKKSY  235

Query  939   ASILS-SQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             ASI+   + + G TK+YVPT  +++   KTE QS  + A  PVPE+      S    ES 
Sbjct  236   ASIVKVMKGSSGSTKVYVPTKTTKVTPAKTENQSPGLAAPAPVPESSVTS--SINAPESS  293

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV++LEA F+K+GPIK GG+QVRSN+QQ +CFGFVEF  L
Sbjct  294   DAPEEVEGHSIYIRNLPLNVTVSQLEAEFQKFGPIKQGGVQVRSNKQQAYCFGFVEFLSL  353

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +SM++AIQ SPI+IGD QAVVEIK
Sbjct  354   SSMHSAIQASPIIIGDHQAVVEIK  377


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQT  P  +P PSA++VGNAFVEQYY +LH SP+ V+RFY++SSV+S PD +G
Sbjct  1     MQTENP-QLP-PSAEVVGNAFVEQYYYVLHRSPELVFRFYRDSSVMSWPDSNG  51



>ref|XP_009346023.1| PREDICTED: putative G3BP-like protein isoform X1 [Pyrus x bretschneideri]
Length=470

 Score =   275 bits (703),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 212/337 (63%), Gaps = 15/337 (4%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMQAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQD-EADSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +    ++   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNVPLPTDTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
             PD L  +PA+   EE  N G ++ + S  DE  V +++ +  +  +  ++N+  A ++ T
Sbjct  167   PDHLVVDPATPSEEEDLNNGAEVCDPSDNDEGSVVEDELVEPEPPALASQNRGLAEVDPT  226

Query  978   ---TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapa  808
                    Q+DAPK SYASIL  +    P ++ VP     +       S     P P   A
Sbjct  227   PDPAPETQEDAPKKSYASILLEKSTASPVRV-VPRTVRTVSANSDHQSTGPAKPFPAPEA  285

Query  807   piaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                   A  ES N  EEA EG+SI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++Q
Sbjct  286   SAPIGDAAPESSNTHEEAPEGYSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSKQ  345

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  346   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  382


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSRPD +G
Sbjct  1     MQEATPA--PAPSAQLVGNAFVEQYYHILHQSPQLVHRFYQDSSSLSRPDTNG  51



>ref|XP_010528411.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Tarenaya hassleriana]
 ref|XP_010528412.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Tarenaya hassleriana]
Length=438

 Score =   274 bits (701),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 169/360 (47%), Positives = 226/360 (63%), Gaps = 30/360 (8%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLM----LYQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   N    M      Q IN+KI S+D+ +Y AEIKTADAQN
Sbjct  29    LHHSPELVYRFYQ-DSSVLSRPNHDGAMSSVTTMQGINEKILSMDFTSYKAEIKTADAQN  87

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD GYFVLNDVFRY++ DE  S+   + 
Sbjct  88    SYKDGVTVLVTGCLTGKDNLQRKFAQSFFLAPQDVGYFVLNDVFRYLDDDEP-SDKYPIE  146

Query  1221  GVDDEPTVIPSPEA---PDPEPAHVPDSLNANPASSDTEEVKN-VGIKIHESLEDEKQVS  1054
              +++   V P PE    PDP+P    +S    P + D     N V ++       E Q++
Sbjct  147   SINNANQVSPVPEPVTRPDPKPL---ESDRVIPVAEDNNAKANAVAVR-------EVQIA  196

Query  1053  DEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILS-SQMNKGPTKIYVPTNA  877
             D KE   + ++ ++        ES +S +++DAPK SYASI+  ++ ++ PTKI +PTN 
Sbjct  197   DGKENKKEPQNSID--------ESDSSLVKEDAPKKSYASIVKVAKGSEMPTKIDMPTNT  248

Query  876   SRMKTEK-QSASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAE  700
             S+  T+K ++  + + V  P        S    E+  A  EAEG+SIY+RNLPFN TV++
Sbjct  249   SKASTKKAENEPVGSSVHSPAPEGSTQESVVSPETGEADGEAEGYSIYIRNLPFNTTVSQ  308

Query  699   LEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             L+A FKK+GPIK  GIQVR+N+QQG+CFGFVEF   +SMN+AIQ SPI I  R AV+E K
Sbjct  309   LDAEFKKFGPIKKDGIQVRNNKQQGYCFGFVEFLSQSSMNDAIQASPINILGRNAVIEAK  368


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M++Q+  P   P P  Q+V NAFVEQYY ILHHSP+ VYRFYQ+SSVLSRP+ DG
Sbjct  1     MSLQSANPQAAPTP--QMVANAFVEQYYHILHHSPELVYRFYQDSSVLSRPNHDG  53



>ref|XP_006374412.1| nuclear transport factor 2 family protein [Populus trichocarpa]
 gb|ERP52209.1| nuclear transport factor 2 family protein [Populus trichocarpa]
Length=393

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 214/331 (65%), Gaps = 19/331 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y++Y AEIKTADAQ S+  GVIVLVTGCLTGKD++K+KFTQTFFLAPQ+
Sbjct  62    QAINDKILSLNYKDYTAEIKTADAQESHEKGVIVLVTGCLTGKDDVKKKFTQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADSN-AKMVNG-VDDEPTVIPSPEAPD----PEPAHVPDSLNA  1138
             KGYFVLNDVFR+V ++E   N + + NG V+  P  + +    D    P+P    D L  
Sbjct  122   KGYFVLNDVFRFVGENEPMPNTSALANGIVESAPPALTAESGWDDVVEPDPTQATDHLTV  181

Query  1137  NPASSDTEEVKNVGIKI--HESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
             +PA+S  EE  N G ++  H   ED   +  E   +V+  +   +N+  A++ +  ++++
Sbjct  182   DPATSFEEEDLNNGSEVCDHSDKEDGSVIDIE---VVEPVTDSTQNEILATINAAPASLE  238

Query  963   DDAPKMSYASILSSQMNKGPTKIY---VPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
              DAPK+SYASIL       P  ++       A+ +  E+QSA+           A  +  
Sbjct  239   -DAPKISYASILKVMKGNTPHPVHFSMTKMRAAPISIEQQSAN---SAKSAAPEALASAG  294

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
             ++  E+ +  EEAEGHSI+V+NLPF+ TV +LE  FK +GPIKHGGIQVRS++ QGFCFG
Sbjct  295   SSAGETSDVHEEAEGHSIFVKNLPFDATVEQLEEAFKHFGPIKHGGIQVRSSK-QGFCFG  353

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF  ++SM  A++ SPI IGD QA+VE K
Sbjct  354   FVEFETMSSMQGALEASPINIGDHQAIVEEK  384


 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q T PA+  GPSA++VGNAFVEQYY ILH SP+ V+RFYQ+SS LSRP+ DG
Sbjct  1     MATQETAPAS--GPSAEVVGNAFVEQYYHILHESPELVHRFYQDSSSLSRPNTDG  53



>ref|XP_010695230.1| PREDICTED: ras GTPase-activating protein-binding protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   273 bits (699),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 220/328 (67%), Gaps = 13/328 (4%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +M    IN+KI SL+Y++Y AEIKTADAQ S+  GVIVLVTG LTGKDN+++KF Q+FFL
Sbjct  58    VMTMPGINEKILSLNYKDYIAEIKTADAQQSFGNGVIVLVTGYLTGKDNVRKKFAQSFFL  117

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPE-PAHVPDSLNAN  1135
             APQ+KGYFVLNDVFRY+E +E+ S A    G+++   V  +P AP+ E P HVP+     
Sbjct  118   APQEKGYFVLNDVFRYIEDEESASPALDPVGINE--NVEAAPLAPEQEQPPHVPEHNGQV  175

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P SS+ E++ N+  ++ +  ++E     E+EI V+    LN+ + S ++ S  S+ QDDA
Sbjct  176   PESSNEEDI-NIEAEVCDPSDNEDGSITEEEI-VEPPVQLNQRE-SVTVTSELSSSQDDA  232

Query  954   PKMSYASILSS-QMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeapapiaPSTAI  784
             PK SYA+IL + + N  PT +  P    R+K  +  Q A++    P P +    + S A 
Sbjct  233   PKRSYAAILKAIKSNLAPTPVKAPATNVRVKPPSRNQEATV---KPAPLSEPSASTSEAG  289

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                 +   E EGHS++VRNLP N T A+LE VF K+GPIK GG+QVRSN+ QGFCFGFVE
Sbjct  290   PGKSDVPVEVEGHSVHVRNLPQNATAAQLEEVFSKFGPIKQGGVQVRSNK-QGFCFGFVE  348

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F  L+SMN+AI+ SPIMIG R+AV+E K
Sbjct  349   FESLSSMNSAIEASPIMIGSRKAVIEEK  376


 Score = 86.3 bits (212),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  +PA  P  SAQ+VGNAFVEQYYLILH SP+ V+RFYQESS++SRPD +G
Sbjct  1     MAMQAESPAATP--SAQVVGNAFVEQYYLILHQSPELVFRFYQESSIMSRPDSNG  53



>ref|XP_011006569.1| PREDICTED: putative G3BP-like protein isoform X3 [Populus euphratica]
Length=473

 Score =   273 bits (697),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 220/337 (65%), Gaps = 31/337 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEIKTADAQ S+  GVIVLVTGCLTGKD++K+KFTQTFFLAPQ+
Sbjct  62    QAINDKILSLNYEDYTAEIKTADAQESHEKGVIVLVTGCLTGKDDVKKKFTQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADSN-AKMVNG-VDDEPTVIPSPEAPD----PEPAHVPDSLNA  1138
             KGYFVLND+FR+V ++E   N + + NG V++ P  + +    D    P+P    D L A
Sbjct  122   KGYFVLNDIFRFVGENEPMPNTSALANGIVENAPPALTAESGWDDVVEPDPTQATDHLTA  181

Query  1137  NPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNE-----NQTSASLESTT  976
             +PA+S  EE  N G ++ + S +D+  V D + +   T+S  NE     N + ASLE   
Sbjct  182   DPATSFEEEDLNNGSEVCDHSDKDDGSVIDVEVVEPVTDSTQNEILATINASPASLE---  238

Query  975   SAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT-----EKQSASMvaqvpvpeap  811
                  DAPK+SYASIL  ++ KG T   V  + ++M+      E+QSA+           
Sbjct  239   -----DAPKISYASIL--KVKKGSTPHPVHFSMTKMRAAPKSIEQQSAN---SAKSAAPE  288

Query  810   apiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             A  +  ++  E+ +  EEAEGHSI+V+NLPF+ TV +LE  FK +GPIK GGIQVRS++ 
Sbjct  289   ALASAGSSAGETSDVHEEAEGHSIFVKNLPFDATVEQLEETFKHFGPIKRGGIQVRSSK-  347

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  ++SM  A++ SPI IGD QA+VE K
Sbjct  348   QGFCFGFVEFETMSSMQGALEASPINIGDHQAIVEEK  384


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q T PA+  GPSA++VGNAFVEQYY ILH SP+ V+RFYQ+SS LSRP+ DG
Sbjct  1     MATQETAPAS--GPSAEVVGNAFVEQYYHILHKSPELVHRFYQDSSSLSRPNTDG  53



>ref|XP_008374643.1| PREDICTED: putative G3BP-like protein isoform X2 [Malus domestica]
Length=469

 Score =   272 bits (696),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 213/337 (63%), Gaps = 16/337 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I++KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMTTVTTMQAISEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  ++   VNGV++      +PEA    DPEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTDTASVNGVNES-----APEAIVTADPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
             PD L  +PA+   EE  N G ++ + S  DE  V +++ +  +  +  ++N+  A +E T
Sbjct  167   PDHLVVDPATPSEEEDLNNGAEVCDPSDNDEGSVVEDELVEPEPPALASQNRGLAEVEPT  226

Query  978   ---TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapa  808
                    Q+DAPK SYASIL  +    P ++ V      +       S     P P   A
Sbjct  227   PDPAPETQEDAPKKSYASILLEKSTASPVRV-VSRTVRTVSANSDHQSAGPAKPFPAPEA  285

Query  807   piaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                   A  ES N  EEA EG+SI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++ 
Sbjct  286   SAPIGDAAPESSNTHEEAPEGYSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSK-  344

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  345   QGFCFGFVEFESLSSMQSALEASPITIGDRLAVIEEK  381


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSRPD  G
Sbjct  1     MQEATPA--PAPSAQLVGNAFVEQYYHILHQSPQLVHRFYQDSSSLSRPDTKG  51



>ref|XP_008240007.1| PREDICTED: ras GTPase-activating protein-binding protein 1 isoform 
X1 [Prunus mume]
Length=465

 Score =   272 bits (695),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 218/336 (65%), Gaps = 17/336 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I+ KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMATVTTMQAISQKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N  +VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLQTNNVLVNGINES-----APEAILTAEPEPTHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  + A+S  EE  N G ++ +  ++++    E+EI V+  ++ ++NQ  A ++ T 
Sbjct  167   PDHLVVDHATSFEEEDLNNGPEVCDPSDNDEGSVIEEEI-VEPPAYSSQNQGLADIDPTP  225

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASR-MKTEKQSASMvaqvpvpeapa  808
                   Q+D PK SYASI+  + N   + + VPT   R +       S+    P P   A
Sbjct  226   DPAPETQEDVPKKSYASIV-MKSNAASSPVRVPTRTVRTISANTDHQSLGYAKPAPAPVA  284

Query  807   piaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQ  628
                   A  ES NA EE EGHSI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++ Q
Sbjct  285   SAPSGDAAPESSNAHEE-EGHSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSK-Q  342

Query  627   GFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  343   GFCFGFVEFETLSSMQSALEASPITIGDRPAVIEEK  378


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  +PA+ P  SAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSR D +G
Sbjct  1     MQEASPASAP--SAQLVGNAFVEQYYHILHESPQLVHRFYQDSSSLSRTDVNG  51



>ref|XP_010315752.1| PREDICTED: putative G3BP-like protein, partial [Solanum lycopersicum]
Length=274

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 186/277 (67%), Gaps = 21/277 (8%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             L+L ++ N  I SLDY+NY +EI+TADAQ+S+  GV+VLVTGCLTG+D LKRKF QTFFL
Sbjct  9     LLLSRKFNTLICSLDYKNYKSEIRTADAQDSFKDGVVVLVTGCLTGRDKLKRKFAQTFFL  68

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP  1132
             APQDKGYFVLNDVFRYVE +E D             T++     PDPEP HV D  N + 
Sbjct  69    APQDKGYFVLNDVFRYVEDNETD-------------TIL----TPDPEPTHVVDPPNLDQ  111

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             ASS TEEV+ V  K ++S  D +QV DE+EI+V+  S+ N++Q   + ES  S  Q+DAP
Sbjct  112   ASSPTEEVQYVEEKANDSSVDGRQVVDEREIVVENGSYFNKDQHPTNKESANSVAQEDAP  171

Query  951   KMSYASILSSQMNKGPTKIYVPTNASR---MKTEKQS-ASMvaqvpvpeapapiaPSTAI  784
             K  YASI+ SQ  KGPTKIYVPTN SR   +K  KQ  A++   V    +         +
Sbjct  172   KKPYASIVISQTKKGPTKIYVPTNTSRVAPLKAVKQPVAAVAQNVAPEASNPTTTSGIDV  231

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYG  673
              ES +A++EAEG+SIYVRNLP ++TVA+LEA FK  G
Sbjct  232   PESNDAEDEAEGYSIYVRNLPLDVTVAQLEAEFKTMG  268



>ref|XP_004169646.1| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding 
protein 1-like [Cucumis sativus]
Length=472

 Score =   271 bits (693),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 212/327 (65%), Gaps = 16/327 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +Y AEI TADAQ S+  GVIVLVTGCLTGKD+L+RKF+QTFF APQD
Sbjct  63    QAINDKIISLNYGDYTAEIITADAQESHEKGVIVLVTGCLTGKDSLRRKFSQTFFXAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDV RYVE+ E+  SN+   + + D    + S   P+PEP+HVP+ L   P ++
Sbjct  123   KGYYVLNDVLRYVEETESIRSNSSSGDAIKDNTVTVTS--TPEPEPSHVPNHLTVEPPTA  180

Query  1122  -DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
              + E++ NV      S  DE   S  +E +V    H +E++   +        Q+DAPK 
Sbjct  181   LEEEDMNNVPEVCDPSSNDEG--SVIEEEVVVEAPHPSEHEVVVTAVDAAPVAQEDAPKK  238

Query  945   SYASILS-SQMNKGPTKIYVPTNASR----MKTEKQSASMvaqvpvpeapapiaPSTAID  781
             SYASI+   +   GP  +YVPT   R       + QS  +V   PVP+  A    +  + 
Sbjct  239   SYASIVKVPKTVSGP--VYVPTTTVRAPPPANPDHQSTGLVKPAPVPDVSAANGDN--LP  294

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
             ES N  EEAEGHSIYVRNLPF+ TV  LE  FKK+GPIK  GIQVRSN+ QGFCFGFVEF
Sbjct  295   ESSNLHEEAEGHSIYVRNLPFDATVDHLEEEFKKFGPIKRDGIQVRSNK-QGFCFGFVEF  353

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
               L+S++ A++ SP+ IGDRQAVVE K
Sbjct  354   EQLSSVHGALEASPLTIGDRQAVVEEK  380


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  1860  ATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             ++ P PSAQ+VGNAFV QYY ILHHSP  V+RFYQ++S+LSRPD +G
Sbjct  8     SSSPTPSAQVVGNAFVGQYYHILHHSPQLVHRFYQDTSLLSRPDGNG  54



>ref|XP_009338199.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X3 [Pyrus x bretschneideri]
Length=466

 Score =   270 bits (691),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 213/337 (63%), Gaps = 18/337 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   + I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMEAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  +PA+   +E  N G ++ +  ++++    E E++   E     +Q  A ++ T 
Sbjct  167   PDHLVVDPATPFEDEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQNLAEVDPTP  223

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeap  811
                   Q+DAPK SYASIL  +    P  + VP     +   T  Q AS  A+       
Sbjct  224   DPAPETQEDAPKKSYASILLKKSTVSPAHV-VPRTVRTVSANTNHQPASPPAKSFPAPEA  282

Query  810   apiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             +P     A + S + +E  EGHSI+VRNLP++ TV +LE  FK++GPIK  GIQVRS++Q
Sbjct  283   SPPTGDAAPESSHSHEEAPEGHSIHVRNLPYDATVGQLEKEFKRFGPIKRDGIQVRSSKQ  342

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  343   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  379


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP+ V+RFYQ+SS LSR D +G
Sbjct  1     MQEVTPA--PAPSAQLVGNAFVEQYYHILHQSPELVHRFYQDSSSLSRTDING  51



>ref|XP_009338177.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009338184.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Pyrus x bretschneideri]
Length=467

 Score =   270 bits (691),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 213/337 (63%), Gaps = 18/337 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   + I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMEAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  +PA+   +E  N G ++ +  ++++    E E++   E     +Q  A ++ T 
Sbjct  167   PDHLVVDPATPFEDEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQNLAEVDPTP  223

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeap  811
                   Q+DAPK SYASIL  +    P  + VP     +   T  Q AS  A+       
Sbjct  224   DPAPETQEDAPKKSYASILLKKSTVSPAHV-VPRTVRTVSANTNHQPASPPAKSFPAPEA  282

Query  810   apiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             +P     A + S + +E  EGHSI+VRNLP++ TV +LE  FK++GPIK  GIQVRS++Q
Sbjct  283   SPPTGDAAPESSHSHEEAPEGHSIHVRNLPYDATVGQLEKEFKRFGPIKRDGIQVRSSKQ  342

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  343   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  379


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP+ V+RFYQ+SS LSR D +G
Sbjct  1     MQEVTPA--PAPSAQLVGNAFVEQYYHILHQSPELVHRFYQDSSSLSRTDING  51



>ref|XP_002514643.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF47749.1| RNA binding protein, putative [Ricinus communis]
Length=464

 Score =   270 bits (690),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 208/322 (65%), Gaps = 11/322 (3%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AE+K ADAQ SY  GVIVLVTGCLTGKDN+K+KF+QTFFLAPQD
Sbjct  62    QAINDKILSLNYEDYTAEVKNADAQESYEKGVIVLVTGCLTGKDNIKKKFSQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLNDVFR+V E     +N  +VNGV ++ T    P  P  EP     S+  +PA+S
Sbjct  122   KGYFVLNDVFRFVGENGSLPNNTVLVNGVSEDAT----PITPTVEPGWGDISVAVDPATS  177

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
               ++  N G ++ +  + E+   +E+E+ VD + +   N TS      + AI +DAPK S
Sbjct  178   FEDKDLNNGAEVCDPSDKEEGSVNEEEV-VDPQPYSTCNITSV---GASPAILEDAPKKS  233

Query  942   YASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             YASIL   + N  P  ++  T   ++        +        A   IAP++   +S + 
Sbjct  234   YASILKVMKGNTVPRSVHAATTNVKVAPINSEKQLPNSTKPAYASEAIAPTSGSAQSSDI  293

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
              EE EGHSIYVR+L FN T A+LE  FKK+GPIK GGIQVRSN+ QGFCFGFVEF  L+S
Sbjct  294   HEEVEGHSIYVRSLSFNATEAQLEEAFKKFGPIKCGGIQVRSNK-QGFCFGFVEFETLSS  352

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             M +A++ S I +GDRQA+VE K
Sbjct  353   MQSALEASSITVGDRQAIVEEK  374


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  1830  VGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             VGNAFVEQYY ILH SP  V++FYQ+SS+LSRPD DG
Sbjct  17    VGNAFVEQYYHILHQSPGLVHKFYQDSSLLSRPDADG  53



>ref|XP_004138199.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Cucumis sativus]
 gb|KGN63733.1| hypothetical protein Csa_1G013810 [Cucumis sativus]
Length=472

 Score =   270 bits (690),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 212/327 (65%), Gaps = 16/327 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +Y AEI TADAQ S+  GVIVLVTGCLTGKD+L+RKF+QTFFLAPQD
Sbjct  63    QAINDKIISLNYGDYTAEIITADAQESHEKGVIVLVTGCLTGKDSLRRKFSQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGY+VLNDV RYVE+ E+  SN+   + + D    + S   P+PEP+HVP+ L   P ++
Sbjct  123   KGYYVLNDVLRYVEETESIRSNSSSGDAIKDNTVTVTS--TPEPEPSHVPNHLTVEPPTA  180

Query  1122  -DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
              + E++ NV      S  DE   S  +E +V    H +E++   +        Q+DAPK 
Sbjct  181   LEEEDMNNVPEVCDPSSNDEG--SVIEEEVVVEAPHPSEHEVVVTAVDAAPVAQEDAPKK  238

Query  945   SYASILS-SQMNKGPTKIYVPTNASR----MKTEKQSASMvaqvpvpeapapiaPSTAID  781
             SYASI+   +   GP  +YVPT   R       + QS  +V   PVP+  A    +  + 
Sbjct  239   SYASIVKVPKTVSGP--VYVPTTTVRAPPPANPDHQSTGLVKPAPVPDVSAANGDN--LP  294

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
             ES N  EEAEGHSIYVRNLPF+ TV  LE  FKK+GPIK  GIQVRSN+ QGFCFGFVEF
Sbjct  295   ESSNLHEEAEGHSIYVRNLPFDATVDHLEEEFKKFGPIKRDGIQVRSNK-QGFCFGFVEF  353

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
               L+S++ A++ SP+ IGD QAVVE K
Sbjct  354   EQLSSVHGALEASPLTIGDCQAVVEEK  380


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -2

Query  1860  ATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             ++ P PSAQ+VGNAFV QYY ILHHSP  V+RFYQ++S+LSRPD +G
Sbjct  8     SSSPTPSAQVVGNAFVGQYYHILHHSPQLVHRFYQDTSLLSRPDGNG  54



>ref|XP_008240008.1| PREDICTED: ras GTPase-activating protein-binding protein 1 isoform 
X2 [Prunus mume]
Length=464

 Score =   270 bits (689),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 217/336 (65%), Gaps = 18/336 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I+ KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMATVTTMQAISQKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N  +VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLQTNNVLVNGINES-----APEAILTAEPEPTHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  + A+S  EE  N G ++ +  ++++    E+EI V+  ++ ++NQ  A ++ T 
Sbjct  167   PDHLVVDHATSFEEEDLNNGPEVCDPSDNDEGSVIEEEI-VEPPAYSSQNQGLADIDPTP  225

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASR-MKTEKQSASMvaqvpvpeapa  808
                   Q+D PK SYASI+  + N   + + VPT   R +       S+    P P   A
Sbjct  226   DPAPETQEDVPKKSYASIV-MKSNAASSPVRVPTRTVRTISANTDHQSLGYAKPAPAPVA  284

Query  807   piaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQ  628
                   A  ES NA E  EGHSI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++ Q
Sbjct  285   SAPSGDAAPESSNAHE--EGHSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSK-Q  341

Query  627   GFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  342   GFCFGFVEFETLSSMQSALEASPITIGDRPAVIEEK  377


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  +PA+ P  SAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSR D +G
Sbjct  1     MQEASPASAP--SAQLVGNAFVEQYYHILHESPQLVHRFYQDSSSLSRTDVNG  51



>ref|XP_011006568.1| PREDICTED: putative G3BP-like protein isoform X2 [Populus euphratica]
Length=483

 Score =   269 bits (688),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 220/347 (63%), Gaps = 41/347 (12%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEIKTADAQ S+  GVIVLVTGCLTGKD++K+KFTQTFFLAPQ+
Sbjct  62    QAINDKILSLNYEDYTAEIKTADAQESHEKGVIVLVTGCLTGKDDVKKKFTQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADSN-AKMVNG-VDDEPTVIPSPEAPD--------------PE  1168
             KGYFVLND+FR+V ++E   N + + NG V++ P  + +    D              P+
Sbjct  122   KGYFVLNDIFRFVGENEPMPNTSALANGIVENAPPALTAESGWDDVVEPESGWDDVVEPD  181

Query  1167  PAHVPDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNE-----N  1006
             P    D L A+PA+S  EE  N G ++ + S +D+  V D + +   T+S  NE     N
Sbjct  182   PTQATDHLTADPATSFEEEDLNNGSEVCDHSDKDDGSVIDVEVVEPVTDSTQNEILATIN  241

Query  1005  QTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT-----EKQSASM  841
              + ASLE        DAPK+SYASIL  ++ KG T   V  + ++M+      E+QSA+ 
Sbjct  242   ASPASLE--------DAPKISYASIL--KVKKGSTPHPVHFSMTKMRAAPKSIEQQSAN-  290

Query  840   vaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKH  661
                       A  +  ++  E+ +  EEAEGHSI+V+NLPF+ TV +LE  FK +GPIK 
Sbjct  291   --SAKSAAPEALASAGSSAGETSDVHEEAEGHSIFVKNLPFDATVEQLEETFKHFGPIKR  348

Query  660   GGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GGIQVRS++ QGFCFGFVEF  ++SM  A++ SPI IGD QA+VE K
Sbjct  349   GGIQVRSSK-QGFCFGFVEFETMSSMQGALEASPINIGDHQAIVEEK  394


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q T PA+  GPSA++VGNAFVEQYY ILH SP+ V+RFYQ+SS LSRP+ DG
Sbjct  1     MATQETAPAS--GPSAEVVGNAFVEQYYHILHKSPELVHRFYQDSSSLSRPNTDG  53



>ref|XP_009346030.1| PREDICTED: putative G3BP-like protein isoform X2 [Pyrus x bretschneideri]
Length=469

 Score =   268 bits (686),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 211/337 (63%), Gaps = 16/337 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMQAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQD-EADSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +    ++   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNVPLPTDTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
             PD L  +PA+   EE  N G ++ + S  DE  V +++ +  +  +  ++N+  A ++ T
Sbjct  167   PDHLVVDPATPSEEEDLNNGAEVCDPSDNDEGSVVEDELVEPEPPALASQNRGLAEVDPT  226

Query  978   ---TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapa  808
                    Q+DAPK SYASIL  +    P ++ VP     +       S     P P   A
Sbjct  227   PDPAPETQEDAPKKSYASILLEKSTASPVRV-VPRTVRTVSANSDHQSTGPAKPFPAPEA  285

Query  807   piaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                   A  ES N  EEA EG+SI+VRNLP++ TV +LE  FKK+GPIK  GIQVRS++ 
Sbjct  286   SAPIGDAAPESSNTHEEAPEGYSIHVRNLPYDATVGQLEKEFKKFGPIKRDGIQVRSSK-  344

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  345   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  381


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP  V+RFYQ+SS LSRPD +G
Sbjct  1     MQEATPA--PAPSAQLVGNAFVEQYYHILHQSPQLVHRFYQDSSSLSRPDTNG  51



>gb|KDO72776.1| hypothetical protein CISIN_1g0125641mg, partial [Citrus sinensis]
Length=337

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 187/281 (67%), Gaps = 5/281 (2%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY+NY AEIKTADAQNS+  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  61    INQKILSLDYKNYKAEIKTADAQNSHKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  120

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+  E        N +DD P    +P  PD +  HVPD    +P +S  E
Sbjct  121   YFVLNDVFRYVDDGEVLEKYP-ANSIDDAPA---APSIPDIDHTHVPDPPAPDPVTSHVE  176

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
             E +N+  +++E  E E+Q+  E+E +V+++S+  E   SA +ES +S+  +DAPK SYAS
Sbjct  177   EDQNISERVYEPSEQERQLVTEREAVVESQSYAVETDASAMVESASSSALEDAPKKSYAS  236

Query  933   ILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEE  757
             I+   +   GPTK+YVPTN  ++ T+K     +     P +      ST   ES NA EE
Sbjct  237   IVRVVKGGSGPTKVYVPTNTVKVTTKKTENQPIKSENPPSSETSAPVSTDAPESSNAHEE  296

Query  756   AEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNR  634
              EGHSIY+RNLP  +TVA LE  FKK+GP+K GGIQVR N+
Sbjct  297   VEGHSIYIRNLPDTMTVASLEVEFKKFGPVKQGGIQVRHNK  337


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+ T TP     PSAQ+VGNAFVEQYY ILH +P+ V+RFYQ+SSVLSRPD +G
Sbjct  1     MALHTATP-----PSAQVVGNAFVEQYYHILHSTPELVFRFYQDSSVLSRPDSNG  50



>ref|XP_011006566.1| PREDICTED: putative G3BP-like protein isoform X1 [Populus euphratica]
 ref|XP_011006567.1| PREDICTED: putative G3BP-like protein isoform X1 [Populus euphratica]
Length=484

 Score =   268 bits (686),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 166/348 (48%), Positives = 220/348 (63%), Gaps = 42/348 (12%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEIKTADAQ S+  GVIVLVTGCLTGKD++K+KFTQTFFLAPQ+
Sbjct  62    QAINDKILSLNYEDYTAEIKTADAQESHEKGVIVLVTGCLTGKDDVKKKFTQTFFLAPQE  121

Query  1299  KGYFVLNDVFRYVEQDEADSN-AKMVNGV--------------DD--EPTVIPSPEAPDP  1171
             KGYFVLND+FR+V ++E   N + + NG+              DD  EP      +  +P
Sbjct  122   KGYFVLNDIFRFVGENEPMPNTSALANGIVENAPPALTAESGWDDVVEPAESGWDDVVEP  181

Query  1170  EPAHVPDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLNE-----  1009
             +P    D L A+PA+S  EE  N G ++ + S +D+  V D + +   T+S  NE     
Sbjct  182   DPTQATDHLTADPATSFEEEDLNNGSEVCDHSDKDDGSVIDVEVVEPVTDSTQNEILATI  241

Query  1008  NQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT-----EKQSAS  844
             N + ASLE        DAPK+SYASIL  ++ KG T   V  + ++M+      E+QSA+
Sbjct  242   NASPASLE--------DAPKISYASIL--KVKKGSTPHPVHFSMTKMRAAPKSIEQQSAN  291

Query  843   MvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIK  664
                        A  +  ++  E+ +  EEAEGHSI+V+NLPF+ TV +LE  FK +GPIK
Sbjct  292   ---SAKSAAPEALASAGSSAGETSDVHEEAEGHSIFVKNLPFDATVEQLEETFKHFGPIK  348

Query  663   HGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              GGIQVRS++ QGFCFGFVEF  ++SM  A++ SPI IGD QA+VE K
Sbjct  349   RGGIQVRSSK-QGFCFGFVEFETMSSMQGALEASPINIGDHQAIVEEK  395


 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q T PA+  GPSA++VGNAFVEQYY ILH SP+ V+RFYQ+SS LSRP+ DG
Sbjct  1     MATQETAPAS--GPSAEVVGNAFVEQYYHILHKSPELVHRFYQDSSSLSRPNTDG  53



>ref|XP_008367558.1| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding 
protein 2-like [Malus domestica]
Length=465

 Score =   268 bits (685),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 156/336 (46%), Positives = 209/336 (62%), Gaps = 17/336 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   + I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTGKDN+ RKF Q
Sbjct  52    NMTTVTTMEAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGKDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  +PA    EE  N G ++ +  ++++    E E++   E     +Q  A ++ T 
Sbjct  167   PDHLVVDPAIPFEEEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQNLAEVDPTP  223

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapap  805
                   Q+DAPK SYASIL  +    P ++ VP     +               P   A 
Sbjct  224   DPAPETQEDAPKKSYASILLKKSMASPVRV-VPHTVRTVSANTDHLPAGPAKSFPAPEAS  282

Query  804   iaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQ  628
                  A  ES ++ EEA EG+SI+VRNLP++ TV +LE  FK++GPIK  GIQVRS++QQ
Sbjct  283   PPTGDAAPESSHSHEEAPEGYSIHVRNLPYDATVGQLEKEFKRFGPIKRDGIQVRSSKQQ  342

Query  627   GFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  343   GFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  378


 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP+ V+RFYQ+SS LSR D  G
Sbjct  1     MQEATPA--PAPSAQLVGNAFVEQYYHILHQSPELVHRFYQDSSSLSRMDIKG  51



>ref|XP_007037585.1| RNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22086.1| RNA binding protein, putative isoform 1 [Theobroma cacao]
Length=451

 Score =   267 bits (683),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 221/331 (67%), Gaps = 14/331 (4%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+K+ SL+YE+Y AEIKTADAQ+S+  GVIVLVTGCLTGKDN+++KFTQ
Sbjct  54    NMTTVTTMQAINEKVLSLNYEDYTAEIKTADAQDSFEKGVIVLVTGCLTGKDNVRKKFTQ  113

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSL  1144
             TFFLAPQDKGYFVLNDV RYVE+ E   N+  VNGV ++ +   S   P+PEP +  D L
Sbjct  114   TFFLAPQDKGYFVLNDVLRYVEEKEL-HNSVPVNGVSEQAST--SALTPEPEPTY--DPL  168

Query  1143  NANPASSDTEEVKNV--GIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
               +P +   EEV+++  G ++ +  + E+    E+E+ V  ++  ++N++ A+++S    
Sbjct  169   VVDPVTH--EEVEDISNGAEVCDPSDKEEGSVIEEEVFV-PQNVASQNESVATVDSVPVV  225

Query  969   IQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
             I+ DAPK SYASI+   + N   T +YVP+N  R     Q  S+ +  P P   A +  S
Sbjct  226   IE-DAPKQSYASIVKVMKSNTASTPVYVPSNNVRAAPADQQ-SIASAKPAPAPEAAVPNS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                 ES N  EEAEGHSIYVRNLP+    A+LE  FKK+GPIK  GIQVR+N+ QGF FG
Sbjct  284   DNAPESSNDNEEAEGHSIYVRNLPYAAMPAQLEEAFKKFGPIKRNGIQVRTNK-QGFTFG  342

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +S+ +A++ SPI+IGDR+A VE K
Sbjct  343   FVEFEMASSVQSALEASPIIIGDRKADVEEK  373


 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  +PA  P  SAQ+VGNAFVEQYY ILHHSP+ V+RFYQ+SS LSRPD DG
Sbjct  1     MAMQEGSPANPP--SAQVVGNAFVEQYYHILHHSPNLVHRFYQDSSCLSRPDKDG  53



>ref|XP_007037586.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22087.1| RNA binding protein, putative isoform 2 [Theobroma cacao]
Length=452

 Score =   265 bits (677),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 220/331 (66%), Gaps = 15/331 (5%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+K+ SL+YE+Y AEIKTADAQ+S+  GVIVLVTGCLTGKDN+++KFTQ
Sbjct  54    NMTTVTTMQAINEKVLSLNYEDYTAEIKTADAQDSFEKGVIVLVTGCLTGKDNVRKKFTQ  113

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSL  1144
             TFFLAPQDKGYFVLNDV RYVE+ E   N+  VNGV ++ +   S   P+PEP +  D L
Sbjct  114   TFFLAPQDKGYFVLNDVLRYVEEKEL-HNSVPVNGVSEQAST--SALTPEPEPTY--DPL  168

Query  1143  NANPASSDTEEVKNV--GIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
               +P +   EEV+++  G ++ +  + E+    E+E+ V  ++  ++N++ A+++S    
Sbjct  169   VVDPVTH--EEVEDISNGAEVCDPSDKEEGSVIEEEVFV-PQNVASQNESVATVDSVPVV  225

Query  969   IQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
             I+ DAPK SYASI+   + N   T +YVP+N  R     Q  S+ +  P P   A +  S
Sbjct  226   IE-DAPKQSYASIVKVMKSNTASTPVYVPSNNVRAAPADQQ-SIASAKPAPAPEAAVPNS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                 ES N  EEAEGHSIYVRNLP+    A+LE  FKK+GPIK  GIQVR+N+  GF FG
Sbjct  284   DNAPESSNDNEEAEGHSIYVRNLPYAAMPAQLEEAFKKFGPIKRNGIQVRTNK--GFTFG  341

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +S+ +A++ SPI+IGDR+A VE K
Sbjct  342   FVEFEMASSVQSALEASPIIIGDRKADVEEK  372


 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  +PA  P  SAQ+VGNAFVEQYY ILHHSP+ V+RFYQ+SS LSRPD DG
Sbjct  1     MAMQEGSPANPP--SAQVVGNAFVEQYYHILHHSPNLVHRFYQDSSCLSRPDKDG  53



>ref|XP_009338191.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Pyrus x bretschneideri]
Length=466

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 212/337 (63%), Gaps = 19/337 (6%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   + I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMEAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  +PA+   +E  N G ++ +  ++++    E E++   E     +Q  A ++ T 
Sbjct  167   PDHLVVDPATPFEDEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQNLAEVDPTP  223

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeap  811
                   Q+DAPK SYASIL  +    P  + VP     +   T  Q AS  A+       
Sbjct  224   DPAPETQEDAPKKSYASILLKKSTVSPAHV-VPRTVRTVSANTNHQPASPPAKSFPAPEA  282

Query  810   apiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             +P     A + S + +E  EGHSI+VRNLP++ TV +LE  FK++GPIK  GIQVRS++ 
Sbjct  283   SPPTGDAAPESSHSHEEAPEGHSIHVRNLPYDATVGQLEKEFKRFGPIKRDGIQVRSSK-  341

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  342   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  378


 Score = 75.9 bits (185),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP+ V+RFYQ+SS LSR D +G
Sbjct  1     MQEVTPA--PAPSAQLVGNAFVEQYYHILHQSPELVHRFYQDSSSLSRTDING  51



>ref|XP_009338207.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X4 [Pyrus x bretschneideri]
Length=465

 Score =   263 bits (673),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 212/337 (63%), Gaps = 19/337 (6%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   + I +KI+SL+Y +Y AEIKTAD+Q SY  GVIVLVTGCLTG+DN+ RKF Q
Sbjct  52    NMTTVTTMEAIGEKIQSLNYGDYTAEIKTADSQESYEKGVIVLVTGCLTGRDNVGRKFAQ  111

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHV  1156
             TFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA    +PEP H 
Sbjct  112   TFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIVTAEPEPIHA  166

Query  1155  PDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST-  979
             PD L  +PA+   +E  N G ++ +  ++++    E E++   E     +Q  A ++ T 
Sbjct  167   PDHLVVDPATPFEDEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQNLAEVDPTP  223

Query  978   --TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeap  811
                   Q+DAPK SYASIL  +    P  + VP     +   T  Q AS  A+       
Sbjct  224   DPAPETQEDAPKKSYASILLKKSTVSPAHV-VPRTVRTVSANTNHQPASPPAKSFPAPEA  282

Query  810   apiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
             +P     A + S + +E  EGHSI+VRNLP++ TV +LE  FK++GPIK  GIQVRS++ 
Sbjct  283   SPPTGDAAPESSHSHEEAPEGHSIHVRNLPYDATVGQLEKEFKRFGPIKRDGIQVRSSK-  341

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  342   QGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  378


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 2/53 (4%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MQ  TPA  P PSAQLVGNAFVEQYY ILH SP+ V+RFYQ+SS LSR D +G
Sbjct  1     MQEVTPA--PAPSAQLVGNAFVEQYYHILHQSPELVHRFYQDSSSLSRTDING  51



>gb|KEH32035.1| ras GTPase-activating binding-like protein [Medicago truncatula]
Length=370

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 211/312 (68%), Gaps = 17/312 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+ I SL+YE+  AEIKTADAQ SY  GVIVLVTGCLTGKDN++RKF+QTFFLAPQD
Sbjct  62    QAINETIVSLNYEDCTAEIKTADAQESYEKGVIVLVTGCLTGKDNVRRKFSQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEAD--SNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGY+VLNDVFRY+E+++A   S+A +   +++    +  PE+ D  P+   + L  +PA+
Sbjct  122   KGYYVLNDVFRYIEENDAPQLSSASINTVINENAEAVHIPESEDINPS---EHLVEDPAT  178

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTS----ASLESTTSAIQDD  958
             S  +E  N G +++  ++++     E+ +++D E     N  S     +++  TSA+QDD
Sbjct  179   SAVDENPNNGDEVYYPMDNK-----EEGLVIDEEVAAPPNDPSENDIVTIQDPTSAVQDD  233

Query  957   APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST-AID  781
             A K SYASI+  + N    ++YVP+ A+R+ + K +    A       P  +APS+ +  
Sbjct  234   ARKTSYASIV-MKSNTASGRVYVPSRAARVASAKSNEQRHATTKSTPGPEALAPSSDSAP  292

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              + +  EEAEGHSIY+RNLPFN T+  LE VFKK+GPIKHGG+QVRS++  GFCFGFVE+
Sbjct  293   RTSDVPEEAEGHSIYIRNLPFNATIELLEEVFKKFGPIKHGGVQVRSSK-HGFCFGFVEY  351

Query  600   HGLNSMNNAIQD  565
               L+S+ NA++D
Sbjct  352   EELSSVQNALKD  363


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQ  1756
             MA+Q   P+T P P  Q+VGNAFVEQYY ILH SPD V+RFYQ
Sbjct  1     MAVQEANPSTTPSP--QVVGNAFVEQYYHILHQSPDLVHRFYQ  41



>ref|XP_004299295.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Fragaria vesca subsp. vesca]
Length=470

 Score =   262 bits (670),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 204/323 (63%), Gaps = 12/323 (4%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I  KI+SL+YE Y AEIKTADAQ S+  GVIVLVTGCLTGKDN+ RKFTQTFFLAPQ+ G
Sbjct  65    IRIKIKSLNYEEYTAEIKTADAQESFEKGVIVLVTGCLTGKDNVGRKFTQTFFLAPQENG  124

Query  1293  YFVLNDVFRYVEQDEAD-SNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             Y+VLNDVFRY+E +E+  +N+  VN VD+   V  S    +PEP   P+ L     ++  
Sbjct  125   YYVLNDVFRYIEDNESSQTNSVPVNTVDESAPVAAS--IAEPEPTQAPEPLVVEEPATFV  182

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLE-STTSAIQDDAPKMSY  940
             +E  N G ++ +  + E+    E E++++ E  +   Q+    E       Q+DAPK SY
Sbjct  183   DEDPNNGPEVVDPSDIEEGSVIEDEVVIE-EPPIESIQSRDLPEVDPIPETQEDAPKKSY  241

Query  939   ASI---LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             ASI   + S +   P ++  P   S         S+ +  P P   A      A  ES N
Sbjct  242   ASIVKVMKSSVTSSPVRVARPRTVS---ANTDHPSVGSAKPSPAPEASAPSGDAAPESSN  298

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
             A EEAEGHSI+VRNLP++ TV +LE  FKK+G IK  GIQVRS++ QGFCFGFVEF  ++
Sbjct  299   AHEEAEGHSIHVRNLPYDATVEQLEKEFKKFGSIKRDGIQVRSSK-QGFCFGFVEFESVS  357

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             SM NA++ SPIMIGDRQAV+E K
Sbjct  358   SMQNALEASPIMIGDRQAVIEEK  380


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = -2

Query  1857  TVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             T+P PSAQLVGNAFVEQYY +LHHSP+ VY+FYQ+SS LSR D +G
Sbjct  10    TLP-PSAQLVGNAFVEQYYQVLHHSPELVYKFYQDSSALSRTDING  54



>gb|KEH32034.1| ras GTPase-activating binding-like protein [Medicago truncatula]
Length=370

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 210/311 (68%), Gaps = 17/311 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+ I SL+YE+  AEIKTADAQ SY  GVIVLVTGCLTGKDN++RKF+QTFFLAPQD
Sbjct  62    QAINETIVSLNYEDCTAEIKTADAQESYEKGVIVLVTGCLTGKDNVRRKFSQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEAD--SNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGY+VLNDVFRY+E+++A   S+A +   +++    +  PE+ D  P+   + L  +PA+
Sbjct  122   KGYYVLNDVFRYIEENDAPQLSSASINTVINENAEAVHIPESEDINPS---EHLVEDPAT  178

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTS----ASLESTTSAIQDD  958
             S  +E  N G +++  ++++     E+ +++D E     N  S     +++  TSA+QDD
Sbjct  179   SAVDENPNNGDEVYYPMDNK-----EEGLVIDEEVAAPPNDPSENDIVTIQDPTSAVQDD  233

Query  957   APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST-AID  781
             A K SYASI+  + N    ++YVP+ A+R+ + K +    A       P  +APS+ +  
Sbjct  234   ARKTSYASIV-MKSNTASGRVYVPSRAARVASAKSNEQRHATTKSTPGPEALAPSSDSAP  292

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              + +  EEAEGHSIY+RNLPFN T+  LE VFKK+GPIKHGG+QVRS++  GFCFGFVE+
Sbjct  293   RTSDVPEEAEGHSIYIRNLPFNATIELLEEVFKKFGPIKHGGVQVRSSK-HGFCFGFVEY  351

Query  600   HGLNSMNNAIQ  568
               L+S+ NA++
Sbjct  352   EELSSVQNALK  362


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQ  1756
             MA+Q   P+T P P  Q+VGNAFVEQYY ILH SPD V+RFYQ
Sbjct  1     MAVQEANPSTTPSP--QVVGNAFVEQYYHILHQSPDLVHRFYQ  41



>ref|XP_010660608.1| PREDICTED: putative G3BP-like protein isoform X3 [Vitis vinifera]
Length=402

 Score =   259 bits (661),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 209/308 (68%), Gaps = 10/308 (3%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S +++N   EI T D+Q+SY GGVIVLVTGCL  KD  ++KFTQ+FFLAPQ 
Sbjct  62    QGINEKILSSEFKNRKTEIMTTDSQSSYEGGVIVLVTGCLMTKDKRRKKFTQSFFLAPQY  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLNDV RY+   EA      +NG +D P V  +     P   H PD    +PA+S 
Sbjct  122   NGYYVLNDVLRYIVDGEALETIP-INGTNDSPAVSLNQ---GPGHTHDPDPPVPDPATSV  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E+ + V  K+++ LE+E+Q+ +E+E   +T+SH  EN  S   ES++S+ Q+DAPK SY
Sbjct  178   VEDDEIVIEKVYDPLENEEQLVNEEEDFTETQSHPIENDDSTIAESSSSSAQEDAPKKSY  237

Query  939   ASILS-SQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             ASI+   + + G TK+YVPT  +++   KTE QS  + A  PVPE+      S    ES 
Sbjct  238   ASIVKVMKGSSGSTKVYVPTKTTKVTPAKTENQSPGLAAPAPVPESSVTS--SINAPESS  295

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV++LEA F+K+GPIK GG+QVRSN+QQ +CFGFVEF  L
Sbjct  296   DAPEEVEGHSIYIRNLPLNVTVSQLEAEFQKFGPIKQGGVQVRSNKQQAYCFGFVEFLSL  355

Query  591   NSMNNAIQ  568
             +SM++AIQ
Sbjct  356   SSMHSAIQ  363


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT  P  +P PSA++VGNAFVEQYY +LH SP+ V+RFY++SSV+S PD +G
Sbjct  1     MAMQTENPQ-LP-PSAEVVGNAFVEQYYYVLHRSPELVFRFYRDSSVMSWPDSNG  53



>gb|KHG02603.1| Putative G3BP-like protein [Gossypium arboreum]
Length=462

 Score =   257 bits (657),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 211/330 (64%), Gaps = 9/330 (3%)
 Frame = -2

Query  1509  HLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKF  1330
             H N   +   Q IN+K+ SL+YE+Y AEIKTADA++S+  G+I+LVTG LTGKDN+K+KF
Sbjct  52    HGNMTTVTTLQAINEKVLSLNYEDYTAEIKTADAEDSFEKGIILLVTGSLTGKDNVKKKF  111

Query  1329  TQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPD  1150
              QTFFLAPQDKGYFVLNDVFRYVE+ E   N+   NG+ ++ ++     A  PEP    D
Sbjct  112   AQTFFLAPQDKGYFVLNDVFRYVEEKELQ-NSVPANGISEQASI----SALTPEPELTDD  166

Query  1149  SLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
              L   P +   EE  N G ++ + L D+++ S  +E +V+ ++   +N+   +++S+   
Sbjct  167   QLAKEPLNYSEEEDINNGAEVCDPL-DKEEGSVVEEEVVEPQNIAGQNKRIVAVDSSP-M  224

Query  969   IQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST  790
             + DDAPK SYASI+    +K  T +YVPTN    K   Q   + A++    A        
Sbjct  225   VPDDAPKQSYASIVKVIKSKASTPVYVPTNNVGAKPVNQRPVLSAKIAPIPAAEVPNSDN  284

Query  789   AIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
             A   S N  EEAEGHSIYVRNLP+N T  +LE  F+K+G IK  GIQVRSN+ QGF FGF
Sbjct  285   APG-SSNDNEEAEGHSIYVRNLPYNATPQQLEEAFRKFGTIKCNGIQVRSNK-QGFTFGF  342

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +S+ +A++ SPI IGDRQA VE K
Sbjct  343   VEFENPSSVQSALEASPITIGDRQAAVEEK  372


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  +P   P  S Q++GNAFVEQYY ILH SP+ V+RFYQ+SS LSRPD  G
Sbjct  1     MAMQEGSPVFTP--STQVIGNAFVEQYYHILHQSPNLVHRFYQDSSHLSRPDMHG  53



>ref|XP_010546208.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Tarenaya hassleriana]
Length=463

 Score =   256 bits (654),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 204/333 (61%), Gaps = 25/333 (8%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q INDKI SL+YE+Y AEI+TADAQ S+  GVIVLVTG LTGKDN+++KFTQTFFL
Sbjct  56    VTTMQAINDKILSLNYEDYTAEIETADAQESFEKGVIVLVTGSLTGKDNVRKKFTQTFFL  115

Query  1311  APQDKGYFVLNDVFRYVEQDE-ADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             APQDKG+FVLNDVFR++E+ E   + +  +NG+ +    +        E  HV DS    
Sbjct  116   APQDKGFFVLNDVFRFLEEKELTQTRSVTINGISENVQAV--------EQEHVTDSHEPE  167

Query  1134  P---ASSDTEEVKNVGIKIHESLEDEKQVSDEKEI---LVDTESHLNENQTSASLESTTS  973
             P   AS + E++ NV      S +DE  V D++ +   +  T + +     +ASL     
Sbjct  168   PEPVASIEEEDLDNVAEVYDPSDKDEGSVVDDEIVEPPIQPTHTEILSTDDAASLS----  223

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMK--TEKQSASMvaqvpvpeapapia  799
               Q+DAPK SYASIL   M  GPT  +V TN +R    +  Q  ++    PV    A   
Sbjct  224   --QEDAPKQSYASIL-KLMKSGPTTTHVATNKTRAGPVSTNQKQTVPRVKPVATPEASAP  280

Query  798   PSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
              +    +S N   E +GHSIYVRNLPF+ T  +LE VFKK+G IK  GIQVRSN+ QGFC
Sbjct  281   SNENAPDSSNVNGEDDGHSIYVRNLPFDATPTQLEEVFKKFGAIKDDGIQVRSNK-QGFC  339

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFVEF   +    A++ SP+MIGDRQAV+E K
Sbjct  340   FGFVEFETSSGKQAALEASPVMIGDRQAVIEEK  372


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +PA    PSA++VG+AFVEQYY ILH SP  V+RFYQ+SS+LSR D  G
Sbjct  1     MAKQEASPA----PSAEVVGHAFVEQYYHILHQSPGLVHRFYQDSSLLSRADAAG  51



>ref|XP_007037587.1| RNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY22088.1| RNA binding protein, putative isoform 3 [Theobroma cacao]
Length=366

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 208/315 (66%), Gaps = 14/315 (4%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+K+ SL+YE+Y AEIKTADAQ+S+  GVIVLVTGCLTGKDN+++KFTQ
Sbjct  54    NMTTVTTMQAINEKVLSLNYEDYTAEIKTADAQDSFEKGVIVLVTGCLTGKDNVRKKFTQ  113

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSL  1144
             TFFLAPQDKGYFVLNDV RYVE+ E   N+  VNGV ++ +   S   P+PEP +  D L
Sbjct  114   TFFLAPQDKGYFVLNDVLRYVEEKEL-HNSVPVNGVSEQAST--SALTPEPEPTY--DPL  168

Query  1143  NANPASSDTEEVKNV--GIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
               +P +   EEV+++  G ++ +  + E+    E+E+ V  ++  ++N++ A+++S    
Sbjct  169   VVDPVTH--EEVEDISNGAEVCDPSDKEEGSVIEEEVFV-PQNVASQNESVATVDSVPVV  225

Query  969   IQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
             I+ DAPK SYASI+   + N   T +YVP+N  R     Q  S+ +  P P   A +  S
Sbjct  226   IE-DAPKQSYASIVKVMKSNTASTPVYVPSNNVRAAPADQQ-SIASAKPAPAPEAAVPNS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                 ES N  EEAEGHSIYVRNLP+    A+LE  FKK+GPIK  GIQVR+N+ QGF FG
Sbjct  284   DNAPESSNDNEEAEGHSIYVRNLPYAAMPAQLEEAFKKFGPIKRNGIQVRTNK-QGFTFG  342

Query  612   FVEFHGLNSMNNAIQ  568
             FVEF   +S+ +A++
Sbjct  343   FVEFEMASSVQSALE  357


 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  +PA    PSAQ+VGNAFVEQYY ILHHSP+ V+RFYQ+SS LSRPD DG
Sbjct  1     MAMQEGSPAN--PPSAQVVGNAFVEQYYHILHHSPNLVHRFYQDSSCLSRPDKDG  53



>ref|XP_010663446.1| PREDICTED: putative G3BP-like protein isoform X1 [Vitis vinifera]
 ref|XP_010663447.1| PREDICTED: putative G3BP-like protein isoform X2 [Vitis vinifera]
Length=468

 Score =   253 bits (646),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 204/326 (63%), Gaps = 13/326 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI S  Y  Y  EI+TADAQ+SY  GV VLVTG +T KDN+KRKF Q+FFLAPQD
Sbjct  62    QAINDKIMSFHYGEYKMEIETADAQDSYKEGVTVLVTGSVTLKDNVKRKFGQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
              GYFVLND+F Y+E+ ++   N   V+G+++  T   +   PDPE  HVPD L  +PA+ 
Sbjct  122   NGYFVLNDIFTYIEEKKSLQENFAPVDGINE--TAPTAALTPDPEANHVPDHLVVDPATP  179

Query  1122  DTEEVKNVG--IKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
               EE +++    ++ +  ++E+    E+E +V+  S  +EN+ S  ++S  +A Q+DAPK
Sbjct  180   SFEEEEDLNNVAEVCDPSDNEEGSVIEEEAVVEPPSISSENEISTVVDSAPAA-QEDAPK  238

Query  948   MSYASI---LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI   +       P        A+    ++Q A   +    P   A    S +  E
Sbjct  239   KSYASIVKVMKGSATSTPVFATSTVRAAPANIDQQLAG--SAKSAPAPEAWTPTSDSAPE  296

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S N  EE  G SIYVR+LP + TV +LE  FKK+GPIK  GIQVRSN+QQGFCFGFVEF 
Sbjct  297   SSNINEE--GFSIYVRHLPLSATVPQLEEEFKKFGPIKQDGIQVRSNKQQGFCFGFVEFE  354

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L+SM +A++ SPI IGDRQAVVE K
Sbjct  355   SLSSMQSALEASPITIGDRQAVVEEK  380


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  TPA  P  SA  VGNAFV+QYY ILH +P+ +Y+FYQ+SSVLSRPD  G
Sbjct  1     MAMQEATPA--PLHSAAFVGNAFVDQYYPILHQNPELLYKFYQDSSVLSRPDSSG  53



>emb|CDP19749.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   253 bits (647),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 208/325 (64%), Gaps = 15/325 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IND+I+S DY+NY AEIKTADAQ+SY GGVIVLVTGCLTG DN++RKFTQTFFLAPQ+
Sbjct  132   QAINDRIQSFDYKNYSAEIKTADAQDSYQGGVIVLVTGCLTGTDNVRRKFTQTFFLAPQE  191

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLNDVFRY+E+ EA + N+ + NG  D P+ +     P+P PA    + ++  A  
Sbjct  192   KGYFVLNDVFRYIEEFEASEVNSALPNGAADLPSTVTLASDPEPHPASDHSAFDSTTA-L  250

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
             + E+ +N G ++++   D +  S  +E++ + +S     +T   + S  SA  ++  K S
Sbjct  251   EAEDTQN-GAEVYDP-SDSETGSVVEEVVNEPQSKSTPIETVMVISSDLSATPEE--KKS  306

Query  942   YASILS-SQMNKGPTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             YASI+   +     T +YVPT+++R       +Q+ S     P P A AP   S    ES
Sbjct  307   YASIVKVPKATPRSTPVYVPTSSARSVPANVNQQAHSPEQTSPEPHASAPAVESGP--ES  364

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
              N  E  EG+SIYVRNL  N T   LE  FKK+G IK  GIQVRSN+ QG CFGFVEF  
Sbjct  365   SNVHE--EGYSIYVRNLALNATPQHLEEEFKKFGAIKCDGIQVRSNK-QGSCFGFVEFES  421

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
             L SM NAI+ SP+ IG RQAVVE K
Sbjct  422   LESMQNAIKASPVSIGGRQAVVEEK  446


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P P+AQ+VGNAFV+QYY ILH SP+ VY+FYQ+SSVLSRPD +G
Sbjct  80    PLPTAQVVGNAFVDQYYHILHRSPELVYKFYQDSSVLSRPDSNG  123



>gb|KHG13524.1| nxt3 [Gossypium arboreum]
Length=460

 Score =   250 bits (638),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 219/329 (67%), Gaps = 9/329 (3%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+K+ SL+Y++Y AEIKTADAQ+S+  GVIV+VTGCLTGKDN++RKFTQ
Sbjct  56    NMTTVTTMQAINEKVLSLNYQDYTAEIKTADAQDSFEKGVIVVVTGCLTGKDNIRRKFTQ  115

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSL  1144
             TFFLAPQDKGYFVLND+FRY+E DE   N   VNGV ++ +   S    +PEP++  D  
Sbjct  116   TFFLAPQDKGYFVLNDIFRYIEDDEL-QNTIPVNGVSEQAST--SILTSEPEPSN--DHP  170

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               +P +   +E  N G ++ +   DE++ S  +E +V+ +  +N+N+ S  ++ +T A+ 
Sbjct  171   VEDPLTYPEDEDINNGAEVCDP-SDEEEGSVIEEEVVEPQKVVNQNE-SVVVDDSTPAVL  228

Query  963   DDAPKMSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             +DAPK SYASI+    +   PT + V T  +R+   +Q +++ A+         +  S  
Sbjct  229   EDAPKKSYASIVKVMKSTAPPTLVNVTTRYARVVPAEQRSNVSAKPAPVAPIVAVPNSDN  288

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
               ES N  EEAEGHSIYVRNLP+N T A+LE  FKK+GPIK  GIQVRSN+ QGF FGFV
Sbjct  289   APESSNENEEAEGHSIYVRNLPYNATPAQLEEAFKKFGPIKRNGIQVRSNK-QGFTFGFV  347

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +S+ +A++ SPI IGDRQA VE K
Sbjct  348   EFETPSSVQSALEASPITIGDRQAAVEEK  376


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MAMQ  +PA    PSAQ+VGNAFVEQYY ILH SP+ V+RFYQ+ S LSRPD
Sbjct  1     MAMQEGSPADTHTPSAQVVGNAFVEQYYHILHQSPNLVHRFYQDLSCLSRPD  52



>ref|XP_006848484.1| hypothetical protein AMTR_s00013p00254870 [Amborella trichopoda]
 gb|ERN10065.1| hypothetical protein AMTR_s00013p00254870 [Amborella trichopoda]
Length=481

 Score =   250 bits (639),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 203/334 (61%), Gaps = 30/334 (9%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q INDKI SLDY N  AEIKT DAQ S+N GV+VLVTG LTGKDN++R FTQ+FFL
Sbjct  58    ITTMQAINDKILSLDYGNSRAEIKTVDAQESFNLGVLVLVTGYLTGKDNVRRNFTQSFFL  117

Query  1311  APQDKGYFVLNDVFRYVEQD-EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             APQDKGYFVLNDVFRYVE++ + + N  +VN              PD E      ++   
Sbjct  118   APQDKGYFVLNDVFRYVEENGQLEGNPGLVN--------------PDME-----STMRTP  158

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQV----SDEKEILVDTESHLNENQTSASLES-----  982
             P   + ++V +    + E   + ++V     DE   +V+ E+ ++E      +ES     
Sbjct  159   PEQVEVQKVSDEATHLSEEDINAEEVYNPSDDEDGSVVEGEAPIDEVINEVRIESPATVD  218

Query  981   TTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapi  802
               S++Q++ PK SYASI+   M + P+ + VP  ++R         ++A  P   A    
Sbjct  219   AVSSVQEEVPKKSYASIVKV-MKESPSHLSVPVPSARATPSNSERQVIAPAPPAVAQEAH  277

Query  801   aPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGF  622
             AP+T   ES   + E +GHSIY+++LP N T A+LE  FKK+G IK GGIQVRSN+QQGF
Sbjct  278   APNTNPTESSTQEAEGDGHSIYIKSLPLNATAAQLEEEFKKFGAIKSGGIQVRSNKQQGF  337

Query  621   CFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             CFGFVEF   +S+ +AI+ SPIMIG RQA VE K
Sbjct  338   CFGFVEFESSSSVQSAIEASPIMIGGRQAFVEEK  371


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P P AQ+VGNAFV QYY ILH SP+ VYRFYQE+S L RP+ +G
Sbjct  10    PVPPAQVVGNAFVHQYYNILHQSPELVYRFYQETSRLGRPEENG  53



>ref|XP_010522574.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Tarenaya 
hassleriana]
Length=455

 Score =   248 bits (633),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 200/329 (61%), Gaps = 27/329 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+YE Y  EI+TADAQ SY+ G IVLVTGCLTGKD++++KFTQ FFLAPQD
Sbjct  60    QAINEKILSLNYEEYKVEIETADAQESYDKGAIVLVTGCLTGKDSVRKKFTQMFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP-AS  1126
             KGYFVLNDVFR+ E+ D A +++   NGV +    +        EP HV +S  + P AS
Sbjct  120   KGYFVLNDVFRFFEEKDPAQAHSITTNGVSENTEAV--------EPEHVTESHESEPVAS  171

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA--IQDDAP  952
              + E++ NV      S  DE  V  E EI+      L E + +  L S  +A   Q+DAP
Sbjct  172   IEEEDLDNVAEVYDPSDRDEGSVV-EDEIV----EPLIEPRQTEILSSGEAAPVSQEDAP  226

Query  951   KMSYASILSSQMNKGPTKIYV-----PTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             K SYASIL   M  GPT  +V     P  A     +KQ+A     V   EA      +  
Sbjct  227   KQSYASIL-KLMKSGPTTSHVVAANKPKAAPVSDNQKQTAPPAKPVASSEAFPSNENTP-  284

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
               +S++   E +GHSIYVRNLPF  T  +LE  FKK+GPIKH GIQVRSN+ QGFCFGFV
Sbjct  285   --DSRHVNGEDDGHSIYVRNLPFYATPTQLEEAFKKFGPIKHEGIQVRSNK-QGFCFGFV  341

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +    A++ SPI IGD QAV+E K
Sbjct  342   EFETSSGKQAALEASPITIGDCQAVIEEK  370


 Score = 71.6 bits (174),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +PA    PSA++VG+AFVEQYY ILH SP  V+RFYQ+SS L+RPD  G
Sbjct  1     MAKQEASPA----PSAEVVGHAFVEQYYHILHQSPGLVHRFYQDSSFLTRPDASG  51



>emb|CAN77669.1| hypothetical protein VITISV_038107 [Vitis vinifera]
Length=1100

 Score =   258 bits (660),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 211/310 (68%), Gaps = 10/310 (3%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI S +++N   EI T D+Q+SY GGVIVLVTGCL  KD  ++KFTQ+FFLAPQ 
Sbjct  62    QGINEKILSSEFKNRKTEIMTTDSQSSYEGGVIVLVTGCLMTKDKRRKKFTQSFFLAPQY  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLNDV RY+   EA      +NG +D P V  +     P   H PD    +PA+S 
Sbjct  122   NGYYVLNDVLRYIVDGEALETIP-INGTNDSPAVSLNQ---GPGHTHDPDPPVPDPATSV  177

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              E+ + V  K+++ LE+E+Q+ +E+E   +T+SH  EN  S   ES++S+ Q+DAPK SY
Sbjct  178   VEDDEIVIEKVYDPLENEEQLVNEEEDFTETQSHPIENDDSTIAESSSSSAQEDAPKKSY  237

Query  939   ASILS-SQMNKGPTKIYVPTNASRM---KTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             ASI+   + + G TK+YVPT  +++   KTE QS  + A  PVPE+      S    ES 
Sbjct  238   ASIVKVMKGSSGSTKVYVPTKTTKVTPAKTENQSPGLAAPAPVPESSVTS--SINAPESS  295

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             +A EE EGHSIY+RNLP N+TV++LEA F+K+GPIK GG+QVRSN+QQ +CFGFVEF  L
Sbjct  296   DAPEEVEGHSIYIRNLPLNVTVSQLEAEFQKFGPIKQGGVQVRSNKQQAYCFGFVEFLSL  355

Query  591   NSMNNAIQDS  562
             +SM++AIQ++
Sbjct  356   SSMHSAIQNA  365


 Score = 75.1 bits (183),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT  P  +P PSA++VGNAFVEQYY +LH SP+ V+RFY++SSV+S PD +G
Sbjct  1     MAMQTENPQ-LP-PSAEVVGNAFVEQYYYVLHRSPELVFRFYRDSSVMSWPDSNG  53



>ref|XP_009136424.1| PREDICTED: ras GTPase-activating protein-binding protein 2 isoform 
X2 [Brassica rapa]
Length=450

 Score =   246 bits (628),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 193/323 (60%), Gaps = 26/323 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQDKG
Sbjct  62    INDKIMSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP-DPEPAHVPDSLNANPASSDT  1117
             YFVLNDVFR++E+ E  + A  +NG     T     +AP +PE   V     A P    T
Sbjct  122   YFVLNDVFRFLEEKEVTTQA--ING-----TTTRDVQAPVEPERVVVSHEAEAEPEPVAT  174

Query  1116  EEVKNVGIKIHESLEDEKQVSD----EKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
                    I+  E LE+  +V D    ++ ++VD E      Q S S     S  Q DAPK
Sbjct  175   -------IEEEEDLENVAEVYDPSDKDEGVVVDAEPIEPSAQISHS--EVPSLPQGDAPK  225

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP     PT  +R K    +  +    P      P A +  +  S N
Sbjct  226   HSYASIL-KLMKSGP----APTQVARSKPRVAAPVVTKPKPAAPPAEPAAAAENVPNSSN  280

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+QQGFCFGFVEF   +
Sbjct  281   VDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGAIKHEGIQVRSNKQQGFCFGFVEFEMAS  340

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAV+E K
Sbjct  341   GKQSALEASPVTIGDRQAVLEEK  363


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD  G
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDATG  51



>ref|XP_009136423.1| PREDICTED: ras GTPase-activating protein-binding protein 2 isoform 
X1 [Brassica rapa]
Length=451

 Score =   246 bits (628),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 193/323 (60%), Gaps = 26/323 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQDKG
Sbjct  62    INDKIMSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP-DPEPAHVPDSLNANPASSDT  1117
             YFVLNDVFR++E+ E  + A  +NG     T     +AP +PE   V     A P    T
Sbjct  122   YFVLNDVFRFLEEKEVTTQA--ING-----TTTRDVQAPVEPERVVVSHEAEAEPEPVAT  174

Query  1116  EEVKNVGIKIHESLEDEKQVSD----EKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
                    I+  E LE+  +V D    ++ ++VD E      Q S S     S  Q DAPK
Sbjct  175   -------IEEEEDLENVAEVYDPSDKDEGVVVDAEPIEPSAQISHS--EVPSLPQGDAPK  225

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP     PT  +R K    +  +    P      P A +  +  S N
Sbjct  226   HSYASIL-KLMKSGP----APTQVARSKPRVAAPVVTKPKPAAPPAEPAAAAENVPNSSN  280

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+QQGFCFGFVEF   +
Sbjct  281   VDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGAIKHEGIQVRSNKQQGFCFGFVEFEMAS  340

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAV+E K
Sbjct  341   GKQSALEASPVTIGDRQAVLEEK  363


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD  G
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDATG  51



>ref|XP_010663448.1| PREDICTED: putative G3BP-like protein isoform X3 [Vitis vinifera]
Length=467

 Score =   246 bits (629),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 203/326 (62%), Gaps = 14/326 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI S  Y  Y  EI+TADAQ+SY  GV VLVTG +T KDN+KRKF Q+FFLAPQD
Sbjct  62    QAINDKIMSFHYGEYKMEIETADAQDSYKEGVTVLVTGSVTLKDNVKRKFGQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
              GYFVLND+F Y+E+ ++   N   V+G+++  T   +   PDPE  HVPD L  +PA+ 
Sbjct  122   NGYFVLNDIFTYIEEKKSLQENFAPVDGINE--TAPTAALTPDPEANHVPDHLVVDPATP  179

Query  1122  DTEEVKNVG--IKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
               EE +++    ++ +  ++E+    E+E +V+  S  +EN+ S  ++S  +A Q+DAPK
Sbjct  180   SFEEEEDLNNVAEVCDPSDNEEGSVIEEEAVVEPPSISSENEISTVVDSAPAA-QEDAPK  238

Query  948   MSYASI---LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI   +       P        A+    ++Q A   +    P   A    S +  E
Sbjct  239   KSYASIVKVMKGSATSTPVFATSTVRAAPANIDQQLAG--SAKSAPAPEAWTPTSDSAPE  296

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S N  E  EG SIYVR+LP + TV +LE  FKK+GPIK  GIQVRSN+ QGFCFGFVEF 
Sbjct  297   SSNINE--EGFSIYVRHLPLSATVPQLEEEFKKFGPIKQDGIQVRSNK-QGFCFGFVEFE  353

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L+SM +A++ SPI IGDRQAVVE K
Sbjct  354   SLSSMQSALEASPITIGDRQAVVEEK  379


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQ  TPA  P  SA  VGNAFV+QYY ILH +P+ +Y+FYQ+SSVLSRPD  G
Sbjct  1     MAMQEATPA--PLHSAAFVGNAFVDQYYPILHQNPELLYKFYQDSSVLSRPDSSG  53



>emb|CBI15315.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   247 bits (630),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 203/326 (62%), Gaps = 14/326 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI S  Y  Y  EI+TADAQ+SY  GV VLVTG +T KDN+KRKF Q+FFLAPQD
Sbjct  95    QAINDKIMSFHYGEYKMEIETADAQDSYKEGVTVLVTGSVTLKDNVKRKFGQSFFLAPQD  154

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
              GYFVLND+F Y+E+ ++   N   V+G+++  T   +   PDPE  HVPD L  +PA+ 
Sbjct  155   NGYFVLNDIFTYIEEKKSLQENFAPVDGINE--TAPTAALTPDPEANHVPDHLVVDPATP  212

Query  1122  DTEEVKNVG--IKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
               EE +++    ++ +  ++E+    E+E +V+  S  +EN+ S  ++S  +A Q+DAPK
Sbjct  213   SFEEEEDLNNVAEVCDPSDNEEGSVIEEEAVVEPPSISSENEISTVVDSAPAA-QEDAPK  271

Query  948   MSYASI---LSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI   +       P        A+    ++Q A   +    P   A    S +  E
Sbjct  272   KSYASIVKVMKGSATSTPVFATSTVRAAPANIDQQLAG--SAKSAPAPEAWTPTSDSAPE  329

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S N  E  EG SIYVR+LP + TV +LE  FKK+GPIK  GIQVRSN+ QGFCFGFVEF 
Sbjct  330   SSNINE--EGFSIYVRHLPLSATVPQLEEEFKKFGPIKQDGIQVRSNK-QGFCFGFVEFE  386

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L+SM +A++ SPI IGDRQAVVE K
Sbjct  387   SLSSMQSALEASPITIGDRQAVVEEK  412


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 2/57 (4%)
 Frame = -2

Query  1890  FRMAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             F MAMQ  TPA  P  SA  VGNAFV+QYY ILH +P+ +Y+FYQ+SSVLSRPD  G
Sbjct  32    FYMAMQEATPA--PLHSAAFVGNAFVDQYYPILHQNPELLYKFYQDSSVLSRPDSSG  86



>gb|KHN13549.1| Putative G3BP-like protein [Glycine soja]
Length=582

 Score =   247 bits (631),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 187/329 (57%), Gaps = 32/329 (10%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+++ + AEIKTADAQ SY  GV VLVTGCLTGKDNL+RKF Q+FFLAPQD G
Sbjct  64    INEKILSLNFKEFKAEIKTADAQKSYKEGVTVLVTGCLTGKDNLRRKFAQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPD--------------------  1174
             YFVLNDVFRYVE D   S    V G  D   V  +PE                       
Sbjct  124   YFVLNDVFRYVE-DHEPSELPPVTGDGDAAAVTVTPEPGKIIIQKICIFSFKIYSGVGFM  182

Query  1173  -----PEPAHVPDSLNANPASSDTEEVKNVGIKIHE-SLEDEKQVSDEKEILVDTESHLN  1012
                   EP+H  DS   +P +S   + + V    +E S   E+ +  E    V+     N
Sbjct  183   LFSFFTEPSHFADSSAPDPTNSHVNKGQTVAENAYEPSNHHERHIPIENVDNVEPHFQSN  242

Query  1011  ENQTSASLESTTSAIQDDAPKMSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMva  835
              N  S + E  +SA +    K SYASI+  Q      TK+YVPTN  +    K    +V 
Sbjct  243   GNDDSQATELASSAQE----KKSYASIVKVQKEGSVATKVYVPTNTLKSGPNKTENKVVE  298

Query  834   qvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGG  655
              V   E       S    ES +A EE EGHSIY+RNLP N+T A+LE  FKK+GPIK GG
Sbjct  299   SVESTEVSEAALDSVNNPESSDAHEEVEGHSIYIRNLPLNVTAAQLELEFKKFGPIKPGG  358

Query  654   IQVRSNRQQGFCFGFVEFHGLNSMNNAIQ  568
             IQVR+N+QQG+CFGFVEF  LNSMN+AIQ
Sbjct  359   IQVRNNKQQGYCFGFVEFLSLNSMNSAIQ  387


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+QT TP T P  SAQ+VGNAFVEQYY ILHHSPD VYRFYQ+SSV+SRPD  G
Sbjct  1     MALQTATPPTTP--SAQVVGNAFVEQYYHILHHSPDLVYRFYQDSSVISRPDSSG  53



>ref|XP_002864713.1| nuclear transport factor 2 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH40972.1| nuclear transport factor 2 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=459

 Score =   244 bits (622),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 192/323 (59%), Gaps = 18/323 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEEYTAEIETADAQESHERGVIVLVTGHLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANP---A  1129
             KGYFVLNDVFR +E+ E  + A+ V  ++  P  + +P   +PE   V + L   P   A
Sbjct  120   KGYFVLNDVFRSLEEKEVTAQARSV-PINGNPRDVQAPV--EPERVIVTNELEVEPEPVA  176

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             S + E++ NV      S +DE        ++VD E     NQ S +     S  Q DAPK
Sbjct  177   SIEEEDLDNVAEVYDPSDKDEG-------VVVDVEPIEPPNQISHN--EILSVSQGDAPK  227

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL  QM   P   +V  N  R        +     P     A    +  +  S +
Sbjct  228   HSYASIL-KQMKSSPAPTHVAPNKPRPAPVNHKPTAPPAKPAAGPEASAHEN--VPNSSH  284

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+QQGFCFGFVEF   +
Sbjct  285   VDVEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGFVEFETSS  344

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAVVE K
Sbjct  345   GKQSALEASPVTIGDRQAVVEEK  367


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  48



>ref|XP_010443914.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Camelina sativa]
Length=462

 Score =   244 bits (622),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 192/326 (59%), Gaps = 22/326 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDDEPTVIPSPEAP-DPEPAHVPDSLNANP-  1132
             KGYFVLNDVFR++E+ E  + A+ V  NG   +       +AP +PE  +V       P 
Sbjct  120   KGYFVLNDVFRFLEEKEVTTQARSVAINGTTRD------VQAPVEPERVNVSHEAEVEPE  173

Query  1131  --ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
               AS + E++ NV      S +DE  V D + I   T+   NE           S  Q D
Sbjct  174   PVASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQLSHNE---------VLSVPQGD  224

Query  957   APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
             APK SYASIL   M  GP   +V  N  R      +    A+     A    +    +  
Sbjct  225   APKHSYASIL-KLMKSGPAPTHVARNKPRAAPVSTNQKQTARSAEHVAAPEASVLENVQN  283

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S +   + +GHSIYVRNLPF+ T  +LE VFKK+G IK  GIQVRSN+QQGFCFGFVEF 
Sbjct  284   SSHVDVDDDGHSIYVRNLPFDSTPTQLEEVFKKFGAIKVEGIQVRSNKQQGFCFGFVEFE  343

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
               +   +A+  SP+ IGDRQAVVE K
Sbjct  344   TASGKQSALDASPVTIGDRQAVVEEK  369


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q   P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD +G
Sbjct  1     MAQQEANPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDVNG  51



>gb|KDO65713.1| hypothetical protein CISIN_1g012356mg [Citrus sinensis]
Length=465

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 212/333 (64%), Gaps = 20/333 (6%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   + IND+I SL+YE+Y AEIKTADAQ+SY  GVIVLVTGCLTGKDN+K+KFTQTFFL
Sbjct  56    VTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFL  115

Query  1311  APQDK-GYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNA  1138
             APQDK GYFVLNDVFR+VE++E+ ++N+  V  V++        EA  PEPAH  D + A
Sbjct  116   APQDKGGYFVLNDVFRFVEENESLENNSDSV--VNETAPTANVTEA--PEPAHDQDHIPA  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
             + A     E  + G ++ +  + E+    E EI V+  S+  +N+  AS++S   A Q D
Sbjct  172   DRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEI-VEPPSNSVQNEVHASVDSAPVA-QGD  229

Query  957   AP-KMSYASILSSQMNKG---PTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapia  799
             AP K SYASI+  ++ KG    +  YVP   +R      ++QS +M    P P   A   
Sbjct  230   APEKKSYASIV--KVMKGYNISSAAYVPARKARPTPPNADQQSPAM--AKPAPVPEASAL  285

Query  798   PSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
              S    E+ N  EEAEG SIYVRNL F  T  ELE  FK +GPIK  G+QVRSN+ QG+C
Sbjct  286   SSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNK-QGYC  344

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFV F    S+ +A++ SPI+IGDR A VE K
Sbjct  345   FGFVAFETPGSVQSALEASPILIGDRPADVEAK  377


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  +PA    PSAQ+VGNAFVEQYY ILH SP  V+RFYQ+SS+LSRPD +G
Sbjct  1     MAVQEGSPA----PSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNG  51



>ref|XP_006477682.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Citrus sinensis]
Length=465

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 212/333 (64%), Gaps = 20/333 (6%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   + IND+I SL+YE+Y AEIKTADAQ+SY  GVIVLVTGCLTGKDN+K+KFTQTFFL
Sbjct  56    VTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFL  115

Query  1311  APQDK-GYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNA  1138
             APQDK GYFVLNDVFR+VE++E+ ++N+  V  V++        EA  PEPAH  D + A
Sbjct  116   APQDKGGYFVLNDVFRFVEENESLENNSDSV--VNETAPTANVTEA--PEPAHDQDHIPA  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
             + A     E  + G ++ +  + E+    E EI V+  S+  +N+  AS++S   A Q D
Sbjct  172   DRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEI-VEPPSNSVQNEVHASVDSAPVA-QGD  229

Query  957   AP-KMSYASILSSQMNKG---PTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapia  799
             AP K SYASI+  ++ KG    +  YVP   +R      ++QS +M    P P   A   
Sbjct  230   APEKKSYASIV--KVMKGYNISSAAYVPARKARPTPPNADQQSPAM--AKPAPVPEASAL  285

Query  798   PSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
              S    E+ N  EEAEG SIYVRNL F  T  ELE  FK +GPIK  G+QVRSN+ QG+C
Sbjct  286   SSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNK-QGYC  344

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFV F    S+ +A++ SPI+IGDR A VE K
Sbjct  345   FGFVAFETPGSVQSALEASPILIGDRPADVEAK  377


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +PA    PSAQ+VGNAFVEQYY ILH SP  V+RFYQ+SS+LSRPD +G
Sbjct  1     MAAQEGSPA----PSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNG  51



>ref|XP_010456883.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Camelina sativa]
Length=464

 Score =   242 bits (618),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 192/326 (59%), Gaps = 22/326 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDDEPTVIPSPEAP-DPEPAHVPDSLNANP-  1132
             KGYFVLNDVFR++E+ E  + A+ V  NG   +       +AP +PE  +V       P 
Sbjct  120   KGYFVLNDVFRFLEEKEVTTQARSVAINGTTRD------VQAPVEPERVNVSHEAEVEPE  173

Query  1131  --ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
               AS + E++ NV      S +DE  V D + I   T+   NE           S  Q D
Sbjct  174   PVASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQLSHNE---------VLSVPQGD  224

Query  957   APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
             APK SYASIL   M  GP + +V  N  R      +    A+     A    +    +  
Sbjct  225   APKHSYASIL-KLMKSGPAQTHVSRNKPRAAPVSTNQKTSARPAEHVAAPEASALENVQN  283

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
             S +   + +GHSIYVRNLPF+ T  +LE VFK +G IK  GIQVRSN+QQGFCFGFVEF 
Sbjct  284   SSHVDVDDDGHSIYVRNLPFDSTPTQLEEVFKTFGAIKVEGIQVRSNKQQGFCFGFVEFE  343

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
               +   +A+  SP+ IGDRQAVVE K
Sbjct  344   TASGKQSALDASPVTIGDRQAVVEEK  369


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD +G
Sbjct  8     PSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDVNG  51



>ref|XP_010037242.1| PREDICTED: ras GTPase-activating protein-binding protein 2 isoform 
X2 [Eucalyptus grandis]
Length=448

 Score =   242 bits (617),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 155/339 (46%), Positives = 208/339 (61%), Gaps = 34/339 (10%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+KI SL+YE+Y AEI+TADAQ SY  GVIVLVTGCLTGKD+++RKFTQ
Sbjct  54    NITTVKTTQAINEKILSLNYEDYTAEIETADAQESYGNGVIVLVTGCLTGKDHVRRKFTQ  113

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDS  1147
             TFFLAPQ+KGYFVLNDVFR++E++E    ++   NG+ +       P   + EPA VPD 
Sbjct  114   TFFLAPQEKGYFVLNDVFRFLEENEPIPIHSTANNGISNATATAALPL--EQEPAKVPDE  171

Query  1146  LNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEIL--VDTESHLNENQTSASLESTTS  973
             L A               K+   L +E+Q+++  EIL       ++ E++   ++EST  
Sbjct  172   LAA---------------KLSTPLVEEEQLNNGPEILNPSGNGGYVIEDK---AIESTPH  213

Query  972   AI------QDDAPKMSYASILSSQMNKGPT-KIYVPTNASRMKTEKQSASMvaqvpvpea  814
              I      ++DAPK SYASI+        T K+ VP+   R  T    AS   Q+    +
Sbjct  214   KIDSCLASEEDAPKKSYASIVKVMQGHAVTGKVTVPSKTER--TPPPPASDTQQLSKKAS  271

Query  813   papiaPSTAI-DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSN  637
                  PST I  ES +  EEAEG SI++RNLPF+ TV +LE  FKK+GPIK  GIQVRS+
Sbjct  272   VITPNPSTDIAPESSDVHEEAEGRSIFIRNLPFDATVEQLEEEFKKFGPIKSNGIQVRSS  331

Query  636   RQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             + QG CFGF+EF   +S  +A++ SPI IGD +A++E K
Sbjct  332   K-QGSCFGFIEFETSSSRESALKASPITIGDHRALIEEK  369


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q     + P P AQ+V NAFVEQYY ILH SP  V+RFYQ+SSVL RPD  G
Sbjct  1     MAVQEA--GSAPTPGAQVVANAFVEQYYHILHQSPGLVHRFYQDSSVLGRPDVSG  53



>ref|XP_008791326.1| PREDICTED: ras GTPase-activating protein-binding protein 1 [Phoenix 
dactylifera]
 ref|XP_008791327.1| PREDICTED: ras GTPase-activating protein-binding protein 1 [Phoenix 
dactylifera]
Length=471

 Score =   242 bits (618),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 202/330 (61%), Gaps = 21/330 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL++++Y  +I+T D+Q SY  GV ++VTG LTG DN+ R+F Q+FFLAPQ+
Sbjct  62    QAINDKIMSLEFKDYFTKIETVDSQMSYKNGVFIVVTGSLTGLDNVWRRFAQSFFLAPQE  121

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGV-DDEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
              G YFVLNDVFR+V E   A+ N  + NG  +D+P    +P   +PEPA + +   A+ A
Sbjct  122   NGGYFVLNDVFRFVNENKPAEINQALANGTSNDDPK---TPLTAEPEPASIQERHVADLA  178

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +  +E   + G+++    E+      E E++VD   H + +      E+T S +Q+DAPK
Sbjct  179   TPLSEGEADNGVEVFNPSENGDS-GVEDEVVVDPLVHESHSDAQPVSETTASVVQEDAPK  237

Query  948   MSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI+  ++ KG   P  +YVPTN +     K + +   +          A  T I  
Sbjct  238   KSYASIV--KVMKGSSSPKPVYVPTNKT-----KPAPANPEKPAAASTAPAHASETPIPN  290

Query  777   SKNAQE----EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
             SK   E    E EGHSIY+RNLP N T  ++E  FKK+GPIK GG+QVRS++ + FCFGF
Sbjct  291   SKTVPEKNSREVEGHSIYIRNLPLNATAEQVEEEFKKFGPIKPGGVQVRSHKIERFCFGF  350

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF  L SM +AI+ SPIMIG RQA VE K
Sbjct  351   VEFESLKSMQDAIKASPIMIGGRQAYVEEK  380



>ref|XP_006440772.1| hypothetical protein CICLE_v10020038mg [Citrus clementina]
 gb|ESR54012.1| hypothetical protein CICLE_v10020038mg [Citrus clementina]
Length=465

 Score =   242 bits (617),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 212/333 (64%), Gaps = 20/333 (6%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   + IND+I SL+YE+Y AEIKTADAQ+SY  GVIVLVTGCLTGKDN+K+KFTQTFFL
Sbjct  56    VTTMKAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFL  115

Query  1311  APQDK-GYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNA  1138
             APQDK GYFVLNDVFR+VE++E+ ++N+  V  V++        EA  PEPAH  D + A
Sbjct  116   APQDKGGYFVLNDVFRFVEENESLENNSDSV--VNETAPTANVAEA--PEPAHNQDHIPA  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
             + A     E  + G ++ +  + E+    E EI V+  ++  +N+  AS++S   A Q D
Sbjct  172   DRAIVIEGEDLDNGPEVCDPSDKEEGSVVEDEI-VEPPTNSVQNEVHASVDSAPVA-QGD  229

Query  957   AP-KMSYASILSSQMNKG---PTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapia  799
             AP K SYASI+  ++ KG    +  YVP   +R      ++QS +M    P P   A   
Sbjct  230   APEKKSYASIV--KVMKGYNISSAAYVPARKARPTPPNADQQSPAM--AKPAPVPEASAL  285

Query  798   PSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
              S    E+ N  EEAEG SIYVRNL F  T  ELE  FK +GPIK  G+QVRSN+ QG+C
Sbjct  286   SSDGAPENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNK-QGYC  344

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFV F    S+ +A++ SPI+IGDR A VE K
Sbjct  345   FGFVAFETPGSVQSALEASPILIGDRPADVEAK  377


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +PA    PSAQ+VGNAFVEQYY ILH SP  V+RFYQ+SS+LSRPD +G
Sbjct  1     MAAQEGSPA----PSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNG  51



>ref|XP_010939185.1| PREDICTED: putative G3BP-like protein isoform X1 [Elaeis guineensis]
 ref|XP_010939186.1| PREDICTED: putative G3BP-like protein isoform X1 [Elaeis guineensis]
Length=470

 Score =   241 bits (616),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 195/326 (60%), Gaps = 14/326 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SLD+++Y  +I+T D+Q SY  GV ++VTG LTG DN+ RKF Q+FFLAPQ+
Sbjct  62    QAINDKIMSLDFKDYFTKIETVDSQMSYKNGVFIVVTGSLTGLDNVWRKFAQSFFLAPQE  121

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVD-DEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
              G YFVLNDVFR+V E   A+ N  + NG   D P    +P   +PEPA + +   A  A
Sbjct  122   NGGYFVLNDVFRFVNENKPAEMNQPLANGTSSDAPK---TPLTAEPEPASIQERHVAELA  178

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +  +E   + G ++    E+      E E++VD   H + N      E+T S   +DAPK
Sbjct  179   TPLSEGDADNGEEVFNPSENGGS-GVEDEVVVDPPVHESHNDAQPGSETTASVAHEDAPK  237

Query  948   MSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI+  ++ KG   P  +YVPT  ++    K     V       A     P++ + E
Sbjct  238   KSYASIV--KVMKGSPSPKPVYVPTAKTKPSPAKPEKPAVVSTAPAHASETPVPNSTVPE  295

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
               N   E EGHSIY+RNLP N T  ++E  FKK+GPIK GG+QVRS++ + FCFGFVEF 
Sbjct  296   --NNSHEVEGHSIYIRNLPLNATAEQVEEEFKKFGPIKPGGVQVRSHKIERFCFGFVEFE  353

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
              L SM +AI+ SPIMIG RQA VE K
Sbjct  354   SLKSMQDAIKASPIMIGGRQAYVEEK  379


 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+ T TP  VP PS Q+VG+AFV QYY ILH +P+QV+RFYQ+SS+LSRPD DG
Sbjct  1     MALPTGTP--VPLPSPQVVGSAFVHQYYHILHQTPEQVFRFYQDSSILSRPDSDG  53



>emb|CDY02179.1| BnaA03g39880D [Brassica napus]
Length=504

 Score =   242 bits (618),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 191/323 (59%), Gaps = 27/323 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQDKG
Sbjct  116   INDKIMSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGTDNVRKKFSQTFFLAPQDKG  175

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP-DPEPAHVPDSLNANPASSDT  1117
             YFVLNDVFR++E+ E  + A  +NG     T     +AP +PE   V     A P    T
Sbjct  176   YFVLNDVFRFLEEKEVTTQA--ING-----TTTRDVQAPVEPERVVVSHEAEAEPEPVAT  228

Query  1116  ----EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
                 E+++NV    + S +DE  V D + I         E  T  S     S  Q DAPK
Sbjct  229   IEEEEDLENVAEVYNPSDKDEGVVVDAEPI---------EPPTQLSHSEVPSVPQGDAPK  279

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP     PT  +R K    +  +    P      P A +  +  S N
Sbjct  280   HSYASIL-KLMKSGPA----PTQVARSKPRVAAPVVTKPKPAAPPAEPAAAAENVPNSSN  334

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+ QGFCFGFVEF   +
Sbjct  335   VDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGAIKHEGIQVRSNK-QGFCFGFVEFETAS  393

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAV+E K
Sbjct  394   GKQSALEASPVTIGDRQAVLEEK  416


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  55    MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  102



>ref|NP_200906.2| nuclear transport factor 2 and RNA recognition motif domain-containing 
protein [Arabidopsis thaliana]
 dbj|BAB10647.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL32982.1| AT5g60980/MSL3_100 [Arabidopsis thaliana]
 gb|AAO23575.1| At5g60980/MSL3_100 [Arabidopsis thaliana]
 gb|AED97407.1| nuclear transport factor 2 and RNA recognition motif domain-containing 
protein [Arabidopsis thaliana]
Length=460

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 192/330 (58%), Gaps = 31/330 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+Q+FFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQSFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDD------EPTVIPSPEAPDPEPAHVPDSL  1144
             KGYFVLNDVFR++E+ E  + A+ V  NG         EP  +     P+ EP  V    
Sbjct  120   KGYFVLNDVFRFLEEKEVTAQARSVPINGTTRDVQAPIEPERVVVSHEPEVEPEPV----  175

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
                 AS + E++ NV      S +DE  V D + I   T+   NE           S  Q
Sbjct  176   ----ASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQISHNE---------ILSVPQ  222

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-  787
              DAPK SYASIL  QM   P      T+ +R K      +     P  E  A    S   
Sbjct  223   GDAPKHSYASIL-KQMKSSPAPT---THVARNKPRPAPVNQKLTAPPAEPAARPEASAHE  278

Query  786   -IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
              +  S +   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+QQGFCFGF
Sbjct  279   NVPNSSHVDVEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNKQQGFCFGF  338

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +   +A++ SP+ IGDRQAVVE K
Sbjct  339   VEFETSSGKQSALEASPVTIGDRQAVVEEK  368


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS L+RPD
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSFLTRPD  48



>ref|XP_010483757.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Camelina sativa]
Length=462

 Score =   240 bits (613),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 151/323 (47%), Positives = 192/323 (59%), Gaps = 16/323 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDDEPTVIPSPEAPDPEPAHVPDSLNANP-A  1129
             KGYFVLNDVFR++E+ E  + A+ V  NG   +   + +P  P+         + + P A
Sbjct  120   KGYFVLNDVFRFLEEKEVTTQARSVAINGTTRD---VQAPVEPERLNVSHETEVESEPVA  176

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             S + E++ NV      S +DE        ++VD E H+ E  T  S     S  Q DAPK
Sbjct  177   SIEEEDLDNVAEVYDPSDKDEG-------VVVDVE-HI-EPPTQLSHNEVLSVPQGDAPK  227

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP   +V  N  R      +    A+     A    +    +  S +
Sbjct  228   HSYASIL-KLMKSGPAPTHVARNKPRAAPVNTNQKTTARPAEHVAAPEASALENVQNSSH  286

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                + +GHSIYVRNLPF+ T  +LE VFK +G IK  GIQVRSN+QQGFCFGFVEF   +
Sbjct  287   VDVDDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKVEGIQVRSNKQQGFCFGFVEFETAS  346

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A+  SP+ IGDRQAVVE K
Sbjct  347   GKQSALDASPVTIGDRQAVVEEK  369


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD +G
Sbjct  8     PSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDVNG  51



>ref|XP_009136425.1| PREDICTED: ras GTPase-activating protein-binding protein 2 isoform 
X3 [Brassica rapa]
Length=450

 Score =   239 bits (611),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 192/323 (59%), Gaps = 27/323 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQDKG
Sbjct  62    INDKIMSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP-DPEPAHVPDSLNANPASSDT  1117
             YFVLNDVFR++E+ E  + A  +NG     T     +AP +PE   V     A P    T
Sbjct  122   YFVLNDVFRFLEEKEVTTQA--ING-----TTTRDVQAPVEPERVVVSHEAEAEPEPVAT  174

Query  1116  EEVKNVGIKIHESLEDEKQVSD----EKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
                    I+  E LE+  +V D    ++ ++VD E      Q S S     S  Q DAPK
Sbjct  175   -------IEEEEDLENVAEVYDPSDKDEGVVVDAEPIEPSAQISHS--EVPSLPQGDAPK  225

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP     PT  +R K    +  +    P      P A +  +  S N
Sbjct  226   HSYASIL-KLMKSGP----APTQVARSKPRVAAPVVTKPKPAAPPAEPAAAAENVPNSSN  280

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+ QGFCFGFVEF   +
Sbjct  281   VDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGAIKHEGIQVRSNK-QGFCFGFVEFEMAS  339

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAV+E K
Sbjct  340   GKQSALEASPVTIGDRQAVLEEK  362


 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD  G
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDATG  51



>ref|XP_010030762.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010030766.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW83733.1| hypothetical protein EUGRSUZ_B00605 [Eucalyptus grandis]
Length=458

 Score =   239 bits (611),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 193/328 (59%), Gaps = 32/328 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y++Y  EIKTADAQ S+  GVIVLVTGCLTG+DN KRKFTQTFFLAPQD
Sbjct  62    QAINEKILSLNYKDYTVEIKTADAQESHANGVIVLVTGCLTGRDNAKRKFTQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPE-----APDPEPAHVPDSLNAN  1135
             KGYFVLNDVFRYV + E  +N    N     P V  +PE     APD     V       
Sbjct  122   KGYFVLNDVFRYVGETELLANGTTENA----PAVALTPELGTINAPD----QVAAEPEIA  173

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
                 D + V     ++ +  ++E  V +E+ I         E+    + EST +A +DD 
Sbjct  174   IEEEDLDNVA----EVCDPSDNEGSVIEEETI---------ESPVHKAAESTPAA-EDDT  219

Query  954   PKMSYASILSS-QMNKGPTKIYVPTN--ASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             PK +YA+IL + Q N     ++VP +  A    +  Q  ++ A             S   
Sbjct  220   PK-TYAAILKAIQSNAASRSVHVPPSRAAVGATSNVQQLTVSAPAKPSAPVTSAPVSDNA  278

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              ES N  EE EGHSIY+RNLP+N TV  LE  F+K+G IK  GIQVRS + QG CFGFVE
Sbjct  279   PESSNHNEEVEGHSIYIRNLPYNATVELLEEEFRKFGSIKPNGIQVRSAK-QGSCFGFVE  337

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F  L+SM++A+Q SPI IGD  AVVE+K
Sbjct  338   FEALSSMHSALQASPIAIGDHNAVVEVK  365


 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  TPA  P  SA++VGNAFVEQYY ILH SP+ V+RFYQ+SS+LSRPD +G
Sbjct  1     MAIQEPTPAAPP--SAEVVGNAFVEQYYHILHQSPEMVHRFYQDSSLLSRPDANG  53



>ref|XP_010037241.1| PREDICTED: ras GTPase-activating protein-binding protein 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW48920.1| hypothetical protein EUGRSUZ_K02533 [Eucalyptus grandis]
Length=449

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 201/338 (59%), Gaps = 31/338 (9%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+KI SL+YE+Y AEI+TADAQ SY  GVIVLVTGCLTGKD+++RKFTQ
Sbjct  54    NITTVKTTQAINEKILSLNYEDYTAEIETADAQESYGNGVIVLVTGCLTGKDHVRRKFTQ  113

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDS  1147
             TFFLAPQ+KGYFVLNDVFR++E++E    ++   NG+ +       P   + EPA VPD 
Sbjct  114   TFFLAPQEKGYFVLNDVFRFLEENEPIPIHSTANNGISNATATAALPL--EQEPAKVPDE  171

Query  1146  LNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEIL--VDTESHLNENQTSASLESTTS  973
             L A               K+   L +E+Q+++  EIL       ++ E++   ++EST  
Sbjct  172   LAA---------------KLSTPLVEEEQLNNGPEILNPSGNGGYVIEDK---AIESTPH  213

Query  972   AI------QDDAPKMSYASILSSQMNKGPT-KIYVPTNASRMKTEKQSASMvaqvpvpea  814
              I      ++DAPK SYASI+        T K+ VP+   R      S +          
Sbjct  214   KIDSCLASEEDAPKKSYASIVKVMQGHAVTGKVTVPSKTERTPPPPASDTQQLSKKASVI  273

Query  813   papiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNR  634
                 +   A + S   +E AEG SI++RNLPF+ TV +LE  FKK+GPIK  GIQVRS++
Sbjct  274   TPNPSTDIAPESSDVHEEAAEGRSIFIRNLPFDATVEQLEEEFKKFGPIKSNGIQVRSSK  333

Query  633   QQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              QG CFGF+EF   +S  +A++ SPI IGD +A++E K
Sbjct  334   -QGSCFGFIEFETSSSRESALKASPITIGDHRALIEEK  370


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q     + P P AQ+V NAFVEQYY ILH SP  V+RFYQ+SSVL RPD  G
Sbjct  1     MAVQEA--GSAPTPGAQVVANAFVEQYYHILHQSPGLVHRFYQDSSVLGRPDVSG  53



>ref|XP_010246715.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Nelumbo nucifera]
Length=470

 Score =   239 bits (610),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 167/449 (37%), Positives = 235/449 (52%), Gaps = 95/449 (21%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmdvss*VQAIK  1666
             P+AQ+VGNAFV QYY I+H SP+ VYRFYQ+ S L RP+ DGSM+            A+ 
Sbjct  11    PTAQVVGNAFVHQYYHIMHQSPELVYRFYQDISKLGRPETDGSMS------------AVT  58

Query  1665  LLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVLQHLNFFFLM  1486
              +  + E                                  +IL++D             
Sbjct  59    TMQTINE----------------------------------KILSLD-------------  71

Query  1485  LYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAP  1306
              Y +   +I+++D            AQ+S+NGGV+VLVTG LTGKDN++  FTQ+FFLAP
Sbjct  72    -YSKYRAEIKTVD------------AQDSFNGGVLVLVTGYLTGKDNVRSNFTQSFFLAP  118

Query  1305  QDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
             QDKGYFVLND+FRY+E+ E  D N  + N   DE     +P AP+ + A         PA
Sbjct  119   QDKGYFVLNDMFRYMEELELHDGNQGLPN---DE----VAPLAPEQDLA---------PA  162

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLE-----STTSAIQ  964
                    + V  +     E      +E + +V+ E+ ++E      +E      ++SA+Q
Sbjct  163   QEHQSTEQPVPEEEVNVEEVYNHSDNEGDSVVEEEAPVSEVVDEIQIEPQMVTESSSAVQ  222

Query  963   DDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             ++ PK SYASI+   + N  P     P+        ++      Q P P    P++ S A
Sbjct  223   EEVPKKSYASIVKVMKENAAPLSAPAPSPVRPGPANQERQMAPTQSPSPANETPVSNSNA  282

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
              +   + + E +GHSIY+RNLP N T A+LE  FK++GPIK  G+QVRSN+QQ FCFGFV
Sbjct  283   AENGSHQEGEGDGHSIYIRNLPLNATPAQLEEEFKRFGPIKVNGVQVRSNKQQAFCFGFV  342

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++ +AI+ SPIMIG RQA VE K
Sbjct  343   EFEVASAVQSAIEASPIMIGGRQAFVEEK  371



>ref|XP_010246716.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X2 [Nelumbo nucifera]
Length=465

 Score =   239 bits (609),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 167/449 (37%), Positives = 235/449 (52%), Gaps = 95/449 (21%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmdvss*VQAIK  1666
             P+AQ+VGNAFV QYY I+H SP+ VYRFYQ+ S L RP+ DGSM+            A+ 
Sbjct  11    PTAQVVGNAFVHQYYHIMHQSPELVYRFYQDISKLGRPETDGSMS------------AVT  58

Query  1665  LLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVLQHLNFFFLM  1486
              +  + E                                  +IL++D             
Sbjct  59    TMQTINE----------------------------------KILSLD-------------  71

Query  1485  LYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAP  1306
              Y +   +I+++D            AQ+S+NGGV+VLVTG LTGKDN++  FTQ+FFLAP
Sbjct  72    -YSKYRAEIKTVD------------AQDSFNGGVLVLVTGYLTGKDNVRSNFTQSFFLAP  118

Query  1305  QDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
             QDKGYFVLND+FRY+E+ E  D N  + N   DE     +P AP+ + A         PA
Sbjct  119   QDKGYFVLNDMFRYMEELELHDGNQGLPN---DE----VAPLAPEQDLA---------PA  162

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLE-----STTSAIQ  964
                    + V  +     E      +E + +V+ E+ ++E      +E      ++SA+Q
Sbjct  163   QEHQSTEQPVPEEEVNVEEVYNHSDNEGDSVVEEEAPVSEVVDEIQIEPQMVTESSSAVQ  222

Query  963   DDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             ++ PK SYASI+   + N  P     P+        ++      Q P P    P++ S A
Sbjct  223   EEVPKKSYASIVKVMKENAAPLSAPAPSPVRPGPANQERQMAPTQSPSPANETPVSNSNA  282

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
              +   + + E +GHSIY+RNLP N T A+LE  FK++GPIK  G+QVRSN+QQ FCFGFV
Sbjct  283   AENGSHQEGEGDGHSIYIRNLPLNATPAQLEEEFKRFGPIKVNGVQVRSNKQQAFCFGFV  342

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++ +AI+ SPIMIG RQA VE K
Sbjct  343   EFEVASAVQSAIEASPIMIGGRQAFVEEK  371



>ref|XP_006394546.1| hypothetical protein EUTSA_v100055271mg, partial [Eutrema salsugineum]
 gb|ESQ31832.1| hypothetical protein EUTSA_v100055271mg, partial [Eutrema salsugineum]
Length=428

 Score =   237 bits (604),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 188/324 (58%), Gaps = 18/324 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  26    QAINDKIMSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQD  85

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGYFVLNDVFR++E+    + A+ V  NG   +       +AP  EP  V   + ++ A 
Sbjct  86    KGYFVLNDVFRFLEEKPVTTQARSVTINGTTRD------VQAPPMEPERV---IVSHEAE  136

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLN--ENQTSASLESTTSAIQDDAP  952
              + E V ++     E L++  +V D  +        +   E  T  S        Q DAP
Sbjct  137   VEPEPVASIE---EEDLDNVAEVYDPSDKDDGVVVDVEPIEPPTQLSHSEILPVSQGDAP  193

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             K SYAS+L  ++   P   +V  N  R      +    A      A    +    +  S 
Sbjct  194   KHSYASVL--KLKSSPAPTHVARNKPRAAPVSTNQKPTAPHAETAAAPDASGLENVPNSS  251

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             N   E +GHSIYVRNLPF+ T  +LE VFK YG IKH GIQVRSN+QQGFCFGFVEF   
Sbjct  252   NVDVEDDGHSIYVRNLPFDSTPTQLEEVFKNYGAIKHEGIQVRSNKQQGFCFGFVEFETS  311

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +   +A++ SPI IGDRQAVVE K
Sbjct  312   SGKQSALEASPITIGDRQAVVEEK  335



>ref|XP_010030774.1| PREDICTED: putative G3BP-like protein isoform X2 [Eucalyptus 
grandis]
 gb|KCW83732.1| hypothetical protein EUGRSUZ_B00605 [Eucalyptus grandis]
Length=457

 Score =   237 bits (605),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 192/328 (59%), Gaps = 33/328 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y++Y  EIKTADAQ S+  GVIVLVTGCLTG+DN KRKFTQTFFLAPQD
Sbjct  62    QAINEKILSLNYKDYTVEIKTADAQESHANGVIVLVTGCLTGRDNAKRKFTQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPE-----APDPEPAHVPDSLNAN  1135
             KGYFVLNDVFRYV + E  +N    N     P V  +PE     APD     V       
Sbjct  122   KGYFVLNDVFRYVGETELLANGTTENA----PAVALTPELGTINAPD----QVAAEPEIA  173

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
                 D + V     ++ +  ++E  V +E+ I         E+    + EST +A +DD 
Sbjct  174   IEEEDLDNVA----EVCDPSDNEGSVIEEETI---------ESPVHKAAESTPAA-EDDT  219

Query  954   PKMSYASILSS-QMNKGPTKIYVPTN--ASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             PK +YA+IL + Q N     ++VP +  A    +  Q  ++ A             S   
Sbjct  220   PK-TYAAILKAIQSNAASRSVHVPPSRAAVGATSNVQQLTVSAPAKPSAPVTSAPVSDNA  278

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              ES N  EE EGHSIY+RNLP+N TV  LE  F+K+G IK  GIQVRS   +G CFGFVE
Sbjct  279   PESSNHNEEVEGHSIYIRNLPYNATVELLEEEFRKFGSIKPNGIQVRS--AKGSCFGFVE  336

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F  L+SM++A+Q SPI IGD  AVVE+K
Sbjct  337   FEALSSMHSALQASPIAIGDHNAVVEVK  364


 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  TPA  P  SA++VGNAFVEQYY ILH SP+ V+RFYQ+SS+LSRPD +G
Sbjct  1     MAIQEPTPAAPP--SAEVVGNAFVEQYYHILHQSPEMVHRFYQDSSLLSRPDANG  53



>ref|XP_008810750.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Phoenix dactylifera]
Length=479

 Score =   236 bits (602),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 203/332 (61%), Gaps = 25/332 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+++++  +I+T D+Q SY  GV ++VTG LTG DN+ +KF Q+FFLAPQ+
Sbjct  62    QAINDKIMSLNFKDWFTKIETVDSQMSYKNGVFIVVTGSLTGLDNVWQKFAQSFFLAPQE  121

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAP---DPEPAHVPDSLNAN  1135
              G YFVLNDVFR+V E+  A+ N  ++NG  ++     +P+AP   +PEPA V +     
Sbjct  122   NGGYFVLNDVFRFVNEKQPAEINPMLLNGTSND-----APKAPATAEPEPASVQEHHVVG  176

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
              A+  +E   + G ++    E+      E E+ VD   H +++      E+T+S  QDDA
Sbjct  177   LATPQSEGNADNGEEVFNPSENGGS-GVEDEVAVDPPVHESQSDARPVSETTSSVAQDDA  235

Query  954   PKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             PK SYASI+  ++ KG   P  +YVPT     KT+   AS   +          AP T +
Sbjct  236   PKKSYASIV--KVMKGSPSPKPVYVPTT----KTKPAPAS-PEKPAAASTVPARAPETPV  288

Query  783   DESKNAQE----EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
              +SK   E    E EGHSIY+RNLP N T  ++E  FKK+G IK GG+QVRS++ + FCF
Sbjct  289   SDSKGVPEKNSHEVEGHSIYIRNLPLNATAEQVEDEFKKFGTIKAGGVQVRSHKIERFCF  348

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF  L SM +AI+ SPIMIG RQA VE K
Sbjct  349   GFVEFESLKSMQDAIEASPIMIGGRQAYVEEK  380



>ref|XP_008792919.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Phoenix dactylifera]
Length=483

 Score =   235 bits (600),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 197/328 (60%), Gaps = 10/328 (3%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q IN+KI S+ Y  + AEIKT DAQ S +GGV+VLVTG LTGKDN++R FTQ+FFL
Sbjct  59    ITTMQAINEKILSMYYREFGAEIKTVDAQESLDGGVLVLVTGYLTGKDNIRRSFTQSFFL  118

Query  1311  APQDKGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             A QDKGY+VLND+FRYVE+ DE    + +VN  D   T+ P  EAP P+  HV +    +
Sbjct  119   ATQDKGYYVLNDIFRYVEEADEQQGISGLVN--DTGVTLAPQQEAPPPQEQHVIERAVLH  176

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P   +    + V    + S  ++  V +E+  + +    +  N  +   +S ++ +Q++A
Sbjct  177   PGEEEEVNEEAV---YNPSENEDGSVVEEEAPVAEVIDEIPNNSQAVLADSNSATVQEEA  233

Query  954   PKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQS--ASMvaqvpvpeapapiaPSTAID  781
              K SYASI+   M      + +P +A    T   S   +  A           A S+A++
Sbjct  234   LKKSYASIVKV-MKDNVAPLSIPASAPARPTPSNSDQQAAPAFTAAAAPENVAASSSAVE  292

Query  780   ESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                 AQE E +GHS+Y++NLP N T  +L   FK++GPIK GGIQVRS++QQGFCFGFVE
Sbjct  293   TKNTAQESEVDGHSVYIKNLPLNCTPEQLHEEFKRFGPIKPGGIQVRSHKQQGFCFGFVE  352

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++ +AI+ SPIMIG  QA VE K
Sbjct  353   FEVTSAVQSAIEASPIMIGRHQAFVEEK  380


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA +   P   P PSAQ+V NAFV QYY ILH SP+ VYRFY E+S L R +  G
Sbjct  1     MASEQLAPGGSP-PSAQVVANAFVHQYYHILHQSPELVYRFYMENSKLGRSEAQG  54



>ref|XP_010274054.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Nelumbo nucifera]
 ref|XP_010274055.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Nelumbo nucifera]
 ref|XP_010274056.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Nelumbo nucifera]
Length=466

 Score =   235 bits (599),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 195/323 (60%), Gaps = 17/323 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLDY  Y AEIKT DAQ+S+NGGVIVLVTG LTG+DN++R FTQ+FFLAPQD
Sbjct  61    QAINEKILSLDYSKYRAEIKTVDAQDSFNGGVIVLVTGYLTGEDNVRRNFTQSFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQDE-ADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLND+FRY+E+ E  D N  + NGV    T    PE   P        +  +P  S
Sbjct  121   KGYFVLNDIFRYMEEVEHHDGNQGLPNGVAAPLT----PEQNTP-------PVQEHPEQS  169

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLN-ENQTSASLESTTSAIQDDAPKM  946
               EE  NV    + S  +E  V +E+  + +    +  E+Q    +    SA+Q++ PK 
Sbjct  170   FPEEDVNVEEVYNPSDNEEGSVVEEEAPVAEVVDEVPIESQM---VTEPCSAVQEEVPKK  226

Query  945   SYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             SYASI+        P  +  P  A      ++   +  Q  V    API+   A +   +
Sbjct  227   SYASIVKVMKESAVPLSVPTPPAARPAPANQERQVVPPQSTVSSNEAPISNPNATENGSH  286

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              + E +GHSIY+RNLP N T A+LE  FK++GPIK  G+QVRSN+QQ FCFGFVEF   +
Sbjct  287   QEGEGDGHSIYIRNLPLNATSAQLEEEFKRFGPIKINGVQVRSNKQQAFCFGFVEFEVSS  346

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             ++ +AI+ SPIMIG RQA VE K
Sbjct  347   AVQSAIEASPIMIGGRQAFVEEK  369


 Score = 72.4 bits (176),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+AQ+VGNAFV QYY I+H SPD VYRFYQ+SS L RPD DG
Sbjct  11    PTAQVVGNAFVHQYYHIMHQSPDLVYRFYQDSSKLGRPDSDG  52



>ref|XP_006484219.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006484220.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Citrus sinensis]
Length=453

 Score =   234 bits (596),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 198/322 (61%), Gaps = 12/322 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IND I SLDY+NY+ +I +ADAQ SY+ G+ VLVTGCL GKDN++RKFTQ+FFLAPQD
Sbjct  61    KEINDMIVSLDYQNYNVQIFSADAQASYDNGLTVLVTGCLIGKDNVRRKFTQSFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKM-VNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGYFVLND+ RYV++ DE D +A + +N VD+      +P  PDPEP  VP++   N  +
Sbjct  121   KGYFVLNDILRYVDEIDEKDGSAGLTINDVDENAPA--APLTPDPEPTQVPNNTVLNHVN  178

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                E+ K+     H  L++ + +  EK +  D     ++N    + E   S  +++APK 
Sbjct  179   PVNEDAKSSNEASH-PLDNGQVLVAEKAVAADPPVVASQNDARPAKEPVASKNEEEAPKK  237

Query  945   SYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             S+AS++   +NK      V   A  +KT + S +               PS+     +N 
Sbjct  238   SFASVV-HDLNKSKAPFNVIMRAPSVKTVESSRAT------AAPKVAAPPSSNSSLERNN  290

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
                A+GHSI+V NLP + TV +L+ +F+++GP+K  GIQVRS +Q G CFGFVEF   +S
Sbjct  291   DHAAKGHSIFVGNLPDSATVDQLKLIFEQFGPVKPDGIQVRSQKQTGNCFGFVEFESASS  350

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             + + ++ SPI+IG R+A +E+K
Sbjct  351   VQSVLKASPIVIGSRKASIEVK  372


 Score = 69.3 bits (168),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             S Q+VGNAFVEQYY ILH +PD V+RFYQESS++SRPD  G
Sbjct  12    SPQVVGNAFVEQYYCILHQNPDVVHRFYQESSMVSRPDQSG  52



>ref|NP_851235.1| nuclear transport factor 2 and RNA recognition motif domain-containing 
protein [Arabidopsis thaliana]
 gb|AED97406.1| nuclear transport factor 2 and RNA recognition motif domain-containing 
protein [Arabidopsis thaliana]
Length=459

 Score =   233 bits (595),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 191/330 (58%), Gaps = 32/330 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+Q+FFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQSFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDD------EPTVIPSPEAPDPEPAHVPDSL  1144
             KGYFVLNDVFR++E+ E  + A+ V  NG         EP  +     P+ EP  V    
Sbjct  120   KGYFVLNDVFRFLEEKEVTAQARSVPINGTTRDVQAPIEPERVVVSHEPEVEPEPV----  175

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
                 AS + E++ NV      S +DE  V D + I   T+   NE           S  Q
Sbjct  176   ----ASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQISHNE---------ILSVPQ  222

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-  787
              DAPK SYASIL  QM   P      T+ +R K      +     P  E  A    S   
Sbjct  223   GDAPKHSYASIL-KQMKSSPAPT---THVARNKPRPAPVNQKLTAPPAEPAARPEASAHE  278

Query  786   -IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
              +  S +   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+ QGFCFGF
Sbjct  279   NVPNSSHVDVEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNK-QGFCFGF  337

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +   +A++ SP+ IGDRQAVVE K
Sbjct  338   VEFETSSGKQSALEASPVTIGDRQAVVEEK  367


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS L+RPD
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSFLTRPD  48



>ref|XP_010483758.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Camelina sativa]
Length=461

 Score =   233 bits (595),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 191/323 (59%), Gaps = 17/323 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDDEPTVIPSPEAPDPEPAHVPDSLNANP-A  1129
             KGYFVLNDVFR++E+ E  + A+ V  NG   +   + +P  P+         + + P A
Sbjct  120   KGYFVLNDVFRFLEEKEVTTQARSVAINGTTRD---VQAPVEPERLNVSHETEVESEPVA  176

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             S + E++ NV      S +DE        ++VD E H+ E  T  S     S  Q DAPK
Sbjct  177   SIEEEDLDNVAEVYDPSDKDEG-------VVVDVE-HI-EPPTQLSHNEVLSVPQGDAPK  227

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASIL   M  GP   +V  N  R      +    A+     A    +    +  S +
Sbjct  228   HSYASIL-KLMKSGPAPTHVARNKPRAAPVNTNQKTTARPAEHVAAPEASALENVQNSSH  286

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                + +GHSIYVRNLPF+ T  +LE VFK +G IK  GIQVRSN+ QGFCFGFVEF   +
Sbjct  287   VDVDDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKVEGIQVRSNK-QGFCFGFVEFETAS  345

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A+  SP+ IGDRQAVVE K
Sbjct  346   GKQSALDASPVTIGDRQAVVEEK  368


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD +G
Sbjct  8     PSPGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDVNG  51



>ref|XP_006845877.1| hypothetical protein AMTR_s00154p00067340 [Amborella trichopoda]
 gb|ERN07552.1| hypothetical protein AMTR_s00154p00067340 [Amborella trichopoda]
Length=449

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 194/330 (59%), Gaps = 14/330 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SLDY    AEIKT DAQ S++GGVIVLVTG LTGKDNL RKFTQ+FFLAPQD
Sbjct  62    QAINDKILSLDYSELKAEIKTVDAQKSFDGGVIVLVTGYLTGKDNLTRKFTQSFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KG+FVLNDVFRYV++ E  +  +   +G+ +     P     +P P      ++   A  
Sbjct  122   KGFFVLNDVFRYVDESEKLEGKSASTDGISETEPDSPLTSELEPAPTVQEHEVSKQAAPV  181

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
                 V N    +  S   E  V +E E+L++  + + +    + +ES  S +Q+D PK S
Sbjct  182   VENGVNNAQGDLEASDNSEGSVVEE-EVLLEKTTDIRQKDVQSKVES-PSQVQEDVPKKS  239

Query  942   YASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN-  769
             YASI+   + NK P  + VPT A   +   + A          +PAP      ++ S   
Sbjct  240   YASIVKVMKENKAPMSVQVPTKALVKEVPLKVAPKNPDCSPVASPAPAPAPKTLESSNGN  299

Query  768   -------AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
                     + EAEG+SIY+  LP + TV+++E  FKK+GPIK GGIQVRSN+  GFCFGF
Sbjct  300   GPESSSPEESEAEGYSIYIGGLPMSATVSKVEEEFKKFGPIKIGGIQVRSNK--GFCFGF  357

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +S+ +A++ SPI IG RQA VE K
Sbjct  358   VEFESHSSVESALKASPITIGGRQAFVEEK  387


 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  1851  PGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P PSAQ+VGNAFV QYY ILH SP  VYRFYQ+SSVL RP+PDG
Sbjct  10    PVPSAQVVGNAFVAQYYHILHQSPSLVYRFYQDSSVLGRPEPDG  53



>ref|XP_009130140.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Brassica rapa]
Length=450

 Score =   231 bits (590),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 188/324 (58%), Gaps = 27/324 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL YE+Y AEI+TADAQ SY  GVIVLVTG LTG DN++++F+QTFFLAPQD
Sbjct  57    QAINEKIMSLKYEDYTAEIETADAQESYERGVIVLVTGGLTGSDNVRKRFSQTFFLAPQD  116

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDD--EP-TVIPSPEAPDPEPAHVPDSLNANPA  1129
             KGYFVLNDVFR++E+ +  ++      V    EP  V+ S EA           +   P 
Sbjct  117   KGYFVLNDVFRFLEEKDVAAHNGTTRDVQAPVEPERVVVSHEA----------EVEPEPV  166

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +S  E++ NV  ++++  E ++ V      +VD E      Q S S     S  Q D PK
Sbjct  167   ASIEEDLDNVA-EVYDPCEKDEGV------VVDAEPIQPPPQLSHS--EVPSVPQGDPPK  217

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-IDESK  772
              SYASIL   MN  P    V    +R K      S   +       A  A     +  S 
Sbjct  218   HSYASIL-KLMNSSPAPARV---VARNKPRPAPVSTNQRPTATPPAASEASGVENVQNSN  273

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             N   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQ+RSN+QQGFCFGFVEF   
Sbjct  274   NVDVEDDGHSIYVRNLPFDATPTQLEEVFKSFGAIKHEGIQIRSNKQQGFCFGFVEFETS  333

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +   +A++ SP+ IGDRQ V+E K
Sbjct  334   SGKQSALEASPVTIGDRQVVLEEK  357


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  7     PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSMLTRPD  45



>emb|CDY42844.1| BnaAnng06690D [Brassica napus]
Length=445

 Score =   231 bits (588),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/325 (45%), Positives = 190/325 (58%), Gaps = 33/325 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL YE+Y AEI+TADAQ SY  GVIVLVTGCLTG DN++++F+QTFFLAPQD
Sbjct  57    QAINEKIMSLKYEDYTAEIETADAQESYERGVIVLVTGCLTGSDNVRKRFSQTFFLAPQD  116

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDD--EP-TVIPSPEAPDPEPAHVPDSLNANPA  1129
             KGYFVLNDVFR++E+ +  ++      V    EP  V+ S EA           +   P 
Sbjct  117   KGYFVLNDVFRFLEEKDVTAHNGTTRDVQAPVEPERVVVSHEA----------EVEPEPV  166

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +S  E++ NV  ++++  E ++ V      +VD E      Q S S     S  Q DAPK
Sbjct  167   ASIEEDLDNVA-EVYDPCEKDEGV------VVDAEPIQPPPQLSHS--EVPSVPQGDAPK  217

Query  948   MSYASILSSQMNK--GPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
              SYASIL   MN    P ++  P        ++ +A+  A                +  S
Sbjct  218   HSYASIL-KLMNSSPAPARVVKPRPGPVSNNQRPTATPPAASEASGVEN-------VQNS  269

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
              N   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQ+RSN+ QGFCFGFVEF  
Sbjct  270   SNVDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGGIKHEGIQIRSNK-QGFCFGFVEFET  328

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
              +   +A++ SP+ IGDRQ V+E K
Sbjct  329   SSGKQSALEASPVTIGDRQVVLEEK  353


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  7     PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSMLTRPD  45



>gb|AAM62628.1| ras-GTPase-activating protein SH3-domain binding protein-like 
[Arabidopsis thaliana]
Length=459

 Score =   231 bits (588),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 190/330 (58%), Gaps = 32/330 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIV VTG LTG DN+++KF+Q+FFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHERGVIVPVTGRLTGNDNVRKKFSQSFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NGVDD------EPTVIPSPEAPDPEPAHVPDSL  1144
             KGYFVLNDVFR++E+ E  + A+ V  NG         EP  +     P+ EP  V    
Sbjct  120   KGYFVLNDVFRFLEEKEVTAQARSVPINGTTRDVQAPIEPERVVVSHEPEVEPEPV----  175

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
                 AS + E++ NV      S +DE  V D + I   T+   NE           S  Q
Sbjct  176   ----ASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIEPPTQISHNE---------ILSVPQ  222

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-  787
              DAPK SYASIL  QM   P      T+ +R K      +     P  E  A    S   
Sbjct  223   GDAPKHSYASIL-KQMKSSPAPT---THVARNKPRPAPVNQKLTAPPAEPAARPEASAHE  278

Query  786   -IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
              +  S +   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+ QGFCFGF
Sbjct  279   NVPNSSHVDVEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNK-QGFCFGF  337

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +   +A++ SP+ IGDRQAVVE K
Sbjct  338   VEFETSSGKQSALEASPVTIGDRQAVVEEK  367


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS L+RPD
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSFLTRPD  48



>emb|CDY23092.1| BnaC07g30950D [Brassica napus]
Length=471

 Score =   231 bits (588),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 186/323 (58%), Gaps = 24/323 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI SL YE Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQDKG
Sbjct  82    INDKILSLKYEEYTAEIETADAQESHERGVIVLVTGRLTGNDNVRKKFSQTFFLAPQDKG  141

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFR++E+++  + A  +NG        P     +PE   V       P    T 
Sbjct  142   YFVLNDVFRFLEENKVTTQA--INGTTTRDVHTPV----EPERVVVSREAEVEPEPVAT-  194

Query  1113  EVKNVGIKIHESLEDEKQVSD----EKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                   I+  E L+   +V D    ++ ++VD E      Q S S     S  Q DAPK 
Sbjct  195   ------IEEEEDLDSVAEVYDPSDKDEGVVVDAEPIEPPAQISHS--EVPSLPQGDAPKH  246

Query  945   SYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-IDESKN  769
             SYASIL   M  GP      T  +R K    +  +    P      P A +   +  S N
Sbjct  247   SYASIL-KLMKSGPAPT---TQVARSKPRAAAPVVTKPKPAAPPAEPAAAAPENVPNSSN  302

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
                E +GHSIYVRNL F+ T  +LE VFK +G IKH GIQVRSN+QQGFCFGFVEF   +
Sbjct  303   VDVEDDGHSIYVRNLTFDTTPTQLEEVFKSFGAIKHEGIQVRSNKQQGFCFGFVEFETAS  362

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
                +A++ SP+ IGDRQAV+E K
Sbjct  363   GKQSALEASPVTIGDRQAVLEEK  385


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 4/57 (7%)
 Frame = -2

Query  1899  NIYFRMAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             +++  MA Q  +P+    P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  16    SLFITMAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  68



>gb|KHG13523.1| nxt3 [Gossypium arboreum]
Length=486

 Score =   230 bits (587),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 207/313 (66%), Gaps = 9/313 (3%)
 Frame = -2

Query  1503  NFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQ  1324
             N   +   Q IN+K+ SL+Y++Y AEIKTADAQ+S+  GVIV+VTGCLTGKDN++RKFTQ
Sbjct  56    NMTTVTTMQAINEKVLSLNYQDYTAEIKTADAQDSFEKGVIVVVTGCLTGKDNIRRKFTQ  115

Query  1323  TFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSL  1144
             TFFLAPQDKGYFVLND+FRY+E DE   N   VNGV ++ +   S    +PEP++  D  
Sbjct  116   TFFLAPQDKGYFVLNDIFRYIEDDELQ-NTIPVNGVSEQAST--SILTSEPEPSN--DHP  170

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               +P +   +E  N G ++ +   DE++ S  +E +V+ +  +N+N+ S  ++ +T A+ 
Sbjct  171   VEDPLTYPEDEDINNGAEVCDP-SDEEEGSVIEEEVVEPQKVVNQNE-SVVVDDSTPAVL  228

Query  963   DDAPKMSYASILSSQMNKG-PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             +DAPK SYASI+    +   PT + V T  +R+   +Q +++ A+         +  S  
Sbjct  229   EDAPKKSYASIVKVMKSTAPPTLVNVTTRYARVVPAEQRSNVSAKPAPVAPIVAVPNSDN  288

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
               ES N  EEAEGHSIYVRNLP+N T A+LE  FKK+GPIK  GIQVRSN+ QGF FGFV
Sbjct  289   APESSNENEEAEGHSIYVRNLPYNATPAQLEEAFKKFGPIKRNGIQVRSNK-QGFTFGFV  347

Query  606   EFHGLNSMNNAIQ  568
             EF   +S+ +A++
Sbjct  348   EFETPSSVQSALE  360


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MAMQ  +PA    PSAQ+VGNAFVEQYY ILH SP+ V+RFYQ+ S LSRPD
Sbjct  1     MAMQEGSPADTHTPSAQVVGNAFVEQYYHILHQSPNLVHRFYQDLSCLSRPD  52



>ref|XP_008792920.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X2 [Phoenix dactylifera]
Length=482

 Score =   229 bits (584),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 139/328 (42%), Positives = 196/328 (60%), Gaps = 11/328 (3%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q IN+KI S+ Y  + AEIKT DAQ S +GGV+VLVTG LTGKDN++R FTQ+FFL
Sbjct  59    ITTMQAINEKILSMYYREFGAEIKTVDAQESLDGGVLVLVTGYLTGKDNIRRSFTQSFFL  118

Query  1311  APQDKGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             A QDKGY+VLND+FRYVE+ DE    + +VN  D   T+ P  EAP P+  HV +    +
Sbjct  119   ATQDKGYYVLNDIFRYVEEADEQQGISGLVN--DTGVTLAPQQEAPPPQEQHVIERAVLH  176

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P   +    + V    + S  ++  V +E+  + +    +  N  +   +S ++ +Q++A
Sbjct  177   PGEEEEVNEEAV---YNPSENEDGSVVEEEAPVAEVIDEIPNNSQAVLADSNSATVQEEA  233

Query  954   PKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQS--ASMvaqvpvpeapapiaPSTAID  781
              K SYASI+   M      + +P +A    T   S   +  A           A S+A++
Sbjct  234   LKKSYASIVKV-MKDNVAPLSIPASAPARPTPSNSDQQAAPAFTAAAAPENVAASSSAVE  292

Query  780   ESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                 AQE E +GHS+Y++NLP N T  +L   FK++GPIK GGIQVRS++ QGFCFGFVE
Sbjct  293   TKNTAQESEVDGHSVYIKNLPLNCTPEQLHEEFKRFGPIKPGGIQVRSHK-QGFCFGFVE  351

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++ +AI+ SPIMIG  QA VE K
Sbjct  352   FEVTSAVQSAIEASPIMIGRHQAFVEEK  379


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA +   P   P PSAQ+V NAFV QYY ILH SP+ VYRFY E+S L R +  G
Sbjct  1     MASEQLAPGGSP-PSAQVVANAFVHQYYHILHQSPELVYRFYMENSKLGRSEAQG  54



>emb|CDY47006.1| BnaC02g41910D [Brassica napus]
Length=433

 Score =   228 bits (580),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 176/324 (54%), Gaps = 57/324 (18%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL YE+Y AEI+TADAQ SY  GVIVLVTGCLTG DN+ ++F+QTFFLAPQD
Sbjct  60    QAINEKIMSLKYEDYTAEIETADAQESYERGVIVLVTGCLTGSDNVGKRFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDD--EP-TVIPSPEAP-DPEPAHVPDSLNANP  1132
             KGYFVLNDVFR++E+ +  ++      V    EP  V+ S EA  +PEP   P      P
Sbjct  120   KGYFVLNDVFRFLEEKDVTAHNGTTRDVQAPVEPERVVVSHEAEVEPEPPIQP------P  173

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A     EV++V                                            Q DAP
Sbjct  174   AQLSHSEVRSVP-------------------------------------------QGDAP  190

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             K SYASIL   MN  P    V  N  R     Q ++       P A    +    +  S 
Sbjct  191   KHSYASIL-KLMNSSPALTRVARNKPR---PAQVSTNQRPTATPPAVTEASGVENVPNSS  246

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             N   E  GHSIYVRNLPF+ T  +LE VFK +G IKH GIQ+RSN+QQGFCFGFVEF   
Sbjct  247   NVDVEDAGHSIYVRNLPFDTTPTQLEEVFKSFGAIKHEGIQIRSNKQQGFCFGFVEFETS  306

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +   +A++ SP+ IGDRQ V+E K
Sbjct  307   SGKQSALEASPVTIGDRQVVLEEK  330


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  10    PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  48



>ref|XP_010936467.1| PREDICTED: putative G3BP-like protein [Elaeis guineensis]
Length=512

 Score =   229 bits (585),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 202/333 (61%), Gaps = 27/333 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL++++   +I+T D+Q SY  GV ++VTG LTG DN+ +KF Q+FFLAPQ+
Sbjct  110   QAINDKIMSLNFKDCFTKIETVDSQMSYKNGVFIVVTGSLTGLDNVWQKFAQSFFLAPQE  169

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPD-------S  1147
              G YFVLNDVFR+V E+  A+ N  + NG  ++     +P   +PEPA V +       +
Sbjct  170   NGGYFVLNDVFRFVNEKQPAEINQMLPNGTSND--AAKAPLTAEPEPASVQEHHVVGLAT  227

Query  1146  LNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAI  967
               +   + D EEV N        +EDE        + V+   H +++      E+T S  
Sbjct  228   PQSEGTADDDEEVFNPSENGGSEVEDE--------VAVEPPVHESQSDARPVSETTASMA  279

Query  966   QDDAPKMSYASILS-SQMNKGPTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapia  799
             Q+DAPK SYASI+   + N  P  +YVPT  ++      EK +A+  + VPV     PI 
Sbjct  280   QEDAPKKSYASIVKVMKGNPSPKPVYVPTTKTKPAPASPEKPAAA--STVPVHAPETPIP  337

Query  798   PSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
              S AI E KN+ E  EGHSIY+RNLP N T  ++E  FKK+GPIK GG+QVRS++ + FC
Sbjct  338   NSKAIPE-KNSHE-VEGHSIYIRNLPLNATAEQVEDEFKKFGPIKPGGVQVRSHKIERFC  395

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFVEF  L SM +AI+ SP+MIG RQA VE K
Sbjct  396   FGFVEFESLKSMQDAIEASPVMIGGRQAFVEEK  428



>emb|CAN80261.1| hypothetical protein VITISV_043950 [Vitis vinifera]
Length=1124

 Score =   238 bits (606),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 167/427 (39%), Positives = 233/427 (55%), Gaps = 50/427 (12%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvtt  1699
             MQ  TPA  P  SA  VGNAFV+QYY ILH +P+ +Y+FYQ+SSVLSRPD  G       
Sbjct  1     MQEATPA--PLHSAAFVGNAFVDQYYPILHQNPELLYKFYQDSSVLSRPDSSG-------  51

Query  1698  mdvss*VQAIKLLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYS--GILFTRILNID  1525
                     ++  ++ L+ +          G        + L  +H+   G LF R     
Sbjct  52    --------SMTTVTTLQASAV--------GF------HIVLHKLHHGSFGGLFARGDRPH  89

Query  1524  PTVLQH----LNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLT  1357
                + H    +N   +     INDKI S  Y  Y  EI+TADAQ+SY  GV VLVTG +T
Sbjct  90    DYSIDHDFLLVNEMTVKSLNAINDKIMSFHYGEYKMEIETADAQDSYKEGVTVLVTGSVT  149

Query  1356  GKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA  1180
              KDN+KRKF Q+FFLAPQD GYFVLND+F Y+E+ ++   N   V+G+++  T   +   
Sbjct  150   LKDNVKRKFGQSFFLAPQDNGYFVLNDIFTYIEEKKSLQENFVXVDGINE--TAPTAALT  207

Query  1179  PDPEPAHVPDSLNANPASSDTEEVKNVG--IKIHESLEDEKQVSDEKEILVDTESHLNEN  1006
             PDPE  HVPD L  +PA+   EE +++    ++ +  ++E+    E+E +V+  S  +EN
Sbjct  208   PDPEANHVPDHLVVDPATPSFEEEEDLNNVAEVCDPSDNEEGSVIEEEAVVEPPSISSEN  267

Query  1005  QTSASLESTTSAIQDDAPKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMva  835
             + S  ++S  +A Q+DAPK SYASI+  ++ KG    T ++  +               +
Sbjct  268   EISTVVDSAPAA-QEDAPKKSYASIV--KVMKGSATSTPVFAXSXVRAAPANIDQXLAGS  324

Query  834   qvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGG  655
                     A    S +  ES N  E  EG SIYVR+LP + TV +LE  FKK+GPIK  G
Sbjct  325   AKSAXAPEAXTPTSDSAPESSNINE--EGFSIYVRHLPLSATVPQLEEEFKKFGPIKQDG  382

Query  654   IQVRSNR  634
             IQVRSN+
Sbjct  383   IQVRSNK  389



>ref|XP_004247060.1| PREDICTED: putative G3BP-like protein [Solanum lycopersicum]
Length=474

 Score =   228 bits (580),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 185/323 (57%), Gaps = 13/323 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ D+Q S+NGGV VLVTG LTGKDNL R F+QTFFLAPQD
Sbjct  58    QAINDKILSLNYADFRAEIKSVDSQESFNGGVHVLVTGYLTGKDNLIRNFSQTFFLAPQD  117

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      +A  V   D    V P     DP PA   H+ D    +  
Sbjct  118   RGYFVLNDMFRYVEIAN-QQDAVQVPETDVLAPVTPEQIVVDPSPAQENHISDQSTPSAE  176

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
              ++  EV N           +     +    V     ++E Q  +++ + T+ I ++ PK
Sbjct  177   EANGGEVYN---------PPQNDNVPDMVEEVPVAEVVDEVQGDSTMVAETNIIIEEVPK  227

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASI+        T    P  A R    K    +   +    A +P   S  +D   N
Sbjct  228   KSYASIVMHLKESAATFSPPPAPAPRKIVPKNVEHVRQLLAPAPADSPALSSDFVDNVNN  287

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              + EA+GHSIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQQGFCFGFVEF    
Sbjct  288   QEGEADGHSIYIKGLPMSATTAMLEDEFKKFGPIKNGGIQVRSNRQQGFCFGFVEFEVET  347

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             ++  AI+ SPI+IG RQA VE K
Sbjct  348   AVQKAIEASPILIGGRQAAVEEK  370


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  1860  ATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             A  P  SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  3     AAQPPVSAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  49



>ref|XP_009130141.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Brassica rapa]
Length=449

 Score =   225 bits (573),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 187/324 (58%), Gaps = 28/324 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL YE+Y AEI+TADAQ SY  GVIVLVTG LTG DN++++F+QTFFLAPQD
Sbjct  57    QAINEKIMSLKYEDYTAEIETADAQESYERGVIVLVTGGLTGSDNVRKRFSQTFFLAPQD  116

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDD--EP-TVIPSPEAPDPEPAHVPDSLNANPA  1129
             KGYFVLNDVFR++E+ +  ++      V    EP  V+ S EA           +   P 
Sbjct  117   KGYFVLNDVFRFLEEKDVAAHNGTTRDVQAPVEPERVVVSHEA----------EVEPEPV  166

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +S  E++ NV  ++++  E ++ V      +VD E      Q S S     S  Q D PK
Sbjct  167   ASIEEDLDNVA-EVYDPCEKDEGV------VVDAEPIQPPPQLSHS--EVPSVPQGDPPK  217

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA-IDESK  772
              SYASIL   MN  P    V    +R K      S   +       A  A     +  S 
Sbjct  218   HSYASIL-KLMNSSPAPARV---VARNKPRPAPVSTNQRPTATPPAASEASGVENVQNSN  273

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
             N   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQ+RSN+ QGFCFGFVEF   
Sbjct  274   NVDVEDDGHSIYVRNLPFDATPTQLEEVFKSFGAIKHEGIQIRSNK-QGFCFGFVEFETS  332

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
             +   +A++ SP+ IGDRQ V+E K
Sbjct  333   SGKQSALEASPVTIGDRQVVLEEK  356


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  7     PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSMLTRPD  45



>gb|KDO65714.1| hypothetical protein CISIN_1g012356mg [Citrus sinensis]
Length=402

 Score =   223 bits (569),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 199/313 (64%), Gaps = 20/313 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IND+I SL+YE+Y AEIKTADAQ+SY  GVIVLVTGCLTGKDN+K+KFTQTFFLAPQD
Sbjct  60    KAINDRILSLNYEDYTAEIKTADAQDSYEKGVIVLVTGCLTGKDNVKKKFTQTFFLAPQD  119

Query  1299  K-GYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             K GYFVLNDVFR+VE++E+ ++N+  V  V++        EA  PEPAH  D + A+ A 
Sbjct  120   KGGYFVLNDVFRFVEENESLENNSDSV--VNETAPTANVTEA--PEPAHDQDHIPADRAI  175

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP-K  949
                 E  + G ++ +  + E+    E EI V+  S+  +N+  AS++S   A Q DAP K
Sbjct  176   VIEGEDLDNGPEVCDPSDKEEGSVVEDEI-VEPPSNSVQNEVHASVDSAPVA-QGDAPEK  233

Query  948   MSYASILSSQMNKG---PTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTA  787
              SYASI+  ++ KG    +  YVP   +R      ++QS +M    P P   A    S  
Sbjct  234   KSYASIV--KVMKGYNISSAAYVPARKARPTPPNADQQSPAM--AKPAPVPEASALSSDG  289

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
               E+ N  EEAEG SIYVRNL F  T  ELE  FK +GPIK  G+QVRSN+ QG+CFGFV
Sbjct  290   APENSNVNEEAEGCSIYVRNLAFTTTSTELEEAFKIFGPIKKNGVQVRSNK-QGYCFGFV  348

Query  606   EFHGLNSMNNAIQ  568
              F    S+ +A++
Sbjct  349   AFETPGSVQSALE  361


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 4/55 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  +PA    PSAQ+VGNAFVEQYY ILH SP  V+RFYQ+SS+LSRPD +G
Sbjct  1     MAVQEGSPA----PSAQVVGNAFVEQYYHILHQSPGLVHRFYQDSSLLSRPDSNG  51



>ref|XP_009799393.1| PREDICTED: putative G3BP-like protein isoform X2 [Nicotiana sylvestris]
Length=478

 Score =   226 bits (575),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 189/327 (58%), Gaps = 21/327 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV VLVTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQESFNGGVHVLVTGYLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLN  1141
             +GYFVLND+FRYVE    QD     A  V   D    V     A DP PA   H+ +   
Sbjct  124   RGYFVLNDMFRYVEIVNQQD-----AVQVPETDVLAPVTTEQIAADPPPAQENHISEQ--  176

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                 S+   E  N G   +    D   V  E+  + +    ++E Q  + + + ++ I +
Sbjct  177   ----STPFAEEANGGEVYNPPENDNVPVVQEEVPVAEV---VDEVQGDSQMAAESNIIVE  229

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
             D PK SYASI+        T    P  A R    K    M        A +P+  S  +D
Sbjct  230   DVPKKSYASIVMHLKESAATFSPPPAPAPRKIVPKSVGQMSQPPAAALADSPVLSSDFVD  289

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
                N + EA+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQQGFCFGFVEF
Sbjct  290   NVNNQEGEADGYSIYIKGLPMSATAAMLEEEFKKFGPIKNGGIQVRSNRQQGFCFGFVEF  349

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                 ++  AI+ SP++IG RQAVVE K
Sbjct  350   EVEPAVQKAIEASPVLIGGRQAVVEEK  376


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_009111969.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Brassica rapa]
 emb|CDY16827.1| BnaA09g05550D [Brassica napus]
Length=454

 Score =   224 bits (571),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 198/330 (60%), Gaps = 33/330 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEI TADAQ S+  GVIVLVTG LTGKDN+++KF+QTFFLAPQD
Sbjct  60    QAINDKIMSLNYEDYTAEIDTADAQESHERGVIVLVTGRLTGKDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVD----DEP-TVIPSPEAP-DPEPAHVPDSLNA  1138
             KGYFVLNDVFR++E+ +  + A+ V   D     EP +VI S EA  +PEP         
Sbjct  120   KGYFVLNDVFRFLEEKDVSTQARSVTIKDVQAPVEPESVIVSHEAEVEPEPV--------  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
               A+ + E+V+NV  ++++  E ++ V      +VD E      Q   S     S    D
Sbjct  172   --ATIEEEDVENVA-EVYDPCEKDEGV------VVDVEPIDPPAQIIHS--EILSVSNGD  220

Query  957   APKMSYASILS-SQMNKGPTKIYV---PTNASRMKTEKQSASMvaqvpvpeapapiaPST  790
              P  +YASIL   + +  P  +     P  A+ ++T ++ A   A        +    + 
Sbjct  221   PP--TYASILKLMKSSPAPPSLVARNKPRAAAPVRTNQKPAPPPAGHAAAPNDSSGLEN-  277

Query  789   AIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
              +  S N   E +GHSIYVRNLPF+ T  +LE VFK +G +KH GIQVRSN+QQGFCFGF
Sbjct  278   -VQNSSNVDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGDVKHEGIQVRSNKQQGFCFGF  336

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +   +A++ SPI IGDRQ V+E K
Sbjct  337   VEFETSSGKQSALEASPITIGDRQVVLEEK  366


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  10    PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  48



>gb|KCW83734.1| hypothetical protein EUGRSUZ_B00605 [Eucalyptus grandis]
Length=357

 Score =   220 bits (561),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 180/312 (58%), Gaps = 32/312 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y++Y  EIKTADAQ S+  GVIVLVTGCLTG+DN KRKFTQTFFLAPQD
Sbjct  62    QAINEKILSLNYKDYTVEIKTADAQESHANGVIVLVTGCLTGRDNAKRKFTQTFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPE-----APDPEPAHVPDSLNAN  1135
             KGYFVLNDVFRYV + E  +N    N     P V  +PE     APD     V       
Sbjct  122   KGYFVLNDVFRYVGETELLANGTTENA----PAVALTPELGTINAPD----QVAAEPEIA  173

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
                 D + V  V     +  ++E  V +E+ I         E+    + EST +A +DD 
Sbjct  174   IEEEDLDNVAEVC----DPSDNEGSVIEEETI---------ESPVHKAAESTPAA-EDDT  219

Query  954   PKMSYASILSS-QMNKGPTKIYVPTN--ASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             PK +YA+IL + Q N     ++VP +  A    +  Q  ++ A             S   
Sbjct  220   PK-TYAAILKAIQSNAASRSVHVPPSRAAVGATSNVQQLTVSAPAKPSAPVTSAPVSDNA  278

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
              ES N  EE EGHSIY+RNLP+N TV  LE  F+K+G IK  GIQVRS + QG CFGFVE
Sbjct  279   PESSNHNEEVEGHSIYIRNLPYNATVELLEEEFRKFGSIKPNGIQVRSAK-QGSCFGFVE  337

Query  603   FHGLNSMNNAIQ  568
             F  L+SM++A+Q
Sbjct  338   FEALSSMHSALQ  349


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q  TPA    PSA++VGNAFVEQYY ILH SP+ V+RFYQ+SS+LSRPD +G
Sbjct  1     MAIQEPTPAA--PPSAEVVGNAFVEQYYHILHQSPEMVHRFYQDSSLLSRPDANG  53



>gb|ABR16060.1| unknown [Picea sitchensis]
Length=476

 Score =   223 bits (569),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 147/329 (45%), Positives = 195/329 (59%), Gaps = 24/329 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SLDY +Y AEIKT D+Q+SY+ GV+VLVTG L GKD +KR FTQ+FFLAPQDKG
Sbjct  65    INEKIISLDYSDYTAEIKTVDSQDSYSQGVLVLVTGALNGKDGVKRNFTQSFFLAPQDKG  124

Query  1293  YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVI----PSPEAPDPEPAHVPDSLNANPA  1129
             YFVLNDVFRY+ E  + ++    +NG+ ++ + +    P+ E   P+  HV D     P 
Sbjct  125   YFVLNDVFRYLDEPPQPETTNVFINGITEQTSKVPAPEPAAEPAPPQELHVVD----QPV  180

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             S   EE +   I +    E+     +E   L   ES  NE Q +A +       Q++APK
Sbjct  181   SELEEEPQVEEIYVQSDHEEGPVAVEEAPHLQVLESVQNEQQPAAEVPVLA---QEEAPK  237

Query  948   MSYASILSSQMN-KGPTKI-----YVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
              SYASI+  Q   + P +       +P N  R  T    A +   +P   +      ST 
Sbjct  238   KSYASIVKVQAPVQAPVQAPSIPRTIPVNVERQAT----APIQTPIPSESSGPSAPNSTE  293

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
              + S  A  EA+G SIY++NLP N T ++LE  FKK+GPIK  G+QVRSN+QQGFC+GFV
Sbjct  294   NNSSLEA--EADGRSIYIKNLPLNATSSQLEEEFKKFGPIKPDGVQVRSNKQQGFCYGFV  351

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +SM +AI+ SPI IG R A VE K
Sbjct  352   EFESSSSMQSAIEASPITIGGRPAYVEEK  380


 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  +PA    P A +VGNAFV QYY +LH SP  V+RFYQ+SS L RP+P+G
Sbjct  1     MATQQVSPAAA-VPPASVVGNAFVHQYYHVLHQSPQMVFRFYQDSSKLGRPEPNG  54



>emb|CDP03910.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   220 bits (561),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/321 (41%), Positives = 187/321 (58%), Gaps = 29/321 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+YE + AEI++ DAQ S+NGGV VLVTG LTG DN+ R F+Q+FFLAPQD
Sbjct  63    QAINEKILSLNYEQFRAEIRSVDAQESFNGGVQVLVTGYLTGNDNMIRNFSQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             +GYFVLND+FRYVE  ++ D+N  + N V     V P     DP P  V ++  +  ++S
Sbjct  123   RGYFVLNDIFRYVENGNQQDANQGVANEV-----VAPVTPEQDPPPPAVQENHVSEQSTS  177

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
               EE+   G +++   E+ +  + E+E+ V       +++    +ES T    ++ PK S
Sbjct  178   SAEEIS--GGEVYNPPENGEIPNAEEEVPVAEVLDEVQDEMQIVVESNTKI--EEVPKKS  233

Query  942   YASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQ  763
             YASI+   + +       PT A R                       +     +   +  
Sbjct  234   YASIVMD-LKESAVAFSSPTPAPRKSVPN------------------SQDPPPERESDGL  274

Query  762   EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
                +G+SIY++ LP N TV  LE  F+K+GPI++GGIQVRSNRQQGFCFGFVEF   +++
Sbjct  275   VPPDGYSIYIKGLPMNATVTLLENEFRKFGPIRNGGIQVRSNRQQGFCFGFVEFEVPSAV  334

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
               AI+ SPI IG RQA+VE K
Sbjct  335   QKAIEASPIAIGGRQAIVEEK  355


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP+ VYRFYQ+ S L RP  DG
Sbjct  14    SAQVVGNAFVQQYYHILHHSPELVYRFYQDMSKLGRPGDDG  54



>ref|XP_008661434.1| PREDICTED: uncharacterized protein LOC100193813 isoform X1 [Zea 
mays]
Length=546

 Score =   223 bits (569),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 171/464 (37%), Positives = 229/464 (49%), Gaps = 61/464 (13%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmdvss*VQAIKLLS  1657
             Q+VGNAFV QYY ILH SP+ VYRFYQESS L RP   G     T   +         L 
Sbjct  26    QVVGNAFVHQYYNILHQSPELVYRFYQESSRLGRPSGTGDDGMETVTSMDVSSSPTPPLL  85

Query  1656  CLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVLQHLNFFFLMLYQ  1477
               +            G P  N         H +G  F      D   ++       ++ Q
Sbjct  86    LSRGPDL--------GAPGPNS--------HLNGGDFGVACASDCVYVR-----VRLVLQ  124

Query  1476  RINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDK  1297
              INDKI S+  +   AEIK  DAQ S  GGV VLV G LTG++++ R+F Q+FFLAPQ+K
Sbjct  125   AINDKIVSMGIDR--AEIKAVDAQESLCGGVTVLVMGHLTGRNSVSREFVQSFFLAPQEK  182

Query  1296  GYFVLNDVFRYVEQDEADSNAK------------------------MVNG-VDDEPTVIP  1192
             GYFVLND+ RYV ++  D   +                        + NG V  +   +P
Sbjct  183   GYFVLNDILRYVGEEGGDEGGEQQPATEVAADVVAADVEAATPASILANGTVGGDTVTVP  242

Query  1191  SPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLN  1012
                +P PE         A PA +  EEV N  + +     D   + +E  +  +  + + 
Sbjct  243   QDASPQPE------CQVAEPALNPKEEVLNREV-VCNPPNDVNPIVEETPVP-EVINEVP  294

Query  1011  ENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaq  832
              N   A   S+ SA  ++APK SYASI+       P    VP+  +  KTEKQS+   A 
Sbjct  295   NNVGVAPPISSPSAPPEEAPKKSYASIVKVMKEYRPPAPAVPSRPAPPKTEKQSSPAPAL  354

Query  831   vpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGI  652
             V    A  P   S +  +      E + H+IYVR+LP N T  +LE  FK++G IKH GI
Sbjct  355   VADAPAFTPNPQSGSFQDP-----EVDAHAIYVRSLPLNATPQQLEEEFKRFGAIKHDGI  409

Query  651   QVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QVRSN+ QGFC+GFVEF   +++  AI+ SP+ IG+RQ  VE K
Sbjct  410   QVRSNKIQGFCYGFVEFEDASAVQTAIEASPVTIGERQCYVEEK  453



>ref|XP_006352678.1| PREDICTED: putative G3BP-like protein-like isoform X1 [Solanum 
tuberosum]
Length=477

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 184/331 (56%), Gaps = 31/331 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLIRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      +   V  +D    V P     DP      H+P+       
Sbjct  125   RGYFVLNDMFRYVET-AGQHDTVHVPVIDAVAPVTPEQIVADPPTVPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++ ++++   E            
Sbjct  184   EADVGEVYNPSENGDVTIVEEEVPVSEVVDEVQDGSEVVAESDNKTGE------------  231

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T    P  ASR K   +S   V Q        P + S
Sbjct  232   -----VPKKSYASIVMHLKESAATFSPPPAPASR-KPMTKSVVQVNQPAATATDGPYSSS  285

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
               ID   N  E A+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFG
Sbjct  286   DTIDNINNT-EAADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCFG  344

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IGDRQAVVE K
Sbjct  345   FVEFEVESAVQKAIEASPVLIGDRQAVVEEK  375


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_006352679.1| PREDICTED: putative G3BP-like protein-like isoform X2 [Solanum 
tuberosum]
Length=476

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 184/331 (56%), Gaps = 32/331 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLIRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      +   V  +D    V P     DP      H+P+       
Sbjct  125   RGYFVLNDMFRYVET-AGQHDTVHVPVIDAVAPVTPEQIVADPPTVPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++ ++++   E            
Sbjct  184   EADVGEVYNPSENGDVTIVEEEVPVSEVVDEVQDGSEVVAESDNKTGE------------  231

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T    P  ASR K   +S   V Q        P + S
Sbjct  232   -----VPKKSYASIVMHLKESAATFSPPPAPASR-KPMTKSVVQVNQPAATATDGPYSSS  285

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
               ID   N   EA+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFG
Sbjct  286   DTIDNINNT--EADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCFG  343

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IGDRQAVVE K
Sbjct  344   FVEFEVESAVQKAIEASPVLIGDRQAVVEEK  374


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_009799392.1| PREDICTED: putative G3BP-like protein isoform X1 [Nicotiana sylvestris]
Length=479

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 189/328 (58%), Gaps = 22/328 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV VLVTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQESFNGGVHVLVTGYLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLN  1141
             +GYFVLND+FRYVE    QD     A  V   D    V     A DP PA   H+ +   
Sbjct  124   RGYFVLNDMFRYVEIVNQQD-----AVQVPETDVLAPVTTEQIAADPPPAQENHISEQ--  176

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                 S+   E  N G   +    D   V  E+  + +    ++E Q  + + + ++ I +
Sbjct  177   ----STPFAEEANGGEVYNPPENDNVPVVQEEVPVAEV---VDEVQGDSQMAAESNIIVE  229

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
             D PK SYASI+        T    P  A R    K    M        A +P+  S  +D
Sbjct  230   DVPKKSYASIVMHLKESAATFSPPPAPAPRKIVPKSVGQMSQPPAAALADSPVLSSDFVD  289

Query  780   ESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                N + E A+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQQGFCFGFVE
Sbjct  290   NVNNQEGEAADGYSIYIKGLPMSATAAMLEEEFKKFGPIKNGGIQVRSNRQQGFCFGFVE  349

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F    ++  AI+ SP++IG RQAVVE K
Sbjct  350   FEVEPAVQKAIEASPVLIGGRQAVVEEK  377


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_007049693.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 2, partial [Theobroma cacao]
 gb|EOX93850.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 2, partial [Theobroma cacao]
Length=420

 Score =   219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 192/329 (58%), Gaps = 36/329 (11%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL Y  + AEI T DAQ+S+NGGV+V VTG LTGKD +KRKFTQ+FFLAPQD
Sbjct  65    QAINEKILSLGYGEFTAEITTVDAQDSHNGGVLVHVTGYLTGKDKVKRKFTQSFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPE-----APDPEPAHVPDSLNAN  1135
             KGYFVLNDVFRYV  D+A+  +   + VDD P+ +P        A  PE A+ P+    N
Sbjct  125   KGYFVLNDVFRYV--DDAEHQSGSQDRVDDNPSPVPENHIVLQPAASPEEANGPEVY--N  180

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P+ +    ++     + E ++   ++ D+ +++ D  S + E                  
Sbjct  181   PSENGDGSIEEDEAPVAEVVD---EMPDDSQMVADYNSKIEE-----------------V  220

Query  954   PKMSYASILSSQMNKGPTKIYVPTNA---SRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             PK SYASI+   M +    +  PT++   S +K+ +Q  +         A      S  +
Sbjct  221   PKKSYASIVKV-MKENAVSLSAPTHSPVKSAVKSHEQLGTAAPPTAPAPASDAQISSNIV  279

Query  783   DESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
              E+ N Q+ EAEG SIYV+ LP N T + LE  FKK+GPIK GGIQVRS  Q+GFCFGFV
Sbjct  280   AENGNNQDAEAEGPSIYVKGLPLNATPSMLENEFKKFGPIKSGGIQVRS--QKGFCFGFV  337

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++  AI+ SPI I  R+AVVE K
Sbjct  338   EFEVASAVQGAIEASPISIDGRKAVVEEK  366


 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PA +  P+A +VGNAFV QYYLILH SP  V+RFY +SS L RP+ +G
Sbjct  9     PAGITAPTADVVGNAFVHQYYLILHQSPALVHRFYHDSSKLGRPEENG  56



>gb|EMT20814.1| Ras GTPase-activating protein-binding protein 1 [Aegilops tauschii]
Length=576

 Score =   223 bits (568),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 171/473 (36%), Positives = 236/473 (50%), Gaps = 94/473 (20%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmdvss*VQAIKLLS  1657
             Q+VGNAFV+QYY ILH SP+ V+RFYQE+S + RP   G+               +  ++
Sbjct  23    QVVGNAFVQQYYNILHQSPELVFRFYQEASRIGRPATTGAD--------------MDTVT  68

Query  1656  CLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVLQHLNFFFLMLYQ  1477
              ++             +P    P   L     SG L    L    T    LN FFL   Q
Sbjct  69    TME-------------VPLTPRP---LFPRFRSGHLGA--LECWETFSGVLNGFFL---Q  107

Query  1476  RINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDK  1297
              IN+KI S+D     AEI+  DAQ S  GGV VLVTG LTGKD++ R+F Q+FFLAPQ+K
Sbjct  108   AINEKIMSMDIAR--AEIRGVDAQESLCGGVTVLVTGHLTGKDDVCREFAQSFFLAPQEK  165

Query  1296  GYFVLNDVFRYVEQDEADSNAKMVNGVDDEP---------------TVIPSPEAP---DP  1171
             GYFVLND+ RYV Q EAD +          P               TV P    P   + 
Sbjct  166   GYFVLNDILRYVGQGEADPSLPPPQQQQPAPELDAVVAPAAALANGTVAPVESVPREQEA  225

Query  1170  EPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNE------  1009
              P   PD   + P +++ E+ K          E+     ++ E+ V  E+ + E      
Sbjct  226   SPQPEPDLSESVPHTNEEEDPK----------EEVYNPPNDTEVPVVEETPVPEVIDEVP  275

Query  1008  NQTSASLESTTSAI-QDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaq  832
             N  +AS+  +   +  ++APK SYASI+       P    VP   +  K EKQ+ +    
Sbjct  276   NNVAASIPVSAPPVPHEEAPKKSYASIVKVMKAVLPPNSAVPYRPAPPKPEKQAPA----  331

Query  831   vpvpeapapiaPSTAID--------ESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKK  679
                       APS A+D        ES N Q+ E +  ++YV+NLP + T ++LE  FK+
Sbjct  332   ---------PAPSVAVDAPTFSPNPESSNIQDPEVDALAVYVKNLPLHATPSQLEEEFKR  382

Query  678   YGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             +G IKH GIQVRS++ QGFC+GF+EF   +S+ +A+  SP+ I DR   VE K
Sbjct  383   FGTIKHDGIQVRSHKIQGFCYGFIEFEDASSVQSALAASPVTIDDRPCHVEEK  435



>ref|XP_010649833.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 ref|XP_010649841.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 ref|XP_010649845.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 ref|XP_010649853.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 ref|XP_010649856.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 ref|XP_010649860.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Vitis vinifera]
 emb|CBI27297.3| unnamed protein product [Vitis vinifera]
Length=484

 Score =   221 bits (562),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 152/364 (42%), Positives = 202/364 (55%), Gaps = 62/364 (17%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IND I S DY+ + AEI TADAQ SY  GV+VLVTGCLTGKDN++RKFTQ+FFLAPQD G
Sbjct  64    INDMILSFDYKGHKAEILTADAQFSYKDGVVVLVTGCLTGKDNVRRKFTQSFFLAPQDNG  123

Query  1293  YFVLNDVFRYVEQDEADSNAKM-VNGVDDEPTVIPSPEAPDPEPAHV---PDSLNANPA-  1129
             YFVLNDVFRY+++ E+     + VN V++   V  +P  P+PE  HV   P S N +P  
Sbjct  124   YFVLNDVFRYMDERESLMVETIAVNDVNENSPV--APLTPEPESTHVLDHPKSNNTSPVE  181

Query  1128  --SSDTEEV----KNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAI  967
               ++D EEV    +N G+ + E    EK V    EI VD    ++        E+ ++ I
Sbjct  182   EDAADDEEVCDLTENEGVPVSE----EKVVC---EIPVDPSKDVHPVS-----ETVSAVI  229

Query  966   QDDAPKMSYASILSSQMNKGPT-KIYVP------------------------TNASRMKT  862
              +DAPK SYASI+     +  T  ++VP                        + A R + 
Sbjct  230   NEDAPKKSYASIVKVMKGEMATSSVHVPPGAVRAAKSNAKVSPANIERHVSTSAAPRAQV  289

Query  861   EKQSASMvaqvpvpeapapiaPSTAID----------ESKNAQEEAEGHSIYVRNLPFNI  712
                +++           AP + ST  +          ES     E  GHSIY+ NLP N 
Sbjct  290   HSSNSAPSGNSAPSGNNAPSSNSTPTNNGAPRSNISPESGQDHPEVGGHSIYIGNLPLNA  349

Query  711   TVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAV  532
             TV ++E VFKK+GPI  GGIQ+RS   +G+ FGFVEF  L+SM++AI+ SPI IG  QA 
Sbjct  350   TVQQVEGVFKKFGPIISGGIQIRS--YKGYGFGFVEFESLDSMHSAIKASPITIGGHQAT  407

Query  531   VEIK  520
             +E K
Sbjct  408   IEQK  411


 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MAMQT    + PGPSA++VGN FVEQYYL+L+ SP+ VYRFY +SSVLSRP PDG
Sbjct  1     MAMQTED--SSPGPSAEVVGNVFVEQYYLVLYQSPELVYRFYHDSSVLSRPGPDG  53



>ref|XP_009775381.1| PREDICTED: putative G3BP-like protein isoform X1 [Nicotiana sylvestris]
Length=470

 Score =   220 bits (560),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 143/332 (43%), Positives = 188/332 (57%), Gaps = 32/332 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  61    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  121   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDVEAPVTPQQIVADPPPVQENHIPEQSTPPVE  179

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  180   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  227

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T  + P  A   K   +    V Q        P++ S
Sbjct  228   -----VPKKSYASIVMHLKESAAT--FSPPPAPSRKPMAKRVEQVNQPAATATDGPVSSS  280

Query  792   TAIDESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
              ++D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCF
Sbjct  281   DSVDNMNDPEGEAADGYSVYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCF  340

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   +++  AI+ SP++IG RQAVVE K
Sbjct  341   GFVEFEVESAVQKAIEASPVLIGGRQAVVEEK  372


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    VVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  52



>ref|XP_009390807.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=440

 Score =   219 bits (557),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 199/332 (60%), Gaps = 16/332 (5%)
 Frame = -2

Query  1509  HLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKF  1330
             H     +   + IN+KI S+ +     E K+ DAQ S  GGVIVLVTG LTG+D +KR F
Sbjct  53    HGAMSLITTTEAINEKILSIGF--VRVETKSVDAQESLGGGVIVLVTGFLTGEDTVKRDF  110

Query  1329  TQTFFLAPQDKGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVP  1153
             TQ+FFLAPQDKGY+VLND+FR+VE+ D    +  +VNG    P V P   +P  +  H  
Sbjct  111   TQSFFLAPQDKGYYVLNDIFRFVEEADNQPEHQGLVNGTS-APHV-PEHGSPTQKEQHAL  168

Query  1152  DSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
             +    +P++ + E V  V +    +  D  +V +E+E + +  +       +A +ES   
Sbjct  169   E--QTSPSAVEDEGVSEVEVY---NPSDNGEVVEEEEPMGEVINEAPNTCQTAVVESRAV  223

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
               Q++ PK SYASI+  ++ KG +  +VP   +R+ ++  S    +Q     A    A S
Sbjct  224   TTQEELPKKSYASIV--KILKGSSSAFVP---ARIPSKPSSIKAESQALPTPAADVPASS  278

Query  792   TAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
                 ES N QE EA+G+SIYV+NLP + T A+LE  FKK+G IK GGIQVRS++ QGFCF
Sbjct  279   FNAAESSNMQEAEADGYSIYVKNLPLDATPAQLEEEFKKFGAIKSGGIQVRSHKLQGFCF  338

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   +++ +AI+ SP++IG RQA VE K
Sbjct  339   GFVEFEAASAVQSAIEASPVIIGGRQAYVEEK  370


 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+Q +     P  SAQ+VGNAFV+QYY ILH SP+ VYRFYQESS L RPD  G
Sbjct  1     MAVQPSVAGRSP-LSAQVVGNAFVQQYYHILHQSPELVYRFYQESSKLGRPDAHG  54



>ref|XP_009799394.1| PREDICTED: putative G3BP-like protein isoform X3 [Nicotiana sylvestris]
Length=476

 Score =   219 bits (559),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 188/328 (57%), Gaps = 25/328 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV VLVTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQESFNGGVHVLVTGYLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLN  1141
             +GYFVLND+FRYVE    QD           V +   + P     +P PA   H+ +   
Sbjct  124   RGYFVLNDMFRYVEIVNQQDAVQ--------VPETDVLAPVTTEQNPPPAQENHISEQ--  173

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                 S+   E  N G   +    D   V  E+  + +    ++E Q  + + + ++ I +
Sbjct  174   ----STPFAEEANGGEVYNPPENDNVPVVQEEVPVAEV---VDEVQGDSQMAAESNIIVE  226

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
             D PK SYASI+        T    P  A R    K    M        A +P+  S  +D
Sbjct  227   DVPKKSYASIVMHLKESAATFSPPPAPAPRKIVPKSVGQMSQPPAAALADSPVLSSDFVD  286

Query  780   ESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                N + E A+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQQGFCFGFVE
Sbjct  287   NVNNQEGEAADGYSIYIKGLPMSATAAMLEEEFKKFGPIKNGGIQVRSNRQQGFCFGFVE  346

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F    ++  AI+ SP++IG RQAVVE K
Sbjct  347   FEVEPAVQKAIEASPVLIGGRQAVVEEK  374


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_009775385.1| PREDICTED: putative G3BP-like protein isoform X4 [Nicotiana sylvestris]
Length=467

 Score =   219 bits (558),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 187/329 (57%), Gaps = 29/329 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  61    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRYVE + +  +A  V   D E  V P    P  +  H+P+        +D
Sbjct  121   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDVEAPVTPQQNPPPVQENHIPEQSTPPVEEAD  179

Query  1119  TEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               EV N        +  +     E   +V D  E++V++++   E               
Sbjct  180   VGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE---------------  224

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+        T  + P  A   K   +    V Q        P++ S ++
Sbjct  225   --VPKKSYASIVMHLKESAAT--FSPPPAPSRKPMAKRVEQVNQPAATATDGPVSSSDSV  280

Query  783   DESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFGFV
Sbjct  281   DNMNDPEGEAADGYSVYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCFGFV  340

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++  AI+ SP++IG RQAVVE K
Sbjct  341   EFEVESAVQKAIEASPVLIGGRQAVVEEK  369


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    VVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  52



>ref|XP_007049692.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 1 [Theobroma cacao]
 gb|EOX93849.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 1 [Theobroma cacao]
Length=476

 Score =   219 bits (557),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 190/325 (58%), Gaps = 19/325 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL Y  + AEI T DAQ+S+NGGV+V VTG LTGKD +KRKFTQ+FFLAPQD
Sbjct  65    QAINEKILSLGYGEFTAEITTVDAQDSHNGGVLVHVTGYLTGKDKVKRKFTQSFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA-HVPDSLNANPASS  1123
             KGYFVLNDVFRYV  D+A+  +   + VDD        + P P P  H+     A+P  +
Sbjct  125   KGYFVLNDVFRYV--DDAEHQSGSQDRVDDSKASFTPEQDPSPVPENHIVLQPAASPEEA  182

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
             +  EV N       S+E+     DE  +    +   +++Q  A   S      ++ PK S
Sbjct  183   NGPEVYNPSENGDGSIEE-----DEAPVAEVVDEMPDDSQMVADYNSKI----EEVPKKS  233

Query  942   YASILSSQMNKGPTKIYVPTNA---SRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             YASI+   M +    +  PT++   S +K+ +Q  +         A      S  + E+ 
Sbjct  234   YASIVKV-MKENAVSLSAPTHSPVKSAVKSHEQLGTAAPPTAPAPASDAQISSNIVAENG  292

Query  771   NAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             N Q+ EAEG SIYV+ LP N T + LE  FKK+GPIK GGIQVRS  Q+GFCFGFVEF  
Sbjct  293   NNQDAEAEGPSIYVKGLPLNATPSMLENEFKKFGPIKSGGIQVRS--QKGFCFGFVEFEV  350

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
              +++  AI+ SPI I  R+AVVE K
Sbjct  351   ASAVQGAIEASPISIDGRKAVVEEK  375


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PA +  P+A +VGNAFV QYYLILH SP  V+RFY +SS L RP+ +G
Sbjct  9     PAGITAPTADVVGNAFVHQYYLILHQSPALVHRFYHDSSKLGRPEENG  56



>gb|KHG08250.1| Putative G3BP-like protein [Gossypium arboreum]
Length=469

 Score =   218 bits (556),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 148/337 (44%), Positives = 189/337 (56%), Gaps = 44/337 (13%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL Y  + AEI T DAQ+S+NGGV+VLVTG LTGKD +KRKFTQ+FFLAPQD
Sbjct  65    QAINEKILSLGYGEFTAEITTVDAQDSHNGGVLVLVTGYLTGKDKVKRKFTQSFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAK-MVNGVD----DEPTVIPSPEAPDPEPAHVPDSLNA-  1138
             KGYFVLNDVFR+V+  +     +  VNG +     E    P PE    +PA +P+  N  
Sbjct  125   KGYFVLNDVFRFVDDTKHQPGGQDPVNGFEASLTPEQGHSPVPENHIEQPAALPEECNGP  184

Query  1137  ---NPA----SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLEST  979
                NP+     S  EE   V   + E  +D K VSD K  +                   
Sbjct  185   EVYNPSENGDGSIEEEESPVAEVVDEIPDDSKMVSDSKPEM-------------------  225

Query  978   TSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNA---SRMKTEKQSASMvaqvpvpeapa  808
                  ++ PK SYASIL   + +    +  PT +   S +K+++             A  
Sbjct  226   -----EELPKKSYASILKV-LKENAVPVSAPTQSPVKSAVKSQEHPRIAAPPSAPMPASD  279

Query  807   piaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                 S  + E+ N Q+ EAEG SIYV+ LP N T + LE  FKK+GPIK GGIQVRS  Q
Sbjct  280   AQVSSNNVTENGNNQDAEAEGPSIYVKGLPLNATPSMLEIEFKKFGPIKSGGIQVRS--Q  337

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             +GFCFGFVEF   +S+ +AI+ SPI IG R+AVVE K
Sbjct  338   KGFCFGFVEFEMASSVQSAIEASPINIGGRKAVVEEK  374


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  1881  AMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +++   PA +  P++ +VGNAFV QYYLILH SP+ V+RFY +SS L RP+ +G
Sbjct  3     SVEQQVPAGIATPTSDVVGNAFVHQYYLILHQSPELVHRFYHDSSKLGRPEENG  56



>ref|XP_009111970.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Brassica rapa]
Length=453

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 197/330 (60%), Gaps = 34/330 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+YE+Y AEI TADAQ S+  GVIVLVTG LTGKDN+++KF+QTFFLAPQD
Sbjct  60    QAINDKIMSLNYEDYTAEIDTADAQESHERGVIVLVTGRLTGKDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVD----DEP-TVIPSPEAP-DPEPAHVPDSLNA  1138
             KGYFVLNDVFR++E+ +  + A+ V   D     EP +VI S EA  +PEP         
Sbjct  120   KGYFVLNDVFRFLEEKDVSTQARSVTIKDVQAPVEPESVIVSHEAEVEPEPV--------  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
               A+ + E+V+NV  ++++  E ++ V      +VD E      Q   S     S    D
Sbjct  172   --ATIEEEDVENVA-EVYDPCEKDEGV------VVDVEPIDPPAQIIHS--EILSVSNGD  220

Query  957   APKMSYASILS-SQMNKGPTKIYV---PTNASRMKTEKQSASMvaqvpvpeapapiaPST  790
              P  +YASIL   + +  P  +     P  A+ ++T ++ A   A        +    + 
Sbjct  221   PP--TYASILKLMKSSPAPPSLVARNKPRAAAPVRTNQKPAPPPAGHAAAPNDSSGLEN-  277

Query  789   AIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGF  610
              +  S N   E +GHSIYVRNLPF+ T  +LE VFK +G +KH GIQVRSN+ QGFCFGF
Sbjct  278   -VQNSSNVDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGDVKHEGIQVRSNK-QGFCFGF  335

Query  609   VEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VEF   +   +A++ SPI IGDRQ V+E K
Sbjct  336   VEFETSSGKQSALEASPITIGDRQVVLEEK  365


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             P A++VG AFVEQYY ILH SP  V+RFYQ+SS+L+RPD
Sbjct  10    PGAEVVGRAFVEQYYHILHQSPGLVHRFYQDSSLLTRPD  48



>gb|KCW48428.1| hypothetical protein EUGRSUZ_K02132 [Eucalyptus grandis]
Length=463

 Score =   217 bits (553),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 184/320 (58%), Gaps = 16/320 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I++KI+SLDY  + AEI T DAQ+SY GGV VLVTG LTG+D  KRKFTQ+FFLAPQDKG
Sbjct  65    IDEKIQSLDYRGFTAEIITVDAQDSYKGGVTVLVTGYLTGRDQTKRKFTQSFFLAPQDKG  124

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             YFVLND+FRYVE+      N   VNG++   T+    E+  P   ++P  + A+      
Sbjct  125   YFVLNDIFRYVEEPSHQQPNHGSVNGMEAPQTI--EQESTPPLENNIPHQVAADSEEVGQ  182

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             EEV N       S   +  V +E+  + +    +NE    +   + + A  +D PK SYA
Sbjct  183   EEVYN------PSENGDGSVVEEEAPVPEV---VNETPADSHTVAESHAKNEDVPKKSYA  233

Query  936   SILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE-  760
              IL   M +G   +   +   +   + Q   M A  P          S    E+ N QE 
Sbjct  234   YILGV-MKEGAVNVPSSSPLPKPVPKSQEPQMTAPPPPAPILETQVSSLKATENGNVQEV  292

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E++GHSIY++ LP N +  ++E  FKK+G IK GG+Q+RS  Q+GFCFGFVEF   +S  
Sbjct  293   ESDGHSIYLKGLPMNASYPQIENEFKKFGAIKAGGVQIRS--QKGFCFGFVEFEESSSAQ  350

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AI+ SPI IG RQ V+E K
Sbjct  351   SAIEASPITIGGRQVVIEPK  370


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +VGNAFV QYY ILH SP+ V+RFYQ+SS L RP+ +G
Sbjct  17    VVGNAFVHQYYHILHQSPEHVHRFYQDSSKLGRPEENG  54



>ref|XP_010036786.1| PREDICTED: ras GTPase-activating protein-binding protein 1 [Eucalyptus 
grandis]
 gb|KCW48429.1| hypothetical protein EUGRSUZ_K02132 [Eucalyptus grandis]
Length=470

 Score =   216 bits (550),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/320 (43%), Positives = 184/320 (58%), Gaps = 16/320 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I++KI+SLDY  + AEI T DAQ+SY GGV VLVTG LTG+D  KRKFTQ+FFLAPQDKG
Sbjct  65    IDEKIQSLDYRGFTAEIITVDAQDSYKGGVTVLVTGYLTGRDQTKRKFTQSFFLAPQDKG  124

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             YFVLND+FRYVE+      N   VNG++   T+    E+  P   ++P  + A+      
Sbjct  125   YFVLNDIFRYVEEPSHQQPNHGSVNGMEAPQTI--EQESTPPLENNIPHQVAADSEEVGQ  182

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             EEV N       S   +  V +E+  + +    +NE    +   + + A  +D PK SYA
Sbjct  183   EEVYN------PSENGDGSVVEEEAPVPEV---VNETPADSHTVAESHAKNEDVPKKSYA  233

Query  936   SILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE-  760
              IL   M +G   +   +   +   + Q   M A  P          S    E+ N QE 
Sbjct  234   YILGV-MKEGAVNVPSSSPLPKPVPKSQEPQMTAPPPPAPILETQVSSLKATENGNVQEV  292

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             E++GHSIY++ LP N +  ++E  FKK+G IK GG+Q+RS  Q+GFCFGFVEF   +S  
Sbjct  293   ESDGHSIYLKGLPMNASYPQIENEFKKFGAIKAGGVQIRS--QKGFCFGFVEFEESSSAQ  350

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +AI+ SPI IG RQ V+E K
Sbjct  351   SAIEASPITIGGRQVVIEPK  370


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +VGNAFV QYY ILH SP+ V+RFYQ+SS L RP+ +G
Sbjct  17    VVGNAFVHQYYHILHQSPEHVHRFYQDSSKLGRPEENG  54



>ref|XP_009775384.1| PREDICTED: putative G3BP-like protein isoform X3 [Nicotiana sylvestris]
Length=467

 Score =   215 bits (548),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 186/331 (56%), Gaps = 33/331 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  61    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  121   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDVEAPVTPQQIVADPPPVQENHIPEQSTPPVE  179

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  180   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  227

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T  + P  A   K   +    V Q        P++ S
Sbjct  228   -----VPKKSYASIVMHLKESAAT--FSPPPAPSRKPMAKRVEQVNQPAATATDGPVSSS  280

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
              ++D   + + EA+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFG
Sbjct  281   DSVDNMNDPEGEADGYSVYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCFG  338

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IG RQAVVE K
Sbjct  339   FVEFEVESAVQKAIEASPVLIGGRQAVVEEK  369


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    VVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  52



>ref|XP_009614846.1| PREDICTED: putative G3BP-like protein isoform X2 [Nicotiana tomentosiformis]
Length=473

 Score =   215 bits (548),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 187/331 (56%), Gaps = 30/331 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQIVADPPPVQENHIPEQSTPPAE  181

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  182   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  229

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+   + +       P   +  K   +    V Q        P++ S
Sbjct  230   -----VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
              ++D   + + EA+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFG
Sbjct  284   DSVDNINDPEGEADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNRQQGFCFG  343

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IG  QAVVE K
Sbjct  344   FVEFEVESAVQKAIEASPVLIGGWQAVVEEK  374


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_004505359.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X3 [Cicer arietinum]
Length=448

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 192/324 (59%), Gaps = 24/324 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIKSHDYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSLNANP---  1132
             ++VLNDVFRYVE+    D  +   N  D+     PS EA  P+PEP HVP+ +       
Sbjct  122   FYVLNDVFRYVEEYKSVDIESVPSNDADES---APS-EAFTPEPEPNHVPEDIPPRQSVV  177

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A +DT    N+  ++   LE+ K    E  I V+        +  +S E   S  Q+D P
Sbjct  178   ADTDT----NISKEVSLPLENGKLSVTENVIPVNHVKETIHQEQPSSTEKVASNTQEDTP  233

Query  951   KMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K S+ASI+++ + N  P  +          +  + A    +V    AP   AP+T     
Sbjct  234   KKSFASIVNALKDNSKPFHLRT--------SPAKPAVQQPRVISAPAPEAPAPNTDSPLE  285

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN +   + H+I+V NLP N TV +L+ VFKK+GPIK  GIQVRSN+QQG CFGFVEF  
Sbjct  286   KNNENAGKAHAIFVANLPMNATVEQLDRVFKKFGPIKPNGIQVRSNKQQGSCFGFVEFES  345

Query  594   LNSMNNAIQDS-PIMIGDRQAVVE  526
               SM +A++ S P+M+ +R+  +E
Sbjct  346   AASMQSALEASPPVMLDNRRLSIE  369


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH +PDQV+RFY +SSV+SRP+ DG
Sbjct  10    PTPQMVGNAFVEQYYSILHQNPDQVHRFYHDSSVMSRPEEDG  51



>ref|XP_004505357.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X1 [Cicer arietinum]
Length=458

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 192/324 (59%), Gaps = 24/324 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIKSHDYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSLNANP---  1132
             ++VLNDVFRYVE+    D  +   N  D+     PS EA  P+PEP HVP+ +       
Sbjct  122   FYVLNDVFRYVEEYKSVDIESVPSNDADES---APS-EAFTPEPEPNHVPEDIPPRQSVV  177

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A +DT    N+  ++   LE+ K    E  I V+        +  +S E   S  Q+D P
Sbjct  178   ADTDT----NISKEVSLPLENGKLSVTENVIPVNHVKETIHQEQPSSTEKVASNTQEDTP  233

Query  951   KMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K S+ASI+++ + N  P  +          +  + A    +V    AP   AP+T     
Sbjct  234   KKSFASIVNALKDNSKPFHLRT--------SPAKPAVQQPRVISAPAPEAPAPNTDSPLE  285

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN +   + H+I+V NLP N TV +L+ VFKK+GPIK  GIQVRSN+QQG CFGFVEF  
Sbjct  286   KNNENAGKAHAIFVANLPMNATVEQLDRVFKKFGPIKPNGIQVRSNKQQGSCFGFVEFES  345

Query  594   LNSMNNAIQDS-PIMIGDRQAVVE  526
               SM +A++ S P+M+ +R+  +E
Sbjct  346   AASMQSALEASPPVMLDNRRLSIE  369


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH +PDQV+RFY +SSV+SRP+ DG
Sbjct  10    PTPQMVGNAFVEQYYSILHQNPDQVHRFYHDSSVMSRPEEDG  51



>ref|XP_008777906.1| PREDICTED: LOW QUALITY PROTEIN: ras GTPase-activating protein-binding 
protein 1-like [Phoenix dactylifera]
Length=469

 Score =   214 bits (544),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 192/333 (58%), Gaps = 11/333 (3%)
 Frame = -2

Query  1509  HLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKF  1330
             H     +   Q IN+KI S+D+  + AEIKT DAQ+S NGGV+VLVTG +TGKDN++R F
Sbjct  55    HGTMISVTSMQAINEKILSMDF--HGAEIKTVDAQDSLNGGVLVLVTGYVTGKDNVRRDF  112

Query  1329  TQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAK-MVNGVDDEPTVIPSPEAPDPEPAHVP  1153
             TQ+FFLAPQDKG+FVLND+FRYV + E    ++ + NG      + P  ++P  +  HVP
Sbjct  113   TQSFFLAPQDKGFFVLNDIFRYVGEAEHQQGSQGLANGAG--APLSPEQDSPPQQEQHVP  170

Query  1152  DSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
             +     P   +    +      +     E  V +E+  + +       +  +  +++ ++
Sbjct  171   EHNVPPPEEEEEANEEE---VFNPXDNGEGSVVEEEAPVGEVVDEAPNSSQAVVVDAASA  227

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNAS-RMKTEKQSASMvaqvpvpeapapiaP  796
              IQ++APK SYASI+   M         PT+AS R    K             AP   A 
Sbjct  228   TIQEEAPKKSYASIVKV-MKDSAAAFSAPTSASARPAPAKPERQAAPAPMPATAPDTPAV  286

Query  795   STAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFC  619
             S++  E    QE EA+GHSIYV++LP + T  +LE  FK++G IK GGIQVRS++ QGFC
Sbjct  287   SSSAGEGSGVQEAEADGHSIYVKSLPLSATPEQLEEEFKRFGHIKPGGIQVRSHKLQGFC  346

Query  618   FGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FGFVEF   +++ +AI  SPIMIG RQ  VE K
Sbjct  347   FGFVEFEEASAVQSAIAASPIMIGSRQVFVEEK  379


 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             Q+VGNAFV+QYY ILH +P  V+RFYQESS L RP+  G
Sbjct  18    QVVGNAFVQQYYHILHQTPALVHRFYQESSKLGRPEDHG  56



>ref|XP_008792921.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X3 [Phoenix dactylifera]
Length=450

 Score =   213 bits (542),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/326 (41%), Positives = 184/326 (56%), Gaps = 39/326 (12%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +   Q IN+KI S+ Y  + AEIKT DAQ S +GGV+VLVTG LTGKDN++R FTQ+FFL
Sbjct  59    ITTMQAINEKILSMYYREFGAEIKTVDAQESLDGGVLVLVTGYLTGKDNIRRSFTQSFFL  118

Query  1311  APQDKGYFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             A QDKGY+VLND+FRYVE+ DE    + +VN  D   T+ P  EAP P+  HV +    +
Sbjct  119   ATQDKGYYVLNDIFRYVEEADEQQGISGLVN--DTGVTLAPQQEAPPPQEQHVIERAVLH  176

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P   +    + V    +   E+E     E+E  V     + +N    S+ ++  A     
Sbjct  177   PGEEEEVNEEAV----YNPSENEDGSVVEEEAPVAEVKVMKDNVAPLSIPASAPAR----  228

Query  954   PKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
                             PT    P+N+ +      +A+   +            S+A++  
Sbjct  229   ----------------PT----PSNSDQQAAPAFTAAAAPENVAAS-------SSAVETK  261

Query  774   KNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
               AQE E +GHS+Y++NLP N T  +L   FK++GPIK GGIQVRS++QQGFCFGFVEF 
Sbjct  262   NTAQESEVDGHSVYIKNLPLNCTPEQLHEEFKRFGPIKPGGIQVRSHKQQGFCFGFVEFE  321

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
               +++ +AI+ SPIMIG  QA VE K
Sbjct  322   VTSAVQSAIEASPIMIGRHQAFVEEK  347


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA +   P   P PSAQ+V NAFV QYY ILH SP+ VYRFY E+S L R +  G
Sbjct  1     MASEQLAPGGSP-PSAQVVANAFVHQYYHILHQSPELVYRFYMENSKLGRSEAQG  54



>emb|CDX87195.1| BnaC09g05100D [Brassica napus]
Length=520

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 184/327 (56%), Gaps = 23/327 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI  L+YE+Y AEI TADAQ S+  GVIVLVTG LTGKDN+++KF+QTFFLAPQD
Sbjct  122   QAINDKIMPLNYEDYTAEIDTADAQESHERGVIVLVTGRLTGKDNVRKKFSQTFFLAPQD  181

Query  1299  KGYFVLNDVFRYVEQDE-ADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             KGYFVLNDVFR++E+ E   + A+ V   D +  V       +PE   V           
Sbjct  182   KGYFVLNDVFRFLEEKEVVTTQARSVTIKDVQAPV-------EPESVVVSHEAEVEVEPE  234

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
                 ++   I+    + D+    DE  ++VD E      Q   S     S    D P  +
Sbjct  235   PVATIEEEDIENVAEVYDDPCEKDEG-VVVDVEPIEPPAQIIHS--EILSVSNGDPP--T  289

Query  942   YASILSSQMNKGPTKIYVPTNASRMKTEKQS---ASMvaqvpvpeapapiaPSTAID---  781
             YASIL   M   P     PT+ +R K    +    +     P  E   P   S+ ++   
Sbjct  290   YASIL-KLMKSSPAP---PTHVARNKPRAAAPVRTNQKPAPPPAETALPPNASSGLENDH  345

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              S N   E +GHSIYVRNLPF+ T  +LE VFK +G +KH GIQVRSN+QQGFCFGFVEF
Sbjct  346   NSSNVDVEDDGHSIYVRNLPFDTTPTQLEEVFKSFGDVKHEGIQVRSNKQQGFCFGFVEF  405

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                +   +A++ SPI IGDRQ V+E K
Sbjct  406   ETSSGKQSALEASPITIGDRQVVLEEK  432


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 16/95 (17%)
 Frame = -2

Query  2004  SISQSEIFPSFFL*TKTLSLSPSR*TESQIFATL*NIYFRMAMQTTTPATVPGPSAQLVG  1825
             S++ S + P F L  + +SL P   +  QI          MA Q  +  T PG  A++VG
Sbjct  35    SVAVSLVLPLFLL-QQQISLCPL--SPPQI---------TMAQQEAS--TSPG--AEVVG  78

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
              AFVEQYY ILH SP  V+RFYQ+SS+L+RPD  G
Sbjct  79    RAFVEQYYHILHQSPGLVHRFYQDSSLLTRPDLTG  113



>ref|XP_004242411.1| PREDICTED: putative G3BP-like protein isoform X1 [Solanum lycopersicum]
 ref|XP_010323091.1| PREDICTED: putative G3BP-like protein isoform X1 [Solanum lycopersicum]
Length=477

 Score =   213 bits (541),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 143/328 (44%), Positives = 181/328 (55%), Gaps = 25/328 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +  AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDLRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLVRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE   +  +   V   D    V P     DP  A   H+P+       
Sbjct  125   RGYFVLNDMFRYVET-ASQHDTVQVPVTDAVAPVTPEQIVADPPTAPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD---  958
              +D  EV N               S+  ++L+  E            + +    + D   
Sbjct  184   EADVGEVYN--------------PSENGDVLIVEEEVPVSEVVHEVQDGSEVVAESDNKT  229

Query  957   --APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +S   V Q        P + S  I
Sbjct  230   GEVPKKSYASIV-MHLKESAATFSPPPAPAARKPMTKSVVQVNQPAATTTDGPYSSSETI  288

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D + N  E A+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFGFVE
Sbjct  289   D-NINDTEAADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCFGFVE  347

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++  AI+ SP++IGDRQAVVE K
Sbjct  348   FEVESAVQKAIEASPVLIGDRQAVVEEK  375


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_008789695.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Phoenix dactylifera]
Length=469

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 137/332 (41%), Positives = 193/332 (58%), Gaps = 9/332 (3%)
 Frame = -2

Query  1509  HLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKF  1330
             H     +   + IN+KI S+D+  + AEIKT D+Q+S +GGV VLVTG LTGKDN+KR F
Sbjct  55    HGALISVTSMKAINEKILSMDF--HRAEIKTVDSQDSLDGGVFVLVTGYLTGKDNVKRDF  112

Query  1329  TQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPD  1150
             TQ+FFLAPQDKG+FVLND+FRYV + E    ++ +      P  +   ++P  E  HV +
Sbjct  113   TQSFFLAPQDKGFFVLNDIFRYVGEAERQLGSQGLENGAGAPLSLEQ-DSPPQEEQHVSE  171

Query  1149  SLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
               +      +    + V            +  +    ++D     N +Q   S ++  + 
Sbjct  172   PESCPQEEEEEANEEEVSNPSDNGEGSVVEEEELVGEVIDEAP--NSSQAVIS-DAAAAT  228

Query  969   IQDDAPKMSYASILSSQMNKGPTKIYVPTNAS-RMKTEKQSASMvaqvpvpeapapiaPS  793
             +Q++APK SYASI+   M +    + VPT+AS R    K             AP   A +
Sbjct  229   VQEEAPKKSYASIVKV-MKEIAAPLSVPTSASARPPPAKPEGQAAPAPMAATAPDIPAAN  287

Query  792   TAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
             +++ ES N QE EA+GHSIY+++LP N T  +LE  FK++G IK GGIQVRS++ QGFCF
Sbjct  288   SSVVESNNVQEAEADGHSIYIKSLPLNATPDQLEEEFKRFGRIKPGGIQVRSHKLQGFCF  347

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   N++ +AI+ SPI IG RQA VE K
Sbjct  348   GFVEFEEANAVQSAIEASPITIGGRQAFVEEK  379


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = -2

Query  1866  TPATVPG--PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             T A  PG  PSAQ+VGNAFV+QYY ILH SP+ VYRFYQESS L RP+  G
Sbjct  6     TSAAAPGSPPSAQVVGNAFVQQYYHILHQSPELVYRFYQESSKLGRPEAHG  56



>ref|XP_006352680.1| PREDICTED: putative G3BP-like protein-like isoform X3 [Solanum 
tuberosum]
Length=475

 Score =   212 bits (540),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/331 (44%), Positives = 182/331 (55%), Gaps = 33/331 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLIRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      +   V  +D    V P     DP      H+P+       
Sbjct  125   RGYFVLNDMFRYVET-AGQHDTVHVPVIDAVAPVTPEQIVADPPTVPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++ ++++   E            
Sbjct  184   EADVGEVYNPSENGDVTIVEEEVPVSEVVDEVQDGSEVVAESDNKTGE------------  231

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T    P  ASR K   +S   V Q        P + S
Sbjct  232   -----VPKKSYASIVMHLKESAATFSPPPAPASR-KPMTKSVVQVNQPAATATDGPYSSS  285

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
               ID   N  E A+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFG
Sbjct  286   DTIDNINNT-EAADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCFG  342

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IGDRQAVVE K
Sbjct  343   FVEFEVESAVQKAIEASPVLIGDRQAVVEEK  373


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_006352681.1| PREDICTED: putative G3BP-like protein-like isoform X4 [Solanum 
tuberosum]
Length=474

 Score =   212 bits (539),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 145/331 (44%), Positives = 182/331 (55%), Gaps = 34/331 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLIRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      +   V  +D    V P     DP      H+P+       
Sbjct  125   RGYFVLNDMFRYVET-AGQHDTVHVPVIDAVAPVTPEQIVADPPTVPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++ ++++   E            
Sbjct  184   EADVGEVYNPSENGDVTIVEEEVPVSEVVDEVQDGSEVVAESDNKTGE------------  231

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T    P  ASR K   +S   V Q        P + S
Sbjct  232   -----VPKKSYASIVMHLKESAATFSPPPAPASR-KPMTKSVVQVNQPAATATDGPYSSS  285

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
               ID   N   EA+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFG
Sbjct  286   DTIDNINNT--EADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCFG  341

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IGDRQAVVE K
Sbjct  342   FVEFEVESAVQKAIEASPVLIGDRQAVVEEK  372


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_010323092.1| PREDICTED: putative G3BP-like protein isoform X2 [Solanum lycopersicum]
Length=476

 Score =   211 bits (538),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 180/328 (55%), Gaps = 26/328 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +  AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDLRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLVRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE   +  +   V   D    V P     DP  A   H+P+       
Sbjct  125   RGYFVLNDMFRYVET-ASQHDTVQVPVTDAVAPVTPEQIVADPPTAPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD---  958
              +D  EV N               S+  ++L+  E            + +    + D   
Sbjct  184   EADVGEVYN--------------PSENGDVLIVEEEVPVSEVVHEVQDGSEVVAESDNKT  229

Query  957   --APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +S   V Q        P + S  I
Sbjct  230   GEVPKKSYASIV-MHLKESAATFSPPPAPAARKPMTKSVVQVNQPAATTTDGPYSSSETI  288

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D   +   EA+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFGFVE
Sbjct  289   DNINDT--EADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNRQQGFCFGFVE  346

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++  AI+ SP++IGDRQAVVE K
Sbjct  347   FEVESAVQKAIEASPVLIGDRQAVVEEK  374


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>gb|KHN42950.1| Putative G3BP-like protein [Glycine soja]
Length=362

 Score =   208 bits (529),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 138/324 (43%), Positives = 193/324 (60%), Gaps = 23/324 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY ++  EI +ADAQ SY  GVIV+VTGCLTG DNLKRKFTQ+FFLAPQDKG
Sbjct  10    INKKILSLDYTSFRVEILSADAQPSYKDGVIVVVTGCLTGSDNLKRKFTQSFFLAPQDKG  69

Query  1293  YFVLNDVFRYV-EQDEADSNAKMVNGVDDE--PTVIPSPEAPDPEPAHVPDSLNANPASS  1123
             YFVLNDVFRYV E    D  +   N   DE  PT       P+PE  HV + +   PAS 
Sbjct  70    YFVLNDVFRYVDEYKSVDIESVPANDAADESAPT---DAFVPEPEAIHVAEDV---PASQ  123

Query  1122  DTEEVKNVGI--KIHESLEDEKQVSDEKEILVD--TESHLNENQTSASLESTTSAIQDDA  955
                   ++G+  ++ + LE+      EK + VD   E    E+ + A   ++ ++++ D 
Sbjct  124   TDVVDADIGVSKEVSQPLENGNLSVTEKVVPVDHVKECSHQEHHSHAEKAASNNSLE-DT  182

Query  954   PKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             PK S+ASI+++ + +     +V  +  ++  + + +S+        AP   APST     
Sbjct  183   PKKSFASIVNA-LKENAAPFHVRVSPVKLLEQPRVSSI-------PAPEAPAPSTDSPPE  234

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN +   + ++I+V NLP N TV +LE VF+K+GPIK  GIQVRSN+QQ  CFGFVEF  
Sbjct  235   KNNEIGGKAYAIFVANLPMNATVEQLERVFQKFGPIKRDGIQVRSNKQQQSCFGFVEFES  294

Query  594   LNSMNNAIQDS-PIMIGDRQAVVE  526
               SM +A++ S P+ +  R+  +E
Sbjct  295   ATSMQSALEASPPVTLDGRRLSIE  318



>ref|XP_009614845.1| PREDICTED: putative G3BP-like protein isoform X1 [Nicotiana tomentosiformis]
Length=474

 Score =   211 bits (537),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 187/332 (56%), Gaps = 31/332 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQIVADPPPVQENHIPEQSTPPAE  181

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  182   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  229

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+   + +       P   +  K   +    V Q        P++ S
Sbjct  230   -----VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSS  283

Query  792   TAIDESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
              ++D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCF
Sbjct  284   DSVDNINDPEGEAADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNRQQGFCF  343

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   +++  AI+ SP++IG  QAVVE K
Sbjct  344   GFVEFEVESAVQKAIEASPVLIGGWQAVVEEK  375


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_009775383.1| PREDICTED: putative G3BP-like protein isoform X2 [Nicotiana sylvestris]
Length=468

 Score =   211 bits (536),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 186/332 (56%), Gaps = 34/332 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  61    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  121   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDVEAPVTPQQIVADPPPVQENHIPEQSTPPVE  179

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  180   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  227

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+        T  + P  A   K   +    V Q        P++ S
Sbjct  228   -----VPKKSYASIVMHLKESAAT--FSPPPAPSRKPMAKRVEQVNQPAATATDGPVSSS  280

Query  792   TAIDESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
              ++D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCF
Sbjct  281   DSVDNMNDPEGEAADGYSVYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCF  338

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   +++  AI+ SP++IG RQAVVE K
Sbjct  339   GFVEFEVESAVQKAIEASPVLIGGRQAVVEEK  370


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    VVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  52



>ref|XP_009614849.1| PREDICTED: putative G3BP-like protein isoform X5 [Nicotiana tomentosiformis]
Length=471

 Score =   210 bits (535),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 186/329 (57%), Gaps = 28/329 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRYVE + +  +A  V   D E  V P    P  +  H+P+        +D
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQNPPPVQENHIPEQSTPPAEEAD  181

Query  1119  TEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               EV N        +  +     E   +V D  E++V++++   E               
Sbjct  182   VGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE---------------  226

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +    V Q        P++ S ++
Sbjct  227   --VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSSDSV  283

Query  783   DESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNRQQGFCFGFV
Sbjct  284   DNINDPEGEAADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNRQQGFCFGFV  343

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++  AI+ SP++IG  QAVVE K
Sbjct  344   EFEVESAVQKAIEASPVLIGGWQAVVEEK  372


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>gb|EYU44203.1| hypothetical protein MIMGU_mgv1a010963mg [Erythranthe guttata]
Length=296

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 177/278 (64%), Gaps = 24/278 (9%)
 Frame = -2

Query  1569  IHYSGILFTRILNIDPTVLQHLNFFFLML----YQRINDKIRSLDYENYDAEIKTADAQN  1402
             +H+S  L  R    D +VL   +   LM      + INDKI SLDY+NY AEIKTADAQ+
Sbjct  29    LHHSPELVFRFYQ-DVSVLSRPDPNGLMTTVTTMKSINDKICSLDYKNYKAEIKTADAQD  87

Query  1401  SYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVN  1222
             SY  GVIVLVTG LTGKDN +RKFTQTFFLAPQDKGY+VLND+FRY E+ E + ++ +V 
Sbjct  88    SYADGVIVLVTGYLTGKDNRRRKFTQTFFLAPQDKGYYVLNDLFRYAEESEPEISSGLVT  147

Query  1221  GVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKE  1042
             GV + P   P+  A DPEP  V DS   N A+   EEV+ +  KI E   DE +VSD+K+
Sbjct  148   GVVEAP---PTSVAQDPEPLRVVDSPIVNHATPQLEEVEVIEEKIDEQGTDEIEVSDDKD  204

Query  1041  ILVDTESHLNENQTSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASR--M  868
             +LV+ ESH NEN              DD PK SYASILSS   K PTK+YVP   ++  +
Sbjct  205   VLVEAESHSNEN-------------HDDTPKKSYASILSSLTKKSPTKVYVPAKTAKVPV  251

Query  867   KTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQEEA  754
             KTEKQ     A+  V E+  P+AP+ A  ESK+AQ+E 
Sbjct  252   KTEKQQRQPAAEESVIESSVPVAPNNA-PESKDAQDEG  288


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 45/55 (82%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA QT  P   P PSAQ+VGNAFVEQYY ILHHSP+ V+RFYQ+ SVLSRPDP+G
Sbjct  1     MATQTANPP--PAPSAQVVGNAFVEQYYHILHHSPELVFRFYQDVSVLSRPDPNG  53



>ref|XP_009415829.1| PREDICTED: putative G3BP-like protein [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415837.1| PREDICTED: putative G3BP-like protein [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415846.1| PREDICTED: putative G3BP-like protein [Musa acuminata subsp. 
malaccensis]
 ref|XP_009415854.1| PREDICTED: putative G3BP-like protein [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   210 bits (535),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 189/331 (57%), Gaps = 19/331 (6%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             +M  Q IND I SLD+ N   EI+TAD+Q SY  GV+++VTG   G+D ++RKF Q+FFL
Sbjct  58    VMSVQAINDMIMSLDFRNCFTEIETADSQISYQNGVLIVVTGSFIGQDAIRRKFAQSFFL  117

Query  1311  APQDKG-YFVLNDVFRYV-EQDEADSNAKMVNGV-DDEPTVIPSPEA-PDPEPAHVPDSL  1144
             APQ+KG YFVLNDVFR++ E  + + N  + +G  DD P V  SPEA P  +    P++ 
Sbjct  118   APQEKGGYFVLNDVFRFLSETRQREMNYMLGDGTKDDSPQVPISPEAEPTCQEHDAPETP  177

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
                  + + EE+ N         +DE        ++VD  +   E+ +    E   S  Q
Sbjct  178   LLEENADNMEELPNQSEDGGSGFDDE--------VIVDPPADTGESDSQTVHEVIASGGQ  229

Query  963   DDAPKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
             DD PK SYASI+  ++ KG   P  +Y  T   +++   Q   +V+  P          S
Sbjct  230   DDLPKKSYASIV--KVMKGSSSPVPVYT-TPKEKVEVAPQEPVIVSPAPASTPEVSHPAS  286

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
                    N   E EGHSIY+RNL  N T  ++E  FKK+GPIK GG+QVRS++ + +CFG
Sbjct  287   NN-FPENNNNVEEEGHSIYIRNLSLNATAEQVEEEFKKFGPIKPGGVQVRSHKVERYCFG  345

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF  L SM  AI+ SP+MIG RQA+VE K
Sbjct  346   FVEFESLKSMQAAIEASPVMIGGRQAIVEEK  376


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA+   +P +   P  Q++G+AFV+QYY ILH SP+ V++FYQ+SS ++RP+ DG
Sbjct  1     MALPAASPVSSLTP--QVIGSAFVQQYYHILHQSPEMVHKFYQDSSTVNRPNSDG  53



>ref|XP_010907890.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Elaeis guineensis]
 ref|XP_010907892.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Elaeis guineensis]
 ref|XP_010907893.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Elaeis guineensis]
Length=470

 Score =   209 bits (531),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 194/329 (59%), Gaps = 17/329 (5%)
 Frame = -2

Query  1491  LMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFL  1312
             ++  Q IN+KI S+D+  + AEIKT DAQ+S NGGV+VLVTG +TG DN +R FTQ+FFL
Sbjct  64    VISMQAINEKILSMDF--HGAEIKTVDAQDSLNGGVLVLVTGYVTGMDNDRRDFTQSFFL  121

Query  1311  APQDKGYFVLNDVFRYVEQDEADSNAK-MVNGVDDEPTVIPSPEAPDPEPAHVPDSLNAN  1135
             APQDKG+FVLND+FRYV + E     + + NG      + P  ++P     HVP+     
Sbjct  122   APQDKGFFVLNDIFRYVGEAEHQQGGQGLANGAG--APLSPGQDSPPQHEQHVPEQDVPP  179

Query  1134  PASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             P   +  E +      + S   E  V +E  +    +   N +Q +  +++T + IQ++A
Sbjct  180   PEEEEANEEE----VYNPSDNGEDSVVEEAPVCEVIDEGPNSSQ-AVVVDATAAIIQEEA  234

Query  954   PKMSYASILSSQMNKGPTKIYVPTNASR----MKTEKQSASMvaqvpvpeapapiaPSTA  787
             PK SYASI+   M      + VPT+ S      K E+Q+          + PA  + +  
Sbjct  235   PKKSYASIVKV-MKDNAAPLSVPTSVSARPAPAKPERQAGPASMPATALDTPAASSSAGE  293

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
                 + A  E +GHSIYVR+LP N T  +LE  FK++G IK GGIQVRS++ QGFCFGFV
Sbjct  294   GSSVQEA--EGDGHSIYVRSLPLNATPDQLEEEFKRFGRIKPGGIQVRSHKLQGFCFGFV  351

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++ +AI+ SPI+IG RQA VE K
Sbjct  352   EFEEASAVQSAIEASPIVIGGRQAFVEEK  380


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             Q+VGNAFV+QYY ILH SP  V+RFYQESS L RP+  G
Sbjct  21    QVVGNAFVQQYYHILHQSPALVHRFYQESSKLGRPEAHG  59



>ref|XP_008351895.1| PREDICTED: putative G3BP-like protein, partial [Malus domestica]
Length=363

 Score =   205 bits (522),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 171/285 (60%), Gaps = 17/285 (6%)
 Frame = -2

Query  1350  DNLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA--  1180
             DN+ RKF QTFFLAPQ+KGY+VLNDVFRY+E +E+  +N   VNG+++      +PEA  
Sbjct  1     DNVGRKFAQTFFLAPQEKGYYVLNDVFRYIEDNESLPTNTASVNGINES-----APEAIV  55

Query  1179  -PDPEPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQ  1003
               +PEP H PD L  +PA    EE  N G ++ +  ++++    E E++   E     +Q
Sbjct  56    TAEPEPIHAPDHLVVDPAIPFEEEDLNNGAEVCDPSDNDEGSVVEDELV---EPPALPSQ  112

Query  1002  TSASLESTTSA---IQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaq  832
               A ++ T       Q+DAPK SYASIL  +    P ++ VP     +            
Sbjct  113   NLAEVDPTPDPAPETQEDAPKKSYASILLKKSMASPVRV-VPHTVRTVSANTDHLPAGPA  171

Query  831   vpvpeapapiaPSTAIDESKNAQEEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGG  655
                P   A      A  ES ++ EEA EG+SI+VRNLP++ TV +LE  FK++GPIK  G
Sbjct  172   KSFPAPEASPPTGDAAPESSHSHEEAPEGYSIHVRNLPYDATVGQLEKEFKRFGPIKRDG  231

Query  654   IQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             IQVRS++QQGFCFGFVEF  L+SM +A++ SPI IGDR AV+E K
Sbjct  232   IQVRSSKQQGFCFGFVEFESLSSMQSALEASPITIGDRPAVIEEK  276



>ref|XP_009412729.1| PREDICTED: putative G3BP-like protein isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=485

 Score =   207 bits (528),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 190/327 (58%), Gaps = 17/327 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI S+DY  + AEIKT DAQ S +GG++VLVTG LTGKD++KR FTQ+FFLA QDKG
Sbjct  65    INEKILSVDYSEFRAEIKTVDAQESLDGGIVVLVTGYLTGKDDVKRNFTQSFFLATQDKG  124

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEP---------TVIPSPEAPDPEPAHVPDSLN  1141
             Y+VLND+FRYV+       +  +   D  P         T+    EAP  +   V ++  
Sbjct  125   YYVLNDIFRYVDDGNDQWESGALTSGDRAPLAPEQGIDGTLEQQQEAPPKQDQQVTEAPE  184

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                  ++ E   +  I+   +LE+E    +    ++D  + +++   +   +S ++AI +
Sbjct  185   EV-ELNEEEVFNSPEIEDAPTLEEEAPTIE----MIDEVAKISQTVVA---DSGSAAILE  236

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
              APK SYASI+       P  +  P  +     +    +     P P      A STA +
Sbjct  237   GAPKKSYASIVKVMKENAPPSVPAPVPSRSAVVDIDQLASPVPTPAPAPNNTSAGSTAGE  296

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              +   + E +G+SIY++NLP N T A+L+  FKK+GPIK GGIQVRS++QQGFCFGFVEF
Sbjct  297   SNSTQESEVDGYSIYIKNLPLNATPAQLDEEFKKFGPIKPGGIQVRSHKQQGFCFGFVEF  356

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                +++  AI+ SPIMIG RQA VE K
Sbjct  357   EVASAVQCAIEASPIMIGGRQAFVEEK  383


 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDP  1726
             MA + + P     P AQ+VGNAFV QYY +LH SP  V+RFYQE+S L RPDP
Sbjct  1     MASEQSAPVGSSHP-AQVVGNAFVNQYYHVLHRSPQLVFRFYQEASKLGRPDP  52



>ref|XP_009404225.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009404226.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009404227.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Musa acuminata subsp. malaccensis]
Length=447

 Score =   206 bits (524),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 187/323 (58%), Gaps = 23/323 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI S+   +  AE+ + DAQ S  GGVIVLVTG LTG+DN+KR FTQ+FFLA QDKG
Sbjct  65    INAKILSMG--SVRAEMTSVDAQESLGGGVIVLVTGHLTGEDNVKRDFTQSFFLARQDKG  122

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             ++VLND+FR+VE+ D    +  + N  D      P  + P  E  H PD  +  P   + 
Sbjct  123   FYVLNDIFRFVEEVDHQQGHQSLAN--DSGAPHAPESDLPPEEEQHAPDQTDVLPVEEEE  180

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNE--NQTSASLESTTSAIQDDAPKMS  943
                +                SD  E+ V+ E    E  N+  ++ ES     Q++ PK S
Sbjct  181   VNEEE-----------VYNPSDNGEV-VEEEEPTGEVINEVPSNSESNAVTAQEEMPKKS  228

Query  942   YASILSSQMNKGPTKIYVPTNASRMKTE-KQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             YASI+  ++ K    + VPT AS M T  K     +   P   A    A S+A  ES N 
Sbjct  229   YASIV--KVMKDSASVSVPTRASSMPTSIKAEPQAIPAPPAAPASDMSASSSAAAESSNV  286

Query  765   QE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
             QE E +G+S+YV++LP + T A+LE VFKK+GPIK GGIQVRS++ QGFCFGFVEF   +
Sbjct  287   QEAETDGYSVYVKSLPMDATPAQLEEVFKKFGPIKPGGIQVRSHKLQGFCFGFVEFEVTS  346

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             ++ +AI+ SPIMIG R A VE K
Sbjct  347   AVQSAIEASPIMIGGRSAYVEEK  369


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY +L  SP+ VYRFYQ+SS L RPD  G
Sbjct  14    SAQVVGNAFVQQYYHVLQQSPEHVYRFYQDSSKLGRPDAHG  54



>gb|AES79079.2| nuclear transport factor 2 and RNA recognition motif protein 
[Medicago truncatula]
Length=519

 Score =   208 bits (529),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 166/477 (35%), Positives = 239/477 (50%), Gaps = 116/477 (24%)
 Frame = -2

Query  1887  RMAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmts  1708
             R+AM T+     P P   +VG+AFVEQYY +LH SP+ V+RFYQ+ S L RP+P+G    
Sbjct  5     RIAMATSENQVPPAP--DVVGHAFVEQYYYMLHESPEHVHRFYQDVSKLGRPEPNGI---  59

Query  1707  vttmdvss*VQAIKLLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNI  1528
                         I + + + E                                      I
Sbjct  60    ------------IGITTTMAE--------------------------------------I  69

Query  1527  DPTVLQHLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKD  1348
             D  +L        M Y  ++ +I S+D            AQ S+ GGVIVLVTG + GKD
Sbjct  70    DKKILS-------MGYSELSAEILSVD------------AQESFGGGVIVLVTGFMIGKD  110

Query  1347  NLKRKFTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP---  1177
             N+K+KFTQ FFLAPQ+KGYFVLND+FRYV+++E          + +    I SP +P   
Sbjct  111   NVKQKFTQCFFLAPQEKGYFVLNDIFRYVDENE----------IKEPDHAIRSPASPENV  160

Query  1176  -DP--EPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNEN  1006
              DP      VP+ ++    + D  E++ V    +  +  E++ +   E+LV+     N++
Sbjct  161   LDPLVLETQVPEQISVAAENGDRGELE-VYNPENGQVSVEEEEAPVPEVLVEIP---NDS  216

Query  1005  QTSASLESTTSAIQ---------DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT---  862
             Q +A  +      Q         ++ PK SYASIL  ++ KG         A+ ++T   
Sbjct  217   QKAAGFDHVPDDSQKVAELASQIEEVPKKSYASIL--KVMKGAAAPSSVMTAASVRTSIK  274

Query  861   --EKQSASMvaqvpvpeapapiaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEA  691
               E+QSA+          P     S + +E  N QE EAEG+SIY++ LP N T A +E 
Sbjct  275   IQEQQSAA---APSPSSVPETNGSSISTNEGGNNQETEAEGYSIYLKGLPGNATHALVEN  331

Query  690   VFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             +FKK+GPIK GG+QVR+   +GF FGFVEF   ++  +AI+ SPI+I DRQ V+E K
Sbjct  332   MFKKFGPIKSGGVQVRT--AKGFHFGFVEFEEESAALSAIEASPILINDRQVVIEEK  386



>dbj|BAE71310.1| putative ras-GTPase-activating protein SH3-domain binding protein 
[Trifolium pratense]
Length=447

 Score =   206 bits (523),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/322 (43%), Positives = 186/322 (58%), Gaps = 22/322 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY +Y  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIQSFDYTSYRVEVLSADAQPSYNSGVVVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSL-NANPAS  1126
             ++VLNDVFRYV+     D      N  D+     PS EA  PDPEP HV + +    P  
Sbjct  122   FYVLNDVFRYVDAYKSVDIETVTANDADES---APS-EAFTPDPEPIHVAEDIPTIQPVI  177

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
             +DT+   N+  ++   LE+ K    E  I V+     +  +  AS+E   S  Q+D PK 
Sbjct  178   ADTD--TNISKEVSLPLENGKLSVTENVIPVNHVKESSHQEQMASIEKVPSNTQEDTPKK  235

Query  945   SYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             S+ASI+S+ + N  P         SR    K  A    +V    AP    P+  I   KN
Sbjct  236   SFASIVSAYKDNSAPF-------LSRTSPAK-PAVQPPRVHSVPAPEAPPPNMDIPSEKN  287

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              +     H+I+V NLP   TV +L+ VFKK+G IK  GIQVRSN+  G CFGFVEF    
Sbjct  288   NENGGRAHAIFVANLPMTATVEQLDRVFKKFGTIKRDGIQVRSNK--GSCFGFVEFESAA  345

Query  588   SMNNAIQDS-PIMIGDRQAVVE  526
             S+ +A++ S P+M+ +R+  +E
Sbjct  346   SLQSALEASPPVMLDNRRLSIE  367


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH  PDQV++FY ESSVLSRP+ DG
Sbjct  10    PTPQVVGNAFVEQYYSILHQDPDQVHKFYHESSVLSRPEEDG  51



>ref|XP_009614848.1| PREDICTED: putative G3BP-like protein isoform X4 [Nicotiana tomentosiformis]
Length=471

 Score =   206 bits (525),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 138/331 (42%), Positives = 185/331 (56%), Gaps = 32/331 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQIVADPPPVQENHIPEQSTPPAE  181

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  182   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  229

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+   + +       P   +  K   +    V Q        P++ S
Sbjct  230   -----VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSS  283

Query  792   TAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFG  613
              ++D   + + EA+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFG
Sbjct  284   DSVDNINDPEGEADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNR--GFCFG  341

Query  612   FVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FVEF   +++  AI+ SP++IG  QAVVE K
Sbjct  342   FVEFEVESAVQKAIEASPVLIGGWQAVVEEK  372


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_004505360.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X4 [Cicer arietinum]
Length=446

 Score =   206 bits (523),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 190/324 (59%), Gaps = 26/324 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIKSHDYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSLNANP---  1132
             ++VLNDVFRYVE+    D  +   N  D+     PS EA  P+PEP HVP+ +       
Sbjct  122   FYVLNDVFRYVEEYKSVDIESVPSNDADES---APS-EAFTPEPEPNHVPEDIPPRQSVV  177

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A +DT    N+  ++   LE+ K    E  I V+        +  +S E   S  Q+D P
Sbjct  178   ADTDT----NISKEVSLPLENGKLSVTENVIPVNHVKETIHQEQPSSTEKVASNTQEDTP  233

Query  951   KMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K S+ASI+++ + N  P  +          +  + A    +V    AP   AP+T     
Sbjct  234   KKSFASIVNALKDNSKPFHLRT--------SPAKPAVQQPRVISAPAPEAPAPNTDSPLE  285

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN +   + H+I+V NLP N TV +L+ VFKK+GPIK  GIQVRSN+  G CFGFVEF  
Sbjct  286   KNNENAGKAHAIFVANLPMNATVEQLDRVFKKFGPIKPNGIQVRSNK--GSCFGFVEFES  343

Query  594   LNSMNNAIQDS-PIMIGDRQAVVE  526
               SM +A++ S P+M+ +R+  +E
Sbjct  344   AASMQSALEASPPVMLDNRRLSIE  367


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH +PDQV+RFY +SSV+SRP+ DG
Sbjct  10    PTPQMVGNAFVEQYYSILHQNPDQVHRFYHDSSVMSRPEEDG  51



>dbj|BAE71222.1| putative ras-GTPase-activating protein SH3-domain binding protein 
[Trifolium pratense]
Length=447

 Score =   205 bits (522),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 187/322 (58%), Gaps = 22/322 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY +Y  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIQSFDYTSYRVEVLSADAQPSYNSGVVVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSL-NANPAS  1126
             ++VLNDVFRYV+     D      N  D+     PS EA  PDPEP HV + +    P  
Sbjct  122   FYVLNDVFRYVDAYKSVDIETVPANDADES---APS-EAFTPDPEPIHVAEDIPTIQPVI  177

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
             +DT+   N+  ++   LE+ K    E  I V+     +  +  AS+E   S  Q+D PK 
Sbjct  178   ADTD--TNISKEVSLPLENGKLSVTENVIPVNHVKESSHQEQMASIEKVPSNTQEDTPKK  235

Query  945   SYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             S+ASI+S+ + N  P         SR    K  A    +V    AP   AP+  I   KN
Sbjct  236   SFASIVSAYKDNSAPF-------LSRTSPAK-PAVQPPRVHSVPAPEAPAPNMDIPSEKN  287

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              +     H+I+V NLP   TV +L+ VFKK+G IK  GIQVRSN+  G CFGFVEF    
Sbjct  288   NENGGRAHAIFVANLPMTATVEQLDRVFKKFGTIKRDGIQVRSNK--GSCFGFVEFESAA  345

Query  588   SMNNAIQDS-PIMIGDRQAVVE  526
             S+ +A++ S P+M+ +R+  +E
Sbjct  346   SLQSALEASPPVMLDNRRLSIE  367


 Score = 72.0 bits (175),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH  PDQV++FY ESSVLSRP+ DG
Sbjct  10    PTPQVVGNAFVEQYYSILHQDPDQVHKFYHESSVLSRPEEDG  51



>ref|XP_004505358.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
isoform X2 [Cicer arietinum]
Length=456

 Score =   205 bits (522),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 137/324 (42%), Positives = 190/324 (59%), Gaps = 26/324 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+S DY ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIKSHDYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNVKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEA--PDPEPAHVPDSLNANP---  1132
             ++VLNDVFRYVE+    D  +   N  D+     PS EA  P+PEP HVP+ +       
Sbjct  122   FYVLNDVFRYVEEYKSVDIESVPSNDADES---APS-EAFTPEPEPNHVPEDIPPRQSVV  177

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             A +DT    N+  ++   LE+ K    E  I V+        +  +S E   S  Q+D P
Sbjct  178   ADTDT----NISKEVSLPLENGKLSVTENVIPVNHVKETIHQEQPSSTEKVASNTQEDTP  233

Query  951   KMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             K S+ASI+++ + N  P  +          +  + A    +V    AP   AP+T     
Sbjct  234   KKSFASIVNALKDNSKPFHLRT--------SPAKPAVQQPRVISAPAPEAPAPNTDSPLE  285

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN +   + H+I+V NLP N TV +L+ VFKK+GPIK  GIQVRSN+  G CFGFVEF  
Sbjct  286   KNNENAGKAHAIFVANLPMNATVEQLDRVFKKFGPIKPNGIQVRSNK--GSCFGFVEFES  343

Query  594   LNSMNNAIQDS-PIMIGDRQAVVE  526
               SM +A++ S P+M+ +R+  +E
Sbjct  344   AASMQSALEASPPVMLDNRRLSIE  367


 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH +PDQV+RFY +SSV+SRP+ DG
Sbjct  10    PTPQMVGNAFVEQYYSILHQNPDQVHRFYHDSSVMSRPEEDG  51



>gb|KDP26351.1| hypothetical protein JCGZ_17509 [Jatropha curcas]
Length=474

 Score =   206 bits (523),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 191/323 (59%), Gaps = 16/323 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y+ + AEI T D+Q SYNGGV+VLVTG LTGKDNL++KF Q+FFLAPQDKG
Sbjct  62    INEKILSLNYDEFRAEITTVDSQESYNGGVLVLVTGYLTGKDNLRQKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             Y+VLNDVFRYV+ D  + N  +      E  V P  + P  +  H+ +   A    ++ E
Sbjct  122   YYVLNDVFRYVD-DAKNQNGTLGFFNTVEAPVNPGQDLPSVQENHISEQPIALSEEANGE  180

Query  1113  EV----KNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
             EV    +N    I E  +   +V DE   + D    + E+Q  A     +S+  ++ PK 
Sbjct  181   EVYDPSENGDGSIEEEEQPVPEVVDE---IPDDAQMVTESQIVAE----SSSKIEEVPKK  233

Query  945   SYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             SYASI+   M +       P  +    T K    ++A V    A      ++   E+ NA
Sbjct  234   SYASIVKV-MKENAAPFSSPAPSPLRSTPKSQEQVIAAVIPTAASETHVSTSNATENGNA  292

Query  765   QE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
             QE EAEG SIYV+ LP + T A L++ FKK+GPI+ GGIQVR   Q+GFCFGFVEF  ++
Sbjct  293   QEGEAEGPSIYVKGLPLDATHALLDSEFKKFGPIRTGGIQVRC--QKGFCFGFVEFEVVS  350

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             ++ +AI+ SPIMI   + VVE K
Sbjct  351   AVQSAIEASPIMINGCRVVVEEK  373


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -2

Query  1860  ATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             ATVP     +VGNAFV QYYLILH SP+ V+RFYQ+ S L RP+  G
Sbjct  8     ATVP---PDVVGNAFVHQYYLILHQSPELVHRFYQDVSRLGRPEEGG  51



>ref|XP_009372228.1| PREDICTED: putative G3BP-like protein [Pyrus x bretschneideri]
Length=497

 Score =   206 bits (525),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 195/340 (57%), Gaps = 28/340 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN KI  LDY    A IKT DAQ SYNGGV VLVTG LTGKD +++KFTQ+FFLAPQD
Sbjct  65    EEINKKI--LDYGELSANIKTVDAQESYNGGVFVLVTGYLTGKDLVRKKFTQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              GYFVLNDVFRYVE    E + N  +V+ V+ EP + P  +AP  +  HVP+ + A    
Sbjct  123   VGYFVLNDVFRYVEDSTPENEDNGLVVD-VEVEPPITPKHDAPALQDNHVPEPVIAVSED  181

Query  1125  SDTEEV----KNVGIKIHESLEDEKQVSDEKE------ILVDTESHLN-ENQTSASLES-  982
                EEV    +N  + + E    E +V +E        + V+ ES+   E++++  +E+ 
Sbjct  182   VAKEEVIKPSENGVVSVAEEAVPEPEVVNEIPDDLQLVVKVEAESYSKVEDESNPKVEAE  241

Query  981   ------TTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvp  820
                     S  + +APK SYASIL S+  +G      P    R   +KQ   +    P+ 
Sbjct  242   FNSKVEAESNSKVEAPKKSYASILKSK-KEGTVPFSTPA-PMRFVPKKQEHQV-TAAPIS  298

Query  819   eapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRS  640
                +    ST   E+ N + EAEG+SIY++ LP + T   +E  FKK+G IK  G+QVR 
Sbjct  299   APVSETVASTNARENGNLEPEAEGYSIYIKGLPMDCTNTVIENEFKKFGQIKKNGVQVRI  358

Query  639   NRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              R  GFCFGFVEF   +S+ +A++ SPI+IG RQ  VE K
Sbjct  359   LR--GFCFGFVEFEAASSVQSAMEASPIVIGGRQVFVEEK  396


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M    PA    P+A +VGNAFV QYY IL  SP+ V+RFYQ+ S L RP   G
Sbjct  4     MVQQAPAASLTPTADVVGNAFVLQYYNILEQSPELVHRFYQDISKLGRPGDGG  56



>ref|XP_009614851.1| PREDICTED: putative G3BP-like protein isoform X7 [Nicotiana tomentosiformis]
Length=468

 Score =   205 bits (522),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 184/328 (56%), Gaps = 29/328 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRYVE + +  +A  V   D E  V P    P  +  H+P+        +D
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQNPPPVQENHIPEQSTPPAEEAD  181

Query  1119  TEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               EV N        +  +     E   +V D  E++V++++   E               
Sbjct  182   VGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE---------------  226

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +    V Q        P++ S ++
Sbjct  227   --VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSSDSV  283

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D   + + EA+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFGFVE
Sbjct  284   DNINDPEGEADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNR--GFCFGFVE  341

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++  AI+ SP++IG  QAVVE K
Sbjct  342   FEVESAVQKAIEASPVLIGGWQAVVEEK  369


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_009628137.1| PREDICTED: putative G3BP-like protein isoform X2 [Nicotiana tomentosiformis]
Length=364

 Score =   202 bits (514),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 132/312 (42%), Positives = 178/312 (57%), Gaps = 23/312 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV V VTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQKSFNGGVHVFVTGHLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEAD-SNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSL  1144
             +GYFVLND+FRYVE    QD        ++  V  E TV       DP PA   H+  S 
Sbjct  124   RGYFVLNDMFRYVEIVNQQDTVQVPETDVLAPVTTEQTVA------DPPPAQENHI--SE  175

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
              + P++ +       G +++   E++     E+E+ V       +  +  + ES    I 
Sbjct  176   QSKPSAEEAN-----GGEVYNPPENDNVPVVEEEVHVAEVVDEVQGDSQMAAESNI--IV  228

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             +D PK SYASI+        T   +P  A R    K    M        A +P+  S  +
Sbjct  229   EDVPKKSYASIVMHLKESAATFSPLPAPAPRKIVPKSVGQMSQPPAAAPADSPVLNSDFV  288

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D   N + EA+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQ GFCFGFVE
Sbjct  289   DNVNNQEGEADGYSIYIKGLPMSATAAMLEDEFKKFGPIKNGGIQVRSNRQHGFCFGFVE  348

Query  603   FHGLNSMNNAIQ  568
             F   +++  AI+
Sbjct  349   FEVESAVQKAIE  360


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_008805144.1| PREDICTED: ras GTPase-activating protein-binding protein 2-like 
[Phoenix dactylifera]
Length=438

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/329 (40%), Positives = 178/329 (54%), Gaps = 28/329 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IND I S+DY+ Y+ +I TAD+Q SY+ GVIVLVTGCL G D + RKFTQTFFLAPQ 
Sbjct  62    QAINDMILSMDYKRYEVKIWTADSQPSYDEGVIVLVTGCLIGTDKIPRKFTQTFFLAPQM  121

Query  1299  KGYFVLNDVFRYVEQDEADS-NAKMVN------GVDDEPTVIPSPEAPDPEPAHVPDSLN  1141
              G+FVLNDVFR++++ + D  N  +V+        D + T++     PD  PA V     
Sbjct  122   GGFFVLNDVFRFLDESQPDGINQSLVSTTIDGAATDSKLTLVQDSHVPD--PATVISEAK  179

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                A   +   +N G+ + + +  +  V                 Q   + E  TS  Q+
Sbjct  180   LASAEEASIPSENGGLVVQDKVTVDPPV-----------------QPHIACEIRTSIAQE  222

Query  960   DAPKMSYASILSSQMNKGPTK-IYVPTNASR-MKTEKQSASMvaqvpvpeapapiaPSTA  787
             D PK SYASI+        +K +YVPT   +   T  +   + +  P          +  
Sbjct  223   DVPKKSYASIVKDMKGNASSKPVYVPTTKLQPAPTNPEKPFIQSTAPSLTPEVLARKNDT  282

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             I ES N+    EGHSIY+ NLP N T  ++E  FKK+GPIK  G+QVR ++ + FCFGF+
Sbjct  283   ISESSNSSNSHEGHSIYIGNLPLNATARQVEEEFKKFGPIKPRGVQVRIHKFEHFCFGFI  342

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF    SM  AI  SP+MIGD+ AVV  K
Sbjct  343   EFESPESMKAAIGASPVMIGDKLAVVREK  371


 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA  T TP   P P  Q VG+AF++QYY ILH  P+  Y+FYQ+SS++SRPD +G
Sbjct  1     MAFPTATPVRTPSP--QEVGSAFIKQYYPILHRGPESAYKFYQDSSIISRPDSNG  53



>ref|XP_009799395.1| PREDICTED: putative G3BP-like protein isoform X4 [Nicotiana sylvestris]
Length=380

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 176/312 (56%), Gaps = 22/312 (7%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV VLVTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQESFNGGVHVLVTGYLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLN  1141
             +GYFVLND+FRYVE    QD     A  V   D    V     A DP PA   H+ +   
Sbjct  124   RGYFVLNDMFRYVEIVNQQD-----AVQVPETDVLAPVTTEQIAADPPPAQENHISEQ--  176

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                 S+   E  N G   +    D   V  E+  + +    ++E Q  + + + ++ I +
Sbjct  177   ----STPFAEEANGGEVYNPPENDNVPVVQEEVPVAEV---VDEVQGDSQMAAESNIIVE  229

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
             D PK SYASI+        T    P  A R    K    M        A +P+  S  +D
Sbjct  230   DVPKKSYASIVMHLKESAATFSPPPAPAPRKIVPKSVGQMSQPPAAALADSPVLSSDFVD  289

Query  780   ESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
                N + E A+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQQGFCFGFVE
Sbjct  290   NVNNQEGEAADGYSIYIKGLPMSATAAMLEEEFKKFGPIKNGGIQVRSNRQQGFCFGFVE  349

Query  603   FHGLNSMNNAIQ  568
             F    ++  AI+
Sbjct  350   FEVEPAVQKAIE  361


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>gb|AFK42895.1| unknown [Medicago truncatula]
Length=468

 Score =   204 bits (520),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 194/350 (55%), Gaps = 59/350 (17%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+SL+Y ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIQSLEYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNIKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHVPDSLNAN---  1135
             ++VLNDVFRYV+  ++ D  +  VN  D+     PS EA   P+PEP HVP+ +      
Sbjct  122   FYVLNDVFRYVDAYKSIDIESVPVNDADES---APS-EAIITPEPEPVHVPEVIPPTQTV  177

Query  1134  -PAS-----------SDTEEVKNVGIKIHESLEDEKQVSDEKEILV----DTESHLNENQ  1003
              P +           +DTE +  +  ++   LE+ K    E  I V    ++  H+ E +
Sbjct  178   IPTAQAVIPPTQTVIADTETI--ISKEVSLPLENGKLSVTENVIPVNHVKESSHHVKEPE  235

Query  1002  TSASLESTTSAIQDDAPKMSYASILSS--------QMNKGPTK--IYVPTNASRMKTEKQ  853
                S+E   S  Q+D PK S+ASI+++         +   P K  ++ P   S    E  
Sbjct  236   QPTSIEKVASNTQEDTPKKSFASIVNALKDNSAPFHLRASPAKPAVHPPRVHSVPAPEAP  295

Query  852   SASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYG  673
             + +M                  I   KN +     H+I+V NLP + TV +L+  FKK+G
Sbjct  296   TPNMD-----------------IPLEKNNENAGRAHAIFVANLPMSATVEQLDRAFKKFG  338

Query  672   PIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDS-PIMIGDRQAVVE  526
             PIK  GIQVRSN+  G CFGFVEF    SM +A++ S P+M+ +R+  +E
Sbjct  339   PIKRDGIQVRSNK--GSCFGFVEFESAASMQSALEASPPVMLDNRRLSIE  386


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P  V  P+ Q+VGNAFVEQYY ILH  PDQV+RFY +SSV+SRP+ DG
Sbjct  4     PEAVQTPTPQMVGNAFVEQYYSILHRDPDQVHRFYHDSSVMSRPEEDG  51



>ref|XP_009628139.1| PREDICTED: putative G3BP-like protein isoform X4 [Nicotiana tomentosiformis]
Length=361

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/307 (42%), Positives = 176/307 (57%), Gaps = 16/307 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV V VTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQKSFNGGVHVFVTGHLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      N +    V +   + P     +P PA   H+  S  + P+
Sbjct  124   RGYFVLNDMFRYVE----IVNQQDTVQVPETDVLAPVTTEQNPPPAQENHI--SEQSKPS  177

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             + +       G +++   E++     E+E+ V       +  +  + ES    I +D PK
Sbjct  178   AEEAN-----GGEVYNPPENDNVPVVEEEVHVAEVVDEVQGDSQMAAESNI--IVEDVPK  230

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASI+        T   +P  A R    K    M        A +P+  S  +D   N
Sbjct  231   KSYASIVMHLKESAATFSPLPAPAPRKIVPKSVGQMSQPPAAAPADSPVLNSDFVDNVNN  290

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              + EA+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQ GFCFGFVEF   +
Sbjct  291   QEGEADGYSIYIKGLPMSATAAMLEDEFKKFGPIKNGGIQVRSNRQHGFCFGFVEFEVES  350

Query  588   SMNNAIQ  568
             ++  AI+
Sbjct  351   AVQKAIE  357


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_010323093.1| PREDICTED: putative G3BP-like protein isoform X3 [Solanum lycopersicum]
Length=475

 Score =   204 bits (518),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 179/328 (55%), Gaps = 27/328 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +  AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDLRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLVRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE   +  +   V   D    V P     DP  A   H+P+       
Sbjct  125   RGYFVLNDMFRYVET-ASQHDTVQVPVTDAVAPVTPEQIVADPPTAPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD---  958
              +D  EV N               S+  ++L+  E            + +    + D   
Sbjct  184   EADVGEVYN--------------PSENGDVLIVEEEVPVSEVVHEVQDGSEVVAESDNKT  229

Query  957   --APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +S   V Q        P + S  I
Sbjct  230   GEVPKKSYASIV-MHLKESAATFSPPPAPAARKPMTKSVVQVNQPAATTTDGPYSSSETI  288

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D + N  E A+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFGFVE
Sbjct  289   D-NINDTEAADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCFGFVE  345

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++  AI+ SP++IGDRQAVVE K
Sbjct  346   FEVESAVQKAIEASPVLIGDRQAVVEEK  373


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>gb|KEH22794.1| nuclear transport factor 2 and RNA recognition motif protein 
[Medicago truncatula]
Length=512

 Score =   204 bits (520),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 164/472 (35%), Positives = 237/472 (50%), Gaps = 115/472 (24%)
 Frame = -2

Query  1872  TTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmd  1693
              T+   VP P+  +VG+AFVEQYY +LH SP+ V+RFYQ+ S L RP+P+G         
Sbjct  2     ATSENQVP-PAPDVVGHAFVEQYYYMLHESPEHVHRFYQDVSKLGRPEPNGI--------  52

Query  1692  vss*VQAIKLLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVL  1513
                    I + + + E                                      ID  +L
Sbjct  53    -------IGITTTMAE--------------------------------------IDKKIL  67

Query  1512  QHLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRK  1333
                     M Y  ++ +I S+D            AQ S+ GGVIVLVTG + GKDN+K+K
Sbjct  68    S-------MGYSELSAEILSVD------------AQESFGGGVIVLVTGFMIGKDNVKQK  108

Query  1332  FTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP----DP--  1171
             FTQ FFLAPQ+KGYFVLND+FRYV+++E          + +    I SP +P    DP  
Sbjct  109   FTQCFFLAPQEKGYFVLNDIFRYVDENE----------IKEPDHAIRSPASPENVLDPLV  158

Query  1170  EPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSAS  991
                 VP+ ++    + D  E++ V    +  +  E++ +   E+LV+     N++Q +A 
Sbjct  159   LETQVPEQISVAAENGDRGELE-VYNPENGQVSVEEEEAPVPEVLVEIP---NDSQKAAG  214

Query  990   LESTTSAIQ---------DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT-----EKQ  853
              +      Q         ++ PK SYASIL  ++ KG         A+ ++T     E+Q
Sbjct  215   FDHVPDDSQKVAELASQIEEVPKKSYASIL--KVMKGAAAPSSVMTAASVRTSIKIQEQQ  272

Query  852   SASMvaqvpvpeapapiaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKY  676
             SA+          P     S + +E  N QE EAEG+SIY++ LP N T A +E +FKK+
Sbjct  273   SAAA---PSPSSVPETNGSSISTNEGGNNQETEAEGYSIYLKGLPGNATHALVENMFKKF  329

Query  675   GPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GPIK GG+QVR+   +GF FGFVEF   ++  +AI+ SPI+I DRQ V+E K
Sbjct  330   GPIKSGGVQVRT--AKGFHFGFVEFEEESAALSAIEASPILINDRQVVIEEK  379



>ref|XP_007157833.1| hypothetical protein PHAVU_002G102000g [Phaseolus vulgaris]
 gb|ESW29827.1| hypothetical protein PHAVU_002G102000g [Phaseolus vulgaris]
Length=460

 Score =   202 bits (515),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 197/328 (60%), Gaps = 32/328 (10%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY ++  EI +ADAQ S+  GVIV+VTGCLTG DNLKRKFTQ+FFLAPQDKG
Sbjct  60    INKKILSLDYTSFRVEILSADAQPSHKDGVIVVVTGCLTGSDNLKRKFTQSFFLAPQDKG  119

Query  1293  YFVLNDVFRYVEQDEADS----NAKMVNGVDDEPTVIPSPEAPDPEPAH----VPDSLNA  1138
             YFVLND+FRY+  DE  S    +A   +  +  PT   +PE   PE  H    VPDS   
Sbjct  120   YFVLNDIFRYI--DEYKSVEIESAPANDAEESAPTDAFTPE---PEVIHDAEDVPDS---  171

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVD--TESHLNENQTSASLESTTSAIQ  964
                ++  ++  +V   + + LE+ K +  EK + V+   ES   E+Q+ A  ++ +S  Q
Sbjct  172   --QTTVVDDDISVSKDVSQPLENGKLLVAEKVVPVNHVKESSHVEHQSHAE-KAASSNSQ  228

Query  963   DDAPKMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
             +D PK S+ASI+++ + N  P  +     AS +K  +Q      +VP   A     PS  
Sbjct  229   EDTPKKSFASIVNALKENAAPFHM----RASPVKAVEQP-----RVPSVPASEAPTPSIE  279

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
                 KN +   + ++I+V NLP N TV +LE VFKK+G IK  GIQVRS++QQG CFGFV
Sbjct  280   SPTEKNNENGGKAYAIFVANLPMNATVEQLERVFKKFGAIKRDGIQVRSSKQQGSCFGFV  339

Query  606   EFHGLNSMNNAIQDS-PIMIGDRQAVVE  526
             EF    SM +A++ S P+ + +R+  +E
Sbjct  340   EFESATSMQSALEASPPVTLDNRRLSIE  367


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+ Q+VGNAFVEQYY ILH  PDQV+RFY ESSV+SRP+ DG
Sbjct  8     PTPQMVGNAFVEQYYSILHQEPDQVHRFYHESSVVSRPEEDG  49



>ref|XP_008382599.1| PREDICTED: putative G3BP-like protein [Malus domestica]
Length=497

 Score =   203 bits (517),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 145/346 (42%), Positives = 195/346 (56%), Gaps = 40/346 (12%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN KI  LDY    A IKT DAQ SYNGGV VLVTG LTGKD +++KFTQ+FFLAPQD
Sbjct  65    EEINKKI--LDYGELSANIKTVDAQESYNGGVFVLVTGYLTGKDLVRKKFTQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              GYFVLNDVFRYVE    E + N  +V+ V+ EP + P  +AP  +  HVP+ + A    
Sbjct  123   VGYFVLNDVFRYVEDSTPENEDNGLVVD-VEVEPPITPKHDAPALQDNHVPEPVIAVSED  181

Query  1125  SDTEEVKNVGIKIHES------------LEDEKQVSDEKEILVDTESHLN---ENQTSAS  991
                EEV    IK  E+             E   +  D+ +++V  E+      E +++  
Sbjct  182   VAKEEV----IKPSENGVVSVEEEAVPEPEVVNEXPDDLQLVVKVEAESYSKVEAESNPK  237

Query  990   LES-------TTSAIQDDAPKMSYASILSSQMNKG--PTKIYVPTNASRMKTEKQSASMv  838
             +E+         S  + +APK SYASIL S M +G  P     P  +   K E Q+ +  
Sbjct  238   VEAEFNSKVEAESNSKVEAPKKSYASILKS-MKEGTVPFSTPAPVRSVPKKQEHQATA--  294

Query  837   aqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHG  658
                P+  + +    ST   E+ N + EAEG+SIY++ LP + T   +E  FKK+G IK  
Sbjct  295   --APISASVSETVSSTNARENGNLEPEAEGYSIYIKGLPMDCTNTVIENEFKKFGQIKKN  352

Query  657   GIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             G+QVR  R  GFCFGFVEF   +S+ +A++ SPI+IG RQ  VE K
Sbjct  353   GVQVRILR--GFCFGFVEFEAASSVQSAMEASPIVIGGRQVFVEEK  396


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M    PA    P+A +VGNAFV QYY IL  SP+ V+RFYQ+ S L RP  DG
Sbjct  4     MVQQAPAASLTPTANVVGNAFVLQYYNILEQSPELVHRFYQDISKLGRPGDDG  56



>ref|XP_003607810.1| Ras GTPase-activating protein-binding protein [Medicago truncatula]
Length=455

 Score =   202 bits (514),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 193/350 (55%), Gaps = 59/350 (17%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+SL+Y ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  49    IDKKIQSLEYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNIKRKFAQSFFLAPQDKG  108

Query  1293  YFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHVPDSLNAN---  1135
             ++VLNDVFRYV+  ++ D  +   N  D+     PS EA   P+PEP HVP+ +      
Sbjct  109   FYVLNDVFRYVDAYKSIDIESVPANDADES---APS-EAIITPEPEPVHVPEVIPPTQTV  164

Query  1134  -PAS-----------SDTEEVKNVGIKIHESLEDEKQVSDEKEILV----DTESHLNENQ  1003
              P +           +DTE +  +  ++   LE+ K    E  I V    ++  H+ E +
Sbjct  165   IPTAQTVIPPTQTVIADTETI--ISKEVSLPLENGKLSVTENVIPVNHVKESSHHVKEPE  222

Query  1002  TSASLESTTSAIQDDAPKMSYASILSS--------QMNKGPTK--IYVPTNASRMKTEKQ  853
                S+E   S  Q+D PK S+ASI+++         +   P K  ++ P   S    E  
Sbjct  223   QPTSIEKVASNTQEDTPKKSFASIVNALKDNSAPFHLRASPAKPAVHPPRVHSVPAPEAP  282

Query  852   SASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYG  673
             + +M                  I   KN +     H+I+V NLP + TV +L+  FKK+G
Sbjct  283   TPNMD-----------------IPLEKNNENAGRAHAIFVANLPMSATVEQLDRAFKKFG  325

Query  672   PIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDS-PIMIGDRQAVVE  526
             PIK  GIQVRSN+  G CFGFVEF    SM +A++ S P+M+ +R+  +E
Sbjct  326   PIKRDGIQVRSNK--GSCFGFVEFESAASMQSALEASPPVMLDNRRLSIE  373


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +VGNAFVEQYY ILH  PDQV+RFY +SSV+SRP+ DG
Sbjct  1     MVGNAFVEQYYSILHRDPDQVHRFYHDSSVMSRPEEDG  38



>gb|AES90007.2| ras-GTPase-activating protein-binding protein, putative [Medicago 
truncatula]
Length=468

 Score =   202 bits (515),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 193/350 (55%), Gaps = 59/350 (17%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI+SL+Y ++  E+ +ADAQ SYN GV+V+VTGCLTG DN+KRKF Q+FFLAPQDKG
Sbjct  62    IDKKIQSLEYTSFRVEVLSADAQPSYNNGVMVVVTGCLTGTDNIKRKFAQSFFLAPQDKG  121

Query  1293  YFVLNDVFRYVEQDEA-DSNAKMVNGVDDEPTVIPSPEA---PDPEPAHVPDSLNAN---  1135
             ++VLNDVFRYV+  ++ D  +   N  D+     PS EA   P+PEP HVP+ +      
Sbjct  122   FYVLNDVFRYVDAYKSIDIESVPANDADES---APS-EAIITPEPEPVHVPEVIPPTQTV  177

Query  1134  -PAS-----------SDTEEVKNVGIKIHESLEDEKQVSDEKEILV----DTESHLNENQ  1003
              P +           +DTE +  +  ++   LE+ K    E  I V    ++  H+ E +
Sbjct  178   IPTAQTVIPPTQTVIADTETI--ISKEVSLPLENGKLSVTENVIPVNHVKESSHHVKEPE  235

Query  1002  TSASLESTTSAIQDDAPKMSYASILSS--------QMNKGPTK--IYVPTNASRMKTEKQ  853
                S+E   S  Q+D PK S+ASI+++         +   P K  ++ P   S    E  
Sbjct  236   QPTSIEKVASNTQEDTPKKSFASIVNALKDNSAPFHLRASPAKPAVHPPRVHSVPAPEAP  295

Query  852   SASMvaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYG  673
             + +M                  I   KN +     H+I+V NLP + TV +L+  FKK+G
Sbjct  296   TPNMD-----------------IPLEKNNENAGRAHAIFVANLPMSATVEQLDRAFKKFG  338

Query  672   PIKHGGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDS-PIMIGDRQAVVE  526
             PIK  GIQVRSN+  G CFGFVEF    SM +A++ S P+M+ +R+  +E
Sbjct  339   PIKRDGIQVRSNK--GSCFGFVEFESAASMQSALEASPPVMLDNRRLSIE  386


 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P  V  P+ Q+VGNAFVEQYY ILH  PDQV+RFY +SSV+SRP+ DG
Sbjct  4     PEAVQTPTPQMVGNAFVEQYYSILHRDPDQVHRFYHDSSVMSRPEEDG  51



>ref|XP_010323094.1| PREDICTED: putative G3BP-like protein isoform X4 [Solanum lycopersicum]
 ref|XP_010323095.1| PREDICTED: putative G3BP-like protein isoform X4 [Solanum lycopersicum]
Length=474

 Score =   202 bits (515),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 178/328 (54%), Gaps = 28/328 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y +  AEIK+ DAQ S+NGGV VLVTG LTGKDNL R F QTFFLAPQD
Sbjct  65    QAINDKILSLNYGDLRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLVRNFCQTFFLAPQD  124

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE   +  +   V   D    V P     DP  A   H+P+       
Sbjct  125   RGYFVLNDMFRYVET-ASQHDTVQVPVTDAVAPVTPEQIVADPPTAPQNHIPEQSTPPAE  183

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD---  958
              +D  EV N               S+  ++L+  E            + +    + D   
Sbjct  184   EADVGEVYN--------------PSENGDVLIVEEEVPVSEVVHEVQDGSEVVAESDNKT  229

Query  957   --APKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +S   V Q        P + S  I
Sbjct  230   GEVPKKSYASIV-MHLKESAATFSPPPAPAARKPMTKSVVQVNQPAATTTDGPYSSSETI  288

Query  783   DESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVE  604
             D   +   EA+G+SIY++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFGFVE
Sbjct  289   DNINDT--EADGYSIYIKGLPMSATVALLADEFKKFGPIKNGGIQVRSNR--GFCFGFVE  344

Query  603   FHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             F   +++  AI+ SP++IGDRQAVVE K
Sbjct  345   FEVESAVQKAIEASPVLIGDRQAVVEEK  372


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  1824  NAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  22    NAFVQQYYHILHHSPGLVFRFYQDISKLGRPEEDG  56



>ref|XP_006280786.1| hypothetical protein CARUB_v10026755mg [Capsella rubella]
 ref|XP_006280787.1| hypothetical protein CARUB_v10026755mg [Capsella rubella]
 gb|EOA13684.1| hypothetical protein CARUB_v10026755mg [Capsella rubella]
 gb|EOA13685.1| hypothetical protein CARUB_v10026755mg [Capsella rubella]
Length=332

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 132/292 (45%), Positives = 163/292 (56%), Gaps = 30/292 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL YE+Y AEI+TADAQ S+  GVIVLVTG LTG DN+++KF+QTFFLAPQD
Sbjct  60    QAINDKILSLKYEDYTAEIETADAQESHEKGVIVLVTGHLTGNDNVRKKFSQTFFLAPQD  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMV--NG--------VDDEPTVIPSPEAPDPEPAHVPD  1150
             KGYFVLNDVFR++E+ E  + A+ V  NG        V+ E  V+      +PEP     
Sbjct  120   KGYFVLNDVFRFLEEKEVTAQARSVTINGTTRDVQAPVEPERVVVSHEAEVEPEPV----  175

Query  1149  SLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSA  970
                   AS + E++ NV      S +DE  V D + I   T+   NE           S 
Sbjct  176   ------ASIEEEDLDNVAEVYDPSDKDEGVVVDVEPIKPPTQLSHNE---------VVSV  220

Query  969   IQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPST  790
              Q DAPK SYASIL   MN GP    V  N  R      +     +   P A    +   
Sbjct  221   SQGDAPKHSYASIL-KLMNSGPAPTQVARNKPRAAPVSTNQKPTGRPSEPVAAPEASAHE  279

Query  789   AIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNR  634
              +  S +   E +GHSIYVRNLPF+ T  +LE VFK +G IKH GIQVRSN+
Sbjct  280   NVPNSSHVDVEDDGHSIYVRNLPFDSTPTQLEEVFKNFGAIKHEGIQVRSNK  331


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 4/52 (8%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPD  1729
             MA Q  +P+    P A++VG AFVEQYY ILH SP  VYRFYQ+SS+L+RPD
Sbjct  1     MAQQEASPS----PGAEVVGRAFVEQYYHILHQSPGLVYRFYQDSSLLTRPD  48



>ref|XP_009614847.1| PREDICTED: putative G3BP-like protein isoform X3 [Nicotiana tomentosiformis]
Length=472

 Score =   202 bits (513),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 185/332 (56%), Gaps = 33/332 (10%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE + +  +A  V   D E  V P     DP P    H+P+       
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQIVADPPPVQENHIPEQSTPPAE  181

Query  1128  SSDTEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTS  973
              +D  EV N        +  +     E   +V D  E++V++++   E            
Sbjct  182   EADVGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE------------  229

Query  972   AIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPS  793
                   PK SYASI+   + +       P   +  K   +    V Q        P++ S
Sbjct  230   -----VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSS  283

Query  792   TAIDESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCF  616
              ++D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCF
Sbjct  284   DSVDNINDPEGEAADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNR--GFCF  341

Query  615   GFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             GFVEF   +++  AI+ SP++IG  QAVVE K
Sbjct  342   GFVEFEVESAVQKAIEASPVLIGGWQAVVEEK  373


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_009395104.1| PREDICTED: putative G3BP-like protein isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 189/329 (57%), Gaps = 25/329 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+ N   EIKT D+Q SY  GV+++VTG   G++N+K KF Q+FFLAPQ+
Sbjct  28    QAINEKIMSLDFRNCFTEIKTIDSQLSYQNGVLIVVTGSFIGQENVKSKFAQSFFLAPQE  87

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPE----PAHVPDSLNA  1138
              G YFVLNDVFR++ E    + N  + +G +D+   + +P   D E      H  ++L  
Sbjct  88    NGGYFVLNDVFRFLSETQPREMNHFLSDGTNDD--ALKAPLTSDTEQNLQEYHDVETLQT  145

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
                  + E+V N        +EDE        ++VD  ++ +E  +  + E   S  QDD
Sbjct  146   EEDGDNMEDVLNQSEDGGSGVEDE--------VVVDLPANASEIDSQTTHEVIASGAQDD  197

Query  957   APKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
              PK SYASI+  ++ KG   P  ++V   A   K   +   +V+  P       +     
Sbjct  198   VPKKSYASIV--KVMKGSPSPALVHVTPKA---KVAAEKPVVVSPTPATVPETSVPAIND  252

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             + E+KN  EE EGHSIY+RNL  N T  ++E  FKK+GPIK GG+QVRS++ + +CFGFV
Sbjct  253   VPENKNNVEE-EGHSIYIRNLSPNATAEKVEEEFKKFGPIKPGGVQVRSHKVERYCFGFV  311

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF  L SM  AI+ SPI IG RQA+V+ K
Sbjct  312   EFESLKSMQAAIEASPITIGGRQAIVQEK  340



>ref|XP_010939187.1| PREDICTED: putative G3BP-like protein isoform X2 [Elaeis guineensis]
Length=448

 Score =   201 bits (511),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 179/326 (55%), Gaps = 36/326 (11%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SLD+++Y  +I+T D+Q SY  GV ++VTG LTG DN+ RKF Q+FFLAPQ+
Sbjct  62    QAINDKIMSLDFKDYFTKIETVDSQMSYKNGVFIVVTGSLTGLDNVWRKFAQSFFLAPQE  121

Query  1299  K-GYFVLNDVFRYV-EQDEADSNAKMVNGV-DDEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
               GYFVLNDVFR+V E   A+ N  + NG   D P    +P   +PEPA + +   A  A
Sbjct  122   NGGYFVLNDVFRFVNENKPAEMNQPLANGTSSDAPK---TPLTAEPEPASIQERHVAELA  178

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             +  +E   + G ++    E+      E E++VD   H + N      E+T S   +DAPK
Sbjct  179   TPLSEGDADNGEEVFNPSENGGS-GVEDEVVVDPPVHESHNDAQPGSETTASVAHEDAPK  237

Query  948   MSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDE  778
              SYASI+  ++ KG   P  +YVPT  ++    K     V       A     P++ + E
Sbjct  238   KSYASIV--KVMKGSPSPKPVYVPTAKTKPSPAKPEKPAVVSTAPAHASETPVPNSTVPE  295

Query  777   SKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFH  598
               N   E EGHSIY+RNLP N T  ++E  FKK+GPIK GG+QVRS++            
Sbjct  296   --NNSHEVEGHSIYIRNLPLNATAEQVEEEFKKFGPIKPGGVQVRSHKA-----------  342

Query  597   GLNSMNNAIQDSPIMIGDRQAVVEIK  520
                        SPIMIG RQA VE K
Sbjct  343   -----------SPIMIGGRQAYVEEK  357



>ref|XP_009395103.1| PREDICTED: putative G3BP-like protein isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=440

 Score =   201 bits (510),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 189/329 (57%), Gaps = 25/329 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+ N   EIKT D+Q SY  GV+++VTG   G++N+K KF Q+FFLAPQ+
Sbjct  28    QAINEKIMSLDFRNCFTEIKTIDSQLSYQNGVLIVVTGSFIGQENVKSKFAQSFFLAPQE  87

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPE----PAHVPDSLNA  1138
              G YFVLNDVFR++ E    + N  + +G +D+   + +P   D E      H  ++L  
Sbjct  88    NGGYFVLNDVFRFLSETQPREMNHFLSDGTNDD--ALKAPLTSDTEQNLQEYHDVETLQT  145

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
                  + E+V N        +EDE        ++VD  ++ +E  +  + E   S  QDD
Sbjct  146   EEDGDNMEDVLNQSEDGGSGVEDE--------VVVDLPANASEIDSQTTHEVIASGAQDD  197

Query  957   APKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
              PK SYASI+  ++ KG   P  ++V   A   K   +   +V+  P       +     
Sbjct  198   VPKKSYASIV--KVMKGSPSPALVHVTPKA---KVAAEKPVVVSPTPATVPETSVPAIND  252

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             + E+KN  EE EGHSIY+RNL  N T  ++E  FKK+GPIK GG+QVRS++ + +CFGFV
Sbjct  253   VPENKNNVEE-EGHSIYIRNLSPNATAEKVEEEFKKFGPIKPGGVQVRSHKVERYCFGFV  311

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF  L SM  AI+ SPI IG RQA+V+ K
Sbjct  312   EFESLKSMQAAIEASPITIGGRQAIVQEK  340



>ref|XP_010913086.1| PREDICTED: ras GTPase-activating protein-binding protein 1 [Elaeis 
guineensis]
Length=470

 Score =   201 bits (512),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/322 (42%), Positives = 192/322 (60%), Gaps = 13/322 (4%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI S+D+  + AEIKT D+Q+S +GGV+VLVTG LTGKDN+KR FTQ+FFLAPQDKG
Sbjct  68    INEKILSMDF--HRAEIKTVDSQDSLDGGVLVLVTGYLTGKDNVKRDFTQSFFLAPQDKG  125

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             +FVLND+FRYV + E    ++ +      P  +     P  E  HV +  ++ P   +  
Sbjct  126   FFVLNDIFRYVGEAEHQHGSQDLENGAGAPLSLDQDSPPQQE-QHVSEPNSSLPEEEEEA  184

Query  1113  EVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYAS  934
              V+ V            +  +    ++D     N  Q   S ++  + +Q++APK SYAS
Sbjct  185   SVEEVSNPSDNGEGSVVEEEEPVGEVIDEAP--NSLQAVIS-DAAAATVQEEAPKKSYAS  241

Query  933   ILSSQMNKGPTKIYVPTNASR----MKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             I+   M +    + VPT+AS      K E+Q+A        P+ PA  + +     ++ A
Sbjct  242   IVKV-MKENAAPLSVPTSASARPPPAKPERQAAPAPTATIAPDTPAASSSAVESSNAQEA  300

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
               EA+GHSIY+++LP N T  +LE  FK++G IK GGIQVRS++ QGFCFGFVEF   ++
Sbjct  301   --EADGHSIYIKSLPLNATPDQLEEEFKRFGRIKPGGIQVRSHKLQGFCFGFVEFEEASA  358

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             + +AI+ SP+ IG RQA VE K
Sbjct  359   VQSAIEASPVTIGGRQAYVEEK  380


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -2

Query  1884  MAMQTTTPATVPG--PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA   T+ AT  G  PSAQ+VGNAFV+QYY ILH SP+ VYRFYQESS L RP+  G
Sbjct  1     MAAPQTSAATAAGSPPSAQVVGNAFVQQYYHILHQSPELVYRFYQESSKLGRPEAHG  57



>ref|XP_009614850.1| PREDICTED: putative G3BP-like protein isoform X6 [Nicotiana tomentosiformis]
Length=469

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 184/329 (56%), Gaps = 30/329 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDNL   F QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIKSVDAQESFNGGVHVLVTGYLTGKDNLILNFCQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRYVE + +  +A  V   D E  V P    P  +  H+P+        +D
Sbjct  123   RGYFVLNDMFRYVE-NVSQHDAVQVPVTDAEAPVTPQQNPPPVQENHIPEQSTPPAEEAD  181

Query  1119  TEEVKN--------VGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
               EV N        +  +     E   +V D  E++V++++   E               
Sbjct  182   VGEVYNPPENGDVPIVEEEVPVSEVVDEVQDGSEVVVESDTKTGE---------------  226

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
                PK SYASI+   + +       P   +  K   +    V Q        P++ S ++
Sbjct  227   --VPKKSYASIV-MHLKESAATFSPPPAPAPRKPMAKRVEQVNQPATTATDGPVSSSDSV  283

Query  783   DESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             D   + + E A+G+S+Y++ LP + TVA L   FKK+GPIK+GGIQVRSNR  GFCFGFV
Sbjct  284   DNINDPEGEAADGYSVYIKGLPMSATVALLGDEFKKFGPIKNGGIQVRSNR--GFCFGFV  341

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF   +++  AI+ SP++IG  QAVVE K
Sbjct  342   EFEVESAVQKAIEASPVLIGGWQAVVEEK  370


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  54



>ref|XP_009395101.1| PREDICTED: putative G3BP-like protein isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 189/329 (57%), Gaps = 25/329 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+ N   EIKT D+Q SY  GV+++VTG   G++N+K KF Q+FFLAPQ+
Sbjct  62    QAINEKIMSLDFRNCFTEIKTIDSQLSYQNGVLIVVTGSFIGQENVKSKFAQSFFLAPQE  121

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPE----PAHVPDSLNA  1138
              G YFVLNDVFR++ E    + N  + +G +D+   + +P   D E      H  ++L  
Sbjct  122   NGGYFVLNDVFRFLSETQPREMNHFLSDGTNDD--ALKAPLTSDTEQNLQEYHDVETLQT  179

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
                  + E+V N        +EDE        ++VD  ++ +E  +  + E   S  QDD
Sbjct  180   EEDGDNMEDVLNQSEDGGSGVEDE--------VVVDLPANASEIDSQTTHEVIASGAQDD  231

Query  957   APKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
              PK SYASI+  ++ KG   P  ++V   A   K   +   +V+  P       +     
Sbjct  232   VPKKSYASIV--KVMKGSPSPALVHVTPKA---KVAAEKPVVVSPTPATVPETSVPAIND  286

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             + E+KN  EE EGHSIY+RNL  N T  ++E  FKK+GPIK GG+QVRS++ + +CFGFV
Sbjct  287   VPENKNNVEE-EGHSIYIRNLSPNATAEKVEEEFKKFGPIKPGGVQVRSHKVERYCFGFV  345

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF  L SM  AI+ SPI IG RQA+V+ K
Sbjct  346   EFESLKSMQAAIEASPITIGGRQAIVQEK  374


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 10/85 (12%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsv  1705
             MA+ T +P +   P  Q++GNAFV+QYY ILH SP+ V++FYQ+SS+++RP+ DG     
Sbjct  1     MALPTASPVSPLSP--QVIGNAFVQQYYQILHQSPEMVHKFYQDSSIVNRPNSDG-----  53

Query  1704  ttmdvss*VQAI--KLLSCLKEACF  1636
               M   + +QAI  K++S     CF
Sbjct  54    -EMTSVTTMQAINEKIMSLDFRNCF  77



>ref|XP_009395099.1| PREDICTED: putative G3BP-like protein isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395100.1| PREDICTED: putative G3BP-like protein isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 134/329 (41%), Positives = 189/329 (57%), Gaps = 25/329 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SLD+ N   EIKT D+Q SY  GV+++VTG   G++N+K KF Q+FFLAPQ+
Sbjct  62    QAINEKIMSLDFRNCFTEIKTIDSQLSYQNGVLIVVTGSFIGQENVKSKFAQSFFLAPQE  121

Query  1299  KG-YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPEAPDPE----PAHVPDSLNA  1138
              G YFVLNDVFR++ E    + N  + +G +D+   + +P   D E      H  ++L  
Sbjct  122   NGGYFVLNDVFRFLSETQPREMNHFLSDGTNDD--ALKAPLTSDTEQNLQEYHDVETLQT  179

Query  1137  NPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDD  958
                  + E+V N        +EDE        ++VD  ++ +E  +  + E   S  QDD
Sbjct  180   EEDGDNMEDVLNQSEDGGSGVEDE--------VVVDLPANASEIDSQTTHEVIASGAQDD  231

Query  957   APKMSYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTA  787
              PK SYASI+  ++ KG   P  ++V   A   K   +   +V+  P       +     
Sbjct  232   VPKKSYASIV--KVMKGSPSPALVHVTPKA---KVAAEKPVVVSPTPATVPETSVPAIND  286

Query  786   IDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             + E+KN  EE EGHSIY+RNL  N T  ++E  FKK+GPIK GG+QVRS++ + +CFGFV
Sbjct  287   VPENKNNVEE-EGHSIYIRNLSPNATAEKVEEEFKKFGPIKPGGVQVRSHKVERYCFGFV  345

Query  606   EFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             EF  L SM  AI+ SPI IG RQA+V+ K
Sbjct  346   EFESLKSMQAAIEASPITIGGRQAIVQEK  374


 Score = 68.6 bits (166),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 55/85 (65%), Gaps = 10/85 (12%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsv  1705
             MA+ T +P +   P  Q++GNAFV+QYY ILH SP+ V++FYQ+SS+++RP+ DG     
Sbjct  1     MALPTASPVSPLSP--QVIGNAFVQQYYQILHQSPEMVHKFYQDSSIVNRPNSDG-----  53

Query  1704  ttmdvss*VQAI--KLLSCLKEACF  1636
               M   + +QAI  K++S     CF
Sbjct  54    -EMTSVTTMQAINEKIMSLDFRNCF  77



>ref|XP_009766788.1| PREDICTED: putative G3BP-like protein [Nicotiana sylvestris]
Length=473

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 190/322 (59%), Gaps = 16/322 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEI + DAQ SYNGGV VLVTG L+G DN+ R F+QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIISVDAQESYNGGVHVLVTGLLSGNDNVVRNFSQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTV-IPSPEAPDPEPAHVPDSLNANPASS  1123
             +GYFVLND+FRY      DS  + V    + P + + +P  P+ +P  V  +  +  +S 
Sbjct  123   RGYFVLNDMFRY-----GDSVNQHVTA--EVPAINVVAPVTPEQDPPPVQQNHMSEQSSP  175

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
               EE  N G +++   E+      E++ + +    ++E Q  + +   ++   +DAPK S
Sbjct  176   SVEEA-NEG-EVYNPPENGDIPVKEEDPVAEV---VDEMQDDSQIAVESNIKSEDAPKKS  230

Query  942   YASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQ  763
             YASI+   + +       P   +  K   +S     Q P+     P     +++++ N +
Sbjct  231   YASIV-MHLKESAASFSPPPAPAHRKPMAKSVEQANQPPITATDGPAYSIDSVNDANNQE  289

Query  762   EEA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
              EA EG+SIY++ LP + TVA L   FKK+GPIK GGIQVR NR QGF FGFVEF   ++
Sbjct  290   GEATEGYSIYIKGLPMSATVALLADEFKKFGPIKTGGIQVR-NRHQGFSFGFVEFEVASA  348

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             +  AI+ SPI IG RQAVVE K
Sbjct  349   VQKAIEASPISIGGRQAVVEEK  370


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QY+ ILHHSP  V+RFYQE S L RP+ DG
Sbjct  14    SAQVVANAFVQQYFHILHHSPGLVFRFYQEISKLGRPEDDG  54



>ref|XP_004231668.1| PREDICTED: putative G3BP-like protein [Solanum lycopersicum]
Length=222

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 136/207 (66%), Gaps = 30/207 (14%)
 Frame = -2

Query  1488  MLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLA  1309
             M+ Q IN  I SLDY+NY AEI+TADAQ+S+  GV+VLV GCLTG+DNLK KF QTFFLA
Sbjct  1     MIEQNINTLICSLDYKNYKAEIRTADAQDSFKDGVVVLVNGCLTGRDNLKSKFAQTFFLA  60

Query  1308  PQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPA  1129
             P +KGYFVLNDVFRY E ++ D+ ++++NG +                            
Sbjct  61    PHEKGYFVLNDVFRYGEDNKIDTISEVLNGTE----------------------------  92

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
               D  EV++V  K ++S  D +QV+DE+EI+V+T S+ NE+Q   + E   S  Q+DAPK
Sbjct  93    --DAREVQHVEEKANDSSIDRRQVADEREIVVETGSYFNEDQHPTNTELANSVAQEDAPK  150

Query  948   MSYASILSSQMNKGPTKIYVPTNASRM  868
              SYAS +SSQ+ KGPTKI+V TN SR+
Sbjct  151   KSYASNVSSQIKKGPTKIHVSTNTSRV  177



>ref|XP_009628136.1| PREDICTED: putative G3BP-like protein isoform X1 [Nicotiana tomentosiformis]
Length=365

 Score =   198 bits (503),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 178/313 (57%), Gaps = 24/313 (8%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV V VTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQKSFNGGVHVFVTGHLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVE----QDEAD-SNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSL  1144
             +GYFVLND+FRYVE    QD        ++  V  E TV       DP PA   H+  S 
Sbjct  124   RGYFVLNDMFRYVEIVNQQDTVQVPETDVLAPVTTEQTVA------DPPPAQENHI--SE  175

Query  1143  NANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQ  964
              + P++ +       G +++   E++     E+E+ V       +  +  + ES    I 
Sbjct  176   QSKPSAEEAN-----GGEVYNPPENDNVPVVEEEVHVAEVVDEVQGDSQMAAESNI--IV  228

Query  963   DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAI  784
             +D PK SYASI+        T   +P  A R    K    M        A +P+  S  +
Sbjct  229   EDVPKKSYASIVMHLKESAATFSPLPAPAPRKIVPKSVGQMSQPPAAAPADSPVLNSDFV  288

Query  783   DESKNAQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFV  607
             D   N + E A+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQ GFCFGFV
Sbjct  289   DNVNNQEGEAADGYSIYIKGLPMSATAAMLEDEFKKFGPIKNGGIQVRSNRQHGFCFGFV  348

Query  606   EFHGLNSMNNAIQ  568
             EF   +++  AI+
Sbjct  349   EFEVESAVQKAIE  361


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>ref|XP_009588969.1| PREDICTED: putative G3BP-like protein isoform X1 [Nicotiana tomentosiformis]
Length=475

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 192/321 (60%), Gaps = 14/321 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEI + DAQ SYNGGV VLVTG L G DN+ R F+QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIISVDAQESYNGGVHVLVTGLLAGNDNVVRNFSQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRY      DS  + V   +   T   +P  P+ +P  V  + N+  +S  
Sbjct  123   RGYFVLNDMFRY-----GDSVNQHVT-TEVPATNAVAPVTPEQDPPPVQQNHNSEQSSPS  176

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE  N G +++   E+     +E+  + +    + ++ +  ++ES   +  +DAPK SY
Sbjct  177   VEEA-NEG-EVYNPPENGDMPVEEEVPVAEVVDEM-QDDSQIAVESNIKS--EDAPKKSY  231

Query  939   ASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             ASI+   + +       P+  +  K   +S   V Q P+     P     +++++ N + 
Sbjct  232   ASIV-MHLKESAASFSPPSAPAHRKPTAKSVEQVNQPPITATDGPAFSVDSVNDANNQEG  290

Query  759   EA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
             EA EG+SIY++ LP + TVA L   FKK+GPIK GGIQVR NRQQGF FGFVEF   +++
Sbjct  291   EATEGYSIYIKGLPMSATVALLADEFKKFGPIKTGGIQVR-NRQQGFSFGFVEFEVASAV  349

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
               AI+ SPI IG RQAVVE K
Sbjct  350   QKAIEASPISIGGRQAVVEEK  370


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQE S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQEISKLGRPEDDG  54



>ref|XP_009412730.1| PREDICTED: putative G3BP-like protein isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=484

 Score =   201 bits (511),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 189/327 (58%), Gaps = 18/327 (6%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI S+DY  + AEIKT DAQ S +GG++VLVTG LTGKD++KR FTQ+FFLA QDKG
Sbjct  65    INEKILSVDYSEFRAEIKTVDAQESLDGGIVVLVTGYLTGKDDVKRNFTQSFFLATQDKG  124

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEP---------TVIPSPEAPDPEPAHVPDSLN  1141
             Y+VLND+FRYV+       +  +   D  P         T+    EAP  +   V ++  
Sbjct  125   YYVLNDIFRYVDDGNDQWESGALTSGDRAPLAPEQGIDGTLEQQQEAPPKQDQQVTEAPE  184

Query  1140  ANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQD  961
                  ++ E   +  I+   +LE+E    +    ++D  + +++   +   +S ++AI +
Sbjct  185   EV-ELNEEEVFNSPEIEDAPTLEEEAPTIE----MIDEVAKISQTVVA---DSGSAAILE  236

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
              APK SYASI+       P  +  P  +     +    +     P P      A STA +
Sbjct  237   GAPKKSYASIVKVMKENAPPSVPAPVPSRSAVVDIDQLASPVPTPAPAPNNTSAGSTAGE  296

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
              +   + E +G+SIY++NLP N T A+L+  FKK+GPIK GGIQVRS++ QGFCFGFVEF
Sbjct  297   SNSTQESEVDGYSIYIKNLPLNATPAQLDEEFKKFGPIKPGGIQVRSHK-QGFCFGFVEF  355

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                +++  AI+ SPIMIG RQA VE K
Sbjct  356   EVASAVQCAIEASPIMIGGRQAFVEEK  382


 Score = 65.9 bits (159),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDP  1726
             MA + + P     P AQ+VGNAFV QYY +LH SP  V+RFYQE+S L RPDP
Sbjct  1     MASEQSAPVGSSHP-AQVVGNAFVNQYYHVLHRSPQLVFRFYQEASKLGRPDP  52



>ref|XP_009628138.1| PREDICTED: putative G3BP-like protein isoform X3 [Nicotiana tomentosiformis]
Length=362

 Score =   197 bits (501),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 176/308 (57%), Gaps = 17/308 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y ++ AEI++ D+Q S+NGGV V VTG LTGKDNL R F+QTFFLAPQD
Sbjct  64    QAINEKILSLNYADFRAEIRSVDSQKSFNGGVHVFVTGHLTGKDNLIRNFSQTFFLAPQD  123

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA---HVPDSLNANPA  1129
             +GYFVLND+FRYVE      N +    V +   + P     +P PA   H+  S  + P+
Sbjct  124   RGYFVLNDMFRYVE----IVNQQDTVQVPETDVLAPVTTEQNPPPAQENHI--SEQSKPS  177

Query  1128  SSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPK  949
             + +       G +++   E++     E+E+ V       +  +  + ES    I +D PK
Sbjct  178   AEEAN-----GGEVYNPPENDNVPVVEEEVHVAEVVDEVQGDSQMAAESNI--IVEDVPK  230

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              SYASI+        T   +P  A R    K    M        A +P+  S  +D   N
Sbjct  231   KSYASIVMHLKESAATFSPLPAPAPRKIVPKSVGQMSQPPAAAPADSPVLNSDFVDNVNN  290

Query  768   AQ-EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
              + E A+G+SIY++ LP + T A LE  FKK+GPIK+GGIQVRSNRQ GFCFGFVEF   
Sbjct  291   QEGEAADGYSIYIKGLPMSATAAMLEDEFKKFGPIKNGGIQVRSNRQHGFCFGFVEFEVE  350

Query  591   NSMNNAIQ  568
             +++  AI+
Sbjct  351   SAVQKAIE  358


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  V+RFYQ+ S L RP+ DG
Sbjct  15    SAQVVGNAFVQQYYHILHHSPGLVFRFYQDISKLGRPEDDG  55



>gb|KCW64878.1| hypothetical protein EUGRSUZ_G02443 [Eucalyptus grandis]
Length=374

 Score =   197 bits (501),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 184/318 (58%), Gaps = 26/318 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDK-  1297
             IN+KI SLDYE Y  EI TADAQ S+ GGV VLVTGCL G+DN++R FTQ+FFLAPQ   
Sbjct  73    INEKILSLDYEKYKIEILTADAQASHEGGVQVLVTGCLMGEDNIRRIFTQSFFLAPQKTG  132

Query  1296  GYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             GYFVLND+FRYVE +     +       +E   + +P   DPEPA + D     P   +T
Sbjct  133   GYFVLNDIFRYVEGESPLPVSPAER--HEELRAVEAPPMLDPEPAQIVDP----PVEVET  186

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
               V+    +I  ++E+ ++ +D KEI+V+  +  +E   S        A Q DAPK S+A
Sbjct  187   PLVE----EIVPAVENGEESADGKEIVVEPIADSSEKDDSTVAVPVPDA-QVDAPKKSFA  241

Query  936   SILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+S+   +  P ++  P +    +    +A                P+ +I   K+  +
Sbjct  242   SIVSALNDSAAPFQMRAPVSKPVARPRASTAP-----------KSPVPNESIPAEKSEIQ  290

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
               + HSI+V NLP + T  +LE  FKK+G IK  GIQVRS++  G C+GFVEF   +SM 
Sbjct  291   PVKRHSIFVGNLPLDATPDQLETAFKKFGSIKPNGIQVRSSK--GSCYGFVEFEAESSMQ  348

Query  579   NAIQDSPIMIGDRQAVVE  526
             +A++++ IMIG R+A +E
Sbjct  349   SALEENSIMIGTRKAHIE  366


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -2

Query  1848  GPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
              P  + VGNAF+EQYY +LH +P   +RFY E S L RP PDG
Sbjct  20    APDPKSVGNAFIEQYYPVLHSNPTVAHRFYHEESQLGRPGPDG  62



>ref|XP_002273770.2| PREDICTED: ras GTPase-activating protein-binding protein 1 [Vitis 
vinifera]
 emb|CBI25667.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   199 bits (507),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 186/320 (58%), Gaps = 21/320 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y +  AEIK+ DAQ S+ GGV+VLVTG LTGKDN  R FTQ+FFLAPQDKG
Sbjct  63    INEKILSLNYGDLIAEIKSVDAQESFGGGVLVLVTGYLTGKDNRSRDFTQSFFLAPQDKG  122

Query  1293  YFVLNDVFRYVEQDE-ADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             YFVLND+FRY+E  +  D N  +V+ V+       +P  P+ +P+ V ++    P     
Sbjct  123   YFVLNDLFRYIEDVKYQDGNPGLVSEVE-------APLTPEQDPSPVQENHILEPTPEVP  175

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             EEV        E+ E     +  +E        ++E Q    +  + S I  + PK SYA
Sbjct  176   EEVNEEVYNPSENGE-----ASVEEEEAPVAEVVDEIQDDQMVTISDSKIL-EVPKKSYA  229

Query  936   SILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe-apapiaPSTAIDESKNAQE  760
             SI+     K   +  VP ++      +    +  Q       P P A + AI+   N + 
Sbjct  230   SIV-----KVMKESSVPFSSPTPIPPRPVPKIQEQQVTVAPLPTPGAEANAIENGNNQEG  284

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             EA+GHSIY+R LP N T A LE  FKK+GPIK GG+QVRSN+ QGFCFGFVEF   +++ 
Sbjct  285   EADGHSIYIRGLPSNATPALLEDEFKKFGPIKSGGVQVRSNK-QGFCFGFVEFEVASAVQ  343

Query  579   NAIQDSPIMIGDRQAVVEIK  520
             +A++ SPI IG RQA VE K
Sbjct  344   SAMEASPITIGGRQAFVEEK  363


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q    +T    +AQ+VGNAFV QYY ILH SP+ V+RFYQ+ S L R + +G
Sbjct  1     MAQQAPAGST---HAAQVVGNAFVHQYYHILHQSPELVFRFYQDISKLGRLEENG  52



>ref|XP_004515039.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
[Cicer arietinum]
Length=484

 Score =   199 bits (507),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 132/322 (41%), Positives = 184/322 (57%), Gaps = 26/322 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I+ KI SL Y    AEI + DAQ SY+GGVIVLVTG + GKD++K+KFTQ FFLAPQ+KG
Sbjct  65    IDKKILSLGYSELSAEIISVDAQESYDGGVIVLVTGFMMGKDDIKQKFTQCFFLAPQEKG  124

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPA----HVPDSLNANPAS  1126
             YFVLNDVFRYV+++E       + G D E   I SP  PD +P+     V + ++     
Sbjct  125   YFVLNDVFRYVDENE-------IKGSDRE---IGSPATPDNDPSVLETQVSEQISVTAED  174

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
              D EEV N          + +QVS E+E        L+E    + + +  ++  ++ PK 
Sbjct  175   GDGEEVYN---------PENEQVSAEEE-EAPVPEVLDEIPDDSQMVAGLASQIEEVPKK  224

Query  945   SYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             SYASI+      G   +   +  S  K ++Q +++    P        +     +   N 
Sbjct  225   SYASIVKVMKEGGAAPLPAVSVKSASKVQEQQSTVAPPPPSMSETNGSSIINTNEGGNNQ  284

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNS  586
             + EAEG+SIY++ LP N T A LE  FKK+GPIK GGIQVR+  Q+GF FGFVEF   ++
Sbjct  285   ETEAEGYSIYLKGLPPNATPALLENEFKKFGPIKSGGIQVRA--QKGFYFGFVEFEVASA  342

Query  585   MNNAIQDSPIMIGDRQAVVEIK  520
             + +A++ SPI+I  R  VVE K
Sbjct  343   VQSALEVSPILINGRHVVVEEK  364


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = -2

Query  1875  QTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             Q   P T   P+  +VGNAFV+QYY +LH SP  V+RFYQE S L RP+P+G
Sbjct  6     QQAPPKT---PAPDVVGNAFVDQYYHMLHESPQLVHRFYQEVSKLGRPEPNG  54



>ref|XP_002312286.1| nuclear transport factor 2 family protein [Populus trichocarpa]
 gb|EEE89653.1| nuclear transport factor 2 family protein [Populus trichocarpa]
Length=454

 Score =   198 bits (503),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 133/327 (41%), Positives = 186/327 (57%), Gaps = 20/327 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + I   I SLDY+N   EI+T D+Q SY   V+V+VTG   GKD+ +++FTQ FFL PQD
Sbjct  62    EEIKKLILSLDYKNCVVEIQTVDSQESYENAVMVIVTGFFAGKDSDRKRFTQAFFLVPQD  121

Query  1299  KG--YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              G  YFVLND+FRYVE+ E   N K+ +  +  P   P+P  P PEP  VPD   A   S
Sbjct  122   DGTTYFVLNDIFRYVEESE---NKKISDADNIAP---PTPVTPSPEPPSVPDHTVAVNVS  175

Query  1125  SDTEEVKNVGIKIHES---LEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             ++ EE    G++  ES   L++ +    EK+I+V+ E    +N      E+  S++Q+DA
Sbjct  176   TNLEEG---GVQAKESGHPLDNGEIPISEKDIVVEKEVVATQNDAHPVSEAVASSVQEDA  232

Query  954   PKMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQS-ASMvaqvpvpeapapiaPSTAID  781
             PK SYAS++++  +   P +  V    S +K  KQS  ++       +  +P  P   I 
Sbjct  233   PKKSYASVVNALNLKTQPFQQRV----SDVKPVKQSYTAVPPMASSHQTGSPRPPGNNIV  288

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
             E  N     EG+SI+V NLP + TV EL   F K+G IK  G+QVRS +Q   CFGFVEF
Sbjct  289   EINNNSTAVEGYSIFVANLPMDATVDELIQTFSKFGAIKPNGVQVRSYKQDKNCFGFVEF  348

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                NS+  A++ S + IG R A +E K
Sbjct  349   ESANSVEKALEVSTVTIGTRTAHIERK  375



>ref|XP_002303062.2| hypothetical protein POPTR_0002s24800g [Populus trichocarpa]
 gb|EEE82335.2| hypothetical protein POPTR_0002s24800g [Populus trichocarpa]
Length=402

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 132/334 (40%), Positives = 187/334 (56%), Gaps = 27/334 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL Y    AEI T D+Q SY GGV+VLVTG L G DNL++KFTQ+FFLAPQDKG
Sbjct  63    INEKILSLGYGQVRAEIVTVDSQESYKGGVLVLVTGYLNGNDNLRQKFTQSFFLAPQDKG  122

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+    DS  +  NG  +  +   +P APD +  H  ++  + P ++ +E
Sbjct  123   YFVLNDVFRYVD----DSTHQ--NGNQEPASNFEAPVAPDQDTPHTQETHISEPTAALSE  176

Query  1113  EVKNVGIKIHESLEDE----------------KQVSDEKEILVDTESHLNENQTSASLES  982
             EV  +G +++   E                  ++  +    +VD     ++    + +  
Sbjct  177   EV--IGGEVYNPSESGDVSVEVEEEESGDVSFEEEEEPMPEVVDEIPPDSQLVADSQVVV  234

Query  981   TTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapi  802
              +SA  +D PK SYAS++  Q  +       PT +      K    + A V  P A    
Sbjct  235   ESSAKIEDTPKKSYASVVKVQ-KEYTAPFSSPTPSPLRSAPKIQEQVTAAVSQPPAAESH  293

Query  801   aPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGF  622
               S+   E+ NAQE  EG SIYV+ LP + T   LE  FKK+GPI++GG+QVR   Q+GF
Sbjct  294   VSSSNTFENGNAQESEEGPSIYVKGLPLDATTTLLENEFKKFGPIRNGGVQVR--FQKGF  351

Query  621   CFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             CFGFVEF   +++ +A++ SP+MI   + +VE K
Sbjct  352   CFGFVEFEVASAVQSALEASPVMINGFRVIVEEK  385


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  1854  VPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +P P+A +VGNAF  QYY IL  SPD V+RFYQ+ S   RP  DG
Sbjct  8     LPVPTADVVGNAFAHQYYHILQQSPDLVHRFYQDGSKFGRPGEDG  52



>ref|XP_003556630.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Glycine 
max]
Length=465

 Score =   198 bits (503),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 187/322 (58%), Gaps = 16/322 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY ++  EI +ADAQ S+  GVIV+VTGCLTG DNLKRKFTQ+FFLAPQDKG
Sbjct  60    INKKILSLDYTSFRVEILSADAQPSFKDGVIVVVTGCLTGSDNLKRKFTQSFFLAPQDKG  119

Query  1293  YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPE-APDPEPAHVPDSLNANPASSD  1120
             YFVLNDVFRYV E    D  +   N         P+    P+PE  HV + +  +  +  
Sbjct  120   YFVLNDVFRYVDEYKSVDIESVPANDAATADESAPTDAFVPEPEVIHVAEDVPPSQTAVV  179

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVD---TESHLNENQTSASLESTTSAIQDDAPK  949
               ++ +V  ++ + LE+      EK + V+     SH   +   A   ++ +A++ D PK
Sbjct  180   DADI-SVSKEVSQPLENGNVSVTEKVVPVNHVKESSHQEHSHYHAEKAASNNALE-DTPK  237

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              S+ASI+++ + +     +V  +  ++  + + +S+        AP   APS      KN
Sbjct  238   KSFASIVNA-LKENAAPFHVRVSPVKLVEQPRVSSI-------PAPEAPAPSIESPPEKN  289

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              +   + ++I+V NLP N TV +LE  FKK+GPIK  GIQVRSN+QQ  CFGFVEF    
Sbjct  290   NENGGKAYAIFVANLPMNATVEQLERAFKKFGPIKQDGIQVRSNKQQQSCFGFVEFESAT  349

Query  588   SMNNAIQDS-PIMIGDRQAVVE  526
             SM +A++ S P+ +  R+  +E
Sbjct  350   SMQSALEASPPVTLDGRRLSIE  371


 Score = 72.0 bits (175),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             + Q++GNAFV+QYY ILH  PDQV+RFYQESS+LSRP+ DG
Sbjct  9     TTQMIGNAFVQQYYSILHQEPDQVHRFYQESSILSRPEEDG  49



>ref|XP_007045848.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 2 [Theobroma cacao]
 gb|EOY01680.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 2 [Theobroma cacao]
Length=448

 Score =   197 bits (502),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 185/325 (57%), Gaps = 20/325 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN+ + SLDY++Y AEI  ADAQ SY  G+IVLVTG L GK++++RKFTQ+FFLAPQ+
Sbjct  60    KEINELLLSLDYQSYRAEISFADAQFSYANGLIVLVTGFLIGKNDVRRKFTQSFFLAPQE  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+V NDVFRYV+ +E    A   N VD+      SPE   PE  HVP +  AN  +  
Sbjct  120   GGYYVSNDVFRYVDDNEQVGVAN--NDVDESTQAALSPE---PELTHVPKNAVANHTTVP  174

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVD---TESHLNENQTSASLESTTSAIQDDAPK  949
             ++   N G ++   LE+ K    E E++ +   + S  ++  +  + ++ +  IQDDAPK
Sbjct  175   SDNSGNSGKEVSHPLENGKVSVSENEVVAEQIVSSSEESQYDSHPASQTASPKIQDDAPK  234

Query  948   MSYASILSS-QMNKGPTKIYVPTNASR-MKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
              SY S++ +   N  P  +  P    + M+  +++A+           +    + A++  
Sbjct  235   KSYLSVVHALTKNSAPFIVRAPPPKPKPMEQSRRAAA--------PEASAPKSNKALE--  284

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN        SI+V NLP N T   L  +F K+GPIK  GIQVRS +    CFGFVEF  
Sbjct  285   KNNDVSGMNTSIFVANLPMNATEELLGEIFTKFGPIKPNGIQVRSFKDNKNCFGFVEFES  344

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
               S+ +A+  SPI IG+R+A +E K
Sbjct  345   ATSVQSAVMASPITIGNRKANIEEK  369


 Score = 62.8 bits (151),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = -2

Query  1845  PSA---QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PSA   Q++GNAFV+Q+Y ILH  P Q Y+FY + SVLSRP PDG
Sbjct  7     PSASDPQMIGNAFVKQFYTILHKEPAQAYKFYLDLSVLSRPGPDG  51



>ref|XP_002447622.1| hypothetical protein SORBIDRAFT_06g009000 [Sorghum bicolor]
 gb|EES11950.1| hypothetical protein SORBIDRAFT_06g009000 [Sorghum bicolor]
Length=493

 Score =   199 bits (505),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 136/341 (40%), Positives = 184/341 (54%), Gaps = 41/341 (12%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI S+  +   AEIK  DAQ S  GGV VLV G LTG++ + R+F Q+FFLAPQ+KG
Sbjct  79    INEKIVSMGIDR--AEIKAVDAQESLCGGVTVLVMGHLTGRNGVSREFVQSFFLAPQEKG  136

Query  1293  YFVLNDVFRYVEQDEADSNAK-------------------MVNG-VDDEPTVIPSPEAPD  1174
             YFVLND+ RYV +   D   K                   + NG V  +   +P   +P 
Sbjct  137   YFVLNDILRYVGEGVGDEGTKQQPAPEVAADVETATPAPILANGTVGGDTGTVPQNASPQ  196

Query  1173  PEPAHVPDSLNANPASSDTEEVKNVGIKIHESLED-EKQVSDEKEILVDTESHLNE--NQ  1003
             PE         A PA +  EEV N G ++     D EK V +E  +  D    +NE  N 
Sbjct  197   PE------CQVAEPALNQKEEVVN-GEEVCNPTNDVEKPVVEETLVPED----INEVPNN  245

Query  1002  TSASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpv  823
              + +  S+     ++APK SYASI+       P    VP+  + +KTEKQ++   AQV  
Sbjct  246   VAVAPISSPPVPLEEAPKKSYASIVKVMKEYRPPGSAVPSRPAPLKTEKQASPAPAQVAD  305

Query  822   peapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVR  643
               A      S +  +      E + H+IYVR+LP N T  +LE  FK++G IKH GIQVR
Sbjct  306   ALAFTSNPQSGSFQDP-----EVDAHAIYVRSLPLNATPQQLEEEFKRFGAIKHEGIQVR  360

Query  642   SNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             SN+ QGFC+GFVEF   +++  AI+ SP+ IG+RQ  VE K
Sbjct  361   SNKIQGFCYGFVEFEDASAVQTAIEASPVTIGERQCYVEEK  401


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             Q+VGNAFV QYY ILH SP+ VYRFYQE+S L RP   G
Sbjct  28    QVVGNAFVHQYYNILHQSPELVYRFYQEASRLGRPAGTG  66



>gb|KHN20516.1| Putative G3BP-like protein [Glycine soja]
Length=465

 Score =   198 bits (503),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 187/322 (58%), Gaps = 16/322 (5%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI SLDY ++  EI +ADAQ S+  GVIV+VTGCLTG DNLKRKFTQ+FFLAPQDKG
Sbjct  60    INKKILSLDYTSFRVEILSADAQPSFKDGVIVVVTGCLTGSDNLKRKFTQSFFLAPQDKG  119

Query  1293  YFVLNDVFRYV-EQDEADSNAKMVNGVDDEPTVIPSPE-APDPEPAHVPDSLNANPASSD  1120
             YFVLNDVFRYV E    D  +   N         P+    P+PE  HV + +  +  +  
Sbjct  120   YFVLNDVFRYVDEYKSVDIESVPANDAATADESAPTDAFVPEPEVIHVAEDVPPSQTAVV  179

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVD---TESHLNENQTSASLESTTSAIQDDAPK  949
               ++ +V  ++ + LE+      EK + V+     SH   +   A   ++ +A++ D PK
Sbjct  180   DADI-SVSKEVSQPLENGNVSVTEKVVPVNHVKESSHQEHSHYHAEKAASNNALE-DTPK  237

Query  948   MSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
              S+ASI+++ + +     +V  +  ++  + + +S+        AP   APS      KN
Sbjct  238   KSFASIVNA-LKENAAPFHVRVSPVKLVEQPRVSSI-------PAPEAPAPSIESPPEKN  289

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
              +   + ++I+V NLP N TV +LE  FKK+GPIK  GIQVRSN+QQ  CFGFVEF    
Sbjct  290   NENGGKAYAIFVANLPMNATVEQLERAFKKFGPIKQDGIQVRSNKQQQSCFGFVEFESAT  349

Query  588   SMNNAIQDS-PIMIGDRQAVVE  526
             SM +A++ S P+ +  R+  +E
Sbjct  350   SMQSALEASPPVTLDGRRLSIE  371


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             + Q+VGNAFV+QYY ILH  PDQV+RFYQESS+LSRP+ DG
Sbjct  9     TTQMVGNAFVQQYYSILHQEPDQVHRFYQESSILSRPEEDG  49



>ref|XP_008235434.1| PREDICTED: putative G3BP-like protein [Prunus mume]
 ref|XP_008235435.1| PREDICTED: putative G3BP-like protein [Prunus mume]
Length=510

 Score =   199 bits (505),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 195/343 (57%), Gaps = 31/343 (9%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI  LDY    A I T DAQ SYNGGV VLVTG LTGKDN+++KFTQ+FFLAPQD G
Sbjct  67    INKKI--LDYGELSANIVTVDAQESYNGGVFVLVTGFLTGKDNIRKKFTQSFFLAPQDVG  124

Query  1293  YFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             YFVLNDVFRYV+    +   N  +V+   + P + P  +    +  HV + +        
Sbjct  125   YFVLNDVFRYVDDSTPQNGDNGLVVDAAVEAP-LTPKHDTTALQVYHVSEPVVVVSEDVA  183

Query  1119  TEEVKN------VGIKIHES--------LEDEKQVSDEKEILVDTESHLN-ENQTSASLE  985
              EEV N      V I+  E+        + D+ QV  E   +V+ +S+   E ++++ +E
Sbjct  184   KEEVYNPTENGEVSIEEEEAPVPEVVNEIPDDSQVVAESYSIVEAKSNSKVEAESNSKVE  243

Query  984   S-TTSAIQDDA------PKMSYASILSSQMNKGPTKIYVPTNAS-RMKTEKQSASMvaqv  829
             + + S ++ ++      PK SYASIL   M +       P  AS R   +KQ   + A  
Sbjct  244   AESNSKVEAESNSKVEVPKKSYASILKI-MKESTVPFSTPAPASVRSVPKKQEQQVTAAP  302

Query  828   pvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQ  649
                     +  ST   E+ N + EAEGHSIY++ LP N T A +E  FKK+G IK  G+Q
Sbjct  303   TSVPVSETVVSSTNARENGNLEAEAEGHSIYIKGLPMNSTNALIENEFKKFGLIKQNGVQ  362

Query  648   VRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VRS  Q+GFCFGFVE+   +S+++A++ SPIMIG+RQ  VE K
Sbjct  363   VRS--QKGFCFGFVEYEAASSVHSAMEASPIMIGNRQIFVEEK  403


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PA+   PSA +VGNAFV QYY IL  SP  V+RFYQ+ S L RP  DG
Sbjct  9     PASNLPPSADVVGNAFVLQYYNILEQSPQLVHRFYQDISKLGRPGDDG  56



>ref|XP_003622861.1| Ras GTPase-activating protein-binding protein [Medicago truncatula]
Length=522

 Score =   199 bits (505),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 165/480 (34%), Positives = 238/480 (50%), Gaps = 123/480 (26%)
 Frame = -2

Query  1872  TTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDGsmtsvttmd  1693
              T+   VP P+  +VG+AFVEQYY +LH SP+ V+RFYQ+ S L RP+P+G         
Sbjct  2     ATSENQVP-PAPDVVGHAFVEQYYYMLHESPEHVHRFYQDVSKLGRPEPNGI--------  52

Query  1692  vss*VQAIKLLSCLKEACF*HPN*FPCGLPYMNLPFLFLVSIHYSGILFTRILNIDPTVL  1513
                    I + + + E                                      ID  +L
Sbjct  53    -------IGITTTMAE--------------------------------------IDKKIL  67

Query  1512  QHLNFFFLMLYQRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRK  1333
                     M Y  ++ +I S+D            AQ S+ GGVIVLVTG + GKDN+K+K
Sbjct  68    S-------MGYSELSAEILSVD------------AQESFGGGVIVLVTGFMIGKDNVKQK  108

Query  1332  FTQTFFLAPQDKGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAP----DP--  1171
             FTQ FFLAPQ+KGYFVLND+FRYV+++E          + +    I SP +P    DP  
Sbjct  109   FTQCFFLAPQEKGYFVLNDIFRYVDENE----------IKEPDHAIRSPASPENVLDPLV  158

Query  1170  EPAHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSAS  991
                 VP+ ++    + D  E++ V    +  +  E++ +   E+LV+     N++Q +A 
Sbjct  159   LETQVPEQISVAAENGDRGELE-VYNPENGQVSVEEEEAPVPEVLVEIP---NDSQKAAG  214

Query  990   LESTTSAIQ---------DDAPKMSYASILSSQMNKGPTKIYVPTNASRMKT-----EKQ  853
              +      Q         ++ PK SYASIL  ++ KG         A+ ++T     E+Q
Sbjct  215   FDHVPDDSQKVAELASQIEEVPKKSYASIL--KVMKGAAAPSSVMTAASVRTSIKIQEQQ  272

Query  852   SASMvaqvpvpeapapiaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKY  676
             SA+          P     S + +E  N QE EAEG+SIY++ LP N T A +E +FKK+
Sbjct  273   SAAA---PSPSSVPETNGSSISTNEGGNNQETEAEGYSIYLKGLPGNATHALVENMFKKF  329

Query  675   GPIKHGGIQVRSNRQQGFCFGFVEFH----GLNSMN----NAIQDSPIMIGDRQAVVEIK  520
             GPIK GG+QVR+   +GF FGFVEF      L+++     +A Q SPI+I DRQ V+E K
Sbjct  330   GPIKSGGVQVRT--AKGFHFGFVEFEEESAALSAIESILLSAFQASPILINDRQVVIEEK  387



>tpg|DAA38277.1| TPA: hypothetical protein ZEAMMB73_017117 [Zea mays]
Length=487

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 182/339 (54%), Gaps = 37/339 (11%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI S+  +   AEIK  DAQ S  GGV VLV G LTG++++ R+F Q+FFLAPQ+KG
Sbjct  72    INDKIVSMGIDR--AEIKAVDAQESLCGGVSVLVMGHLTGRNSVSRQFVQSFFLAPQEKG  129

Query  1293  YFVLNDVFRYV-------------------EQDEADSNAKMVNG-VDDEPTVIPSPEAPD  1174
             YFVLND+ RYV                   + +   S   + NG V  + T +P   +P 
Sbjct  130   YFVLNDILRYVGEGGGDEGAEKQPAPEVAADAETTTSAPILANGTVGGDATTVPQDASPQ  189

Query  1173  PEPAHVPDSLNANPASSDTEEVKNVGIKIHESLED-EKQVSDEKEILVDTESHLNENQTS  997
             PE         A PA +  EEV N   ++  SL D EK V++E  +  D  + +  N   
Sbjct  190   PE------CQVAEPALNPKEEVLNG--EVCNSLSDVEKPVAEETPVP-DVINEVPNNVAV  240

Query  996   ASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe  817
             A   S+      +APK SYASI+       P    VP+  +   TEKQ++     V    
Sbjct  241   APPISSPPVPLKEAPKKSYASIVKVMKEHRPLAPAVPSRPAPPITEKQASPAPTPVTEAP  300

Query  816   apapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSN  637
             A +P   S    +      E + H+IYVR+LP N T  +LE  FK++G IKH GIQVRSN
Sbjct  301   AFSPNPQSGGFQDP-----EVDAHAIYVRSLPLNATPQQLEEEFKRFGTIKHEGIQVRSN  355

Query  636   RQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             + QGFC+GFVEF   +++  AI+ SP+ IG+RQ  VE K
Sbjct  356   KIQGFCYGFVEFEDASAVQAAIEASPVTIGERQCFVEEK  394


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRP  1732
             +VGNAFV QYY ILH SP+ VYRFYQE+S L RP
Sbjct  22    VVGNAFVHQYYNILHQSPELVYRFYQEASCLGRP  55



>tpg|DAA38278.1| TPA: RNA-binding protein-like protein [Zea mays]
Length=488

 Score =   197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 182/339 (54%), Gaps = 37/339 (11%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI S+  +   AEIK  DAQ S  GGV VLV G LTG++++ R+F Q+FFLAPQ+KG
Sbjct  72    INDKIVSMGIDR--AEIKAVDAQESLCGGVSVLVMGHLTGRNSVSRQFVQSFFLAPQEKG  129

Query  1293  YFVLNDVFRYV-------------------EQDEADSNAKMVNG-VDDEPTVIPSPEAPD  1174
             YFVLND+ RYV                   + +   S   + NG V  + T +P   +P 
Sbjct  130   YFVLNDILRYVGEGGGDEGAEKQPAPEVAADAETTTSAPILANGTVGGDATTVPQDASPQ  189

Query  1173  PEPAHVPDSLNANPASSDTEEVKNVGIKIHESLED-EKQVSDEKEILVDTESHLNENQTS  997
             PE         A PA +  EEV N   ++  SL D EK V++E  +  D  + +  N   
Sbjct  190   PE------CQVAEPALNPKEEVLNG--EVCNSLSDVEKPVAEETPVP-DVINEVPNNVAV  240

Query  996   ASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe  817
             A   S+      +APK SYASI+       P    VP+  +   TEKQ++     V    
Sbjct  241   APPISSPPVPLKEAPKKSYASIVKVMKEHRPLAPAVPSRPAPPITEKQASPAPTPVTEAP  300

Query  816   apapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSN  637
             A +P   S    +      E + H+IYVR+LP N T  +LE  FK++G IKH GIQVRSN
Sbjct  301   AFSPNPQSGGFQDP-----EVDAHAIYVRSLPLNATPQQLEEEFKRFGTIKHEGIQVRSN  355

Query  636   RQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             + QGFC+GFVEF   +++  AI+ SP+ IG+RQ  VE K
Sbjct  356   KIQGFCYGFVEFEDASAVQAAIEASPVTIGERQCFVEEK  394


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRP  1732
             +VGNAFV QYY ILH SP+ VYRFYQE+S L RP
Sbjct  22    VVGNAFVHQYYNILHQSPELVYRFYQEASCLGRP  55



>ref|XP_010906167.1| PREDICTED: putative G3BP-like protein [Elaeis guineensis]
Length=447

 Score =   196 bits (499),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 180/323 (56%), Gaps = 18/323 (6%)
 Frame = -2

Query  1473  INDKIRSL-DYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD-  1300
             INDKI S+ DY++Y+  I TAD+Q++YN GVIVLVTGCL G + + RKFTQ+FFLAPQ  
Sbjct  64    INDKILSMMDYKSYEVNILTADSQSTYNEGVIVLVTGCLIGINKIPRKFTQSFFLAPQKC  123

Query  1299  KGYFVLNDVFRYVEQDEADS-NAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASS  1123
              G+F+LND+FR++++++ D  N  +V    D         A DP+   V DS   +PA++
Sbjct  124   GGFFILNDLFRFLDENQPDGINQILVCNTMDA-------AATDPDLTLVQDSHAPDPATA  176

Query  1122  DTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMS  943
              +E       K   + E      +   ++ D  +     Q     E  TS   +DA   S
Sbjct  177   ISEA------KFANAEESSIPSENRHLVVQDIVTVDPPVQPHIVSEIRTSIAPEDARMKS  230

Query  942   YASILSSQMNKGPTK-IYVPTNASR-MKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             YASI+        +K +YVPT   + + T  +   M +             +  I ES N
Sbjct  231   YASIVKDMKGSTSSKPVYVPTTKLQPVPTNPEKPFMQSTAASLTPEVLATKNNTISESCN  290

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
             +    EGHSIY+ NLP N T  ++E  FKK+GPIK  G+QVR ++ + FCFGF+EF  L 
Sbjct  291   SSNSHEGHSIYIGNLPVNATARQVEEEFKKFGPIKPRGVQVRIHKFEHFCFGFIEFESLE  350

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             SM  AI+ SP+MIG ++A V+ K
Sbjct  351   SMKAAIEASPVMIGGQEAFVKEK  373


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 41/56 (73%), Gaps = 4/56 (7%)
 Frame = -2

Query  1884  MAMQTTTPATVPGP-SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA  T TPA    P SAQ VGNAF+EQYY ILH  P+  Y+FYQ+SS++SRP+ +G
Sbjct  1     MAFPTVTPA---APLSAQQVGNAFIEQYYTILHRWPESAYKFYQDSSIISRPESNG  53



>emb|CAN80553.1| hypothetical protein VITISV_024360 [Vitis vinifera]
Length=524

 Score =   198 bits (504),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 185/321 (58%), Gaps = 23/321 (7%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL+Y +  AEIK+ DAQ S+ GGV+VLVTG LTGKDN  R FTQ+FFLAPQDKG
Sbjct  96    INEKILSLNYGDLIAEIKSVDAQESFGGGVLVLVTGYLTGKDNRSRDFTQSFFLAPQDKG  155

Query  1293  YFVLNDVFRYVEQDE-ADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             YFVLND+FRY+E  +  D N  +V+ V+       +P  P+ +P+ V ++    P     
Sbjct  156   YFVLNDLFRYIEDVKYQDGNPGLVSEVE-------APLTPEQDPSPVQENHILEPTPEVX  208

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
             EEV        E+ E     +  +E        ++E Q    +  + S I  + PK SYA
Sbjct  209   EEVNEEVYNPSENGE-----ASVEEEEAPVAEVVDEIQDDQMVTISDSKIL-EVPKKSYA  262

Query  936   SILS--SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQ  763
             SI+    + +   +           K ++Q  ++         P P A + AI+   N  
Sbjct  263   SIVKVMKESSVPFSSPTPXPXRPVPKIQEQQVTV------APLPTPGAEANAIENGNNQD  316

Query  762   EEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
              EA+GHSIY+R LP N T A LE  FKK+GPIK GG+QVRSN+ QGFCFGFVEF   +++
Sbjct  317   GEADGHSIYIRGLPSNATPALLEDEFKKFGPIKSGGVQVRSNK-QGFCFGFVEFEVASAV  375

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
              +A++ SPI IG RQA VE K
Sbjct  376   QSAMEASPITIGGRQAFVEEK  396



>ref|XP_007045847.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 1 [Theobroma cacao]
 gb|EOY01679.1| Nuclear transport factor 2 family protein with RNA binding domain, 
putative isoform 1 [Theobroma cacao]
Length=543

 Score =   198 bits (504),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 185/325 (57%), Gaps = 20/325 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN+ + SLDY++Y AEI  ADAQ SY  G+IVLVTG L GK++++RKFTQ+FFLAPQ+
Sbjct  60    KEINELLLSLDYQSYRAEISFADAQFSYANGLIVLVTGFLIGKNDVRRKFTQSFFLAPQE  119

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+V NDVFRYV+ +E    A   N VD+      SPE   PE  HVP +  AN  +  
Sbjct  120   GGYYVSNDVFRYVDDNEQVGVAN--NDVDESTQAALSPE---PELTHVPKNAVANHTTVP  174

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVD---TESHLNENQTSASLESTTSAIQDDAPK  949
             ++   N G ++   LE+ K    E E++ +   + S  ++  +  + ++ +  IQDDAPK
Sbjct  175   SDNSGNSGKEVSHPLENGKVSVSENEVVAEQIVSSSEESQYDSHPASQTASPKIQDDAPK  234

Query  948   MSYASILSS-QMNKGPTKIYVPTNASR-MKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
              SY S++ +   N  P  +  P    + M+  +++A+           +    + A++  
Sbjct  235   KSYLSVVHALTKNSAPFIVRAPPPKPKPMEQSRRAAA--------PEASAPKSNKALE--  284

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
             KN        SI+V NLP N T   L  +F K+GPIK  GIQVRS +    CFGFVEF  
Sbjct  285   KNNDVSGMNTSIFVANLPMNATEELLGEIFTKFGPIKPNGIQVRSFKDNKNCFGFVEFES  344

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
               S+ +A+  SPI IG+R+A +E K
Sbjct  345   ATSVQSAVMASPITIGNRKANIEEK  369


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = -2

Query  1845  PSA---QLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PSA   Q++GNAFV+Q+Y ILH  P Q Y+FY + SVLSRP PDG
Sbjct  7     PSASDPQMIGNAFVKQFYTILHKEPAQAYKFYLDLSVLSRPGPDG  51



>gb|EPS67084.1| hypothetical protein M569_07690 [Genlisea aurea]
Length=492

 Score =   197 bits (501),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 136/327 (42%), Positives = 184/327 (56%), Gaps = 29/327 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL+Y +  A+IK+ DAQ S+NGGV VLVTG LT K+N+  KF Q FFLAPQD
Sbjct  62    QAINEKIMSLNYGDIHADIKSVDAQESHNGGVHVLVTGYLTEKENIAHKFAQAFFLAPQD  121

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
              GY+VLND+FRY+     D +  + + V+D    +P   +P P    V D+L+ N A S 
Sbjct  122   NGYYVLNDIFRYL----GDGSCNLPS-VNDGAVSVPHDSSPIPV---VEDNLSENSAQSA  173

Query  1119  TEEVKNV------GIKIHESLEDEKQVSD-EKEILVDTESHLNENQTSASLESTTSAIQD  961
                V  V      G   +   ++E  V++   E+  D E  +  N           A  +
Sbjct  174   EVAVAEVYDPPENGTVAYVDEKNEIPVAEVTDEVKYDGERVVESN-----------AKTE  222

Query  960   DAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAID  781
             + PK SYASI+        T  + P  A+  KT  ++   V          P+       
Sbjct  223   EVPKKSYASIVMHLKETAAT--FSPPLAAARKTPPKNVEHVNVPVEAATDPPVPVVEP-V  279

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
             E++N QE A+G+SIY++ LP N TV  LE VFK +G IK+ GIQVRSNRQQGFCFGFVEF
Sbjct  280   ENENNQEGADGYSIYIKGLPMNATVFSLEEVFKNFGTIKNDGIQVRSNRQQGFCFGFVEF  339

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                +S+  A++ SP++IG RQA VE K
Sbjct  340   EDASSVQKALEASPVIIGGRQAFVEEK  366


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  1857  TVPGP-SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             TV  P SAQ+V NAFV+QYY ILHHSP  V+RFYQE S L RP+ DG
Sbjct  7     TVATPVSAQVVANAFVQQYYHILHHSPGLVHRFYQEVSRLGRPEEDG  53



>ref|XP_002453867.1| hypothetical protein SORBIDRAFT_04g020120 [Sorghum bicolor]
 gb|EES06843.1| hypothetical protein SORBIDRAFT_04g020120 [Sorghum bicolor]
Length=481

 Score =   197 bits (500),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 181/339 (53%), Gaps = 36/339 (11%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + I++KI  +D     AEI+T D+Q S  GGV VLVTG LTG+D ++R+F+Q+FFLAPQ+
Sbjct  68    EAISEKIMEMDVSK--AEIRTVDSQESLGGGVTVLVTGHLTGRDGVRREFSQSFFLAPQE  125

Query  1299  KGYFVLNDVFRYV----------EQDEADS-----NAKMVNGVDDEPTVIPS-PEAPDPE  1168
             KGYFVLND+FR+V           Q EAD+      A + NG    P V P+ P+  D  
Sbjct  126   KGYFVLNDIFRFVGDIPAPTAVEAQPEADAVVPPVAAPLANGTAT-PAVEPAIPDDHDAV  184

Query  1167  PA---HVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTS  997
             P    HV D     P   D  EV N            ++V DE++ + +  + +  N   
Sbjct  185   PQQENHVVDRSPPQPEEEDEAEVYN---------PPPEEVVDEEQPVPEVINEVPNNVAP  235

Query  996   ASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe  817
              +  +    +Q++APK SYASI+             PT  +  K EKQS      V    
Sbjct  236   VAATTVAPVLQEEAPKKSYASIVKVMKEVPLPAPAPPTRPAPPKPEKQSPPAPTPVTDVP  295

Query  816   apapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSN  637
                    S+  D S   + E + H+IYVRNLP N T  +LE  FKK+G IK  GIQVRSN
Sbjct  296   PF-----SSNPDNSNIQEPEVDAHAIYVRNLPLNATETQLEDEFKKFGTIKQNGIQVRSN  350

Query  636   RQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             + QGFC+GFVEF    S+ +AI+ SP+ IG RQ  VE K
Sbjct  351   KIQGFCYGFVEFEDSTSVQSAIEASPVTIGGRQCYVEEK  389


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  1836  QLVGNAFVEQYYLILHHSPDQVYRFYQESSVL  1741
             Q+VGNAFV+QYYL+LH SPD VYRFYQ++S L
Sbjct  18    QVVGNAFVQQYYLVLHQSPDLVYRFYQDASRL  49



>gb|ABK92852.1| unknown [Populus trichocarpa]
Length=454

 Score =   196 bits (498),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 185/327 (57%), Gaps = 20/327 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + I   I SLDY+N   EI+T D+Q SY   V+V+VTG   GKD+ +++FTQ FFL PQD
Sbjct  62    EEIKKLILSLDYKNCVVEIQTVDSQESYENAVMVIVTGFFAGKDSDRKRFTQAFFLVPQD  121

Query  1299  KG--YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              G  YFVLND+FRYVE+ E   N K+ +  +  P   P+P  P PEP  VPD   A   S
Sbjct  122   DGTTYFVLNDIFRYVEESE---NKKISDADNIAP---PTPVTPSPEPPSVPDHTVAVNVS  175

Query  1125  SDTEEVKNVGIKIHES---LEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDA  955
             ++ EE    G++  ES   L++ +    EK+I+V+ E    +N      E+  S++Q+DA
Sbjct  176   TNLEEG---GVQAKESGHPLDNGEIPISEKDIVVEKEVVATQNDAHPVSEAVASSVQEDA  232

Query  954   PKMSYASILSS-QMNKGPTKIYVPTNASRMKTEKQS-ASMvaqvpvpeapapiaPSTAID  781
             PK SYAS++++  +   P +  V    S +K  KQS  ++       +  +P  P     
Sbjct  233   PKKSYASVVNALNLKTQPFQQRV----SDVKPVKQSYTAVPPMASSHQTGSPRPPGNNTV  288

Query  780   ESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEF  601
             E  N     EG+SI+V NLP + TV EL   F K+G IK  G+QVRS +Q   CFGFVEF
Sbjct  289   EINNNSTAVEGYSIFVANLPMDATVDELIQTFSKFGAIKPNGVQVRSYKQDKNCFGFVEF  348

Query  600   HGLNSMNNAIQDSPIMIGDRQAVVEIK  520
                NS+  A++ S + IG R A +E K
Sbjct  349   ESANSVEKALEVSTVTIGTRTAHIERK  375



>ref|NP_001150471.1| LOC100284101 [Zea mays]
 gb|ACG39208.1| RNA-binding protein-like [Zea mays]
Length=488

 Score =   197 bits (500),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/339 (40%), Positives = 183/339 (54%), Gaps = 37/339 (11%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             INDKI S+  +   A+IK  DAQ S  GGV VLV G LTG++++ R+F Q+FFLAPQ+KG
Sbjct  72    INDKIVSMGIDR--AKIKAVDAQESLCGGVSVLVMGHLTGRNSVSRQFVQSFFLAPQEKG  129

Query  1293  YFVLNDVFRYV-------------------EQDEADSNAKMVNG-VDDEPTVIPSPEAPD  1174
             YFVLND+ RYV                   + ++  S   + NG V  + T +P   +P 
Sbjct  130   YFVLNDILRYVGEGGGDEGAEKQPAPEVAADAEKTTSAPILANGTVGGDATTVPQDASPQ  189

Query  1173  PEPAHVPDSLNANPASSDTEEVKNVGIKIHESLED-EKQVSDEKEILVDTESHLNENQTS  997
             PE         A PA +  EEV N   ++  SL D EK V++E  +  D  + +  N   
Sbjct  190   PE------CQVAEPALNPKEEVLNG--EVCNSLSDVEKPVAEETPVP-DVINEVPNNVAV  240

Query  996   ASLESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpe  817
             A   S+      +APK SYASI+       P    VP+  +   TEKQ++     V    
Sbjct  241   APPISSPPVPLKEAPKKSYASIVKVMKEHRPLAPAVPSRPAPPITEKQASPAPTPVTEAP  300

Query  816   apapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSN  637
             A +P   S    +      E + H+IYVR+LP N T  +LE  FK++G IKH GIQVRSN
Sbjct  301   AFSPNPQSGGFQDP-----EVDAHAIYVRSLPLNATPQQLEEEFKRFGTIKHEGIQVRSN  355

Query  636   RQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             + QGFC+GFVEF   +++  AI+ SP+ IG+RQ  VE K
Sbjct  356   KIQGFCYGFVEFEDASAVQAAIEASPVTIGERQCFVEEK  394


 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  1833  LVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRP  1732
             +VGNAFV QYY ILH SP+ VYRFYQE+S L RP
Sbjct  22    VVGNAFVHQYYNILHQSPELVYRFYQEASCLGRP  55



>ref|XP_007200288.1| hypothetical protein PRUPE_ppa004427mg [Prunus persica]
 gb|EMJ01487.1| hypothetical protein PRUPE_ppa004427mg [Prunus persica]
Length=510

 Score =   197 bits (501),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 194/343 (57%), Gaps = 31/343 (9%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI  LDY    A I T DAQ SYNGGV VLVTG LTGKDN+++KFTQ+FFLAPQD G
Sbjct  67    INKKI--LDYGELSANIVTVDAQESYNGGVFVLVTGFLTGKDNIRKKFTQSFFLAPQDVG  124

Query  1293  YFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             YFVLNDVFRYV+    +   N  +V+   + P + P  +    +  HV + +        
Sbjct  125   YFVLNDVFRYVDDSTPQNGDNGLVVDAAVEAP-LTPKHDTTALQGYHVSEPVVVVSEDVA  183

Query  1119  TEEVKN------VGIKIHES--------LEDEKQVSDEKEILVDTESHLN-ENQTSASLE  985
              EEV N      V I+  E+        + D+ QV  E   +V+ +S+   E ++++ +E
Sbjct  184   KEEVYNPTENGEVSIEEEEAPVPEVVNEIPDDSQVVAESYSIVEAKSNSKVEAESNSKVE  243

Query  984   S-TTSAIQDDA------PKMSYASILSSQMNKGPTKIYVPTNAS-RMKTEKQSASMvaqv  829
             + + S I+ ++      PK SYASIL   M +       P  AS R   +KQ   + A  
Sbjct  244   AESNSKIEAESNSKVEVPKKSYASILKI-MKESTVPFSTPAAASARSVPKKQEQQVTAAP  302

Query  828   pvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQ  649
                     +  ST   E+ N + EAEGHSIY++ LP N T A +E  FKK+G IK  G+Q
Sbjct  303   TSVPVSETVVSSTNARENGNLEAEAEGHSIYIKGLPMNSTNALIENEFKKFGLIKQNGVQ  362

Query  648   VRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             VRS   +GFCFGFVE+   +S+++A++ SPIMIG+RQ  VE K
Sbjct  363   VRS--LKGFCFGFVEYEAASSVHSAMEASPIMIGNRQIFVEEK  403


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -2

Query  1863  PATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             PA+   PSA +VGNAFV QYY IL  SP  V+RFYQ+ S L RP  DG
Sbjct  9     PASNLPPSADVVGNAFVLQYYNILEQSPQLVHRFYQDISKLGRPGDDG  56



>ref|XP_009372036.1| PREDICTED: putative G3BP-like protein [Pyrus x bretschneideri]
Length=497

 Score =   196 bits (499),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 139/342 (41%), Positives = 191/342 (56%), Gaps = 32/342 (9%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN KI  LDY    A IKT DAQ SYNGGV VLVTG LTG+D L++ FTQ+FFLAPQD
Sbjct  65    EEINKKI--LDYGELSANIKTVDAQESYNGGVCVLVTGYLTGRDLLRKTFTQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              GYFVLNDVFRYVE    E + N  +V+ V+ EP + P  +A   +  HVP+ + + P  
Sbjct  123   VGYFVLNDVFRYVEDSNPENEDNGLVVD-VEVEPPITPKHDATALQDNHVPEPVISVPED  181

Query  1125  SDTEEV--------------KNVGIKIHESLEDEKQV--SDEKEILVDTESHLN---ENQ  1003
                EE+              +    ++   + D+ QV    E E     E+  N   E +
Sbjct  182   IVKEELFKPSENGVVSVEEKEVPEPEVVNEIPDDSQVVIKVEAESFAKVEAESNPKVEVE  241

Query  1002  TSASLESTTSAIQDDAPKMSYASILS-SQMNKGPTKIYVPTNASRMKTEKQSASMvaqvp  826
             +S+ +E+ +++ + +APK SYASIL   + +  P     P  +   K E Q A+     P
Sbjct  242   SSSKVEAESNS-KVEAPKKSYASILKIMKESTVPFSTPAPLRSVPKKQEHQVAT----AP  296

Query  825   vpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQV  646
             +    +    ST   E+ N + EAEGHSIY++ LP + T   +E  FKK+G IK  G+QV
Sbjct  297   ISAPVSETVSSTNARENGNLEPEAEGHSIYIKGLPMDCTNTVIETEFKKFGEIKKNGVQV  356

Query  645   RSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             R  R  GFCFGFVEF   +++ +A++ SPI I  RQ  VE K
Sbjct  357   RMLR--GFCFGFVEFEAASAVQSAMEASPIEISGRQVYVEEK  396


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M    PA    P+A +VGNAFV QYY IL  SP+ V+RFYQ+ S L RP  DG
Sbjct  4     MVQQAPAASLAPTADVVGNAFVLQYYNILEQSPELVHRFYQDISKLGRPGDDG  56



>ref|XP_008372510.1| PREDICTED: putative G3BP-like protein [Malus domestica]
Length=497

 Score =   196 bits (499),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 147/347 (42%), Positives = 188/347 (54%), Gaps = 42/347 (12%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IN KI  LDY    A IKT DAQ SYNGGV VLVTG LTGKD L++ FTQ+FFLAPQD
Sbjct  65    EEINKKI--LDYGELSANIKTVDAQESYNGGVFVLVTGYLTGKDLLRKTFTQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQD--EADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
              GYFVLNDVFRYVE    E + N  +V+ V+ EP + P  +A   +  HVP+     P  
Sbjct  123   VGYFVLNDVFRYVEDSNPENEDNGLVVD-VEVEPPITPKHDATALQDNHVPE-----PVI  176

Query  1125  SDTEE-VKNVGIKIHES------------------LEDEKQVSDEKEI----LVDTESHL  1015
             S +E+ VK    K  E+                  + D+ QV ++ E      V+ ES  
Sbjct  177   SVSEDVVKEELFKPSENGVVSVEEKEVPEPEVVNXIPDDSQVVNKVEAESFXKVEAESKP  236

Query  1014  NENQTSASLESTTSAIQDDAPKMSYASILSSQMNKG--PTKIYVPTNASRMKTEKQSASM  841
                  S S     S  + +APK SYASIL S M +G  P     P  +   K E Q A+ 
Sbjct  237   KVEVESNSKVEAESNSKVEAPKKSYASILKS-MKEGTXPFSTPAPVRSVPKKQENQVAT-  294

Query  840   vaqvpvpeapapiaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKH  661
                 P+    +    ST   E+ N + EAEGHSIY++ LP + T   +E  FKK+G IK 
Sbjct  295   ---APISAPVSETVSSTNARENGNLEPEAEGHSIYIKGLPMDCTNTVIETEFKKFGQIKK  351

Query  660   GGIQVRSNRQQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              G+QVR  R  GFCFGFVEF   +S+ +A++ SPI I  +Q  VE K
Sbjct  352   NGVQVRMLR--GFCFGFVEFEAASSVQSAMEASPIEISGQQVYVEEK  396


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  1878  MQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             M    P     P+A +VGNAFV QYY IL  SP+ V+RFYQ+ S L RP  DG
Sbjct  4     MVQQAPVASLXPTADVVGNAFVLQYYNILEQSPELVHRFYQDISKLGRPGDDG  56



>ref|XP_010066841.1| PREDICTED: ras GTPase-activating protein-binding protein 2 [Eucalyptus 
grandis]
 gb|KCW64877.1| hypothetical protein EUGRSUZ_G02443 [Eucalyptus grandis]
Length=438

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 184/318 (58%), Gaps = 26/318 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDK-  1297
             IN+KI SLDYE Y  EI TADAQ S+ GGV VLVTGCL G+DN++R FTQ+FFLAPQ   
Sbjct  73    INEKILSLDYEKYKIEILTADAQASHEGGVQVLVTGCLMGEDNIRRIFTQSFFLAPQKTG  132

Query  1296  GYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             GYFVLND+FRYVE +     +       +E   + +P   DPEPA + D     P   +T
Sbjct  133   GYFVLNDIFRYVEGESPLPVSPAER--HEELRAVEAPPMLDPEPAQIVDP----PVEVET  186

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSYA  937
               V+    +I  ++E+ ++ +D KEI+V+  +  +E   S        A Q DAPK S+A
Sbjct  187   PLVE----EIVPAVENGEESADGKEIVVEPIADSSEKDDSTVAVPVPDA-QVDAPKKSFA  241

Query  936   SILSS-QMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             SI+S+   +  P ++  P +    +    +A                P+ +I   K+  +
Sbjct  242   SIVSALNDSAAPFQMRAPVSKPVARPRASTAP-----------KSPVPNESIPAEKSEIQ  290

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
               + HSI+V NLP + T  +LE  FKK+G IK  GIQVRS++  G C+GFVEF   +SM 
Sbjct  291   PVKRHSIFVGNLPLDATPDQLETAFKKFGSIKPNGIQVRSSK--GSCYGFVEFEAESSMQ  348

Query  579   NAIQDSPIMIGDRQAVVE  526
             +A++++ IMIG R+A +E
Sbjct  349   SALEENSIMIGTRKAHIE  366


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P  + VGNAF+EQYY +LH +P   +RFY E S L RP PDG
Sbjct  21    PDPKSVGNAFIEQYYPVLHSNPTVAHRFYHEESQLGRPGPDG  62



>ref|XP_011089065.1| PREDICTED: putative G3BP-like protein [Sesamum indicum]
Length=471

 Score =   196 bits (497),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 181/335 (54%), Gaps = 41/335 (12%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q I+ KI SL+Y ++ AEIK+ DAQ S+NGGV VLVTG LTGKDN  R F Q+FFLAPQD
Sbjct  63    QAIDAKIVSLNYGDFRAEIKSVDAQESFNGGVNVLVTGYLTGKDNTVRNFAQSFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGV---------------DDEPTVIPSPEAPDPEP  1165
             +GYFVLND+FRY+  D  + N  +VN V                 +   +     P  E 
Sbjct  123   RGYFVLNDMFRYL--DNVNLNPALVNDVLLPAAPEPIPAAAPAPVQEDHVSEESTPSTEE  180

Query  1164  AHVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLE  985
             A   +  N  P + D   V+   + I E ++   +V D+ EI+V++ +   E        
Sbjct  181   AVAGEVYNP-PQNGDVAIVEEE-VPIAEVVD---EVQDDAEIVVESNTKTEE--------  227

Query  984   STTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapap  805
                       PK SYASI+        T  + P  A+  +   ++              P
Sbjct  228   ---------LPKKSYASIVMHLKESAAT--FSPPPAAPRRAPPKNIEQANPTFASATDGP  276

Query  804   iaPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQG  625
             ++ S ++D   N + EA+G+SIY++ LP + T   LE VFKK+G IK  GIQVRSNRQQG
Sbjct  277   VSSSESVDNGNNQEGEADGYSIYIKGLPMSATDTLLEEVFKKFGTIKSDGIQVRSNRQQG  336

Query  624   FCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             FCFGFVEF   +++  A++ SP+ IG RQA VE K
Sbjct  337   FCFGFVEFEEASAVQKALEASPVTIGGRQAFVEEK  371


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY ILHHSP  VYRFYQ+ S L RP+ DG
Sbjct  14    SAQVVGNAFVQQYYHILHHSPGLVYRFYQDISKLGRPEEDG  54



>gb|KDO70352.1| hypothetical protein CISIN_1g037095mg, partial [Citrus sinensis]
Length=334

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 170/284 (60%), Gaps = 12/284 (4%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             + IND I SLDY+NY+ +I +ADAQ SY+ G+ VLVTGCL GKDN++RKFTQ+FFLAPQD
Sbjct  61    KEINDMIVSLDYQNYNVQIFSADAQASYDNGLTVLVTGCLIGKDNVRRKFTQSFFLAPQD  120

Query  1299  KGYFVLNDVFRYVEQ-DEADSNAKM-VNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPAS  1126
             KGYFVLND+ RYV++ D+ D +A + +N VD+      +P  PDPEP  VP++   N  +
Sbjct  121   KGYFVLNDILRYVDEIDDKDGSAGLTINDVDENAPA--APLTPDPEPTQVPNNTVLNHVN  178

Query  1125  SDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
                E+ K+     H  L++ + +  EK +  D     ++N    + E   S  +++APK 
Sbjct  179   PVNEDAKSSNEASHP-LDNGQVLVAEKAVAADPPVVASQNDARPAKEPAASKNEEEAPKK  237

Query  945   SYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNA  766
             S+AS++   +NK      V   A  +KT + S +               PS+     +N 
Sbjct  238   SFASVV-HDLNKSKAPFNVIMRAPSLKTVESSRAT------AAPKVAAPPSSNSSLERNN  290

Query  765   QEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNR  634
                A+GHSI+V NLP + TV +L+ +F+++GP+K  GIQVRS +
Sbjct  291   DHAAKGHSIFVGNLPDSATVDQLKLIFEQFGPVKPDGIQVRSQK  334


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 3/55 (5%)
 Frame = -2

Query  1884  MAMQTTTPATVPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             MA Q  + + +   S Q+VGNAFVEQYY ILH +PD V+RFYQESS++SRPD  G
Sbjct  1     MAQQADSSSAL---SPQVVGNAFVEQYYCILHQNPDVVHRFYQESSMVSRPDQSG  52



>gb|EYU40628.1| hypothetical protein MIMGU_mgv1a005146mg [Erythranthe guttata]
Length=495

 Score =   195 bits (496),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 135/324 (42%), Positives = 185/324 (57%), Gaps = 20/324 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL Y ++ AEI++ DAQ S++GGV VLVTG LT KDN    F Q+FFLAPQD
Sbjct  83    QAINEKIISLKYTDFRAEIRSVDAQESFDGGVQVLVTGYLTAKDNKVSHFAQSFFLAPQD  142

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDP-EPA---HVPDSLNANP  1132
             KGYFVLND+ RYV  D    N  ++  V     V+P   AP P +P    HV  S  + P
Sbjct  143   KGYFVLNDMLRYV--DTVALNPALITEV-----VVPIAAAPIPADPVQENHV--SEQSTP  193

Query  1131  ASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAP  952
             ++ +      V  +++   E+      E+E        ++E Q  A     +SA  ++AP
Sbjct  194   SAEEA-----VAGEVYNPPENGDVAIAEEEEEEPVAEVVDEVQEIAKPLDRSSAKIEEAP  248

Query  951   KMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESK  772
             K +YASI+    +   +  + P  A+  K   ++   V    VP    PI+ S ++D   
Sbjct  249   KKTYASIVKHLKSNAAS--FSPPPAAPRKVAPKTIEPVNPTSVPAPDRPISSSNSVDNEH  306

Query  771   NAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGL  592
               + EA+G+S+Y++ LP N T A LE VFKK+G IK+ GIQVRSNRQQ FCFGFVEF   
Sbjct  307   IQEGEADGYSVYIKGLPMNATDAMLEEVFKKFGTIKNDGIQVRSNRQQAFCFGFVEFEEA  366

Query  591   NSMNNAIQDSPIMIGDRQAVVEIK  520
              S+  A++ SP+ IG RQ  VE K
Sbjct  367   TSVQKALEASPVAIGGRQVFVEEK  390


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             S Q+VGNAFV+QYY ILHHSP  V+RFYQ++S L RP+ DG
Sbjct  34    SPQVVGNAFVQQYYHILHHSPGLVHRFYQDNSKLGRPEIDG  74



>ref|XP_009588970.1| PREDICTED: putative G3BP-like protein isoform X2 [Nicotiana tomentosiformis]
Length=474

 Score =   194 bits (494),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 191/321 (60%), Gaps = 15/321 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI SL+Y ++ AEI + DAQ SYNGGV VLVTG L G DN+ R F+QTFFLAPQD
Sbjct  63    QAINDKILSLNYGDFRAEIISVDAQESYNGGVHVLVTGLLAGNDNVVRNFSQTFFLAPQD  122

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             +GYFVLND+FRY      DS  + V   +   T   +P  P+ +P  V  + N+  +S  
Sbjct  123   RGYFVLNDMFRY-----GDSVNQHVT-TEVPATNAVAPVTPEQDPPPVQQNHNSEQSSPS  176

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EE  N G +++   E+     +E+  + +    + ++ +  ++ES   +  +DAPK SY
Sbjct  177   VEEA-NEG-EVYNPPENGDMPVEEEVPVAEVVDEM-QDDSQIAVESNIKS--EDAPKKSY  231

Query  939   ASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             ASI+   + +       P+  +  K   +S   V Q P+     P     +++++ N + 
Sbjct  232   ASIV-MHLKESAASFSPPSAPAHRKPTAKSVEQVNQPPITATDGPAFSVDSVNDANNQEG  290

Query  759   EA-EGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSM  583
             EA EG+SIY++ LP + TVA L   FKK+GPIK GGIQVR+  +QGF FGFVEF   +++
Sbjct  291   EATEGYSIYIKGLPMSATVALLADEFKKFGPIKTGGIQVRN--RQGFSFGFVEFEVASAV  348

Query  582   NNAIQDSPIMIGDRQAVVEIK  520
               AI+ SPI IG RQAVVE K
Sbjct  349   QKAIEASPISIGGRQAVVEEK  369


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+V NAFV+QYY ILHHSP  V+RFYQE S L RP+ DG
Sbjct  14    SAQVVANAFVQQYYHILHHSPGLVFRFYQEISKLGRPEDDG  54



>ref|XP_009379993.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=462

 Score =   194 bits (493),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 135/325 (42%), Positives = 187/325 (58%), Gaps = 28/325 (9%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN KI S+ +    AE KT DAQ S  GGV VLVTG +TG+DN+KR FTQ+FFLA QDKG
Sbjct  65    INAKILSMGF--VRAETKTVDAQESLGGGVTVLVTGHVTGEDNVKRDFTQSFFLALQDKG  122

Query  1293  YFVLNDVFRYVEQ-DEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDT  1117
             Y+VLND+FR+VE+ +   +   + NG     TV  +P AP  +        + +  +S  
Sbjct  123   YYVLNDIFRFVEEVNHQQAQQGLANG-----TV--APHAPKQDLPSEQGQHDLDQTTSSQ  175

Query  1116  EEVKNVGIKIHESLEDEKQVSDEKE---ILVDTESHLNENQTSASLESTTSAIQDDAPKM  946
              E + V  +   +  D  +V +E+E   +++D        +   + ES  +  Q++ PK 
Sbjct  176   VEDEEVNEEEVYNPSDNGEVVEEEESTGVVID--------EVPNNSESNVATAQEEMPKK  227

Query  945   SYASILSSQMNKG---PTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDES  775
             SYASI+    N     PT+   P   S +K E Q   + A    P +  P + ST +D +
Sbjct  228   SYASIVKDMNNASVSPPTR--APPKPSSIKAEPQV--LPAPPAGPASDMPTSCSTTVDSN  283

Query  774   KNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHG  595
                  EA+G+SIYV+NLP + T A+LE  F+K+G IK  GIQVRS++ QGFCFGFVEF  
Sbjct  284   YTQDAEADGYSIYVKNLPLDATPAQLEEEFRKFGAIKPDGIQVRSHKLQGFCFGFVEFEV  343

Query  594   LNSMNNAIQDSPIMIGDRQAVVEIK  520
              N+  +AI+ SPIMIG R A VE K
Sbjct  344   ANAAQSAIEASPIMIGGRPAYVEEK  368


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             SAQ+VGNAFV+QYY IL  SP+ VYRFYQE S L RPD  G
Sbjct  14    SAQVVGNAFVQQYYHILQQSPELVYRFYQEGSKLGRPDAHG  54



>gb|AFW62474.1| hypothetical protein ZEAMMB73_312737 [Zea mays]
Length=409

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 181/337 (54%), Gaps = 40/337 (12%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I +KI  +D     AEI+T D+Q S  GGV VLVTG LTG+D ++R+F+Q+FFLAPQ+KG
Sbjct  70    IGEKIMEMDVSK--AEIRTVDSQESLGGGVTVLVTGHLTGRDGVRREFSQSFFLAPQEKG  127

Query  1293  YFVLNDVFRYV----------EQDEADSNAKMV--NGVDDEPTVIPSPEAPDPEPA----  1162
             YFVLND+FR+V           Q EAD+    V  NG     T+   P  PD   A    
Sbjct  128   YFVLNDMFRFVGEIPAPTAVEAQPEADAVVLSVAANGTS---TLAVEPATPDDRNAVPQQ  184

Query  1161  --HVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASL  988
               HV D     P   +  EV +            ++V DE++ + +  + +  N  +   
Sbjct  185   EHHVVDRSPPQPEEEEEAEVYD---------PPPEEVVDEEQPVPEVINEVPNNVAAVLA  235

Query  987   ESTTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapa  808
              +    +Q++APK SYASI+             PT  +  K EKQS ++     V     
Sbjct  236   TTVAPVLQEEAPKKSYASIVKVMKEVSLPAPAPPTRTAPPKPEKQSPALAPVKDVLPF--  293

Query  807   piaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQ  631
                  ++  E+ N QE E + H+IYVRNLP N T  +LE  FKK+G IK  GIQVRSN+ 
Sbjct  294   -----SSNPENGNIQEPEDDAHAIYVRNLPLNATETQLEDEFKKFGTIKQNGIQVRSNKI  348

Query  630   QGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             QGFC+GFVEF    S+ +AI+ SP+MIG RQ  +E K
Sbjct  349   QGFCYGFVEFEDSTSVQSAIEASPVMIGGRQCYIEEK  385


 Score = 71.6 bits (174),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRP  1732
             PSAQ+VGNAFV+QYYL+LH SPD VYRFYQE+S L RP
Sbjct  15    PSAQVVGNAFVQQYYLVLHQSPDLVYRFYQEASRLGRP  52



>ref|XP_006386880.1| hypothetical protein POPTR_0002s24800g [Populus trichocarpa]
 gb|ERP64677.1| hypothetical protein POPTR_0002s24800g [Populus trichocarpa]
Length=511

 Score =   195 bits (496),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 132/334 (40%), Positives = 186/334 (56%), Gaps = 27/334 (8%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             IN+KI SL Y    AEI T D+Q SY GGV+VLVTG L G DNL++KFTQ+FFLAPQDKG
Sbjct  63    INEKILSLGYGQVRAEIVTVDSQESYKGGVLVLVTGYLNGNDNLRQKFTQSFFLAPQDKG  122

Query  1293  YFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSDTE  1114
             YFVLNDVFRYV+    DS  +  NG  +  +   +P APD +  H  ++  + P ++ +E
Sbjct  123   YFVLNDVFRYVD----DSTHQ--NGNQEPASNFEAPVAPDQDTPHTQETHISEPTAALSE  176

Query  1113  EVKNVGIKIHESLEDE----------------KQVSDEKEILVDTESHLNENQTSASLES  982
             EV  +G +++   E                  ++  +    +VD     ++    + +  
Sbjct  177   EV--IGGEVYNPSESGDVSVEVEEEESGDVSFEEEEEPMPEVVDEIPPDSQLVADSQVVV  234

Query  981   TTSAIQDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapi  802
              +SA  +D PK SYAS++  Q          PT +      K    + A V  P A    
Sbjct  235   ESSAKIEDTPKKSYASVVKVQKEY-TAPFSSPTPSPLRSAPKIQEQVTAAVSQPPAAESH  293

Query  801   aPSTAIDESKNAQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGF  622
               S+   E+ NAQE  EG SIYV+ LP + T   LE  FKK+GPI++GG+QVR   Q+GF
Sbjct  294   VSSSNTFENGNAQESEEGPSIYVKGLPLDATTTLLENEFKKFGPIRNGGVQVRF--QKGF  351

Query  621   CFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
             CFGFVEF   +++ +A++ SP+MI   + +VE K
Sbjct  352   CFGFVEFEVASAVQSALEASPVMINGFRVIVEEK  385


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -2

Query  1854  VPGPSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             +P P+A +VGNAF  QYY IL  SPD V+RFYQ+ S   RP  DG
Sbjct  8     LPVPTADVVGNAFAHQYYHILQQSPDLVHRFYQDGSKFGRPGEDG  52



>gb|AFW62473.1| hypothetical protein ZEAMMB73_312737, partial [Zea mays]
Length=393

 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 139/338 (41%), Positives = 186/338 (55%), Gaps = 43/338 (13%)
 Frame = -2

Query  1473  INDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQDKG  1294
             I +KI  +D     AEI+T D+Q S  GGV VLVTG LTG+D ++R+F+Q+FFLAPQ+KG
Sbjct  70    IGEKIMEMDVSK--AEIRTVDSQESLGGGVTVLVTGHLTGRDGVRREFSQSFFLAPQEKG  127

Query  1293  YFVLNDVFRYV----------EQDEADSNAKMV--NGVDDEPTVIPSPEAPD----PEPA  1162
             YFVLND+FR+V           Q EAD+    V  NG     T+   P  PD    P+  
Sbjct  128   YFVLNDMFRFVGEIPAPTAVEAQPEADAVVLSVAANGTS---TLAVEPATPDDHAVPQQE  184

Query  1161  HVPDSLNANPASSDTEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNE--NQTSASL  988
             H    ++ +P   + EE   V     E + DE+Q   E          +NE  N  +A L
Sbjct  185   H--HVVDRSPPQPEEEEEAEVYDPPPEEVVDEEQPVPEV---------INEVPNNVAAVL  233

Query  987   ESTTSAI-QDDAPKMSYASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeap  811
              +T + + Q++APK SYASI+             PT  +  K EKQS ++     V    
Sbjct  234   ATTVAPVLQEEAPKKSYASIVKVMKEVSLPAPAPPTRTAPPKPEKQSPALAPVKDVLPF-  292

Query  810   apiaPSTAIDESKNAQE-EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNR  634
                   ++  E+ N QE E + H+IYVRNLP N T  +LE  FKK+G IK  GIQVRSN+
Sbjct  293   ------SSNPENGNIQEPEDDAHAIYVRNLPLNATETQLEDEFKKFGTIKQNGIQVRSNK  346

Query  633   QQGFCFGFVEFHGLNSMNNAIQDSPIMIGDRQAVVEIK  520
              QGFC+GFVEF    S+ +AI+ SP+MIG RQ  +E K
Sbjct  347   IQGFCYGFVEFEDSTSVQSAIEASPVMIGGRQCYIEEK  384


 Score = 71.6 bits (174),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRP  1732
             PSAQ+VGNAFV+QYYL+LH SPD VYRFYQE+S L RP
Sbjct  15    PSAQVVGNAFVQQYYLVLHQSPDLVYRFYQEASRLGRP  52



>gb|EYU40629.1| hypothetical protein MIMGU_mgv1a005146mg [Erythranthe guttata]
Length=490

 Score =   194 bits (494),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 134/320 (42%), Positives = 183/320 (57%), Gaps = 17/320 (5%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q IN+KI SL Y ++ AEI++ DAQ S++GGV VLVTG LT KDN    F Q+FFLAPQD
Sbjct  83    QAINEKIISLKYTDFRAEIRSVDAQESFDGGVQVLVTGYLTAKDNKVSHFAQSFFLAPQD  142

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             KGYFVLND+ RYV  D    N  ++  V     V+P   AP  E  HV  S  + P++ +
Sbjct  143   KGYFVLNDMLRYV--DTVALNPALITEV-----VVPIAAAPIQE-NHV--SEQSTPSAEE  192

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
                   V  +++   E+      E+E        ++E Q  A     +SA  ++APK +Y
Sbjct  193   A-----VAGEVYNPPENGDVAIAEEEEEEPVAEVVDEVQEIAKPLDRSSAKIEEAPKKTY  247

Query  939   ASILSSQMNKGPTKIYVPTNASRMKTEKQSASMvaqvpvpeapapiaPSTAIDESKNAQE  760
             ASI+    +   +  + P  A+  K   ++   V    VP    PI+ S ++D     + 
Sbjct  248   ASIVKHLKSNAAS--FSPPPAAPRKVAPKTIEPVNPTSVPAPDRPISSSNSVDNEHIQEG  305

Query  759   EAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLNSMN  580
             EA+G+S+Y++ LP N T A LE VFKK+G IK+ GIQVRSNRQQ FCFGFVEF    S+ 
Sbjct  306   EADGYSVYIKGLPMNATDAMLEEVFKKFGTIKNDGIQVRSNRQQAFCFGFVEFEEATSVQ  365

Query  579   NAIQDSPIMIGDRQAVVEIK  520
              A++ SP+ IG RQ  VE K
Sbjct  366   KALEASPVAIGGRQVFVEEK  385


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  1842  SAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             S Q+VGNAFV+QYY ILHHSP  V+RFYQ++S L RP+ DG
Sbjct  34    SPQVVGNAFVQQYYHILHHSPGLVHRFYQDNSKLGRPEIDG  74



>gb|KDO65984.1| hypothetical protein CISIN_1g012554mg [Citrus sinensis]
Length=461

 Score =   193 bits (491),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 185/323 (57%), Gaps = 20/323 (6%)
 Frame = -2

Query  1479  QRINDKIRSLDYENYDAEIKTADAQNSYNGGVIVLVTGCLTGKDNLKRKFTQTFFLAPQD  1300
             Q INDKI +L Y  + AEI T DAQ SYNGGVIVLVTG LTGKD+++RKF+Q+FFLAPQD
Sbjct  59    QAINDKILALHYGEFSAEITTVDAQESYNGGVIVLVTGYLTGKDSVRRKFSQSFFLAPQD  118

Query  1299  KGYFVLNDVFRYVEQDEADSNAKMVNGVDDEPTVIPSPEAPDPEPAHVPDSLNANPASSD  1120
             KGYFVLNDVFRYV  D+A          D E  + P  +    +  HV D    +     
Sbjct  119   KGYFVLNDVFRYV--DDAYHVGSQATTNDVEAPITPDQDHSPVQENHVSDQTAISSEEVS  176

Query  1119  TEEVKNVGIKIHESLEDEKQVSDEKEILVDTESHLNENQTSASLESTTSAIQDDAPKMSY  940
              EEV N       ++E+E+    E    +  ++H+       + ES +    ++ PK SY
Sbjct  177   GEEVDNPSENGDGTIEEEEAPVPEVVDAIPDDTHV-------AAESDSKV--EEVPKKSY  227

Query  939   ASILSSQMNKGPTKIYVPTNASR---MKTEKQSASMvaqvpvpeapapiaPSTAIDESKN  769
             ASI+   M      +  P  AS    MK ++Q  +  A  P P +   +  S A +   N
Sbjct  228   ASIVKV-MKDSALPVSSPPPASLRSIMKIQEQPPA-SATSPAPASEKQVTNSNATENGNN  285

Query  768   AQEEAEGHSIYVRNLPFNITVAELEAVFKKYGPIKHGGIQVRSNRQQGFCFGFVEFHGLN  589
               +EAEG SIY++ LP + T A LE  F+K+G I+ GGIQV++  Q+GFCFGFVEF   N
Sbjct  286   --QEAEGPSIYLKGLPPSATHALLENEFRKFGTIRAGGIQVKT--QKGFCFGFVEFEEEN  341

Query  588   SMNNAIQDSPIMIGDRQAVVEIK  520
             ++ +AI+ SPI+I   + VVE K
Sbjct  342   AVQSAIEASPIVISGHRVVVEPK  364


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  1845  PSAQLVGNAFVEQYYLILHHSPDQVYRFYQESSVLSRPDPDG  1720
             P+A +V NAFV QYYLILH SP  V+RFYQ+ S L RP+ +G
Sbjct  9     PTADIVANAFVHQYYLILHQSPQLVHRFYQDISKLGRPEENG  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6138787690416