BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20558_g1_i3 len=323 path=[575:0-55 630:56-147 240:148-185
759:186-187 761:188-212 786:213-322]

Length=323
                                                                      Score     E

dbj|BAA36405.1|  dihydroflavonol 4-reductase                            176   2e-51   Ipomoea purpurea
dbj|BAA59332.1|  dihydroflavonol 4-reductase                            176   3e-51   Ipomoea nil [qian niu]
dbj|BAA36407.1|  dihydroflavonol 4-reductase                            149   4e-41   Ipomoea purpurea
dbj|BAF64707.1|  dihydroflavonol 4-reductase                            147   7e-40   Ipomoea tricolor [campanilla]
gb|ACS87954.1|  dihydroflavonol 4-reductase                             147   1e-39   Ipomoea horsfalliae [Kuhio-vine]
dbj|BAA22076.1|  dihydroflavonol 4-reductase                            145   2e-39   Ipomoea nil [qian niu]
gb|ABY25288.1|  dihydroflavonol 4-reductase C                           145   2e-39   Convolvulus arvensis
gb|ABY25284.1|  dihydroflavonol 4-reductase B                           140   4e-37   Convolvulus arvensis
gb|ABY25283.1|  dihydroflavonol 4-reductase B                           139   4e-37   Turbina oblongata
dbj|BAA36406.1|  dihydroflavonol 4-reductase                            139   5e-37   Ipomoea purpurea
dbj|BAA74700.1|  dihydroflavonol 4-reductase                            139   5e-37   Ipomoea purpurea
gb|AAB84048.1|  dihydroflavonol 4-reductase                             139   6e-37   Ipomoea purpurea
gb|ABW69680.1|  dihydroflavonol 4-reductase                             139   6e-37   Ipomoea purpurea
gb|ABW69681.1|  dihydroflavonol 4-reductase                             139   6e-37   Ipomoea purpurea
gb|ABY61976.1|  dihydroflavonol 4-reductase                             137   4e-36   Ipomoea batatas [batate]
dbj|BAA34637.1|  dihydroflavonol 4-reductase                            137   4e-36   Ipomoea batatas [batate]
gb|ABL74479.1|  dihydroflavonol 4-reductase                             137   4e-36   Ipomoea batatas [batate]
dbj|BAA22072.1|  dihydroflavonol 4-reductase                            137   5e-36   Ipomoea nil [qian niu]
dbj|BAD05164.1|  dihydroflavonol 4-reductase                            134   4e-35   Ipomoea batatas [batate]
gb|ACB42445.1|  dihydroflavonol 4-reductase                             134   5e-35   
gb|ABY25290.1|  dihydroflavonol 4-reductase                             133   7e-35   Evolvulus glomeratus
gb|ACB56920.1|  dihydroflavonol-4-reductase                             132   9e-35   Pilosella officinarum [mouse-ear hawkweed]
gb|ABY25282.1|  dihydroflavonol 4-reductase A                           132   1e-34   Turbina oblongata
gb|ABY25289.1|  dihydroflavonol 4-reductase C                           131   3e-34   Merremia umbellata
gb|ABY25287.1|  dihydroflavonol 4-reductase C                           131   3e-34   Turbina oblongata
emb|CAC88859.1|  dihydroflavonol reductase                              130   7e-34   Rhododendron simsii
gb|ABY25281.1|  dihydroflavonol 4-reductase A                           130   1e-33   Convolvulus arvensis
sp|P51105.1|DFRA_GERHY  RecName: Full=Dihydroflavonol-4-reductase...    130   1e-33   Gerbera hybrid cultivar
gb|ABY25280.1|  dihydroflavonol 4-reductase A                           129   2e-33   Merremia dissecta
gb|AAS46256.1|  dihydroflavonol reductase                               129   2e-33   Ipomoea quamoclit
gb|AGV53048.1|  dihydroflavonol 4-reductase                             128   4e-33   
gb|AAR01565.1|  dihydroflavonol/flavonone-4-reductase like protein      128   6e-33   Sinningia cardinalis
gb|ABY25285.1|  dihydroflavonol 4-reductase B                           127   1e-32   Merremia dissecta
gb|ABN80436.1|  dihydroflavonol 4-reductase                             127   1e-32   Nicotiana tabacum [American tobacco]
gb|ACS12835.1|  dihydroflavonol 4-reductase                             127   1e-32   Nicotiana langsdorffii [fumo-bravo]
ref|NP_001289451.1|  dihydroflavonol-4-reductase                        127   1e-32   
dbj|BAM37961.1|  dihydroflavonol-4-reductase                            127   2e-32   
gb|AHK23093.1|  dihydroflavonol 4-reductase                             126   2e-32   
dbj|BAM42669.1|  dihydroflavonol 4-reductase                            126   2e-32   
gb|AAX12420.1|  dihydroflavonol 4-reductase                             126   2e-32   
gb|AAL89715.1|AF483836_1  dihydroflavonol-4-reductase                   126   2e-32   Vaccinium macrocarpon [American cranberry]
gb|AAL89714.1|AF483835_1  dihydroflavonol-4-reductase                   126   2e-32   Vaccinium macrocarpon [American cranberry]
sp|P51103.1|DFRA_CALCH  RecName: Full=Dihydroflavonol-4-reductase...    126   2e-32   Callistephus chinensis [Chinese aster]
gb|AGI96401.1|  dihydroflavonol 4-reductase                             126   3e-32   
sp|P14720.2|DFRA_PETHY  RecName: Full=Dihydroflavonol-4-reductase...    126   3e-32   Petunia x hybrida [garden petunia]
gb|ABN80438.1|  dihydroflavonol 4-reductase                             126   3e-32   Nicotiana benthamiana
gb|AGI96400.1|  dihydroflavonol 4-reductase                             126   3e-32   
gb|AFC37249.1|  dihydroflavonol4-reductase                              125   4e-32   
dbj|BAA84939.1|  dihydroflavonol 4-reductase                            125   4e-32   Camellia sinensis [black tea]
gb|AAT84073.1|  dihydroflavonol 4-reductase                             125   4e-32   Camellia sinensis [black tea]
gb|AAT66505.1|  dihydroflavonol 4-reductase                             125   4e-32   Camellia sinensis [black tea]
ref|XP_009759956.1|  PREDICTED: dihydroflavonol-4-reductase             125   6e-32   
gb|ABN80437.1|  dihydroflavonol 4-reductase                             125   6e-32   Nicotiana tabacum [American tobacco]
gb|ACK57789.1|  dihydroflavonol reductase                               125   7e-32   Centaurea maculosa
dbj|BAJ17657.1|  dihydroflavonol reductase                              124   9e-32   
gb|ACN60404.1|  dihydroflavonol-4-reductase                             122   1e-31   Capsicum annuum
gb|AGP50169.1|  dihydroflavonol-4-reductase                             125   1e-31   
gb|AAX63400.1|  dihydroflavonol 4-reductase                             124   1e-31   Solanum pinnatisectum
gb|ACO50430.1|  dihydroflavonol 4-reductase                             124   2e-31   
gb|AAM47527.1|  dihydroflavonol reductase                               117   2e-31   Vitis vinifera
gb|AEX88625.1|  dihydroflavonol 4-reductase                             124   2e-31   
gb|AFK33310.1|  unknown                                                 120   2e-31   
ref|NP_001274988.1|  dihydroflavonol 4-reductase                        124   2e-31   
gb|AIY51701.1|  dihydroflavonol 4-reductase                             124   2e-31   
gb|AAZ57436.1|  dihydroflavonol reductase                               124   2e-31   Solanum tuberosum [potatoes]
gb|AIY51700.1|  dihydroflavonol 4-reductase                             124   2e-31   
gb|AFL48186.1|  DFR protein                                             124   2e-31   
gb|AEN83503.1|  dihydroflavonol 4-reductase                             124   2e-31   
emb|CBI19727.3|  unnamed protein product                                127   3e-31   
gb|AFQ98276.1|  dihydroflavonol 4-reductase                             124   3e-31   
gb|AAM73809.1|AF449422_1  dihydroflavonol-4-reductase                   124   3e-31   Solanum tuberosum [potatoes]
gb|AFO59583.1|  diihydroflavonol 4-reductase                            123   3e-31   
gb|ADV03180.1|  dihydroflavonol reductase                               123   4e-31   
emb|CAN80655.1|  hypothetical protein VITISV_011650                     124   4e-31   Vitis vinifera
gb|AFO59582.1|  diihydroflavonol 4-reductase                            123   4e-31   
gb|AEQ04697.1|  dihydroflavonol 4-reductase                             123   5e-31   
gb|AFO59584.1|  diihydroflavonol 4-reductase                            123   6e-31   
gb|AER40962.1|  dihydroflavonol 4-reductase                             122   6e-31   
gb|AFO59589.1|  diihydroflavonol 4-reductase                            123   6e-31   
gb|AFO59585.1|  diihydroflavonol 4-reductase                            122   7e-31   
gb|AFO59588.1|  diihydroflavonol 4-reductase                            122   7e-31   
ref|NP_001275409.1|  dihydroflavonol-4-reductase-like                   122   7e-31   
gb|ABQ97018.1|  dihydroflavonol 4-reductase                             122   7e-31   Saussurea medusa
gb|AGJ70142.1|  dihydroflavonol-4-reductase                             122   8e-31   
gb|AAV71171.1|  dihydroflavonol reductase                               122   9e-31   Lotus corniculatus
gb|AFK35141.1|  unknown                                                 122   9e-31   
gb|AGO02174.1|  dihydroflavonol 4-reductase                             122   9e-31   
dbj|BAF49294.1|  dihydroflavanol 4-reductase                            121   1e-30   Clitoria ternatea
dbj|BAC10993.1|  dihydroflavonol 4-reductase                            122   1e-30   Nierembergia sp. NB17
gb|AAF60298.1|AF233639_1  dihydroflavonol-4-reductase                   122   1e-30   Petunia x hybrida [garden petunia]
dbj|BAJ08042.1|  dihydroflavonol 4-reductase                            121   2e-30   
gb|AEN69001.1|  dihydroflavonol 4-reductase                             121   2e-30   
gb|AAR27014.1|  dihydroflavanol-4-reductase 1                           121   2e-30   Medicago truncatula
dbj|BAE19953.1|  dihydroflavonol 4-reductase                            121   2e-30   Lotus japonicus
ref|XP_007160734.1|  hypothetical protein PHAVU_001G012700g             121   2e-30   
gb|AFO59586.1|  diihydroflavonol 4-reductase                            121   2e-30   
gb|AFO59581.1|  diihydroflavonol 4-reductase                            121   2e-30   
gb|AIY22763.1|  dihydroflavonol 4-reductase                             121   2e-30   
gb|AFO59587.1|  diihydroflavonol 4-reductase                            121   3e-30   
emb|CAA70345.1|  dihydroflavonol reductase                              120   3e-30   Forsythia x intermedia [cultivated forsythia]
gb|AGI16384.1|  dihydroflavonol 4-reductase                             120   3e-30   
gb|ACS12834.1|  dihydroflavonol 4-reductase                             120   3e-30   Nicotiana alata [flowering tobacco]
ref|XP_010315879.1|  PREDICTED: dihydroflavonol-4-reductase isofo...    120   3e-30   
gb|ABK58134.1|  dihydroflavonol 4-reductase                             114   3e-30   Malus domestica [apple tree]
gb|AHL45016.1|  dihydroflavonol 4-reductase                             120   4e-30   
gb|ADZ54784.1|  dihydrokaempferol 4-reductase                           120   4e-30   
ref|NP_001275860.1|  dihydroflavonol-4-reductase                        120   4e-30   
gb|AHK10250.1|  dihydroflavonol 4-reductase                             120   4e-30   
ref|NP_001268144.1|  dihydroflavonol-4-reductase                        120   4e-30   
gb|AFG28176.1|  putative dihydroflavonol 4-reductase                    120   4e-30   
gb|AJA79073.1|  dihydroflavonol 4-reductase                             120   4e-30   
ref|XP_007222317.1|  hypothetical protein PRUPE_ppa008069mg             120   4e-30   
sp|P14721.1|DFRA_ANTMA  RecName: Full=Dihydroflavonol-4-reductase...    120   5e-30   Antirrhinum majus [garden snapdragon]
ref|XP_010494237.1|  PREDICTED: dihydroflavonol-4-reductase-like        120   5e-30   
gb|ACA04004.1|  dihydroflavonol-4-reductase                             121   5e-30   Diplacus aurantiacus
gb|ACN82380.1|  dihydroflavonol 4-reductase                             119   5e-30   Vitis amurensis
emb|CDP01993.1|  unnamed protein product                                120   6e-30   
gb|ABP57077.1|  dihydroflavonol 4-reductase                             120   7e-30   Solenostemon scutellarioides
ref|XP_003638261.1|  Dihydroflavonol reductase                          119   7e-30   
gb|ABK88311.2|  dihydroflavonol 4-reductase                             120   7e-30   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEX07281.1|  DFR                                                     119   7e-30   
gb|AAR27015.1|  dihydroflavonal-4-reductase 2                           119   7e-30   Medicago truncatula
gb|ACA04005.1|  dihydroflavonol-4-reductase                             120   7e-30   Diplacus aurantiacus
gb|ACJ84553.1|  unknown                                                 119   8e-30   Medicago truncatula
gb|AGA82783.1|  dihydroflavonol reductase 2                             119   8e-30   
ref|XP_010247640.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    119   8e-30   
ref|XP_008377381.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    119   8e-30   
ref|XP_010442115.1|  PREDICTED: dihydroflavonol-4-reductase             119   9e-30   
gb|AFK35813.1|  unknown                                                 119   9e-30   
gb|AAF23884.2|AF117263_1  dihydroflavanol reductase 3                   119   9e-30   Lotus corniculatus
gb|ADC96612.1|  dihydroflavonol 4-reductase                             119   9e-30   Chrysanthemum x morifolium [florist's chrysanthemum]
dbj|BAJ08043.1|  dihydroflavonol 4-reductase                            119   1e-29   
gb|AHM27144.1|  dihydroflavonol 4-reductase                             120   1e-29   
gb|AFD28990.1|  dihydroflavonol 4-reductase                             119   1e-29   
gb|AAK00655.1|AF229383_1  dihydroflavonone isomerase                    113   1e-29   Brassica napus [oilseed rape]
gb|ABC95032.1|  dihydroflavonol-4-reductase                             113   1e-29   Brassica juncea [brown mustard]
ref|XP_008220831.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    119   1e-29   
gb|ACV49882.1|  dihydroflavonol 4-reductase                             117   1e-29   
gb|AFO59579.1|  diihydroflavonol 4-reductase                            119   1e-29   
gb|AEO79982.1|  dihydroflavonol 4-reductase                             119   1e-29   
gb|AAS68512.1|  dihydroflavonone isomerase                              113   2e-29   Brassica juncea [brown mustard]
gb|AFO65508.1|  dihydroflavonol 4-reductase                             118   2e-29   
ref|XP_006281803.1|  hypothetical protein CARUB_v10027976mg             118   2e-29   
gb|AEF14420.1|  dihydroflavonol 4-reductase                             118   2e-29   
gb|ABK88310.2|  dihydroflavonol 4-reductase                             119   2e-29   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADV03181.1|  dihydroflavonol reductase                               119   2e-29   
gb|KDO84613.1|  hypothetical protein CISIN_1g040253mg                   118   2e-29   
gb|AFO59580.1|  diihydroflavonol 4-reductase                            119   2e-29   
ref|XP_006473894.1|  PREDICTED: dihydroflavonol-4-reductase             118   2e-29   
emb|CAP08825.1|  dihydroflavonol reductase                              119   2e-29   Arabidopsis lyrata [lyrate rockcress]
gb|AAN63056.1|  dihydroflavonol reductase                               118   2e-29   Populus tremuloides
ref|XP_002863734.1|  dihydroflavonol reductase                          118   2e-29   
ref|XP_010263613.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    117   3e-29   
gb|AAK00657.1|AF229385_1  dihydroflavonone isomerase                    111   3e-29   Brassica oleracea
gb|AEN69002.1|  dihydroflavonol 4-reductase                             117   4e-29   
dbj|BAD95233.1|  dihydroflavonol 4-reductase                            117   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AFO65510.1|  dihydroflavonol 4-reductase                             117   4e-29   
dbj|BAD34461.1|  dihydroflavonol 4-reductase                            117   5e-29   Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAO53727.1|  dihydroflavonol 4-reducatase 2                         117   5e-29   
gb|AGO18339.1|  dihydroflavonol reductase                               115   5e-29   
dbj|BAF45153.1|  dihydroflavonol 4-reductase                            117   5e-29   Humulus lupulus [common hop]
ref|XP_003550388.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    117   5e-29   
gb|AAD56578.1|AF184271_1  dihydroflavonol 4-reductase                   117   5e-29   Daucus carota [carrots]
gb|ABP57067.1|  dihydroflavonol 4-reductase                             117   5e-29   Fagopyrum cymosum
ref|XP_010245913.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    117   5e-29   
gb|AGA82790.1|  dihydroflavonol reductase 3                             114   5e-29   
gb|AIU34714.1|  dihydroflavonol 4-reductase 1                           117   6e-29   
gb|ACZ48697.1|  dihydroflavonol-4-reductase                             117   6e-29   Fagopyrum tataricum [Kangra buckwheat]
gb|AAA32783.1|  dihydroflavonol 4-reductase                             117   6e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31196.1|  hypothetical protein MIMGU_mgv1a006799mg                117   6e-29   
ref|XP_010245912.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    117   6e-29   
gb|AHF58604.1|  dihydroflavonol 4-reductase                             117   8e-29   
dbj|BAA19658.1|  dihydroflavonol 4-reductase                            117   8e-29   Perilla frutescens [beefsteak-mint]
gb|AHZ30596.1|  dihydroflavonol reductase                               116   8e-29   
gb|ACZ48698.1|  dihydroflavonol-4-reductase                             116   8e-29   Fagopyrum esculentum
gb|ACU28803.1|  dihydroflavonol reductase                               116   8e-29   Rhizophora mangle
gb|AFO65509.1|  dihydroflavonol 4-reductase                             116   9e-29   
emb|CAA33544.1|  unnamed protein product                                117   9e-29   Petunia x hybrida [garden petunia]
ref|XP_010481941.1|  PREDICTED: dihydroflavonol-4-reductase-like        117   9e-29   
ref|XP_002862988.1|  dihydroflavonol reductase                          117   9e-29   
gb|ACM62744.1|  dihydroflavonol-4-reductase                             116   9e-29   Garcinia mangostana [mangosteen]
dbj|BAO53728.1|  dihydroflavonol 4-reducatase 2                         114   1e-28   
ref|XP_007160735.1|  hypothetical protein PHAVU_001G012800g             116   1e-28   
ref|XP_011028872.1|  PREDICTED: dihydroflavonol-4-reductase-like ...    116   1e-28   
gb|ABY89686.1|  dihydroflavonol-4-reductase 2 protein                   116   1e-28   
gb|AII26023.1|  dihydroflavanol 4-reductase                             116   1e-28   
gb|AGU42192.1|  dihydroflavonol 4-reductase                             116   1e-28   
gb|AHL46448.1|  dihydroflavonol 4-reductase                             116   1e-28   
ref|XP_004291858.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    116   1e-28   
gb|AHL46451.1|  dihydroflavonol 4-reductase                             116   1e-28   
gb|AEI59122.1|  dihydroflavonol 4-reductase                             115   1e-28   
gb|ABU93477.1|  dihydroflavonol 4-reductase                             116   1e-28   Helianthus annuus
ref|NP_199094.1|  dihydroflavonol-4-reductase                           116   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336072.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    115   2e-28   
sp|Q84KP0.1|DFRA_PYRCO  RecName: Full=Bifunctional dihydroflavono...    115   2e-28   Pyrus communis
dbj|BAF49325.1|  dihydroflavonol 4-reductase                            115   2e-28   Delphinium belladonna
emb|CDX95155.1|  BnaC09g17150D                                          116   2e-28   
gb|ADB45307.1|  dihydroflavonol 4-reductase                             116   2e-28   Brassica juncea var. napiformis [jie cai ge da]
gb|AAX53571.1|  dihydroflavonol 4-reductase                             116   2e-28   Brassica rapa
gb|AAV80210.1|  dihydroflavonol-4-reductase                             116   2e-28   Brassica rapa subsp. pekinensis [bai cai]
gb|AAO73442.1|  dihydroflavonol 4-reductase                             116   2e-28   Brassica oleracea
ref|XP_009114035.1|  PREDICTED: dihydroflavonol-4-reductase             116   2e-28   
gb|AGT39046.1|  dihydroflavonol 4-reductase                             109   2e-28   
emb|CAP08813.1|  dihydroflavonol reductase                              115   2e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA12736.1|  dihydroflavonol-4-reductase                            115   2e-28   Gentiana triflora
ref|XP_006403345.1|  hypothetical protein EUTSA_v10003227mg             115   2e-28   
ref|XP_006403346.1|  hypothetical protein EUTSA_v10003227mg             115   2e-28   
emb|CAP08805.1|  dihydroflavonol reductase                              115   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAO39816.1|  dihydroflavonol 4-reductase                             115   2e-28   Malus domestica [apple tree]
gb|AHB19302.1|  dihydroflavonol-4-reductase                             115   2e-28   
gb|AIB06741.1|  dihydroflavonol 4-reductase                             115   2e-28   
ref|XP_004499179.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    114   2e-28   
dbj|BAH24302.1|  dihydroflavonol 4-reductase                            115   2e-28   Rosa hybrid cultivar
gb|KDP38534.1|  hypothetical protein JCGZ_04459                         115   2e-28   
ref|XP_011028873.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    114   3e-28   
ref|XP_010060970.1|  PREDICTED: dihydroflavonol-4-reductase             115   3e-28   
emb|CAP08819.1|  dihydroflavonol reductase                              115   3e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAP08818.1|  dihydroflavonol reductase                              115   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083203.1|  PREDICTED: LOW QUALITY PROTEIN: dihydroflavo...    115   3e-28   
gb|AEN71545.1|  dihydroflavonol 4-reductase                             115   3e-28   
ref|XP_006878526.1|  hypothetical protein AMTR_s00011p00221520          115   3e-28   
dbj|BAA12723.1|  dihydroflavonol 4-reductase                            115   3e-28   Rosa hybrid cultivar
gb|AAX12422.1|  dihydroflavonol 4-reductase                             115   3e-28   
dbj|BAD67185.1|  dihydroflavonol 4-reductase                            115   3e-28   Spinacia oleracea
gb|AHJ80979.1|  dihydroflavanone reductase                              115   3e-28   
gb|AFI71899.1|  dihydroflavonol 4-reductase                             115   3e-28   
dbj|BAF49318.1|  dihydroflavonol 4-reductase                            114   4e-28   Lobelia erinus
dbj|BAO53730.1|  dihydroflavonol 4-reducatase 2                         115   4e-28   
gb|ACU19265.1|  unknown                                                 114   4e-28   Glycine max [soybeans]
ref|XP_010245914.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    114   4e-28   
gb|ABM64800.1|  dihydroflavonol 4-reductase                             114   4e-28   Gossypium hirsutum [American cotton]
ref|NP_001234408.1|  dihydroflavonol-4-reductase                        115   5e-28   
gb|ABY25286.1|  dihydroflavonol 4-reductase B                           114   5e-28   Petunia x hybrida [garden petunia]
gb|AFF60412.1|  dihydroflavonol reductase                               114   5e-28   
ref|XP_009365091.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    114   5e-28   
gb|AAX16491.1|  dihydroflavonol 4-reductase                             114   5e-28   Crataegus monogyna
gb|AAO39818.1|  dihydroflavonol 4-reductase                             114   5e-28   Pyrus communis
gb|ACP30362.1|  dihydroflavonol-4-reductase protein                     114   5e-28   Malus hybrid cultivar
gb|AGZ15302.1|  dihydroflavonol 4-reductase                             114   5e-28   
ref|NP_001280868.1|  bifunctional dihydroflavonol 4-reductase/fla...    114   6e-28   
gb|ACV72642.1|  dihydroflavonol 4-reductase                             114   6e-28   Gossypium hirsutum [American cotton]
dbj|BAI78343.1|  dihydroflavonol reductase                              114   6e-28   Pelargonium zonale
gb|KFK31813.1|  hypothetical protein AALP_AA6G162000                    114   6e-28   
gb|AIR09398.1|  dihydroflavonol 4-reductase                             114   7e-28   
sp|P51110.1|DFRA_VITVI  RecName: Full=Dihydroflavonol-4-reductase...    114   7e-28   Vitis vinifera
gb|AAP13055.1|  dihydroflavonol 4-reductase                             114   8e-28   Gypsophila elegans [annual baby's-breath]
dbj|BAB92999.1|  dihydroflavonol reductase                              113   8e-28   Malus domestica [apple tree]
gb|KHN20964.1|  Bifunctional dihydroflavonol 4-reductase/flavanon...    114   8e-28   
gb|AIU98514.1|  dihydroflavonol 4-reductase                             114   9e-28   
ref|XP_007017586.1|  Dihydroflavonol-4-reductase                        114   1e-27   
ref|NP_001238612.1|  dihydroflavonol-4-reductase DFR1                   114   1e-27   
ref|XP_002307667.2|  dihydroflavonol reductase family protein           113   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010110052.1|  Bifunctional dihydroflavonol 4-reductase/fla...    113   1e-27   
gb|AHY35315.1|  dihydroflavonol reductase                               113   1e-27   
gb|AHL46445.1|  dihydroflavonol 4-reductase                             113   1e-27   
sp|P51104.1|DFRA_DIACA  RecName: Full=Dihydroflavonol-4-reductase...    113   1e-27   Dianthus caryophyllus [carnation]
gb|AHZ97873.1|  dihydroflavonol 4-reductase                             113   1e-27   
dbj|BAE19948.1|  dihydroflavonol 4-reductase                            113   2e-27   Lotus japonicus
ref|XP_006383711.1|  hypothetical protein POPTR_0005s25110g             113   2e-27   
ref|XP_002300759.1|  dihydroflavonol reductase family protein           113   2e-27   Populus trichocarpa [western balsam poplar]
emb|CAP08822.1|  dihydroflavonol reductase                              113   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABC94578.1|  dihydroflavonol 4-reductase                             113   2e-27   Anthurium andraeanum [flamingo-lily]
gb|AAP20866.1|  putative dihydroflavonol 4-reductase                    113   2e-27   Anthurium andraeanum [flamingo-lily]
gb|AHL46450.1|  dihydroflavonol 4-reductase                             113   2e-27   
ref|NP_001239696.1|  uncharacterized protein LOC100778253               112   2e-27   
gb|AGZ15301.1|  dihydroflavonol 4-reductase                             112   2e-27   
gb|AGT39061.1|  dihydroflavonol 4-reductase                             107   2e-27   
gb|ADY02645.1|  dihydroflavonol 4-reductase                             112   3e-27   
emb|CAC10526.1|  dihydroflavonol 4-reductase                            107   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008347420.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    109   3e-27   
ref|XP_010664947.1|  PREDICTED: dihydroflavonol-4-reductase-like        112   3e-27   
ref|XP_011007452.1|  PREDICTED: dihydroflavonol-4-reductase             112   3e-27   
gb|AFU90827.1|  dihydroflavonol 4-reductase                             112   4e-27   
ref|XP_008347417.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    108   4e-27   
gb|AHZ31751.1|  dihydroflavonol 4-reductase                             112   4e-27   
dbj|BAD67186.1|  dihydroflavonol 4-reductase                            112   4e-27   Phytolacca americana [common pokeberry]
dbj|BAB20075.1|  dihydroflavonol 4-reductase                            112   4e-27   Torenia hybrid cultivar
gb|AGA82788.1|  dihydroflavonol reductase 3                             109   4e-27   
emb|CBI19728.3|  unnamed protein product                                112   4e-27   
gb|ABS84871.1|  dihydroflavonol-4-reductase                             112   6e-27   
dbj|BAE19952.1|  dihydroflavonol 4-reductase                            110   6e-27   
gb|EPS61593.1|  dihydroflavonol 4-reductase                             107   7e-27   
ref|XP_010906334.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    111   7e-27   
dbj|BAE19951.1|  dihydroflavonol 4-reductase                            110   7e-27   
gb|AIM48930.1|  dihydroflavonol 4-reductase                             111   8e-27   
gb|AHL46438.1|  dihydroflavonol 4-reductase                             111   8e-27   
gb|AHL46440.1|  dihydroflavonol 4-reductase                             111   8e-27   
ref|XP_010673251.1|  PREDICTED: dihydroflavonol-4-reductase             111   9e-27   
gb|AAK00656.1|AF229384_1  dihydroflavonone isomerase                    105   9e-27   
gb|AHL46442.1|  dihydroflavonol 4-reductase                             110   1e-26   
dbj|BAE17125.1|  dihydroflavonol 4-reductase                            110   1e-26   
gb|AAX12421.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|AAU12363.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|AAC25960.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|AAS89833.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|AGR34043.1|  dihydroflavonol-4-reductase                             110   1e-26   
ref|XP_004499176.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    110   1e-26   
gb|ADY02647.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|ADY02644.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|ADY02643.1|  dihydroflavonol 4-reductase                             110   1e-26   
gb|KDP38532.1|  hypothetical protein JCGZ_04457                         110   2e-26   
gb|AAG01030.1|  dihydroflavonol 4-reductase                             110   2e-26   
gb|AIZ74402.1|  dihydroflavonol 4-reductase                             110   2e-26   
dbj|BAN62761.1|  dihydroflavonol 4-reductase                            110   2e-26   
emb|CDY21246.1|  BnaC02g28770D                                          108   2e-26   
gb|AFU90826.1|  dihydroflavonol 4-reductase                             109   3e-26   
ref|XP_009398122.1|  PREDICTED: dihydroflavonol-4-reductase-like        109   3e-26   
ref|XP_002510417.1|  cinnamoyl-CoA reductase, putative                  109   4e-26   
gb|AGA82802.1|  dihydroflavonol reductase 1                             107   4e-26   
ref|XP_004499178.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    108   5e-26   
ref|XP_004499177.1|  PREDICTED: bifunctional dihydroflavonol 4-re...    108   6e-26   
ref|XP_007145529.1|  hypothetical protein PHAVU_007G246200g             108   6e-26   
gb|AAO53552.1|  dihydroflavonol 4-reductase                             108   7e-26   
ref|XP_010523603.1|  PREDICTED: dihydroflavonol-4-reductase             108   7e-26   
dbj|BAE19950.1|  dihydroflavonol 4-reductase                            108   7e-26   
gb|AAU12364.1|  dihydroflavonol 4-reductase                             108   8e-26   
gb|AAV83987.1|  dihydroflavonol 4-reductase 5                           108   8e-26   
gb|ABE01414.1|  dihydroflavonol 4-reductase                             108   8e-26   
gb|AAO50084.1|  dihydroflavonol 4-reductase                             108   9e-26   
gb|ABK24604.1|  unknown                                                 108   9e-26   
gb|ABG76202.1|  dihydroflavonol reductase                               108   9e-26   
gb|ADE77658.1|  unknown                                                 108   1e-25   
gb|AAO60212.1|  dihydroflavonol 4-reductase                             108   1e-25   
dbj|BAH36906.1|  dihydroflavonol-4-reductase                            108   1e-25   
dbj|BAD11018.1|  dihydroflavonol-4-reductase                            108   1e-25   
dbj|BAH36916.1|  dihydroflavonol-4-reductase                            108   1e-25   
dbj|BAD11019.1|  dihydroflavonol-4-reductase                            107   1e-25   
sp|P51106.1|DFRA_HORVU  RecName: Full=Dihydroflavonol-4-reductase...    107   2e-25   
gb|ADY02646.1|  dihydroflavonol 4-reductase                             107   2e-25   
prf||1804328A  dihydroflavonol reductase                                107   2e-25
emb|CDM83481.1|  unnamed protein product                                107   2e-25   
gb|AAO60214.1|  dihydroflavonol 4-reductase                             107   2e-25   
gb|AHH28214.1|  dihydroflavonol 4-reducatse                             107   2e-25   
gb|AAV83986.1|  dihydroflavonol 4-reductase 4                           107   3e-25   
gb|AAV83983.1|  dihydroflavonol 4-reductase 1                           107   3e-25   
dbj|BAH36913.1|  dihydroflavonol-4-reductase                            107   3e-25   
dbj|BAH36905.1|  dihydroflavonol-4-reductase                            107   3e-25   
gb|ABK26123.1|  unknown                                                 106   3e-25   
gb|AAS57870.1|  DFR-2                                                   106   3e-25   
dbj|BAH36900.1|  dihydroflavonol-4-reductase                            106   3e-25   
gb|AAD56579.1|AF184272_1  dihydroflavonol 4-reductase like              106   4e-25   
ref|XP_009394236.1|  PREDICTED: dihydroflavonol-4-reductase-like        106   4e-25   
gb|AAU06584.1|  dihydroflavonol-4-reductase                             103   4e-25   
dbj|BAH36903.1|  dihydroflavonol-4-reductase                            106   4e-25   
dbj|BAH36922.1|  dihydroflavonol-4-reductase                            106   4e-25   
gb|ACN40030.1|  unknown                                                 106   5e-25   
gb|ABR17584.1|  unknown                                                 106   5e-25   
gb|AAL35830.1|AF434703_1  dihydroflavonol-4-reductase                   106   5e-25   
dbj|BAD11017.1|  dihydroflavonol-4-reductase                            106   5e-25   
gb|ABR17302.1|  unknown                                                 104   6e-25   
gb|EMS68193.1|  Dihydroflavonol-4-reductase                             106   6e-25   
gb|AAD11472.1|  NADPH-dependent reductase homolog                       103   7e-25   
gb|AAD11485.1|  NADPH-dependent reductase                               102   7e-25   
gb|AAD11501.1|  NADPH-dependent reductase                               102   7e-25   
gb|AAU95082.1|  anthocyanidin reductase                                 105   9e-25   
gb|AHF58605.1|  dihydroflavonol 4-reductase                             105   9e-25   
gb|AAD11502.1|  NADPH-dependent reductase                               102   1e-24   
dbj|BAH36920.1|  dihydroflavonol-4-reductase                            105   1e-24   
ref|XP_002451586.1|  hypothetical protein SORBIDRAFT_04g004290          104   2e-24   
gb|ADE76248.1|  unknown                                                 104   2e-24   
dbj|BAH36911.1|  dihydroflavonol-4-reductase                            104   3e-24   
dbj|BAH36910.1|  dihydroflavonol-4-reductase                            104   3e-24   
gb|ABK24620.1|  unknown                                                 104   3e-24   
dbj|BAH36899.1|  dihydroflavonol-4-reductase                            104   3e-24   
ref|XP_009396003.1|  PREDICTED: dihydroflavonol-4-reductase-like        104   3e-24   
dbj|BAH36909.1|  dihydroflavonol-4-reductase                            104   3e-24   
dbj|BAH36901.1|  dihydroflavonol-4-reductase                            103   3e-24   
dbj|BAH36912.1|  dihydroflavonol-4-reductase                            103   3e-24   
gb|AAD10507.1|  NADPH-dependent reductase                               101   3e-24   
dbj|BAC98343.1|  dihydroflavonol reductase                              102   4e-24   
gb|ABK22120.1|  unknown                                                 103   4e-24   
gb|AAZ95165.1|  dihydroflavonol 4-reductase                           99.0    4e-24   
dbj|BAH36914.1|  dihydroflavonol-4-reductase                            103   4e-24   
dbj|BAH36902.1|  dihydroflavonol-4-reductase                            103   4e-24   
gb|AAC49670.1|  dihydroflavonol-4-reductase                           99.4    5e-24   
gb|AAD10506.1|  NADPH-dependent reductase                               100   5e-24   
dbj|BAH36904.1|  dihydroflavonol-4-reductase                            103   5e-24   
gb|AAD00058.1|  NADPH-dependent reductase                               100   5e-24   
gb|AAV83985.1|  dihydroflavonol 4-reductase 3                           103   6e-24   
gb|AAD10505.1|  A1                                                      100   6e-24   
gb|AAV83984.1|  dihydroflavonol 4-reductase 2                           102   8e-24   
ref|XP_004969260.1|  PREDICTED: dihydroflavonol-4-reductase-like        103   8e-24   
gb|AAD10513.1|  NADPH-dependent reductase                               100   9e-24   
ref|XP_008797532.1|  PREDICTED: dihydroflavonol-4-reductase             102   9e-24   
gb|ADK62520.1|  dihydroflavonol 4-reductase                             102   9e-24   
gb|AAC49671.1|  dihydroflavonol-4-reductase                           98.6    1e-23   
gb|AGT17256.1|  dihydroflavonol4-reductase                              103   1e-23   
gb|AAW66349.1|  NADPH-dependent reductase                               101   1e-23   
dbj|BAB40789.1|  dihydroflavonol 4-reductase                            102   1e-23   
ref|XP_010926084.1|  PREDICTED: dihydroflavonol-4-reductase-like        102   2e-23   
gb|AAW66347.1|  NADPH-dependent reductase                               100   2e-23   
dbj|BAH36921.1|  dihydroflavonol-4-reductase                            102   2e-23   
gb|AEQ61978.1|  dihydroflavonol 4-reductase                           99.8    2e-23   
gb|AAD10519.1|  NADPH-dependent reductase                             99.0    2e-23   
gb|ABR18365.1|  unknown                                                 101   3e-23   
gb|AAM19074.1|  dihydroflavonol reductase                             97.8    3e-23   
gb|AAD10527.1|  NADPH-dependent reductase                             99.0    3e-23   
dbj|BAB85682.1|  dihydroflavonol 4-reductase                          97.8    3e-23   
gb|AAD10511.1|  NADPH-dependent reductase                             98.6    4e-23   
gb|AAW66345.1|  NADPH-dependent reductase                               100   5e-23   
gb|AEW08519.1|  hypothetical protein CL214Contig1_08                  95.9    5e-23   
sp|P51108.1|DFRA_MAIZE  RecName: Full=Dihydroflavonol-4-reductase...    100   5e-23   
tpg|DAA58433.1|  TPA: anthocyaninless1                                98.2    7e-23   
dbj|BAM28975.1|  dihydroflavonol 4-reductase                            100   7e-23   
dbj|BAH36918.1|  dihydroflavonol-4-reductase                            100   8e-23   
gb|AAD10502.1|  NADPH-dependent reductase                             98.6    8e-23   
gb|AAC15248.1|  NADPH-dependent reductase A1                          95.9    9e-23   
gb|AET74074.1|  dihydroflavonol 4-reductase                           96.7    9e-23   
dbj|BAH36919.1|  dihydroflavonol-4-reductase                            100   1e-22   
gb|AFG70348.1|  hypothetical protein CL214Contig1_08                  94.7    1e-22   
ref|XP_002440593.1|  hypothetical protein SORBIDRAFT_09g003710        99.8    1e-22   
gb|AAD10522.2|  NADPH-dependent reductase                             99.0    2e-22   
dbj|BAM28974.1|  dihydroflavonol 4-reductase                          99.4    2e-22   
gb|AIC33029.1|  dihydroflavonol 4-reductase                           99.4    2e-22   
emb|CAA75997.1|  dihydroflavonol4-reductase                           99.4    2e-22   
gb|AAB94015.1|  NADPH-dependent reductase A1-b                        99.4    2e-22   
ref|NP_001140905.1|  anthocyaninless4                                 99.0    2e-22   
ref|XP_003569417.2|  PREDICTED: dihydroflavonol-4-reductase-like ...  99.0    2e-22   
emb|CAA75998.1|  dihydroflavonol4-reductase                           99.0    2e-22   
dbj|BAF93896.1|  dihydroflavonol 4-reductase                          99.0    3e-22   
gb|ABB29305.1|  NADPH-dependent reductase                             98.6    3e-22   
gb|AAD49343.1|AF169801_1  dihydroflavonol-4-reductase                 98.6    3e-22   
dbj|BAE79202.1|  dihydroflavonol 4-reductase                          98.6    3e-22   
gb|AIC33028.1|  dihydroflavonol 4-reductase                           98.6    3e-22   
ref|XP_002456015.1|  hypothetical protein SORBIDRAFT_03g028880        98.6    3e-22   
ref|XP_002456016.1|  hypothetical protein SORBIDRAFT_03g028890        98.6    3e-22   
gb|AAQ83576.1|  dihydroflavonol 4-reductase                           98.6    4e-22   
tpg|DAA58432.1|  TPA: anthocyaninless1                                98.2    4e-22   
dbj|BAE78769.1|  dihydroflavonol 4-reductase                          98.6    4e-22   
gb|ABB29303.1|  NADPH-dependent reductase                             98.2    4e-22   
emb|CAA75996.1|  dihydroflavonol4-reductase                           98.2    4e-22   
gb|AAB62873.1|  dihydroflavonol 4-reductase                           98.2    4e-22   
dbj|BAH36915.1|  dihydroflavonol-4-reductase                          97.8    5e-22   
gb|AGO64770.1|  dihydroflavonol 4-reductase                           97.4    5e-22   
ref|XP_010245915.1|  PREDICTED: bifunctional dihydroflavonol 4-re...  93.6    5e-22   
dbj|BAF03077.1|  dihydroflavonol 4-reductase                          96.3    6e-22   
ref|XP_007149683.1|  hypothetical protein PHAVU_005G090200g           97.4    8e-22   
dbj|BAF93856.1|  dihydroflavonol 4-reductase                          97.1    1e-21   
gb|AIS35914.1|  dihydroflavonol 4-reductase                           96.7    2e-21   
gb|AEF58500.1|  dihydroflavonol-4-reductase                           96.3    2e-21   
emb|CAR64529.1|  dihydroflavonol-4-reductase                          96.3    2e-21   
gb|AGY46123.1|  dihydroflavonol 4-reductase                           96.3    2e-21   
gb|AHA36975.1|  dihydroflavonol 4-reductase                           96.3    2e-21   
gb|KEH30630.1|  cinnamoyl-CoA reductase-like protein                  95.5    2e-21   
gb|AFK48895.1|  unknown                                               94.7    3e-21   
gb|AFP58815.1|  dihydroflavonol-4-reductase                           95.9    3e-21   
ref|XP_003607372.1|  Dihydroflavonol-4-reductase                      95.9    3e-21   
gb|AET74075.2|  dihydroflavonol 4-reductase                           95.5    3e-21   
gb|AAF21888.1|AF101045_3  putative NADPH-dependent reductase A1       95.9    3e-21   
emb|CAA69253.1|  Dihydroflavonol reductase                            95.9    3e-21   
gb|ADP37947.1|  dihydroflavonol 4-reductase                           93.2    3e-21   
gb|AHI49023.1|  dihydroflavonol 4-reductase                           95.5    3e-21   
emb|CAR64530.1|  dihydroflavonol-4-reductase                          95.5    4e-21   
gb|AAU93766.1|  putative dihyroflavonol 4-reductase                   95.5    4e-21   
ref|XP_003607374.1|  Dihydroflavonol-4-reductase                      95.5    4e-21   
gb|KEH19927.1|  cinnamyl alcohol dehydrogenase                        95.5    4e-21   
gb|AGA82796.1|  dihydroflavonol reductase 2                           93.2    5e-21   
gb|AGJ50590.1|  DFR1                                                  95.5    5e-21   
ref|XP_004509912.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  94.7    6e-21   
gb|AFK38743.1|  unknown                                               94.7    6e-21   
ref|XP_003628601.1|  Dihydroflavonol-4-reductase                      94.7    6e-21   
gb|AGA82775.1|  dihydroflavonol reductase 2                           94.0    6e-21   
ref|NP_001152467.1|  dihydroflavonol-4-reductase                      94.7    6e-21   
gb|KCW66061.1|  hypothetical protein EUGRSUZ_G03350                   94.0    6e-21   
gb|ADN03368.1|  dihydroflavonol 4-reductase                           94.4    7e-21   
gb|ABK27116.1|  unknown                                               94.7    7e-21   
ref|XP_006302493.1|  hypothetical protein CARUB_v10020587mg           94.7    7e-21   
gb|ABK27038.1|  unknown                                               94.7    7e-21   
ref|XP_002983967.1|  hypothetical protein SELMODRAFT_119444           94.4    8e-21   
gb|AEX31646.1|  dihydroflavonol 4-reductase                           91.7    1e-20   
gb|AFS60083.1|  dihydroflavonol 4-reductase                           94.0    1e-20   
gb|AEB96144.1|  dihydroflavinol reductase                             94.0    1e-20   
gb|AAQ77347.1|  dihydroflavonol 4-reductase                           94.0    1e-20   
ref|XP_007131547.1|  hypothetical protein PHAVU_011G022400g           93.6    2e-20   
ref|XP_007131544.1|  hypothetical protein PHAVU_011G022100g           93.2    2e-20   
ref|XP_004505624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        93.2    2e-20   
ref|XP_008354953.1|  PREDICTED: tetraketide alpha-pyrone reductas...  91.3    2e-20   
ref|XP_010102365.1|  hypothetical protein L484_015314                 93.2    2e-20   
ref|XP_010470552.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  93.2    2e-20   
ref|XP_010415215.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        93.2    2e-20   
ref|XP_010470551.1|  PREDICTED: cinnamoyl-CoA reductase 1-like is...  93.2    2e-20   
emb|CDY71108.1|  BnaAnng36130D                                        91.3    3e-20   
ref|XP_002268322.1|  PREDICTED: cinnamoyl-CoA reductase 1             92.8    3e-20   
ref|XP_002268122.1|  PREDICTED: cinnamoyl-CoA reductase 1             92.8    3e-20   
gb|KFK35854.1|  hypothetical protein AALP_AA4G045500                  92.8    3e-20   
ref|XP_009774143.1|  PREDICTED: tetraketide alpha-pyrone reductas...  91.3    3e-20   
gb|KHN20639.1|  Dihydroflavonol-4-reductase                           92.8    3e-20   
ref|NP_001242261.1|  uncharacterized protein LOC100804704             92.8    3e-20   
ref|XP_010673672.1|  PREDICTED: dihydroflavonol-4-reductase-like      92.8    4e-20   
gb|KEH19926.1|  cinnamyl alcohol dehydrogenase                        92.4    4e-20   
ref|XP_006304701.1|  hypothetical protein CARUB_v10011960mg           92.4    4e-20   
dbj|BAH98155.1|  dihydroflavonol 4-reductase                          93.2    5e-20   
ref|XP_010270635.1|  PREDICTED: tetraketide alpha-pyrone reductas...  92.4    5e-20   
ref|XP_010479624.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        92.0    6e-20   
ref|XP_010461970.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        92.0    6e-20   
ref|XP_006306213.1|  hypothetical protein CARUB_v10011885mg           92.0    6e-20   
ref|XP_006393056.1|  hypothetical protein EUTSA_v10011653mg           92.0    6e-20   
ref|NP_175552.2|  putative alcohol dehydrogenase                      92.0    6e-20   
ref|XP_004491683.1|  PREDICTED: cinnamoyl-CoA reductase 1-like        92.0    6e-20   
gb|KFK43249.1|  hypothetical protein AALP_AA1G099200                  92.0    6e-20   



>dbj|BAA36405.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=348

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGN QKVKHLLELPK
Sbjct  1    MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNTQKVKHLLELPK  60

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            AEGKLKVWKGVLEEEGSFDEAIAGC
Sbjct  61   AEGKLKVWKGVLEEEGSFDEAIAGC  85



>dbj|BAA59332.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=354

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/85 (99%), Positives = 84/85 (99%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK
Sbjct  1    MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  60

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
             EGKLKVWKGVLEEEGSFDEAIAGC
Sbjct  61   GEGKLKVWKGVLEEEGSFDEAIAGC  85



>dbj|BAA36407.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=356

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/84 (85%), Positives = 77/84 (92%), Gaps = 1/84 (1%)
 Frame = -3

Query  249  GGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK-A  73
            GG H P  PAP VCVTGAAG+VGSWLVMKLLQRGY+VHATVRDPGN +KVKHLLELPK A
Sbjct  4    GGGHAPTLPAPKVCVTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKHLLELPKAA  63

Query  72   EGKLKVWKGVLEEEGSFDEAIAGC  1
            EGKL++WKGVLEEEGSFD+AIAGC
Sbjct  64   EGKLRLWKGVLEEEGSFDDAIAGC  87



>dbj|BAF64707.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64708.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
 dbj|BAF64709.1| dihydroflavonol 4-reductase [Ipomoea tricolor]
Length=421

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 75/85 (88%), Gaps = 1/85 (1%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH PA P P VCVTGAAGF+GSWLVMKLLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDGNH-PALPPPKVCVTGAAGFIGSWLVMKLLQRGYHVHATVRDPGNTKKVKHLLELPK  59

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L +WKGV+EEEGSFDEAIAGC
Sbjct  60   ADTNLTLWKGVMEEEGSFDEAIAGC  84



>gb|ACS87954.1| dihydroflavonol 4-reductase [Ipomoea horsfalliae]
Length=414

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = -3

Query  255  MVGGNH-TPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELP  79
            MV GNH  PA P P VCVTGAAGF+GSWLVMKLLQRGY VHATVRDPGN +KV HLLELP
Sbjct  1    MVDGNHPAPALPPPKVCVTGAAGFIGSWLVMKLLQRGYHVHATVRDPGNTKKVNHLLELP  60

Query  78   KAEGKLKVWKGVLEEEGSFDEAIAGC  1
            KA+  L VWKGV+EEEGSFDEAIAGC
Sbjct  61   KADTNLTVWKGVMEEEGSFDEAIAGC  86



>dbj|BAA22076.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=356

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -3

Query  249  GGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK-A  73
            GG + P  PAP VCVTGAAG+VGSWLVMKLLQRGY+VHATVRDPGN +KVK LLELPK A
Sbjct  4    GGRNAPTLPAPKVCVTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKRLLELPKAA  63

Query  72   EGKLKVWKGVLEEEGSFDEAIAGC  1
            EGKL++WKGVLEEEGSFD+AIAGC
Sbjct  64   EGKLRLWKGVLEEEGSFDDAIAGC  87



>gb|ABY25288.1| dihydroflavonol 4-reductase C [Convolvulus arvensis]
Length=354

 Score =   145 bits (365),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            M  G H    PAP VCVTGA+G++GSWLVMKLLQRGYIVHATVRDPGN ++VKHLL+LPK
Sbjct  1    MSAGGHASTLPAPKVCVTGASGYIGSWLVMKLLQRGYIVHATVRDPGNTKRVKHLLQLPK  60

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  LK +KGVLEEEGSFDEAIAGC
Sbjct  61   ADRNLKFYKGVLEEEGSFDEAIAGC  85



>gb|ABY25284.1| dihydroflavonol 4-reductase B [Convolvulus arvensis]
Length=398

 Score =   140 bits (352),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 4/89 (4%)
 Frame = -3

Query  255  MVGGNH--TPAS-PA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLL  88
            MV G+H  TPA  PA   VCVTGAAGF+GSWLVM+LL+RGY VHATVRDPGN +KVKHLL
Sbjct  1    MVDGDHHTTPADLPARKVVCVTGAAGFIGSWLVMRLLERGYDVHATVRDPGNTKKVKHLL  60

Query  87   ELPKAEGKLKVWKGVLEEEGSFDEAIAGC  1
            ELPKAE  LK++KGV+EEEGSFDEAIAGC
Sbjct  61   ELPKAETNLKLYKGVMEEEGSFDEAIAGC  89



>gb|ABY25283.1| dihydroflavonol 4-reductase B [Turbina oblongata]
Length=399

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 75/90 (83%), Gaps = 5/90 (6%)
 Frame = -3

Query  255  MVGGNHT-PASPAPT----VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHL  91
            MV GNH  PA P PT    VCVTGAAGF+GSWLVM LL+RGY VHATVRDPGN +KVKHL
Sbjct  1    MVDGNHAAPALPPPTKPKVVCVTGAAGFIGSWLVMTLLRRGYHVHATVRDPGNTKKVKHL  60

Query  90   LELPKAEGKLKVWKGVLEEEGSFDEAIAGC  1
            L+LPKA+  L VWKGV+EEEGSFDEAIAGC
Sbjct  61   LDLPKADTNLTVWKGVMEEEGSFDEAIAGC  90



>dbj|BAA36406.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
 dbj|BAA74699.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH    PAP VCVTGAAGF+GSWLV  LLQRGY VHATVRDPGN +KVKHL+ELPK
Sbjct  1    MVDGNH--PLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>dbj|BAA74700.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH    PAP VCVTGAAGF+GSWLV  LLQRGY VHATVRDPGN +KVKHL+ELPK
Sbjct  1    MVDGNH--PLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>gb|AAB84048.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH    PAP VCVTGAAGF+GSWLV  LLQRGY VHATVRDPGN +KVKHL+ELPK
Sbjct  1    MVDGNH--PLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>gb|ABW69680.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH    PAP VCVTGAAGF+GSWLV  LLQRGY VHATVRDPGN +KVKHL+ELPK
Sbjct  1    MVDGNH--PLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>gb|ABW69681.1| dihydroflavonol 4-reductase [Ipomoea purpurea]
Length=386

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH    PAP VCVTGAAGF+GSWLV  LLQRGY VHATVRDPGN +KVKHL+ELPK
Sbjct  1    MVDGNH--PLPAPKVCVTGAAGFIGSWLVKTLLQRGYHVHATVRDPGNTKKVKHLVELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>gb|ABY61976.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=398

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH P  P P VCVTG AGF+GSWLVM LLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDGNH-PLLP-PKVCVTGPAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTVWKGVMEEEGSFDEAIAGC  83



>dbj|BAA34637.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 gb|AEQ92209.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 71/85 (84%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH        VCVTGAAGF+GSWLVM LLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDGNH-----PKVVCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPK  55

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L+VWKGV+EEEGSFDEAIAGC
Sbjct  56   ADTNLRVWKGVMEEEGSFDEAIAGC  80



>gb|ABL74479.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 71/85 (84%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH        VCVTGAAGF+GSWLVM LLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDGNH-----PQVVCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPK  55

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L+VWKGV+EEEGSFDEAIAGC
Sbjct  56   ADTNLRVWKGVMEEEGSFDEAIAGC  80



>dbj|BAA22072.1| dihydroflavonol 4-reductase [Ipomoea nil]
 dbj|BAA59333.1| dihydroflavonol 4-reductase [Ipomoea nil]
Length=403

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV GNH P  P P VCVTGAAGF+GSWLV  LLQRGY +HATVRDPGN +KVKHLLELPK
Sbjct  1    MVDGNH-PLLP-PKVCVTGAAGFIGSWLVKTLLQRGYHIHATVRDPGNTKKVKHLLELPK  58

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L +WKGV+EEEGSFDEAIAGC
Sbjct  59   ADTNLTIWKGVMEEEGSFDEAIAGC  83



>dbj|BAD05164.1| dihydroflavonol 4-reductase [Ipomoea batatas]
 dbj|BAD05178.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=394

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 69/85 (81%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV  NH        VCVTGAAGF+GSWLVM LLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDANH-----PKVVCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPK  55

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  56   ADTNLTVWKGVMEEEGSFDEAIAGC  80



>gb|ACB42445.1| dihydroflavonol 4-reductase [Ipomoea batatas]
Length=395

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 69/85 (81%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            MV  NH        VCVTGAAGF+GSWLVM LLQRGY VHATVRDPGN +KVKHLLELPK
Sbjct  1    MVDANH-----PKVVCVTGAAGFIGSWLVMTLLQRGYHVHATVRDPGNTKKVKHLLELPK  55

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  56   ADTNLTVWKGVMEEEGSFDEAIAGC  80



>gb|ABY25290.1| dihydroflavonol 4-reductase [Evolvulus glomeratus]
Length=350

 Score =   133 bits (334),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -3

Query  246  GNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEG  67
            GN    +    VCVTGA GF+GSWLVM+LL+R YIVHATVRDPGN +KVKHLLELPKA+ 
Sbjct  3    GNDDQHNVVSKVCVTGATGFIGSWLVMRLLERDYIVHATVRDPGNMEKVKHLLELPKADK  62

Query  66   KLKVWKGVLEEEGSFDEAIAGC  1
             L++W+GVLEEEGSFDEAI GC
Sbjct  63   NLRLWRGVLEEEGSFDEAIEGC  84



>gb|ACB56920.1| dihydroflavonol-4-reductase [Pilosella officinarum]
Length=354

 Score =   132 bits (333),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA TVCVTGAAGF+GSWLVM+LL+RGYIVHATVRDP N +KVKHLLELPKAE  L +WK
Sbjct  6    SPA-TVCVTGAAGFIGSWLVMRLLERGYIVHATVRDPDNIKKVKHLLELPKAETNLTLWK  64

Query  48   GVLEEEGSFDEAIAGC  1
            G L EEGSFDEAI GC
Sbjct  65   GDLTEEGSFDEAIEGC  80



>gb|ABY25282.1| dihydroflavonol 4-reductase A [Turbina oblongata]
Length=341

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGN +KVKHLLELPKAE  L++WKGVLEEEG
Sbjct  1    VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNTKKVKHLLELPKAEENLRLWKGVLEEEG  60

Query  27   SFDEAIAGC  1
            SFD+AIAGC
Sbjct  61   SFDDAIAGC  69



>gb|ABY25289.1| dihydroflavonol 4-reductase C [Merremia umbellata]
Length=344

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAG+VGSWLVMKLLQRGYIVHATVRDPGN  KVKHLLELPKA+  L++WKGVLEEEG
Sbjct  1    VTGAAGYVGSWLVMKLLQRGYIVHATVRDPGNTSKVKHLLELPKADTNLRLWKGVLEEEG  60

Query  27   SFDEAIAGC  1
            SFDEAIAGC
Sbjct  61   SFDEAIAGC  69



>gb|ABY25287.1| dihydroflavonol 4-reductase C [Turbina oblongata]
Length=338

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAG+VGSWLVMKLLQRGY+VHATVRDPGN +KVKHLLELPKA+G L++WKGVLEEEG
Sbjct  1    VTGAAGYVGSWLVMKLLQRGYVVHATVRDPGNTKKVKHLLELPKAKGNLRLWKGVLEEEG  60

Query  27   SFDEAIAGC  1
            SFD AIAGC
Sbjct  61   SFDNAIAGC  69



>emb|CAC88859.1| dihydroflavonol reductase [Rhododendron simsii]
Length=344

 Score =   130 bits (327),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             SPA TVCVTGAAGF+GSWLVM+LL+RGY+V ATVRDP N +KVKHLLELPKA+  L +W
Sbjct  6    GSPATTVCVTGAAGFIGSWLVMRLLERGYVVRATVRDPANIKKVKHLLELPKADSNLTLW  65

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  66   KADLNEEGSFDEAIEGC  82



>gb|ABY25281.1| dihydroflavonol 4-reductase A [Convolvulus arvensis]
Length=344

 Score =   130 bits (326),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 5/85 (6%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            M+G +H P      VCVTGAAGFV SWLVM+LL+RGY VHAT RDPGN +KV+HLLELPK
Sbjct  1    MIGDDHKP-----KVCVTGAAGFVASWLVMRLLERGYHVHATSRDPGNTEKVRHLLELPK  55

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A+  LK +K V+EEEGSFDEAIAGC
Sbjct  56   ADTNLKFYKAVMEEEGSFDEAIAGC  80



>sp|P51105.1|DFRA_GERHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Gerbera hybrid cultivar]
 emb|CAA78930.1| dihydroflavonol-4-reductase [Gerbera hybrid cultivar]
Length=366

 Score =   130 bits (326),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA TVCVTGAAGF+GSWLVM+LL+RGY+VHATVRDPG+ +KVKHLLELPKA+  LK+WK
Sbjct  5    SPA-TVCVTGAAGFIGSWLVMRLLERGYVVHATVRDPGDLKKVKHLLELPKAQTNLKLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLTQEGSFDEAIQGC  79



>gb|ABY25280.1| dihydroflavonol 4-reductase A [Merremia dissecta]
Length=356

 Score =   129 bits (324),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAGFVGSWLVMKLLQRGY VHATVRDP NA+KVKHLL+LPKA+  + VWKGV+EEEG
Sbjct  1    VTGAAGFVGSWLVMKLLQRGYHVHATVRDPSNAEKVKHLLQLPKADTNMTVWKGVMEEEG  60

Query  27   SFDEAIAGC  1
            SFDEAIAGC
Sbjct  61   SFDEAIAGC  69



>gb|AAS46256.1| dihydroflavonol reductase [Ipomoea quamoclit]
Length=408

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 3/88 (3%)
 Frame = -3

Query  255  MVGGNHTPASPAPT---VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLE  85
            MV GNH   +PA T   VCVTG AGF+GSWLVMKLLQ+GY VHATVRDPGN +K+KHLLE
Sbjct  1    MVDGNHPAPAPALTPPKVCVTGTAGFIGSWLVMKLLQQGYHVHATVRDPGNTKKLKHLLE  60

Query  84   LPKAEGKLKVWKGVLEEEGSFDEAIAGC  1
            LP A+  L VWKGV+EEEGSFDEAIAGC
Sbjct  61   LPMADTNLTVWKGVMEEEGSFDEAIAGC  88



>gb|AGV53048.1| dihydroflavonol 4-reductase [Actinidia chinensis]
Length=345

 Score =   128 bits (321),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A+   TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDPGN +KVKHLL+LPKAE  L +W
Sbjct  6    AAALDTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPGNMKKVKHLLDLPKAEANLTLW  65

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  66   KADLGEEGSFDEAIQGC  82



>gb|AAR01565.1| dihydroflavonol/flavonone-4-reductase like protein [Sinningia 
cardinalis]
Length=358

 Score =   128 bits (321),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P +PA TVCVTGAAG+VGSWLVMKLL+RGYIVHATVRDPGN +KVKHLLELP A+  L +
Sbjct  6    PLAPATTVCVTGAAGYVGSWLVMKLLERGYIVHATVRDPGNIKKVKHLLELPGAKTNLTL  65

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  +   GSFDEAI GC
Sbjct  66   WKADMTVNGSFDEAIQGC  83



>gb|ABY25285.1| dihydroflavonol 4-reductase B [Merremia dissecta]
Length=388

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAGFVGSWLVM+LLQRGY VHATVRDPGN +KVKHLLELPKA+  L VWKGV+EEEG
Sbjct  1    VTGAAGFVGSWLVMRLLQRGYHVHATVRDPGNTKKVKHLLELPKADTNLTVWKGVMEEEG  60

Query  27   SFDEAIAGC  1
            SFDEA+AGC
Sbjct  61   SFDEAVAGC  69



>gb|ABN80436.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=382

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  HTPASPA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            H P+ PA PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  
Sbjct  10   HAPSPPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  L  EGSFDEAI GC
Sbjct  70   LTLWKADLSVEGSFDEAIQGC  90



>gb|ACS12835.1| dihydroflavonol 4-reductase [Nicotiana langsdorffii]
Length=382

 Score =   127 bits (319),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  HTPASPA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            HT + PA PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  
Sbjct  10   HTSSPPATPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENNKKVKHLLELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  L  EGSFDEAI GC
Sbjct  70   LTLWKADLSVEGSFDEAIQGC  90



>ref|NP_001289451.1| dihydroflavonol-4-reductase [Nicotiana tomentosiformis]
 gb|ACS12833.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  HTPASPA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            H P+ PA PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  
Sbjct  10   HAPSPPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  L  EGSFDEAI GC
Sbjct  70   LTLWKADLSVEGSFDEAIQGC  90



>dbj|BAM37961.1| dihydroflavonol-4-reductase [Nicotiana tabacum]
 dbj|BAM37966.1| dihydroflavonol 4-reductase [Nicotiana tomentosiformis]
Length=382

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  HTPASPA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            H P+ PA PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  
Sbjct  10   HAPSPPAAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  L  EGSFDEAI GC
Sbjct  70   LTLWKADLSVEGSFDEAIQGC  90



>gb|AHK23093.1| dihydroflavonol 4-reductase [Vaccinium corymbosum]
Length=345

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWL+M+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +WK  L 
Sbjct  11   TVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKADLN  70

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  71   EEGSFDEAIEGC  82



>dbj|BAM42669.1| dihydroflavonol 4-reductase [Vaccinium ashei]
Length=345

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWL+M+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +WK  L 
Sbjct  11   TVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKADLN  70

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  71   EEGSFDEAIEGC  82



>gb|AAX12420.1| dihydroflavonol 4-reductase [Vaccinium macrocarpon]
Length=353

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWL+M+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +WK  L 
Sbjct  11   TVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKADLN  70

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  71   EEGSFDEAIEGC  82



>gb|AAL89715.1|AF483836_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=354

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWL+M+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +WK  L 
Sbjct  11   TVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKADLN  70

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  71   EEGSFDEAIEGC  82



>gb|AAL89714.1|AF483835_1 dihydroflavonol-4-reductase [Vaccinium macrocarpon]
Length=342

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWL+M+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +WK  L 
Sbjct  11   TVCVTGAAGFIGSWLIMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWKADLN  70

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  71   EEGSFDEAIEGC  82



>sp|P51103.1|DFRA_CALCH RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Callistephus chinensis]
 emb|CAA91922.1| dihydroflavonol 4-reductase [Callistephus chinensis]
Length=364

 Score =   126 bits (317),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SP PTVCVTGAAGF+GSWLVM+LL+RGYIV ATVR+PG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SP-PTVCVTGAAGFIGSWLVMRLLERGYIVRATVRNPGDMKKVKHLLELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLTQEGSFDEAIEGC  79



>gb|AGI96401.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -3

Query  240  HTPASPA--PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEG  67
            H P+ P   PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+ 
Sbjct  7    HAPSPPVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADT  66

Query  66   KLKVWKGVLEEEGSFDEAIAGC  1
             L +WK  L  EGSFDEAI GC
Sbjct  67   NLTLWKADLTVEGSFDEAIQGC  88



>sp|P14720.2|DFRA_PETHY RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Petunia x hybrida]
 emb|CAA56160.1| dfrA [Petunia x hybrida]
 gb|AGI96402.1| dihydroflavonol 4-reductase [Petunia x hybrida]
 gb|AGP50170.1| dihydroflavonol-4-reductase [Petunia x hybrida]
Length=380

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -3

Query  240  HTPASPA--PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEG  67
            H P+ P   PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+ 
Sbjct  7    HAPSPPVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADT  66

Query  66   KLKVWKGVLEEEGSFDEAIAGC  1
             L +WK  L  EGSFDEAI GC
Sbjct  67   NLTLWKADLTVEGSFDEAIQGC  88



>gb|ABN80438.1| dihydroflavonol 4-reductase [Nicotiana benthamiana]
Length=382

 Score =   126 bits (317),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = -3

Query  240  HTPASPA-PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            HT + PA PTVCVTGAAGF+GSWLVM+L++RGY VHATVRDP N +KVKHLLELPKA+  
Sbjct  10   HTSSPPATPTVCVTGAAGFIGSWLVMRLIERGYNVHATVRDPENNKKVKHLLELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  L  EGSFDEAI GC
Sbjct  70   LTLWKADLSVEGSFDEAIQGC  90



>gb|AGI96400.1| dihydroflavonol 4-reductase [Petunia x hybrida]
Length=380

 Score =   126 bits (316),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = -3

Query  240  HTPASPA--PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEG  67
            H P+ P   PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+ 
Sbjct  7    HAPSPPVAVPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADT  66

Query  66   KLKVWKGVLEEEGSFDEAIAGC  1
             L +WK  L  EGSFDEAI GC
Sbjct  67   NLTLWKADLTVEGSFDEAIQGC  88



>gb|AFC37249.1| dihydroflavonol4-reductase [Camellia chekiangoleosa]
Length=347

 Score =   125 bits (315),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS   TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHLL+LPKA+  L +W
Sbjct  10   ASAPGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  70   KADLNEEGSFDEAIEGC  86



>dbj|BAA84939.1| dihydroflavonol 4-reductase [Camellia sinensis]
 dbj|BAA84940.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   125 bits (315),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS   TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHLL+LPKA+  L +W
Sbjct  10   ASAPGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  70   KADLNEEGSFDEAIEGC  86



>gb|AAT84073.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   125 bits (314),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS   TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHLL+LPKA+  L +W
Sbjct  10   ASAPGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  70   KADLNEEGSFDEAIEGC  86



>gb|AAT66505.1| dihydroflavonol 4-reductase [Camellia sinensis]
Length=347

 Score =   125 bits (314),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS   TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHLL+LPKA+  L +W
Sbjct  10   ASAPGTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPANLKKVKHLLDLPKADTNLTLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  70   KADLNEEGSFDEAIEGC  86



>ref|XP_009759956.1| PREDICTED: dihydroflavonol-4-reductase [Nicotiana sylvestris]
 dbj|BAM37967.1| dihydroflavonol 4-reductase [Nicotiana sylvestris]
Length=381

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H P   APTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHL ELPKA+  L
Sbjct  10   HAPPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLFELPKADTNL  69

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  70   TLWKADLSVEGSFDEAIQGC  89



>gb|ABN80437.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
 dbj|BAF96936.1| dihydroflavonol 4-reductase [Nicotiana tabacum]
Length=381

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H P   APTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHL ELPKA+  L
Sbjct  10   HAPPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLFELPKADTNL  69

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  70   TLWKADLSVEGSFDEAIQGC  89



>gb|ACK57789.1| dihydroflavonol reductase [Centaurea maculosa]
Length=344

 Score =   125 bits (313),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SP  TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDPGN +KVKHL++LPKAE  L +WK
Sbjct  5    SPT-TVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPGNMKKVKHLIQLPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEA+ GC
Sbjct  64   ADLTQEGSFDEAVEGC  79



>dbj|BAJ17657.1| dihydroflavonol reductase [Gynura bicolor]
Length=351

 Score =   124 bits (312),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL+RGYIVHATVRDP + +KVKHL+ELPKAE  L +WK  L 
Sbjct  8    TVCVTGAAGFIGSWLVMRLLERGYIVHATVRDPDDKKKVKHLIELPKAETNLTLWKADLT  67

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  68   KEGSFDEAIKGC  79



>gb|ACN60404.1| dihydroflavonol-4-reductase, partial [Capsicum annuum]
Length=250

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -3

Query  234  PASP-APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            P+ P APTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELP+A+  L 
Sbjct  12   PSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLT  71

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  72   LWKADLTVEGSFDEAIQGC  90



>gb|AGP50169.1| dihydroflavonol-4-reductase [Calibrachoa sp. YC-2013]
Length=383

 Score =   125 bits (313),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 65/82 (79%), Gaps = 2/82 (2%)
 Frame = -3

Query  240  HTPASPA--PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEG  67
            H P+ P   PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KV HLLELPKA+ 
Sbjct  10   HAPSPPVAMPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVNHLLELPKADT  69

Query  66   KLKVWKGVLEEEGSFDEAIAGC  1
             L +WK  L  EGSFDEAI GC
Sbjct  70   NLTLWKADLTVEGSFDEAIQGC  91



>gb|AAX63400.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
 gb|AAX63404.1| dihydroflavonol 4-reductase [Solanum pinnatisectum]
Length=382

 Score =   124 bits (312),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVL  40
            PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L
Sbjct  18   PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNLTLWKADL  77

Query  39   EEEGSFDEAIAGC  1
              EGSFDEAI GC
Sbjct  78   AVEGSFDEAIQGC  90



>gb|ACO50430.1| dihydroflavonol 4-reductase [Dahlia pinnata]
Length=359

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA TVCVTGA+GF+GSWLVM+LL+RGYIV ATVRDPG+ +KVKHL+ELPKAE  L +WK
Sbjct  5    SPA-TVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLIELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLTQEGSFDEAIEGC  79



>gb|AAM47527.1| dihydroflavonol reductase [Vitis vinifera]
Length=95

 Score =   117 bits (294),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIKGC  78



>gb|AEX88625.1| dihydroflavonol 4-reductase [Lycium ruthenicum]
Length=379

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 56/73 (77%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVL  40
            PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L
Sbjct  15   PTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADL  74

Query  39   EEEGSFDEAIAGC  1
            + EGSFDEAI GC
Sbjct  75   KVEGSFDEAIQGC  87



>gb|AFK33310.1| unknown [Lotus japonicus]
Length=176

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + TVCVTGAAGF+GSWLVM+L++RGY V ATVRDP N +KVKHLLELP A+ KL +W
Sbjct  2    SSESETVCVTGAAGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLLELPDAKTKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIRGC  78



>ref|NP_001274988.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54579.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54581.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPK-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>gb|AIY51701.1| dihydroflavonol 4-reductase [Penstemon barbatus]
Length=383

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+ P+ TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHL+ELPKA+  L +
Sbjct  5    PSRPSSTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLIELPKADTNLTL  64

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  +GSFDEAI GC
Sbjct  65   WKADLTVDGSFDEAIQGC  82



>gb|AAZ57436.1| dihydroflavonol reductase [Solanum tuberosum]
Length=382

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPR-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIKGC  90



>gb|AIY51700.1| dihydroflavonol 4-reductase [Penstemon neomexicanus]
Length=383

 Score =   124 bits (311),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+ P+ TVCVTGAAGF+GSWLVM+LL+RGYIV ATVRDP N +KVKHL+ELPKA+  L +
Sbjct  5    PSRPSSTVCVTGAAGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLIELPKADTNLTL  64

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  +GSFDEAI GC
Sbjct  65   WKADLTVDGSFDEAIQGC  82



>gb|AFL48186.1| DFR protein [Capsicum annuum]
Length=382

 Score =   124 bits (310),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = -3

Query  234  PASP-APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            P+ P APTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELP+A+  L 
Sbjct  12   PSPPVAPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPEADTNLT  71

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  72   LWKADLTVEGSFDEAIQGC  90



>gb|AEN83503.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   124 bits (310),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPK-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>emb|CBI19727.3| unnamed protein product [Vitis vinifera]
Length=931

 Score =   127 bits (319),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVMKLLQRGY VHATVRDPGN +KVKHLLELPKA   L +W+  L+
Sbjct  8    TVCVTGASGFIGSWLVMKLLQRGYYVHATVRDPGNVEKVKHLLELPKASTHLSLWRADLK  67

Query  36   EEGSFDEAIAGC  1
            EEGSFD+AI GC
Sbjct  68   EEGSFDDAIQGC  79


 Score =   121 bits (304),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/95 (62%), Positives = 72/95 (76%), Gaps = 8/95 (8%)
 Frame = -3

Query  279  FVFF--TCLKMVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQ  106
            F+FF  + L+ +G      S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +
Sbjct  584  FIFFPGSFLRSMG------SQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVK  637

Query  105  KVKHLLELPKAEGKLKVWKGVLEEEGSFDEAIAGC  1
            KVKHLL+LPKAE  L +WK  L +EGSFDEAI GC
Sbjct  638  KVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGC  672



>gb|AFQ98276.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPK-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>gb|AAM73809.1|AF449422_1 dihydroflavonol-4-reductase [Solanum tuberosum]
Length=382

 Score =   124 bits (310),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPK-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIKGC  90



>gb|AFO59583.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   123 bits (309),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTMEGSFDEAIQGC  89



>gb|ADV03180.1| dihydroflavonol reductase [Iochroma gesnerioides]
Length=381

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>emb|CAN80655.1| hypothetical protein VITISV_011650 [Vitis vinifera]
Length=440

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVMKLLQRGY VHATVRDPGN +KVKHLLELPKA   L +W+  L+
Sbjct  181  TVCVTGASGFIGSWLVMKLLQRGYYVHATVRDPGNVEKVKHLLELPKASTHLSLWRADLK  240

Query  36   EEGSFDEAIAGC  1
            EEGSFD+AI GC
Sbjct  241  EEGSFDDAIQGC  252


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (61%), Gaps = 11/64 (17%)
 Frame = -3

Query  192  GFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEGSFDEA  13
             F+G  L+  +LQ G+         GNA+KVKHLLEL KA     +W+  L EEGSFD+A
Sbjct  16   AFLGGLLI--VLQNGH---------GNAEKVKHLLELHKASTHPSLWRADLNEEGSFDDA  64

Query  12   IAGC  1
            I GC
Sbjct  65   IQGC  68



>gb|AFO59582.1| diihydroflavonol 4-reductase [Iochroma fuchsioides]
Length=381

 Score =   123 bits (309),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>gb|AEQ04697.1| dihydroflavonol 4-reductase [Lycium barbarum]
Length=372

 Score =   123 bits (308),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  PTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVL  40
            PTVCVTGA+GF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L
Sbjct  15   PTVCVTGASGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADL  74

Query  39   EEEGSFDEAIAGC  1
              EGSFDEAI GC
Sbjct  75   TVEGSFDEAIQGC  87



>gb|AFO59584.1| diihydroflavonol 4-reductase [Iochroma baumii]
Length=381

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>gb|AER40962.1| dihydroflavonol 4-reductase [Saussurea involucrata]
Length=342

 Score =   122 bits (306),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SP  TVCVTGAAGF+GSWLVM+LLQRGY V ATVRDPGN +KV HL++LPKAE  L +WK
Sbjct  5    SPT-TVCVTGAAGFIGSWLVMRLLQRGYTVRATVRDPGNMKKVNHLIQLPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEA+ GC
Sbjct  64   ADLTQEGSFDEAVEGC  79



>gb|AFO59589.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   123 bits (308),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>gb|AFO59585.1| diihydroflavonol 4-reductase [Iochroma parvifolium]
Length=381

 Score =   122 bits (307),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>gb|AFO59588.1| diihydroflavonol 4-reductase [Iochroma umbellatum]
Length=381

 Score =   122 bits (307),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>ref|NP_001275409.1| dihydroflavonol-4-reductase-like [Solanum tuberosum]
 gb|AAQ54578.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AAQ54580.1| dihydroflavonol 4-reductase [Solanum tuberosum]
 gb|AEG64707.1| dihydroflavonol 4-reductase [Solanum tuberosum]
Length=382

 Score =   122 bits (307),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P    PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPK-TPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>gb|ABQ97018.1| dihydroflavonol 4-reductase [Saussurea medusa]
 gb|ABS11263.1| dihydroflavonol 4-reductase [Saussurea medusa]
Length=342

 Score =   122 bits (306),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SP  TVCVTGAAGF+GSWLVMKLLQRGY V ATVRDPGN +KV HL++LPKA+  L +WK
Sbjct  5    SPT-TVCVTGAAGFIGSWLVMKLLQRGYTVRATVRDPGNMKKVNHLIQLPKAKTNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLTQEGSFDEAIEGC  79



>gb|AGJ70142.1| dihydroflavonol-4-reductase [Vitis rotundifolia]
Length=337

 Score =   122 bits (305),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGAAGF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPTNMKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>gb|AAV71171.1| dihydroflavonol reductase [Lotus corniculatus]
 dbj|BAE19949.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=336

 Score =   122 bits (305),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+L++RGY+V ATVRDP N +KVKHLLELP+A+ KL +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKLTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  67   EEGSFDEAIKGC  78



>gb|AFK35141.1| unknown [Lotus japonicus]
Length=336

 Score =   122 bits (305),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+L++RGY+V ATVRDP N +KVKHLLELP+A+ KL +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKLTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  67   EEGSFDEAIKGC  78



>gb|AGO02174.1| dihydroflavonol 4-reductase [Ampelopsis grossedentata]
Length=337

 Score =   122 bits (305),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGAAGF+GSW+VM+LL+RGYIV ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSHAETVCVTGAAGFIGSWMVMRLLERGYIVRATVRDPTNMKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSF+EAI GC
Sbjct  62   KADLAEEGSFNEAIKGC  78



>dbj|BAF49294.1| dihydroflavanol 4-reductase [Clitoria ternatea]
Length=339

 Score =   121 bits (304),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S A  VCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KVKHLL+LP A+ KL +WK
Sbjct  3    SAAEVVCVTGASGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLLDLPNAKNKLSLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLGQEGSFDEAIKGC  78



>dbj|BAC10993.1| dihydroflavonol 4-reductase [Nierembergia sp. NB17]
Length=374

 Score =   122 bits (305),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            +PTVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHL ELPKA+  L +WK  
Sbjct  9    SPTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLQELPKADTNLTLWKAD  68

Query  42   LEEEGSFDEAIAGC  1
            L  EGSFDEAI GC
Sbjct  69   LAVEGSFDEAIKGC  82



>gb|AAF60298.1|AF233639_1 dihydroflavonol-4-reductase [Petunia x hybrida]
Length=373

 Score =   122 bits (305),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            + TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  
Sbjct  8    SATVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKAD  67

Query  42   LEEEGSFDEAIAGC  1
            L  EGSFDEAI GC
Sbjct  68   LTVEGSFDEAIQGC  81



>dbj|BAJ08042.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=344

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/78 (74%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            PAS   TVCVTGAAGF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +
Sbjct  4    PASQG-TVCVTGAAGFIGSWLVMRLLERGYAVRATVRDPANMKKVKHLLDLPKAETNLTL  62

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L EEGSFDEAI GC
Sbjct  63   WKADLTEEGSFDEAIQGC  80



>gb|AEN69001.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA  VCVTGA+GF+GSWLVM+LL+RGYIV ATVRDPG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SPA-IVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLAQEGSFDEAIEGC  79



>gb|AAR27014.1| dihydroflavanol-4-reductase 1 [Medicago truncatula]
 gb|KEH40173.1| dihydroflavonol 4-reductase [Medicago truncatula]
Length=334

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGA+GF+GSWLVM+L++RGY+V ATVRDP N +KV HLLELP A+GKL +W
Sbjct  2    GSMAETVCVTGASGFIGSWLVMRLMERGYMVRATVRDPENLKKVSHLLELPGAKGKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>dbj|BAE19953.1| dihydroflavonol 4-reductase [Lotus japonicus]
Length=340

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + TVCVTGAAGF+GSWLVM+L++RGY V AT+RDP N +KVKHLLELP A+ KL +W
Sbjct  2    SSESETVCVTGAAGFIGSWLVMRLIERGYTVRATIRDPANMKKVKHLLELPDAKTKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIRGC  78



>ref|XP_007160734.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
 gb|ESW32728.1| hypothetical protein PHAVU_001G012700g [Phaseolus vulgaris]
Length=354

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KVKHL+ELP A+ KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLVELPGAKTKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|AFO59586.1| diihydroflavonol 4-reductase [Dunalia brachyacantha]
Length=381

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELP A+  L +
Sbjct  12   PSPVARTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPNADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>gb|AFO59581.1| diihydroflavonol 4-reductase [Iochroma calycinum]
Length=381

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = -3

Query  228  SPAP---TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            +P+P   TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L 
Sbjct  11   APSPVGGTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLT  70

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  71   LWKADLTVEGSFDEAIQGC  89



>gb|AIY22763.1| dihydroflavonol 4-reductase [Iochroma calycinum]
Length=370

 Score =   121 bits (303),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = -3

Query  228  SPAP---TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            +P+P   TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L 
Sbjct  11   APSPVGGTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLT  70

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  71   LWKADLTVEGSFDEAIQGC  89



>gb|AFO59587.1| diihydroflavonol 4-reductase [Dunalia solanacea]
Length=381

 Score =   121 bits (303),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  234  PASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKV  55
            P+  A TVCVTGAAGF+GSWLVM+LL+RG+ VHATVRDP N +KVKHLLELPKA+  L +
Sbjct  12   PSPVAQTVCVTGAAGFIGSWLVMRLLERGFNVHATVRDPENKKKVKHLLELPKADTNLTL  71

Query  54   WKGVLEEEGSFDEAIAGC  1
            WK  L  EGSFDEAI GC
Sbjct  72   WKADLTVEGSFDEAIQGC  89



>emb|CAA70345.1| dihydroflavonol reductase [Forsythia x intermedia]
Length=371

 Score =   120 bits (302),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  PAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKG  46
            PA TVCVTGA+GF+GSWLVM+LL+RGY V AT RDP N QKVKHLLELP+A+  L +WK 
Sbjct  9    PATTVCVTGASGFIGSWLVMRLLERGYFVRATARDPENKQKVKHLLELPRADTNLTLWKA  68

Query  45   VLEEEGSFDEAIAGC  1
             +  EGSFDEAI GC
Sbjct  69   DMTVEGSFDEAIQGC  83



>gb|AGI16384.1| dihydroflavonol 4-reductase [Ribes nigrum]
Length=366

 Score =   120 bits (302),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGAAGF+GSWL+M+LL+RGYIV ATVRDP N +KVKHLL+LP A+  L +W
Sbjct  2    GSIAQTVCVTGAAGFIGSWLIMRLLERGYIVRATVRDPKNMKKVKHLLDLPTAKTNLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLSEEGSFDEAINGC  78



>gb|ACS12834.1| dihydroflavonol 4-reductase [Nicotiana alata]
Length=382

 Score =   120 bits (302),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L 
Sbjct  19   TVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLS  78

Query  36   EEGSFDEAIAGC  1
             EGSFDEAI GC
Sbjct  79   VEGSFDEAIQGC  90



>ref|XP_010315879.1| PREDICTED: dihydroflavonol-4-reductase isoform X1 [Solanum lycopersicum]
Length=382

 Score =   120 bits (302),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P     TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPKTT-TVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>gb|ABK58134.1| dihydroflavonol 4-reductase, partial [Malus domestica]
Length=92

 Score =   114 bits (285),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|AHL45016.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   120 bits (301),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSESVCVTGASGFIGSWLVMRLLERGYTVRATVRDPANQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>gb|ADZ54784.1| dihydrokaempferol 4-reductase [Prunus avium]
Length=346

 Score =   120 bits (301),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSESVCVTGASGFIGSWLVMRLLERGYTVRATVRDPANQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>ref|NP_001275860.1| dihydroflavonol-4-reductase [Citrus sinensis]
 ref|XP_006435032.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
 gb|AAS00611.1| dihydroflavonol-4-reductase [Citrus sinensis]
 gb|AAY87035.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|AAY87036.1| dihydroflavonol 4-reductase [Citrus sinensis]
 gb|ESR48272.1| hypothetical protein CICLE_v10001757mg [Citrus clementina]
Length=338

 Score =   120 bits (301),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLLELPKA   L +W
Sbjct  2    GSIAETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEG+FDEAI GC
Sbjct  62   KADLAEEGNFDEAIRGC  78



>gb|AHK10250.1| dihydroflavonol 4-reductase [Vitis davidii]
Length=337

 Score =   120 bits (300),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIKGC  78



>ref|NP_001268144.1| dihydroflavonol-4-reductase [Vitis vinifera]
 pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2C29|F Chain F, Structure Of Dihydroflavonol Reductase From Vitis Vinifera 
At 1.8 A.
 pdb|2IOD|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2IOD|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|2NNL|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol-4-Reductase 
Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3C1T|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|A Chain A, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|B Chain B, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|C Chain C, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|D Chain D, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|E Chain E, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 pdb|3BXX|F Chain F, Binding Of Two Substrate Analogue Molecules To Dihydroflavonol 
4-Reductase Alters The Functional Geometry Of The 
Catalytic Site
 emb|CAA72420.1| dihydroflavonol 4-reductase [Vitis vinifera]
 gb|AAX12423.1| dihydroflavonol 4-reductase [Vitis vinifera]
Length=337

 Score =   120 bits (300),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIKGC  78



>gb|AFG28176.1| putative dihydroflavonol 4-reductase [Vitis bellula]
Length=337

 Score =   120 bits (300),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIKGC  78



>gb|AJA79073.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|AJA79078.1| dihydroflavonol 4-reductase [Prunus persica]
Length=346

 Score =   120 bits (300),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLLELPKAE  L +WK  L 
Sbjct  7    SVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIQGC  78



>ref|XP_007222317.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
 gb|AEJ88220.1| dihydroflavonol 4-reductase [Prunus persica]
 gb|EMJ23516.1| hypothetical protein PRUPE_ppa008069mg [Prunus persica]
Length=346

 Score =   120 bits (300),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLLELPKAE  L +WK  L 
Sbjct  7    SVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIQGC  78



>sp|P14721.1|DFRA_ANTMA RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Antirrhinum majus]
 emb|CAA33543.1| unnamed protein product [Antirrhinum majus]
Length=446

 Score =   120 bits (302),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -3

Query  243  NHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGK  64
            + T    + TVCVTGAAGF+GSWLVM+LL+RGY V ATVRDPGN +KVKHL+ELPKA+  
Sbjct  10   SETAPPSSTTVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPGNMKKVKHLIELPKADTN  69

Query  63   LKVWKGVLEEEGSFDEAIAGC  1
            L +WK  +  EGSFDEAI GC
Sbjct  70   LTLWKADMTVEGSFDEAIQGC  90



>ref|XP_010494237.1| PREDICTED: dihydroflavonol-4-reductase-like [Camelina sativa]
Length=377

 Score =   120 bits (301),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN++KVKHLL+LP A+ KL +WK
Sbjct  3    SQRETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNSKKVKHLLDLPNAKSKLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGS+D+AI GC
Sbjct  63   ADLSDEGSYDDAIKGC  78



>gb|ACA04004.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   121 bits (303),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A PA TVCVTGA GF+GSW+VM+LL+RGYIVHATVRDP N +KVK L+ELP+A+  LK+W
Sbjct  10   APPATTVCVTGATGFIGSWIVMRLLERGYIVHATVRDPENMEKVKDLIELPRADTNLKLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  +  EGS+DEA+ GC
Sbjct  70   KADMNVEGSYDEAVKGC  86



>gb|ACN82380.1| dihydroflavonol 4-reductase [Vitis amurensis]
Length=337

 Score =   119 bits (299),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIKGC  78



>emb|CDP01993.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   120 bits (300),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  255  MVGGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPK  76
            M G   T A+   TVCVTGAAGF+GSWLVM+LL+R Y+V ATVRDPGN +KVKHLL+LPK
Sbjct  1    MEGDIATSAAAKGTVCVTGAAGFIGSWLVMRLLERDYVVRATVRDPGNMKKVKHLLDLPK  60

Query  75   AEGKLKVWKGVLEEEGSFDEAIAGC  1
            A   L +WK  + EEGSFDEA  GC
Sbjct  61   ASTHLTLWKADMTEEGSFDEATQGC  85



>gb|ABP57077.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
 gb|ABP57078.1| dihydroflavonol 4-reductase [Solenostemon scutellarioides]
Length=366

 Score =   120 bits (300),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = -3

Query  237  TPASP-APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            +PA P A TVCVTGA+GF+GSWLVM+LL+RGYIV ATVRDP N +KVKHL ELP+A+  L
Sbjct  2    SPAPPPATTVCVTGASGFIGSWLVMRLLERGYIVRATVRDPENLKKVKHLTELPRADTNL  61

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  +  EGS+DEA+ GC
Sbjct  62   TLWKADMNTEGSYDEAVQGC  81



>ref|XP_003638261.1| Dihydroflavonol reductase [Medicago truncatula]
Length=334

 Score =   119 bits (298),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHLLELP A  KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|ABK88311.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA  VCVTGAAGF+GSWLVM+LL+RGYIV ATVR+PG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SPA-IVCVTGAAGFIGSWLVMRLLERGYIVRATVREPGDMKKVKHLLELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  64   ADLAQEGSFDEAIEGC  79



>gb|AEX07281.1| DFR [Arachis hypogaea]
Length=345

 Score =   119 bits (299),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLLELP A+ KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPANMKKVKHLLELPGAKAKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KAELGEEGSFDEAINGC  78



>gb|AAR27015.1| dihydroflavonal-4-reductase 2 [Medicago truncatula]
 gb|KEH40172.1| dihydroflavonol 4-reductase-like protein [Medicago truncatula]
Length=339

 Score =   119 bits (298),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHLLELP A  KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|ACA04005.1| dihydroflavonol-4-reductase [Diplacus aurantiacus]
Length=470

 Score =   120 bits (301),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A PA TVCVTGA GF+GSW+VM+LL+RGY+VHATVRDP N +KVK L+ELP+A+  LK+W
Sbjct  10   APPATTVCVTGATGFIGSWIVMRLLERGYVVHATVRDPENMEKVKDLIELPRADTNLKLW  69

Query  51   KGVLEEEGSFDEAIAGC  1
            K  +  EGS+DEA+ GC
Sbjct  70   KADMNVEGSYDEAVKGC  86



>gb|ACJ84553.1| unknown [Medicago truncatula]
Length=339

 Score =   119 bits (298),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHLLELP A  KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|AGA82783.1| dihydroflavonol reductase 2, partial [Clarkia gracilis]
Length=306

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S A T+CVTGAAGF+GSWLVM+LL+RGY V ATVRDP N +KVKHLLELPKA+  L +WK
Sbjct  3    SEAETLCVTGAAGFIGSWLVMRLLERGYTVRATVRDPDNMKKVKHLLELPKAQRHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L E+GSFD+AI GC
Sbjct  63   ADLNEDGSFDDAIHGC  78



>ref|XP_010247640.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Nelumbo nucifera]
Length=342

 Score =   119 bits (298),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+G++GSWLVM+LLQ+GYI+ AT+RDP N +KVKHLL+LPKA+  L +WK  L+
Sbjct  9    TVCVTGASGYIGSWLVMRLLQQGYIIRATLRDPNNTEKVKHLLDLPKAQTHLTLWKADLD  68

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  69   DEGSFDEAIQGC  80



>ref|XP_008377381.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Malus domestica]
Length=347

 Score =   119 bits (298),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSKSESVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>ref|XP_010442115.1| PREDICTED: dihydroflavonol-4-reductase [Camelina sativa]
Length=377

 Score =   119 bits (299),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KVKHLL+LP A+ KL +WK
Sbjct  3    SQRETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVKHLLDLPNAKSKLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGS+D+AI GC
Sbjct  63   ADLSDEGSYDDAIKGC  78



>gb|AFK35813.1| unknown [Medicago truncatula]
Length=339

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHLLELP A  KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLMERGYTVRATVRDPDNMKKVKHLLELPGANSKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|AAF23884.2|AF117263_1 dihydroflavanol reductase 3 [Lotus corniculatus]
Length=336

 Score =   119 bits (298),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+L++RGY+V ATVRDP N +KVKHLLELP+A+ K  +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLMERGYMVRATVRDPANMKKVKHLLELPEAKTKPTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            EEGSFDEAI GC
Sbjct  67   EEGSFDEAIKGC  78



>gb|ADC96612.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   119 bits (299),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA  VCVTGA+GF+GSWLVM+LL+RGYIV ATVRDPG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SPA-IVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L  EGSFDEAI GC
Sbjct  64   ADLALEGSFDEAIEGC  79



>dbj|BAJ08043.1| dihydroflavonol 4-reductase [Cyclamen graecum]
Length=331

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SP  TVCVTGAAGF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LPKA   L +WK
Sbjct  6    SPG-TVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPENMKKVKHLLDLPKAGTNLTLWK  64

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGSFDEAI GC
Sbjct  65   ADLTEEGSFDEAIQGC  80



>gb|AHM27144.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=437

 Score =   120 bits (300),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 57/77 (74%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A PA TVCVTGAAGF+GSWLVMKLLQRGY V ATVRDPGN +K+KHL +LPKA+  L +W
Sbjct  16   AVPA-TVCVTGAAGFIGSWLVMKLLQRGYNVRATVRDPGNLKKIKHLTQLPKADTNLTLW  74

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EE SFDEAI GC
Sbjct  75   KADLMEEASFDEAIEGC  91



>gb|AFD28990.1| dihydroflavonol 4-reductase, partial [Nicotiana attenuata]
Length=396

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L 
Sbjct  33   TVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENNKKVKHLLELPKADTNLTLWKADLS  92

Query  36   EEGSFDEAIAGC  1
             EGSFDEAI GC
Sbjct  93   VEGSFDEAIQGC  104



>gb|AAK00655.1|AF229383_1 dihydroflavonone isomerase [Brassica napus]
Length=92

 Score =   113 bits (282),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  3    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLXLWKADLS  62

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  63   DEGSYDDAINGC  74



>gb|ABC95032.1| dihydroflavonol-4-reductase [Brassica juncea]
Length=103

 Score =   113 bits (282),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  4    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  63

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  64   DEGSYDDAINGC  75



>ref|XP_008220831.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 
4-reductase/flavanone 4-reductase [Prunus mume]
Length=349

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLL+LPKAE  L +WK  L 
Sbjct  7    SVCVTGASGFIGSWLIMRLLERGYTVRATVRDPANQKKVKHLLDLPKAETHLTLWKADLA  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIQGC  78



>gb|ACV49882.1| dihydroflavonol 4-reductase [Scutellaria viscidula]
Length=259

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  PAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKG  46
            PA TVCVTGA+GF+GSWLVM+LLQ GYIV ATVRDPGN +KVKHL ELP+A+ KL +WK 
Sbjct  12   PATTVCVTGASGFIGSWLVMRLLQHGYIVRATVRDPGNMEKVKHLTELPQADTKLTLWKA  71

Query  45   VLEEEGSFDEAIAGC  1
             +  +GS+D+A+ GC
Sbjct  72   DMSIQGSYDKAVQGC  86



>gb|AFO59579.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   119 bits (298),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 3/79 (4%)
 Frame = -3

Query  228  SPAP---TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            +P+P   TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLEL KA+  L 
Sbjct  11   APSPVGRTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELTKADTNLT  70

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  71   LWKADLTVEGSFDEAIQGC  89



>gb|AEO79982.1| dihydroflavonol 4-reductase [Prunus avium]
Length=346

 Score =   119 bits (297),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+RGY V  TVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSESVCVTGASGFIGSWLVMRLLERGYTVRTTVRDPANQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>gb|AAS68512.1| dihydroflavonone isomerase [Brassica juncea]
Length=106

 Score =   113 bits (282),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  6    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  65

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  66   DEGSYDDAINGC  77



>gb|AFO65508.1| dihydroflavonol 4-reductase [Narcissus tazetta]
Length=330

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL++GY V ATVRDP NA+KVKHLL+LP A  KL +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLLEQGYTVKATVRDPNNAKKVKHLLDLPHANNKLTLWKADLV  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIDGC  78



>ref|XP_006281803.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
 gb|EOA14701.1| hypothetical protein CARUB_v10027976mg, partial [Capsella rubella]
Length=326

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVMKLL+RGY V ATVRDPGN +KV HLL+LP A+ +L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMKLLERGYFVRATVRDPGNLKKVNHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAIKGC  78



>gb|AEF14420.1| dihydroflavonol 4-reductase [Onobrychis viciifolia]
Length=341

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGAAGFVGSWLVM+L++RGY V ATVRDP N +KVKHLL+LP A+ KL +W
Sbjct  2    GSTSETVCVTGAAGFVGSWLVMRLIERGYTVRATVRDPANMKKVKHLLDLPDAKTKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L  EGSFDEAI GC
Sbjct  62   KADLAHEGSFDEAIKGC  78



>gb|ABK88310.2| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=374

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA  VCVTGA+GF+GSWLVM+LL+RGYIV ATVRDPG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SPA-IVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLLELPKAETNLTLWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L  EGSFDEAI GC
Sbjct  64   ADLALEGSFDEAIEGC  79



>gb|ADV03181.1| dihydroflavonol reductase [Iochroma cyaneum]
Length=381

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 3/79 (4%)
 Frame = -3

Query  228  SPAP---TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            +P+P   TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLEL KA+  L 
Sbjct  11   APSPVGWTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELAKADTNLT  70

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  71   LWKADLTVEGSFDEAIQGC  89



>gb|KDO84613.1| hypothetical protein CISIN_1g040253mg [Citrus sinensis]
Length=338

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLLELPKA   L +W
Sbjct  2    GSIAETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEG+FDE I GC
Sbjct  62   KADLAEEGNFDEPIRGC  78



>gb|AFO59580.1| diihydroflavonol 4-reductase [Iochroma loxense]
Length=381

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 3/79 (4%)
 Frame = -3

Query  228  SPAP---TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLK  58
            +P+P   TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLEL KA+  L 
Sbjct  11   APSPVGRTVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELTKADTNLT  70

Query  57   VWKGVLEEEGSFDEAIAGC  1
            +WK  L  EGSFDEAI GC
Sbjct  71   LWKADLTVEGSFDEAIHGC  89



>ref|XP_006473894.1| PREDICTED: dihydroflavonol-4-reductase [Citrus sinensis]
Length=340

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLLELPKA   L +W
Sbjct  2    GSIAETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNKKKVKHLLELPKASTHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEG+FDE I GC
Sbjct  62   KADLAEEGNFDEPIRGC  78



>emb|CAP08825.1| dihydroflavonol reductase [Arabidopsis lyrata]
Length=384

 Score =   119 bits (297),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQTETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAITGC  78



>gb|AAN63056.1| dihydroflavonol reductase [Populus tremuloides]
Length=346

 Score =   118 bits (295),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             + A TVCVTGA+GF+GSWL+M+LL++GY V ATVRDP N +KVKHLLELPKA   L +W
Sbjct  2    GTEAETVCVTGASGFIGSWLIMRLLEKGYAVRATVRDPDNMKKVKHLLELPKASTHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGS+DEAI GC
Sbjct  62   KADLSEEGSYDEAIQGC  78



>ref|XP_002863734.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39993.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   118 bits (296),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQTETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAITGC  78



>ref|XP_010263613.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional dihydroflavonol 
4-reductase/flavanone 4-reductase-like [Nelumbo nucifera]
Length=342

 Score =   117 bits (294),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGFVGSWLVM+LL+ GY V ATVRDPGN +KVKHLL+LPKA   L +WK  L 
Sbjct  7    TVCVTGAAGFVGSWLVMRLLEEGYTVRATVRDPGNPKKVKHLLDLPKASTHLTLWKADLV  66

Query  36   EEGSFDEAIAGC  1
            ++GSFDEAI GC
Sbjct  67   DDGSFDEAIQGC  78



>gb|AAK00657.1|AF229385_1 dihydroflavonone isomerase [Brassica oleracea]
Length=92

 Score =   111 bits (278),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV HLL+LP A+ +L +WK  L 
Sbjct  3    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVLHLLDLPNAKTQLTLWKADLS  62

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  63   DEGSYDDAINGC  74



>gb|AEN69002.1| dihydroflavonol 4-reductase [Chrysanthemum x morifolium]
Length=357

 Score =   117 bits (294),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA  VCVTGA+GF+GSWLVM+LL+RGY V ATVRDPG+ +KVKHLLELPKAE  L +WK
Sbjct  5    SPA-IVCVTGASGFIGSWLVMRLLERGYSVRATVRDPGDMKKVKHLLELPKAETNLALWK  63

Query  48   GVLEEEGSFDEAIAGC  1
              L  EGSFDEAI GC
Sbjct  64   ADLALEGSFDEAIEGC  79



>dbj|BAD95233.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
Length=382

 Score =   117 bits (294),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>gb|AFO65510.1| dihydroflavonol 4-reductase [Narcissus tazetta]
Length=330

 Score =   117 bits (293),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL++GY V AT RDP NA+KVKHLL+LP A  KL +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLLEQGYTVKATARDPNNAKKVKHLLDLPNANNKLTLWKADLV  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIDGC  78



>dbj|BAD34461.1| dihydroflavonol 4-reductase [Eustoma grandiflorum]
Length=347

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            A TVCVTGAAG++GSWLVM+LL+RGY V ATVRDPG+ +KVKHL ELPKA   L V K  
Sbjct  8    ASTVCVTGAAGYIGSWLVMRLLERGYTVRATVRDPGDVKKVKHLFELPKASTNLTVLKAD  67

Query  42   LEEEGSFDEAIAGC  1
            L EEGSFDEAI GC
Sbjct  68   LIEEGSFDEAIQGC  81



>dbj|BAO53727.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +W
Sbjct  4    SSASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLW  63

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  64   KADLAQEGSFDEAIKGC  80



>gb|AGO18339.1| dihydroflavonol reductase, partial [Raphanus sativus var. niger]
Length=224

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGS+D+AI GC
Sbjct  63   ADLSDEGSYDDAINGC  78



>dbj|BAF45153.1| dihydroflavonol 4-reductase [Humulus lupulus]
Length=350

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S   TVCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHL+ELPKAE +L +W
Sbjct  2    GSEGETVCVTGASGFIGSWLVMRLLELGYTVRATVRDPTNLKKVKHLVELPKAETRLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSF EAI GC
Sbjct  62   KADLSEEGSFHEAIKGC  78



>ref|XP_003550388.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase isoformX1 [Glycine max]
 gb|ABM64803.1| dihydroflavonol-4-reductase 2 [Glycine max]
 dbj|BAO53731.1| dihydroflavonol 4-reducatase 2 [Glycine max]
 dbj|BAO53732.1| dihydroflavonol 4-reducatase 2 [Glycine soja]
 gb|KHN12695.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=354

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +W
Sbjct  4    SSASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLW  63

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  64   KADLAQEGSFDEAIKGC  80



>gb|AAD56578.1|AF184271_1 dihydroflavonol 4-reductase [Daucus carota]
Length=380

 Score =   117 bits (294),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLV++LLQRGY V ATVRDPGN QKVKHLL+LPKAE  L + +  L 
Sbjct  7    TVCVTGASGFIGSWLVLRLLQRGYTVRATVRDPGNPQKVKHLLQLPKAETNLILCRADLN  66

Query  36   EEGSFDEAIAGC  1
            EEGSFD+A+ GC
Sbjct  67   EEGSFDDAVKGC  78



>gb|ABP57067.1| dihydroflavonol 4-reductase [Fagopyrum cymosum]
 gb|ABP57068.1| dihydroflavonol 4-reductase [Fagopyrum cymosum]
Length=341

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GFVGSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPK++  L +WK  L E
Sbjct  8    VCVTGASGFVGSWLVMRLLEHGYVVRATVRDPSNMKKVKHLLDLPKSKTNLSLWKADLSE  67

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  68   EGSFDEAIQGC  78



>ref|XP_010245913.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X2 [Nelumbo 
nucifera]
Length=329

 Score =   117 bits (292),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAG++GSWLVM+LL RGY+V ATVRDP N +KVKHLL+LPKA+  L +WK    
Sbjct  6    TVCVTGAAGYIGSWLVMRLLXRGYVVKATVRDPDNLEKVKHLLDLPKAKTHLTLWKADJV  65

Query  36   EEGSFDEAIAGC  1
            EEGSFDE I GC
Sbjct  66   EEGSFDEVIQGC  77



>gb|AGA82790.1| dihydroflavonol reductase 3, partial [Clarkia gracilis]
Length=213

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + TVCVTGAAGF+GSWLVM+LL+RGY V ATVRD  N +KVKHLLELPKA+  L +W+
Sbjct  13   SESETVCVTGAAGFIGSWLVMRLLERGYTVRATVRDTNNMKKVKHLLELPKAKTHLSLWR  72

Query  48   GVLEEEGSFDEAIAGC  1
              L E+GSFD+AI GC
Sbjct  73   ADLSEDGSFDDAIHGC  88



>gb|AIU34714.1| dihydroflavonol 4-reductase 1 [Rosa rugosa]
Length=349

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GFVGSWLVM+LL+RGY V ATVRDP N++KVKHLL+LPKA   L +WK
Sbjct  3    SESESVCVTGASGFVGSWLVMRLLERGYTVRATVRDPANSKKVKHLLDLPKAATHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGSFDEAI GC
Sbjct  63   ADLAEEGSFDEAIKGC  78



>gb|ACZ48697.1| dihydroflavonol-4-reductase [Fagopyrum tataricum]
Length=341

 Score =   117 bits (292),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GFVGSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPK++  L +WK  L E
Sbjct  8    VCVTGASGFVGSWLVMRLLEHGYVVRATVRDPSNMKKVKHLLDLPKSKTNLSLWKADLSE  67

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  68   EGSFDEAIQGC  78



>gb|AAA32783.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 dbj|BAA85261.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAP08807.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08809.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08811.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08816.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08817.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   117 bits (293),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>gb|EYU31196.1| hypothetical protein MIMGU_mgv1a006799mg [Erythranthe guttata]
Length=431

 Score =   117 bits (294),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  PAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKG  46
            PA TVCVTGAAGF+GSW+VM+LL+RGY+V ATVRDP N  KVKHL+ELPKA+  L +WK 
Sbjct  12   PATTVCVTGAAGFIGSWIVMRLLERGYVVRATVRDPENKSKVKHLVELPKADTNLTLWKA  71

Query  45   VLEEEGSFDEAIAGC  1
             +  +GS+DEA+ GC
Sbjct  72   DMNIKGSYDEAVQGC  86



>ref|XP_010245912.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Nelumbo 
nucifera]
Length=339

 Score =   117 bits (292),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAG++GSWLVM+LL RGY+V ATVRDP N +KVKHLL+LPKA+  L +WK    
Sbjct  6    TVCVTGAAGYIGSWLVMRLLXRGYVVKATVRDPDNLEKVKHLLDLPKAKTHLTLWKADJV  65

Query  36   EEGSFDEAIAGC  1
            EEGSFDE I GC
Sbjct  66   EEGSFDEVIQGC  77



>gb|AHF58604.1| dihydroflavonol 4-reductase [Rosa chinensis]
Length=349

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS + +VCVTGA+GFVGSWL+M+LL RGY V ATVRDP N +KVKHLL+LPKA   L +W
Sbjct  2    ASESESVCVTGASGFVGSWLIMRLLDRGYTVRATVRDPANKKKVKHLLDLPKAATHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>dbj|BAA19658.1| dihydroflavonol 4-reductase [Perilla frutescens]
Length=456

 Score =   117 bits (293),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  PAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKG  46
            PA TVCVTGA+GF+GSW++M+LL+RGY+V ATVRDPG+++KVKHL+ELP A+  L +W+ 
Sbjct  11   PATTVCVTGASGFIGSWIIMRLLERGYVVRATVRDPGDSKKVKHLIELPGADTNLTLWRA  70

Query  45   VLEEEGSFDEAIAGC  1
             +  EGS+DEA+ GC
Sbjct  71   DMNIEGSYDEAVQGC  85



>gb|AHZ30596.1| dihydroflavonol reductase, partial [Prunus domestica]
Length=340

 Score =   116 bits (291),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCV GA+GF GSWLVM+LL+RGY V ATVRDP N +KVKHLLELPKAE  L +WK  L 
Sbjct  1    SVCVXGASGFXGSWLVMRLLERGYTVRATVRDPTNQKKVKHLLELPKAETHLTLWKADLA  60

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  61   DEGSFDEAIQGC  72



>gb|ACZ48698.1| dihydroflavonol-4-reductase [Fagopyrum esculentum]
Length=341

 Score =   116 bits (291),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GFVGSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPK++  L +WK  L E
Sbjct  8    VCVTGASGFVGSWLVMRLLEHGYVVRATVRDPTNMKKVKHLLDLPKSKTNLSLWKADLSE  67

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  68   EGSFDEAIQGC  78



>gb|ACU28803.1| dihydroflavonol reductase [Rhizophora mangle]
Length=352

 Score =   116 bits (291),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S A TVCVTGA+GF+GSWL+M+LL+R Y V ATVRDP N +KVKHLLELPKA+  L +W
Sbjct  2    GSEAKTVCVTGASGFIGSWLIMRLLERDYTVRATVRDPDNIKKVKHLLELPKAKTNLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L  EGSFDEAI GC
Sbjct  62   KADLSVEGSFDEAIKGC  78



>gb|AFO65509.1| dihydroflavonol 4-reductase [Narcissus tazetta]
Length=330

 Score =   116 bits (291),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL++GY V ATVRDP N +KVKHLL+LP A  KL +WK  L 
Sbjct  7    TVCVTGAAGFIGSWLVMRLLEQGYTVKATVRDPNNVKKVKHLLDLPHANKKLTLWKADLV  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  67   DEGSFDEAIDGC  78



>emb|CAA33544.1| unnamed protein product [Petunia x hybrida]
Length=373

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            + TVCVTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L + K  
Sbjct  8    SATVCVTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLLKAD  67

Query  42   LEEEGSFDEAIAGC  1
            L  EGSFDEAI GC
Sbjct  68   LTVEGSFDEAIQGC  81



>ref|XP_010481941.1| PREDICTED: dihydroflavonol-4-reductase-like [Camelina sativa]
Length=377

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KVKHLL+LP A+ KL +W 
Sbjct  3    SQRETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVKHLLDLPNAKSKLTLWM  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGS+D+AI GC
Sbjct  63   ADLSDEGSYDDAIKGC  78



>ref|XP_002862988.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39247.1| dihydroflavonol reductase [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score =   117 bits (292),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQTETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D AI GC
Sbjct  63   ADLSEEGSYDGAITGC  78



>gb|ACM62744.1| dihydroflavonol-4-reductase [Garcinia mangostana]
Length=334

 Score =   116 bits (290),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GF+GSWLVM+LL+RGY V ATVRDP NA+KV+HLLELPKA+  L +WK  L  
Sbjct  8    VCVTGASGFIGSWLVMRLLERGYTVRATVRDPDNAKKVQHLLELPKAKTHLTLWKAELGI  67

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  68   EGSFDEAIQGC  78



>dbj|BAO53728.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=227

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +W
Sbjct  4    SSASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLW  63

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  64   KADLAQEGSFDEAIKGC  80



>ref|XP_007160735.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
 gb|ESW32729.1| hypothetical protein PHAVU_001G012800g [Phaseolus vulgaris]
Length=339

 Score =   116 bits (290),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +W
Sbjct  2    GSTSESVCVTGASGFIGSWLVMRLMERGYTVRATVRDPENMKKVKHLVELPGAKTKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>ref|XP_011028872.1| PREDICTED: dihydroflavonol-4-reductase-like isoform X1 [Populus 
euphratica]
Length=346

 Score =   116 bits (290),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             + A TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLLELPKA   L +W
Sbjct  2    GTEAETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNMKKVKHLLELPKASTHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L  EGS+DEAI GC
Sbjct  62   KADLSVEGSYDEAIQGC  78



>gb|ABY89686.1| dihydroflavonol-4-reductase 2 protein [Brassica rapa subsp. oleifera]
Length=332

 Score =   116 bits (290),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AII26023.1| dihydroflavanol 4-reductase [Pisum sativum]
Length=342

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + TVCVTGA+GF+GSWLVM+L++ GY V ATVRDP N +KVKHLLELP A+ KL +WK
Sbjct  3    SVSETVCVTGASGFIGSWLVMRLIEHGYTVRATVRDPDNVKKVKHLLELPDAKSKLSLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGSFDEAI GC
Sbjct  63   ADLAEEGSFDEAIKGC  78



>gb|AGU42192.1| dihydroflavonol 4-reductase [Raphanus sativus]
Length=387

 Score =   116 bits (291),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A+   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +W
Sbjct  3    AANKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLW  62

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGS+D+AI GC
Sbjct  63   KADLSDEGSYDDAINGC  79



>gb|AHL46448.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GFVGSWLVM+LL+RGY V ATVRDP NA+KVKHLL+LPKA   L +WK
Sbjct  3    SESESVCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIKGC  78



>ref|XP_004291858.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Fragaria vesca subsp. vesca]
 gb|AHL46446.1| dihydroflavonol 4-reductase [Fragaria vesca]
 gb|AHL46447.1| dihydroflavonol 4-reductase [Fragaria vesca]
Length=349

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GFVGSWLVM+LL+RGY V ATVRDP NA+KVKHLL+LPKA   L +WK
Sbjct  3    SESESVCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIKGC  78



>gb|AHL46451.1| dihydroflavonol 4-reductase [Fragaria x ananassa]
Length=349

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GFVGSWLVM+LL+RGY V ATVRDP NA+KVKHLL+LPKA   L +WK
Sbjct  3    SESESVCVTGASGFVGSWLVMRLLERGYTVRATVRDPTNAKKVKHLLDLPKAATHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIKGC  78



>gb|AEI59122.1| dihydroflavonol 4-reductase [Medicago sativa]
Length=339

 Score =   115 bits (289),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+L++ GY V ATVRDP N +KVKHLLELP A  KL +W
Sbjct  2    GSVSETVCVTGASGFIGSWLVMRLIEHGYTVRATVRDPDNIKKVKHLLELPGANSKLSLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLGEEGSFDEAIKGC  78



>gb|ABU93477.1| dihydroflavonol 4-reductase [Helianthus annuus]
Length=355

 Score =   116 bits (290),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            SPA TVCVTGA+GF+GSWLVM+LL+RGYIV ATVRDPG+ +KVKHL ELP AE  L ++K
Sbjct  5    SPA-TVCVTGASGFIGSWLVMRLLERGYIVRATVRDPGDMKKVKHLKELPGAETNLTLYK  63

Query  48   GVLEEEGSFDEAIAGC  1
              + +EGSFDEAI GC
Sbjct  64   ADMTQEGSFDEAIEGC  79



>ref|NP_199094.1| dihydroflavonol-4-reductase [Arabidopsis thaliana]
 sp|P51102.2|DFRA_ARATH RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase; AltName: Full=Protein 
TRANSPARENT TESTA 3 [Arabidopsis thaliana]
 dbj|BAB10636.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAC10525.1| dihydroflavonol 4-reductase [Arabidopsis thaliana]
 emb|CAP08806.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08808.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08812.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08814.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08815.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08821.1| dihydroflavonol reductase [Arabidopsis thaliana]
 gb|AED94866.1| dihydroflavonol-4-reductase [Arabidopsis thaliana]
Length=382

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+  L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>ref|XP_009336072.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Pyrus x bretschneideri]
Length=347

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>sp|Q84KP0.1|DFRA_PYRCO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Flavanone 4-reductase; Short=FNR [Pyrus 
communis]
 gb|AAO39820.1| putative dihydroflavonol 4-reductase [Pyrus communis]
Length=347

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>dbj|BAF49325.1| dihydroflavonol 4-reductase [Delphinium x belladonna]
Length=337

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGF+GSWLVM+LL+RGY+V ATVR+P N +K++HLLELP A+ KL +WK  L 
Sbjct  5    TVCVTGAAGFIGSWLVMRLLERGYLVRATVRNPDNLKKLRHLLELPNAKSKLTLWKADLT  64

Query  36   EEGSFDEAIAGC  1
            E+GS+D+AI GC
Sbjct  65   EDGSYDDAIKGC  76



>emb|CDX95155.1| BnaC09g17150D [Brassica napus]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|ADB45307.1| dihydroflavonol 4-reductase [Brassica juncea var. napiformis]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AAX53571.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
 gb|AAX53572.1| dihydroflavonol 4-reductase [Brassica rapa subsp. oleifera]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AAV80210.1| dihydroflavonol-4-reductase [Brassica rapa subsp. pekinensis]
 gb|ABY89685.1| dihydroflavonol-4-reductase 1 protein [Brassica rapa subsp. oleifera]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AAO73442.1| dihydroflavonol 4-reductase [Brassica oleracea var. capitata]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>ref|XP_009114035.1| PREDICTED: dihydroflavonol-4-reductase [Brassica rapa]
 gb|ABL86389.1| dihydroflavonol 4-reductase [Brassica juncea]
 gb|ABL86390.1| dihydroflavonol 4-reductase [Brassica juncea]
 emb|CDY52372.1| BnaA09g15710D [Brassica napus]
Length=385

 Score =   116 bits (290),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AGT39046.1| dihydroflavonol 4-reductase, partial [Epimedium sagittatum]
Length=93

 Score =   109 bits (273),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGAAGFVGSWLVM+LL+ GY V ATVRDP N +KVKHLL+LP A+ +L ++K  L 
Sbjct  7    TVCVTGAAGFVGSWLVMRLLECGYKVKATVRDPANMKKVKHLLDLPNAKTQLSLFKADLV  66

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAIAGC
Sbjct  67   DEGSFDEAIAGC  78



>emb|CAP08813.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+  L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>dbj|BAA12736.1| dihydroflavonol-4-reductase [Gentiana triflora]
Length=359

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S A TVCVTGA+G++GSWL M+LL+RGY V ATVRDPGN +KV+HLLELPKA   L + K
Sbjct  7    SNATTVCVTGASGYIGSWLAMRLLERGYTVRATVRDPGNLKKVQHLLELPKASTNLTLLK  66

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGSFDEAI GC
Sbjct  67   ADLTEEGSFDEAIHGC  82



>ref|XP_006403345.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
 gb|ESQ44798.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
Length=382

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V  TVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRGTVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+DEAI GC
Sbjct  67   DEGSYDEAINGC  78



>ref|XP_006403346.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
 gb|ESQ44799.1| hypothetical protein EUTSA_v10003227mg [Eutrema salsugineum]
Length=383

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V  TVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYFVRGTVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+DEAI GC
Sbjct  67   DEGSYDEAINGC  78



>emb|CAP08805.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08810.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08826.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   115 bits (289),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S   TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+  L +WK
Sbjct  3    SQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>gb|AAO39816.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   115 bits (288),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIQGC  78



>gb|AHB19302.1| dihydroflavonol-4-reductase [Morus alba]
Length=341

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + TVCVTGA+G++GSWLVM+LL+RGY V ATVRDP N +KVKHLLELPKA+  L +WK
Sbjct  3    SVSETVCVTGASGYIGSWLVMRLLERGYTVRATVRDPANVKKVKHLLELPKAKSNLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSF+EAI GC
Sbjct  63   ADLADEGSFNEAIKGC  78



>gb|AIB06741.1| dihydroflavonol 4-reductase [Mangifera indica]
Length=333

 Score =   115 bits (288),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N  KVKHLLELP A+  L +WK  + E
Sbjct  6    VCVTGASGFIGSWLIMRLLERGYSVRATVRDPNNMNKVKHLLELPNAKTHLTLWKADMTE  65

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  66   EGSFDEAIKGC  76



>ref|XP_004499179.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Cicer arietinum]
Length=279

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGA+GF+GSWLVM+L++ GY V ATVRDP N +KVKHLLELP A+ KL +WK  LEE
Sbjct  8    VCVTGASGFIGSWLVMRLMESGYTVRATVRDPDNMKKVKHLLELPGAKSKLTLWKADLEE  67

Query  33   EGSFDEAIAGC  1
            EGSFDEAI GC
Sbjct  68   EGSFDEAIKGC  78



>dbj|BAH24302.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS + +VCVTGA+GF+GSWLVM+LL RGY V ATVRDP N +KV HLL+LPKA   L +W
Sbjct  2    ASESESVCVTGASGFIGSWLVMRLLDRGYTVRATVRDPANKKKVNHLLDLPKAATHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>gb|KDP38534.1| hypothetical protein JCGZ_04459 [Jatropha curcas]
Length=357

 Score =   115 bits (288),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KV+HLLELPKA+  L  WK  L 
Sbjct  7    TVCVTGASGFIGSWLIMRLLERGYTVRATVRDPDNRKKVQHLLELPKAKTHLSFWKADLS  66

Query  36   EEGSFDEAIAGC  1
             EGSFDEAI GC
Sbjct  67   LEGSFDEAIQGC  78



>ref|XP_011028873.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like isoform X2 [Populus euphratica]
Length=279

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            A TVCVTGA+GF+GSWL+M+LL+RGY V ATVRDP N +KVKHLLELPKA   L +WK  
Sbjct  5    AETVCVTGASGFIGSWLIMRLLERGYAVRATVRDPDNMKKVKHLLELPKASTHLTLWKAD  64

Query  42   LEEEGSFDEAIAGC  1
            L  EGS+DEAI GC
Sbjct  65   LSVEGSYDEAIQGC  78



>ref|XP_010060970.1| PREDICTED: dihydroflavonol-4-reductase [Eucalyptus grandis]
 gb|KCW67873.1| hypothetical protein EUGRSUZ_F01589 [Eucalyptus grandis]
Length=337

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S A  VCVTGAAGF+GSWLVM+LL+RGY V ATVRDP N +KVKHLL+LP+A+  L +WK
Sbjct  3    SEAQVVCVTGAAGFIGSWLVMRLLERGYTVRATVRDPNNMKKVKHLLDLPQAKTHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L E GSFDEAI GC
Sbjct  63   ADLNEAGSFDEAINGC  78



>emb|CAP08819.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08823.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S    VCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQKEIVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>emb|CAP08818.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08820.1| dihydroflavonol reductase [Arabidopsis thaliana]
 emb|CAP08824.1| dihydroflavonol reductase [Arabidopsis thaliana]
Length=384

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S    VCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK
Sbjct  3    SQKEIVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGS+D+AI GC
Sbjct  63   ADLSEEGSYDDAINGC  78



>ref|XP_011083203.1| PREDICTED: LOW QUALITY PROTEIN: dihydroflavonol-4-reductase-like 
[Sesamum indicum]
Length=381

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  210  CVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEE  31
            CVTGAAGF+GSWLVM+LL+RGY + ATVRDPGN +KVKHL ELPKA+  L +WK  +  E
Sbjct  16   CVTGAAGFIGSWLVMRLLERGYTIRATVRDPGNMKKVKHLTELPKADTNLTLWKADMNIE  75

Query  30   GSFDEAIAGC  1
            GSFDEAI GC
Sbjct  76   GSFDEAIQGC  85



>gb|AEN71545.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            A TVCVTGAAGF+GSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPKA+  L +WK  
Sbjct  9    AETVCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMRKVKHLLDLPKADTHLTLWKAD  68

Query  42   LEEEGSFDEAIAGC  1
            L  +GSFDEAI GC
Sbjct  69   LLVDGSFDEAIKGC  82



>ref|XP_006878526.1| hypothetical protein AMTR_s00011p00221520 [Amborella trichopoda]
 gb|ERM94671.1| hypothetical protein AMTR_s00011p00221520 [Amborella trichopoda]
Length=349

 Score =   115 bits (288),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A+   TVCVTGA+GFVGSWL+M+LL+RGY+V ATVRDP N +K +HLL+LP A+ +L +W
Sbjct  5    AATKDTVCVTGASGFVGSWLIMRLLERGYVVKATVRDPENIKKTQHLLDLPSAKERLTLW  64

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFD+AI+GC
Sbjct  65   KADLNDEGSFDDAISGC  81



>dbj|BAA12723.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS + +VCVTGA+GF+GSWLVM+LL RGY V ATVRDP N +KV HLL+LPKA   L +W
Sbjct  2    ASESESVCVTGASGFIGSWLVMRLLDRGYTVRATVRDPANKKKVNHLLDLPKAATHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>gb|AAX12422.1| dihydroflavonol 4-reductase [Rosa hybrid cultivar]
Length=349

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            AS + +VCVTGA+GF+GSWLVM+LL RGY V AT RDP N +KVKHLL+LPKA   L +W
Sbjct  2    ASESESVCVTGASGFIGSWLVMRLLDRGYTVRATARDPANKKKVKHLLDLPKAATHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L EEGSFDEAI GC
Sbjct  62   KADLAEEGSFDEAIKGC  78



>dbj|BAD67185.1| dihydroflavonol 4-reductase [Spinacia oleracea]
Length=342

 Score =   115 bits (287),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTGAAGF+GSWLV +LL+ GYIV ATVRDPGN +KV+HLL+LP A   L +WK  L E
Sbjct  8    VCVTGAAGFIGSWLVKRLLEHGYIVRATVRDPGNVKKVQHLLDLPNANTHLTLWKADLNE  67

Query  33   EGSFDEAIAGC  1
            +GSFDEAI+GC
Sbjct  68   QGSFDEAISGC  78



>gb|AHJ80979.1| dihydroflavanone reductase [Erythranthe lewisii]
Length=463

 Score =   115 bits (289),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  PAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKG  46
            PA TVCVTGAAGF+GSW+VM+LL+RGYIV ATVRDP N  KVKHL+ LPKA+  L +WK 
Sbjct  11   PATTVCVTGAAGFIGSWIVMRLLERGYIVRATVRDPENMSKVKHLVGLPKADTNLTLWKA  70

Query  45   VLEEEGSFDEAIAGC  1
             +  EGS+DEA+ GC
Sbjct  71   DMNIEGSYDEAVQGC  85



>gb|AFI71899.1| dihydroflavonol 4-reductase [Paeonia lactiflora]
Length=364

 Score =   115 bits (287),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            A TVCVTGAAGF+GSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPKA+  L +WK  
Sbjct  9    AETVCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMKKVKHLLDLPKADTHLTLWKAD  68

Query  42   LEEEGSFDEAIAGC  1
            L  +GSFDEAI GC
Sbjct  69   LLVDGSFDEAIKGC  82



>dbj|BAF49318.1| dihydroflavonol 4-reductase [Lobelia erinus]
Length=330

 Score =   114 bits (286),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -3

Query  201  GAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEGSF  22
            GAAGF+GSWLVM+LL+RGY+V ATVRDPGN +KVKHLLELPKA+  L +W+  L EEGSF
Sbjct  12   GAAGFIGSWLVMRLLERGYVVRATVRDPGNLKKVKHLLELPKADTNLTLWRADLTEEGSF  71

Query  21   DEAIAGC  1
            DEAI GC
Sbjct  72   DEAIEGC  78



>dbj|BAO53730.1| dihydroflavonol 4-reducatase 2 [Glycine max]
Length=354

 Score =   115 bits (287),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + +VCVTGA+GF+GSWLVM+L++RGY V ATV DP N +KVKHL+ELP A+ KL +W
Sbjct  4    SSASESVCVTGASGFIGSWLVMRLIERGYTVRATVHDPANMKKVKHLVELPGAKTKLSLW  63

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  64   KADLAQEGSFDEAIKGC  80



>gb|ACU19265.1| unknown [Glycine max]
Length=276

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            +S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +W
Sbjct  4    SSASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPANMKKVKHLVELPGAKTKLSLW  63

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  64   KADLAQEGSFDEAIKGC  80



>ref|XP_010245914.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase-like [Nelumbo nucifera]
Length=343

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+G++G+WLVM+LL +GY+V ATVRDP N +KV HLL LPKA+  L +WK VLE
Sbjct  9    TVCVTGASGYIGAWLVMRLLDQGYVVKATVRDPNNTKKVNHLLHLPKAKTHLTLWKAVLE  68

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  69   DEGSFDEAIQGC  80



>gb|ABM64800.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
 gb|AHG97389.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=355

 Score =   114 bits (286),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTG +GF+GSWL+  LL+RGY+V ATVRDPGN++KVKHLLELPKAE  L +WK  L E
Sbjct  26   VCVTGGSGFIGSWLIKLLLERGYVVRATVRDPGNSKKVKHLLELPKAETHLTLWKADLAE  85

Query  33   EGSFDEAIAGC  1
            EGSFD+AI  C
Sbjct  86   EGSFDDAIQAC  96



>ref|NP_001234408.1| dihydroflavonol-4-reductase [Solanum lycopersicum]
 sp|P51107.1|DFRA_SOLLC RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Solanum lycopersicum]
 emb|CAA79154.1| dihydroflavonol 4-reductase [Solanum lycopersicum]
 prf||2006279A dihydroflavonol 4-reductase
Length=379

 Score =   115 bits (287),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = -3

Query  240  HTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKL  61
            H+P     TV VTG AGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L
Sbjct  12   HSPPKTT-TVWVTGGAGFIGSWLVMRLLERGYNVHATVRDPENQKKVKHLLELPKADTNL  70

Query  60   KVWKGVLEEEGSFDEAIAGC  1
             +WK  L  EGSFDEAI GC
Sbjct  71   TLWKADLAVEGSFDEAIQGC  90



>gb|ABY25286.1| dihydroflavonol 4-reductase B [Petunia x hybrida]
Length=361

 Score =   114 bits (286),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  207  VTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEEEG  28
            VTGAAGF+GSWLVM+LL+RGY VHATVRDP N +KVKHLLELPKA+  L +WK  L  EG
Sbjct  1    VTGAAGFIGSWLVMRLLERGYNVHATVRDPENKKKVKHLLELPKADTNLTLWKADLTVEG  60

Query  27   SFDEAIAGC  1
            SFDEAI GC
Sbjct  61   SFDEAIQGC  69



>gb|AFF60412.1| dihydroflavonol reductase [Pyrus pyrifolia]
Length=347

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>ref|XP_009365091.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|AAX16491.1| dihydroflavonol 4-reductase [Crataegus monogyna]
Length=347

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|AAO39818.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AAO39819.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL50917.1| dihydroflavonol 4-reductase [Pyrus communis]
 gb|AGL81349.1| dihydroflavonol 4-reductase 1 [Pyrus communis]
 gb|AGL81350.1| dihydroflavonol 4-reductase 2 [Pyrus communis]
Length=347

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|ACP30362.1| dihydroflavonol-4-reductase protein [Malus hybrid cultivar]
Length=348

 Score =   114 bits (286),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|AGZ15302.1| dihydroflavonol 4-reductase [Pyrus x bretschneideri]
Length=347

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>ref|NP_001280868.1| bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Malus domestica]
 sp|Q9XES5.1|DFRA_MALDO RecName: Full=Bifunctional dihydroflavonol 4-reductase/flavanone 
4-reductase; AltName: Full=Dihydroflavonol 4-reductase; 
Short=DFR; AltName: Full=Dihydrokaempferol 4-reductase; AltName: 
Full=Flavanone 4-reductase; Short=FNR [Malus domestica]
 gb|AAD26204.1|AF117268_1 dihydroflavonol reductase [Malus domestica]
 gb|AAO39817.1| dihydroflavonol 4-reductase [Malus domestica]
Length=348

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK
Sbjct  3    SESESVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L +EGSFDEAI GC
Sbjct  63   ADLADEGSFDEAIQGC  78



>gb|ACV72642.1| dihydroflavonol 4-reductase [Gossypium hirsutum]
Length=340

 Score =   114 bits (285),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVTG +GF+GSWL+  LL+RGY+V ATVRDPGN++KVKHLLELPKAE  L +WK  L E
Sbjct  11   VCVTGGSGFIGSWLIKLLLERGYVVRATVRDPGNSKKVKHLLELPKAETHLTLWKADLAE  70

Query  33   EGSFDEAIAGC  1
            EGSFD+AI  C
Sbjct  71   EGSFDDAIQAC  81



>dbj|BAI78343.1| dihydroflavonol reductase [Pelargonium zonale]
Length=340

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
            A  A  VCVTGA+GF+GSWL+M+LL+RGY+V ATVRDP N +KVKHLLELPKAE  L +W
Sbjct  5    AQGAEVVCVTGASGFIGSWLIMRLLERGYMVRATVRDPANMKKVKHLLELPKAETNLTLW  64

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L  +GSFDE I GC
Sbjct  65   KADLAVQGSFDEPIQGC  81



>gb|KFK31813.1| hypothetical protein AALP_AA6G162000 [Arabis alpina]
Length=384

 Score =   114 bits (286),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            TVCVTGA+GF+GSWLVM+LL+RGY V ATVRDPGN +KV+HLL+LP A+ +L +WK  L 
Sbjct  7    TVCVTGASGFIGSWLVMRLLERGYDVRATVRDPGNLKKVQHLLDLPNAKTQLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            +EGS+D+AI GC
Sbjct  67   DEGSYDDAINGC  78



>gb|AIR09398.1| dihydroflavonol 4-reductase [Angelonia angustifolia]
Length=438

 Score =   114 bits (286),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  VCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLEE  34
            VCVT AAGF+GSWLVMKLLQRGY V ATVRDPGN +K+KHL +LPKA+  L +WK  L E
Sbjct  22   VCVTRAAGFIGSWLVMKLLQRGYNVRATVRDPGNLKKIKHLTQLPKADTNLTLWKADLME  81

Query  33   EGSFDEAIAGC  1
            E SFDEAI GC
Sbjct  82   EASFDEAIEGC  92



>sp|P51110.1|DFRA_VITVI RecName: Full=Dihydroflavonol-4-reductase; Short=DFR; AltName: 
Full=Dihydrokaempferol 4-reductase [Vitis vinifera]
 emb|CAA53578.1| dihydroflavonol reductase [Vitis vinifera]
Length=337

 Score =   114 bits (284),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 52/77 (68%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -3

Query  231  ASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVW  52
             S + TVCVTGA+GF+GSWLVM+LL+R   V ATVRDP N +KVKHLL+LPKAE  L +W
Sbjct  2    GSQSETVCVTGASGFIGSWLVMRLLERRLTVRATVRDPTNVKKVKHLLDLPKAETHLTLW  61

Query  51   KGVLEEEGSFDEAIAGC  1
            K  L +EGSFDEAI GC
Sbjct  62   KADLADEGSFDEAIKGC  78



>gb|AAP13055.1| dihydroflavonol 4-reductase [Gypsophila elegans]
Length=353

 Score =   114 bits (285),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -3

Query  249  GGNHTPASPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAE  70
            G + T      TVCVTGA+GF+GSWL+M+LL+RGY V  TVRDP N +KV+HLL+LP+A+
Sbjct  13   GKHDTKPVQGETVCVTGASGFIGSWLIMRLLERGYTVRGTVRDPDNTKKVQHLLDLPQAK  72

Query  69   GKLKVWKGVLEEEGSFDEAIAGC  1
              L +WK  L EEGSFD+A+ GC
Sbjct  73   TNLTLWKADLNEEGSFDKAVDGC  95



>dbj|BAB92999.1| dihydroflavonol reductase [Malus domestica]
Length=314

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLL+LPKAE  L +WK  L 
Sbjct  4    SVCVTGASGFIGSWLVMRLLEHGYTVRATVRDPTNQKKVKHLLDLPKAETHLTLWKADLA  63

Query  36   EEGSFDEAIAGC  1
            +EGSFDEAI GC
Sbjct  64   DEGSFDEAIQGC  75



>gb|KHN20964.1| Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase 
[Glycine soja]
Length=343

 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -3

Query  228  SPAPTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWK  49
            S + +VCVTGA+GF+GSWLVM+L++RGY V ATVRDP N +KVKHL+ELP A+ KL +WK
Sbjct  3    SASESVCVTGASGFIGSWLVMRLIERGYTVRATVRDPVNMKKVKHLVELPGAKSKLSLWK  62

Query  48   GVLEEEGSFDEAIAGC  1
              L EEGSFDEAI GC
Sbjct  63   ADLAEEGSFDEAIKGC  78



>gb|AIU98514.1| dihydroflavonol 4-reductase [Paeonia suffruticosa]
Length=364

 Score =   114 bits (284),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 51/74 (69%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  APTVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGV  43
            A TVCVTGAAGF+GSWLVM+LL+ GY+V ATVRDP N +KVKHLL+LPKA+  L +WK  
Sbjct  9    AETVCVTGAAGFIGSWLVMRLLEHGYVVRATVRDPENMRKVKHLLDLPKADTHLTLWKAD  68

Query  42   LEEEGSFDEAIAGC  1
            L  +GSFDE I GC
Sbjct  69   LLVDGSFDETIKGC  82



>ref|XP_007017586.1| Dihydroflavonol-4-reductase [Theobroma cacao]
 gb|EOY14811.1| Dihydroflavonol-4-reductase [Theobroma cacao]
Length=345

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  TVCVTGAAGFVGSWLVMKLLQRGYIVHATVRDPGNAQKVKHLLELPKAEGKLKVWKGVLE  37
            +VCVTGA+GF+GSWLVM+LL+ GY V ATVRDP N +KVKHLLELPKA+  L +WK  L 
Sbjct  7    SVCVTGASGFIGSWLVMRLLENGYAVRATVRDPDNVKKVKHLLELPKADSHLTLWKADLS  66

Query  36   EEGSFDEAIAGC  1
            EEGSFD AI GC
Sbjct  67   EEGSFDAAIQGC  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506643158204