BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20537_g1_i1 len=1559 path=[4497:0-241 2147:242-271 2177:272-326
2232:327-355 3871:356-367 2273:368-391 2297:392-1558]

Length=1559
                                                                      Score     E

dbj|BAG80557.1|  UDP-glucose:glucosyltransferase                        530   0.0      Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009616666.1|  PREDICTED: crocetin glucoside glucosyltransf...    528   0.0      
ref|XP_009609108.1|  PREDICTED: crocetin glucoside glucosyltransf...    523   5e-179   
ref|XP_006351221.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    524   7e-179   
dbj|BAG80553.1|  UDP-glucose:glucosyltransferase                        520   1e-177   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_004250485.1|  PREDICTED: crocetin glucoside glucosyltransf...    519   1e-177   
ref|XP_006367680.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    518   5e-177   
ref|XP_009775011.1|  PREDICTED: crocetin glucoside glucosyltransf...    518   7e-177   
ref|XP_006367683.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    516   4e-176   
ref|XP_006367533.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    515   8e-176   
ref|XP_004249995.1|  PREDICTED: crocetin glucoside glucosyltransf...    513   5e-175   
ref|XP_004249992.1|  PREDICTED: crocetin glucoside glucosyltransf...    510   1e-173   
ref|XP_006367681.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    508   5e-173   
ref|XP_004234916.1|  PREDICTED: crocetin glucoside glucosyltransf...    508   5e-173   
ref|XP_009763810.1|  PREDICTED: crocetin glucoside glucosyltransf...    507   1e-172   
ref|XP_004238697.1|  PREDICTED: crocetin glucoside glucosyltransf...    506   4e-172   
ref|XP_009793442.1|  PREDICTED: crocetin glucoside glucosyltransf...    504   1e-171   
ref|XP_006361192.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    496   2e-168   
ref|XP_009593727.1|  PREDICTED: crocetin glucoside glucosyltransf...    497   3e-168   
ref|XP_004250484.1|  PREDICTED: crocetin glucoside glucosyltransf...    492   7e-167   
ref|XP_006367682.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    489   1e-165   
ref|XP_011084223.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    488   3e-165   
ref|XP_011084222.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    487   9e-165   
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    487   1e-164   
ref|XP_009604940.1|  PREDICTED: crocetin glucoside glucosyltransf...    479   6e-162   
ref|XP_002271587.2|  PREDICTED: crocetin glucoside glucosyltransf...    478   1e-161   Vitis vinifera
ref|XP_006365665.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    478   2e-161   
gb|EYU38052.1|  hypothetical protein MIMGU_mgv1a019912mg                478   9e-161   
ref|XP_009601673.1|  PREDICTED: crocetin glucoside glucosyltransf...    475   4e-160   
dbj|BAH80312.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    475   5e-160   Catharanthus roseus [chatas]
sp|F8WKW8.1|UGT9_GARJA  RecName: Full=Beta-D-glucosyl crocetin be...    473   2e-159   
ref|XP_004243636.1|  PREDICTED: crocetin glucoside glucosyltransf...    473   3e-159   
ref|XP_006367679.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    473   3e-159   
emb|CDO99873.1|  unnamed protein product                                471   9e-159   
ref|XP_004250486.1|  PREDICTED: crocetin glucoside glucosyltransf...    469   8e-158   
emb|CDP00191.1|  unnamed protein product                                469   9e-158   
ref|XP_009770958.1|  PREDICTED: crocetin glucoside glucosyltransf...    468   3e-157   
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    465   2e-156   
ref|XP_009795814.1|  PREDICTED: crocetin glucoside glucosyltransf...    464   6e-156   
ref|XP_009596289.1|  PREDICTED: crocetin glucoside glucosyltransf...    464   1e-155   
ref|XP_010658725.1|  PREDICTED: crocetin glucoside glucosyltransf...    463   1e-155   
ref|XP_004250482.1|  PREDICTED: crocetin glucoside glucosyltransf...    463   1e-155   
ref|XP_009593691.1|  PREDICTED: crocetin glucoside glucosyltransf...    462   2e-155   
ref|XP_004249996.1|  PREDICTED: crocetin glucoside glucosyltransf...    462   2e-155   
ref|XP_011076906.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    461   1e-154   
ref|XP_009796593.1|  PREDICTED: crocetin glucoside glucosyltransf...    461   2e-154   
ref|XP_006355167.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    461   2e-154   
ref|XP_011094502.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    460   4e-154   
ref|XP_006352206.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    459   4e-154   
emb|CDO99874.1|  unnamed protein product                                460   5e-154   
ref|XP_006342241.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    459   7e-154   
ref|XP_010327003.1|  PREDICTED: crocetin glucoside glucosyltransf...    458   2e-153   
ref|XP_006360518.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    456   6e-153   
ref|XP_010318090.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    457   7e-153   
ref|XP_009775012.1|  PREDICTED: crocetin glucoside glucosyltransf...    456   2e-152   
dbj|BAH80313.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    456   2e-152   Catharanthus roseus [chatas]
dbj|BAO51835.1|  UDP-glycosyltransferase 94P1                           456   2e-152   
ref|XP_008375610.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    454   1e-151   
ref|XP_009775013.1|  PREDICTED: crocetin glucoside glucosyltransf...    451   6e-151   
ref|XP_009768067.1|  PREDICTED: crocetin glucoside glucosyltransf...    451   2e-150   
ref|XP_010032103.1|  PREDICTED: crocetin glucoside glucosyltransf...    450   2e-150   
ref|XP_010321591.1|  PREDICTED: crocetin glucoside glucosyltransf...    449   5e-150   
ref|XP_008345567.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    450   5e-150   
ref|XP_010032098.1|  PREDICTED: crocetin glucoside glucosyltransf...    449   6e-150   
ref|XP_007220462.1|  hypothetical protein PRUPE_ppa005532mg             448   2e-149   
ref|XP_008231982.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    447   3e-149   
gb|KCW51498.1|  hypothetical protein EUGRSUZ_J01015                     447   4e-149   
ref|XP_010034309.1|  PREDICTED: crocetin glucoside glucosyltransf...    447   4e-149   
ref|XP_010110161.1|  Cyanidin-3-O-glucoside 2-O-glucuronosyltrans...    447   7e-149   
ref|XP_010034308.1|  PREDICTED: crocetin glucoside glucosyltransf...    446   8e-149   
emb|CDP13368.1|  unnamed protein product                                445   1e-148   
ref|XP_004238624.1|  PREDICTED: crocetin glucoside glucosyltransf...    445   3e-148   
ref|XP_009337015.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    444   1e-147   
ref|XP_009608408.1|  PREDICTED: crocetin glucoside glucosyltransf...    444   2e-147   
ref|XP_004244816.1|  PREDICTED: crocetin glucoside glucosyltransf...    442   2e-147   
ref|XP_010658726.1|  PREDICTED: crocetin glucoside glucosyltransf...    437   9e-146   
gb|KCW51493.1|  hypothetical protein EUGRSUZ_J01009                     437   1e-145   
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...    438   2e-145   
ref|XP_008231997.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    437   3e-145   
ref|XP_002264771.2|  PREDICTED: crocetin glucoside glucosyltransf...    437   4e-145   Vitis vinifera
ref|XP_010033637.1|  PREDICTED: crocetin glucoside glucosyltransf...    436   7e-145   
gb|AHZ30598.1|  ufgt                                                    435   7e-145   
ref|XP_008231988.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    436   1e-144   
gb|AEJ88222.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase           435   2e-144   
ref|XP_008231983.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    434   6e-144   
ref|XP_007220460.1|  hypothetical protein PRUPE_ppa005520mg             434   6e-144   
ref|XP_008231981.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    432   2e-143   
ref|XP_007220461.1|  hypothetical protein PRUPE_ppa005526mg             432   3e-143   
ref|XP_007219141.1|  hypothetical protein PRUPE_ppa016015mg             432   4e-143   
ref|XP_006363504.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    430   1e-142   
gb|AFK79036.1|  glycosyltransferase UGT4                                430   2e-142   
gb|KCW51492.1|  hypothetical protein EUGRSUZ_J01008                     428   2e-142   
gb|KCW53337.1|  hypothetical protein EUGRSUZ_J02585                     429   3e-142   
emb|CDO99872.1|  unnamed protein product                                428   1e-141   
ref|XP_007220458.1|  hypothetical protein PRUPE_ppa005471mg             427   2e-141   
gb|EYU31926.1|  hypothetical protein MIMGU_mgv1a021717mg                424   3e-140   
ref|XP_006436669.1|  hypothetical protein CICLE_v10033610mg             423   4e-140   
gb|KCW51496.1|  hypothetical protein EUGRSUZ_J01013                     421   2e-139   
ref|XP_009335994.1|  PREDICTED: crocetin glucoside glucosyltransf...    422   2e-139   
ref|XP_008375609.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    421   8e-139   
ref|XP_010525697.1|  PREDICTED: crocetin glucoside glucosyltransf...    419   4e-138   
ref|XP_009336996.1|  PREDICTED: crocetin glucoside glucosyltransf...    419   6e-138   
gb|AGR44632.1|  UDP-glucosyltransferase 94B1                            418   7e-138   
ref|XP_002523035.1|  glucosyl/glucuronosyl transferases, putative       417   8e-138   Ricinus communis
ref|XP_009337016.1|  PREDICTED: crocetin glucoside glucosyltransf...    418   9e-138   
ref|XP_008231995.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    416   4e-137   
ref|XP_008344699.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    416   1e-136   
ref|XP_011032817.1|  PREDICTED: crocetin glucoside glucosyltransf...    414   2e-136   
ref|XP_007218014.1|  hypothetical protein PRUPE_ppa005830mg             413   5e-136   
ref|XP_010248422.1|  PREDICTED: crocetin glucoside glucosyltransf...    415   2e-135   
ref|XP_002270285.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    411   5e-135   Vitis vinifera
ref|XP_010649358.1|  PREDICTED: crocetin glucoside glucosyltransf...    410   6e-135   
ref|XP_008345539.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    411   6e-135   
dbj|BAF99027.1|  UDP-glucose:sesaminol 2'-O-glucoside-O-glucosylt...    405   1e-132   Sesamum indicum [beniseed]
ref|XP_011076907.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    405   1e-132   
gb|AED99884.1|  glycosyltransferase                                     405   1e-132   
ref|XP_008449848.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    402   2e-131   
gb|EYU39888.1|  hypothetical protein MIMGU_mgv1a022198mg                401   4e-131   
ref|XP_004250483.1|  PREDICTED: crocetin glucoside glucosyltransf...    399   1e-130   
ref|XP_010034307.1|  PREDICTED: crocetin glucoside glucosyltransf...    397   3e-130   
ref|XP_009775018.1|  PREDICTED: crocetin glucoside glucosyltransf...    399   4e-130   
ref|XP_010034306.1|  PREDICTED: crocetin glucoside glucosyltransf...    397   3e-129   
ref|XP_006436664.1|  hypothetical protein CICLE_v10033373mg             396   3e-129   
gb|KCW51489.1|  hypothetical protein EUGRSUZ_J01005                     397   3e-129   
ref|XP_011032816.1|  PREDICTED: crocetin glucoside glucosyltransf...    394   1e-128   
ref|XP_008344515.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    394   2e-128   
ref|XP_004142256.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    391   3e-127   
emb|CDP12002.1|  unnamed protein product                                389   3e-126   
ref|XP_011075272.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    389   3e-126   
dbj|BAM28984.1|  UDP-glucose glucosyltransferase                        386   4e-125   
ref|XP_011090843.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    384   1e-124   
ref|XP_011090910.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    382   1e-123   
emb|CDP11999.1|  unnamed protein product                                382   1e-123   
gb|EYU18697.1|  hypothetical protein MIMGU_mgv1a006194mg                381   2e-123   
emb|CDP12003.1|  unnamed protein product                                380   6e-123   
ref|XP_008456584.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    380   2e-122   
ref|XP_011090908.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    378   3e-122   
gb|EPS69530.1|  hypothetical protein M569_05234                         375   2e-121   
gb|KCW51491.1|  hypothetical protein EUGRSUZ_J01007                     374   4e-121   
gb|EYU19795.1|  hypothetical protein MIMGU_mgv1a019121mg                375   6e-121   
gb|EYU43900.1|  hypothetical protein MIMGU_mgv1a026213mg                374   1e-120   
ref|XP_011071477.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    372   6e-120   
ref|XP_002311963.2|  hypothetical protein POPTR_0008s02520g             369   4e-119   Populus trichocarpa [western balsam poplar]
ref|XP_004140986.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    371   5e-119   
ref|XP_006342776.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    370   6e-119   
gb|AGP25113.1|  uridine diphosphate glycosyltransferase                 367   5e-118   
gb|AFJ53042.1|  UDP-glycosyltransferase 1                               368   5e-118   
gb|EYU18696.1|  hypothetical protein MIMGU_mgv1a006481mg                367   7e-118   
ref|XP_011091058.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    365   2e-117   
ref|XP_009589204.1|  PREDICTED: crocetin glucoside glucosyltransf...    365   3e-117   
ref|XP_011090911.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    365   3e-117   
emb|CDP05516.1|  unnamed protein product                                364   3e-117   
sp|Q5NTH0.1|UGAT_BELPE  RecName: Full=Cyanidin-3-O-glucoside 2-O-...    363   1e-116   Bellis perennis [English daisy]
ref|XP_009802399.1|  PREDICTED: crocetin glucoside glucosyltransf...    360   1e-116   
ref|XP_009803961.1|  PREDICTED: crocetin glucoside glucosyltransf...    363   2e-116   
emb|CDP17151.1|  unnamed protein product                                363   2e-116   
emb|CDP06965.1|  unnamed protein product                                363   3e-116   
ref|XP_011071476.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    363   4e-116   
gb|ADW20351.1|  putative branch-forming glycosyltransferase             359   7e-115   
ref|XP_009630066.1|  PREDICTED: crocetin glucoside glucosyltransf...    362   9e-115   
ref|XP_011090909.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    359   9e-115   
gb|KDO39400.1|  hypothetical protein CISIN_1g038300mg                   356   3e-114   
ref|XP_008449847.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    357   3e-114   
ref|XP_004229306.1|  PREDICTED: crocetin glucoside glucosyltransf...    357   4e-114   
gb|AGO03777.1|  non-smoky glycosyltransferase 1                         356   1e-113   
ref|XP_004142254.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    354   7e-113   
ref|XP_009416699.1|  PREDICTED: crocetin glucoside glucosyltransf...    355   8e-113   
gb|KGN54053.1|  UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltr...    353   1e-112   
ref|XP_004162020.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    353   1e-112   
ref|XP_006354527.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    353   1e-112   
ref|XP_009804830.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    353   2e-112   
gb|KGN54052.1|  hypothetical protein Csa_4G279810                       352   3e-112   
gb|AGO03779.1|  non-smoky glycosyltransferase 2                         352   3e-112   
ref|XP_006424313.1|  hypothetical protein CICLE_v10030271mg             352   3e-112   
ref|XP_009620256.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    352   5e-112   
gb|AFK79037.1|  glycosyltransferase UGT5                                352   6e-112   
ref|XP_009774569.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    353   6e-112   
ref|XP_004142255.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    351   9e-112   
ref|XP_006851566.1|  hypothetical protein AMTR_s00040p00192700          350   3e-111   
sp|Q8GVE3.2|FLRT_CITMA  RecName: Full=Flavanone 7-O-glucoside 2''...    348   1e-110   Citrus maxima [buntan]
gb|AFB73772.1|  1,2 rhamnosyltransferase                                348   2e-110   
gb|ACX70154.1|  1,2 rhamnosyltransferase                                348   2e-110   Citrus maxima [buntan]
gb|KDO51358.1|  hypothetical protein CISIN_1g046033mg                   344   4e-109   
ref|XP_004250481.1|  PREDICTED: crocetin glucoside glucosyltransf...    345   5e-109   
dbj|BAI44134.1|  flavonoid glycosyltransferase UGT94C2                  343   2e-108   Veronica persica [bird-eye speedwell]
ref|XP_010046728.1|  PREDICTED: crocetin glucoside glucosyltransf...    340   3e-108   
gb|AGA84058.1|  UDP-glucosyltransferase isoform 2                       342   8e-108   
gb|AFJ53038.1|  UDP-glycosyltransferase 1                               337   5e-106   
gb|EYU45580.1|  hypothetical protein MIMGU_mgv1a021692mg                332   2e-104   
dbj|BAI44133.1|  flavonoid glycosyltransferase UGT94F1                  332   4e-104   Veronica persica [bird-eye speedwell]
ref|XP_011071677.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    332   4e-104   
gb|EYU43901.1|  hypothetical protein MIMGU_mgv1a020989mg                330   4e-103   
ref|XP_008347175.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    325   6e-103   
ref|XP_009793589.1|  PREDICTED: crocetin glucoside glucosyltransf...    323   1e-102   
gb|AFJ53040.1|  UDP-glycosyltransferase 1                               327   4e-102   
gb|AFJ53039.1|  UDP-glycosyltransferase 1                               326   7e-102   
gb|EYU45579.1|  hypothetical protein MIMGU_mgv1a006511mg                325   1e-101   
gb|AFJ53037.1|  UDP-glycosyltransferase 1                               324   2e-101   
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      325   3e-101   
gb|EYU43902.1|  hypothetical protein MIMGU_mgv1a020418mg                324   5e-101   
gb|EPS71672.1|  hypothetical protein M569_03087                         324   5e-101   
gb|EPS70316.1|  hypothetical protein M569_04443                         320   4e-100   
ref|XP_008363249.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    318   4e-100   
gb|EPS71334.1|  glycosyltransferase                                     320   5e-100   
gb|AHK12771.1|  flavanone-O-beta-L-rhamnosyltransferase-like prot...    318   5e-99    
gb|EPS60299.1|  hypothetical protein M569_14508                         314   1e-98    
ref|XP_008670653.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    313   1e-96    
ref|XP_006367824.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    310   4e-96    
ref|XP_009623061.1|  PREDICTED: crocetin glucoside glucosyltransf...    306   2e-95    
dbj|BAK08326.1|  predicted protein                                      305   6e-94    
ref|XP_004958654.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    305   7e-94    
ref|NP_001147268.1|  anthocyanidin 3-O-glucosyltransferase              305   1e-93    Zea mays [maize]
tpg|DAA64088.1|  TPA: anthocyanidin 3-O-glucosyltransferase             305   2e-93    
ref|XP_006424314.1|  hypothetical protein CICLE_v10030045mg             300   1e-92    
gb|EPS71335.1|  hypothetical protein M569_03424                         299   1e-91    
ref|NP_001060603.1|  Os07g0672700                                       299   3e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05102.1|  hypothetical protein OsI_27293                          297   1e-90    Oryza sativa Indica Group [Indian rice]
gb|EPS70317.1|  hypothetical protein M569_04444                         293   2e-90    
emb|CDP19775.1|  unnamed protein product                                290   2e-89    
ref|XP_008344517.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    288   3e-89    
ref|XP_009767153.1|  PREDICTED: crocetin glucoside glucosyltransf...    283   1e-86    
gb|EMT05942.1|  hypothetical protein F775_52247                         286   2e-86    
ref|XP_006471419.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    282   8e-86    
ref|XP_009627944.1|  PREDICTED: crocetin glucoside glucosyltransf...    279   4e-85    
ref|XP_004233933.2|  PREDICTED: crocetin glucoside glucosyltransf...    269   3e-82    
gb|EPS70318.1|  hypothetical protein M569_04442                         268   5e-81    
gb|AGO03778.1|  truncated non-smoky glycosyltransferase 1               265   8e-80    
gb|ABR16160.1|  unknown                                                 269   1e-79    Picea sitchensis
ref|XP_010326752.1|  PREDICTED: crocetin glucoside glucosyltransf...    264   2e-79    
gb|ABR18376.1|  unknown                                                 265   2e-78    Picea sitchensis
gb|KDO54370.1|  hypothetical protein CISIN_1g044441mg                   261   2e-78    
emb|CDP14985.1|  unnamed protein product                                259   6e-78    
ref|XP_003559812.1|  PREDICTED: crocetin glucoside glucosyltransf...    261   7e-77    
gb|ABR18123.1|  unknown                                                 260   3e-76    Picea sitchensis
ref|XP_009609569.1|  PREDICTED: crocetin glucoside glucosyltransf...    250   3e-76    
gb|AFJ53041.1|  UDP-glycosyltransferase 1                               253   6e-75    
ref|XP_004166802.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    251   1e-74    
ref|XP_002463370.1|  hypothetical protein SORBIDRAFT_02g042580          256   1e-74    Sorghum bicolor [broomcorn]
ref|XP_003593142.1|  Glucosyltransferase                                247   2e-71    
gb|EMS55799.1|  Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltra...    245   2e-71    
gb|ABR16053.1|  unknown                                                 246   7e-71    Picea sitchensis
ref|XP_011071660.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    240   2e-70    
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    243   5e-70    
gb|AFK37289.1|  unknown                                                 241   4e-69    
gb|KDO51357.1|  hypothetical protein CISIN_1g042362mg                   235   4e-69    
ref|XP_004162019.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    236   4e-69    
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             240   6e-69    
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             239   7e-69    Populus trichocarpa [western balsam poplar]
ref|XP_007148434.1|  hypothetical protein PHAVU_006G208300g             239   1e-68    
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        238   2e-68    
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    238   4e-68    
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       238   5e-68    
ref|XP_007148436.1|  hypothetical protein PHAVU_006G208500g             238   5e-68    
ref|XP_003593144.1|  Glucosyltransferase                                238   6e-68    
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    236   2e-67    
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    235   3e-67    
gb|EPS66584.1|  hypothetical protein M569_08191                         234   6e-67    
emb|CDP12000.1|  unnamed protein product                                229   2e-66    
ref|XP_004485550.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    233   2e-66    
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    232   8e-66    
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       231   1e-65    
gb|AGO03780.1|  truncated non-smoky glycosyltransferase 2               228   1e-65    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          231   2e-65    
ref|XP_003535899.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    231   2e-65    
gb|KHN27169.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            230   2e-65    
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    230   3e-65    
ref|XP_002511902.1|  UDP-glucosyltransferase, putative                  229   5e-65    Ricinus communis
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               229   6e-65    
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    229   7e-65    
emb|CDO97382.1|  unnamed protein product                                229   7e-65    
dbj|BAJ89368.1|  predicted protein                                      229   9e-65    
ref|XP_007219064.1|  hypothetical protein PRUPE_ppa014698mg             221   1e-64    
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            228   2e-64    
ref|XP_003619124.1|  Anthocyanidin 3-O-glucosyltransferase              228   2e-64    
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    228   3e-64    
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    228   3e-64    
gb|KEH32398.1|  UDP-glucosyltransferase family protein                  227   5e-64    
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    227   5e-64    Fragaria x ananassa
gb|KHN26939.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            226   6e-64    
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            226   7e-64    
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   1e-63    
gb|KHN26937.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            225   2e-63    
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   2e-63    
ref|XP_009770809.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    221   2e-63    
ref|XP_003559278.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    226   2e-63    
ref|NP_001240857.1|  soyasaponin III rhamnosyltransferase               225   2e-63    
ref|XP_008366513.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    219   3e-63    
ref|XP_004306714.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    225   3e-63    
ref|XP_010942592.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    225   3e-63    
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       224   4e-63    
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    224   5e-63    
emb|CDP01583.1|  unnamed protein product                                224   6e-63    
ref|XP_011020572.1|  PREDICTED: UDP-glycosyltransferase 91C1            224   7e-63    
ref|XP_007051734.1|  UDP-Glycosyltransferase superfamily protein,...    223   2e-62    
ref|XP_008388229.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       223   2e-62    
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    223   2e-62    
ref|XP_006353004.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       223   3e-62    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    222   3e-62    
ref|XP_002302598.1|  hypothetical protein POPTR_0002s16380g             222   4e-62    
ref|XP_011092852.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       222   5e-62    
emb|CDP01582.1|  unnamed protein product                                221   7e-62    
dbj|BAJ84800.1|  predicted protein                                      221   9e-62    
dbj|BAJ99561.1|  predicted protein                                      221   9e-62    
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    221   1e-61    
ref|XP_003619079.1|  Anthocyanidin 3-O-glucosyltransferase              221   1e-61    
ref|XP_004485549.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    220   2e-61    
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    219   3e-61    
ref|XP_007148435.1|  hypothetical protein PHAVU_006G208400g             219   4e-61    
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             219   5e-61    
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       219   5e-61    
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       218   6e-61    
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    218   7e-61    
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       218   7e-61    
ref|XP_002303861.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    218   8e-61    
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  218   8e-61    
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    219   9e-61    
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    218   1e-60    
ref|XP_004134320.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       218   1e-60    
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    218   1e-60    
ref|XP_010031469.1|  PREDICTED: crocetin glucoside glucosyltransf...    211   1e-60    
gb|AES79436.2|  UDP-glucosyltransferase family protein                  217   1e-60    
ref|XP_011023290.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    218   1e-60    
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    218   2e-60    
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         217   2e-60    
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          217   2e-60    
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       217   2e-60    
ref|XP_008362977.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    217   3e-60    
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    217   3e-60    
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    216   3e-60    
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...    218   3e-60    
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            216   4e-60    
dbj|BAK04512.1|  predicted protein                                      216   6e-60    
ref|XP_008362978.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    216   6e-60    
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       216   7e-60    
ref|XP_004306716.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    216   7e-60    
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein        218   8e-60    
ref|XP_003547595.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    216   8e-60    
gb|KHN33503.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            216   9e-60    
gb|AGU14093.1|  UDP-glycosyltransferase                                 215   1e-59    
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              217   1e-59    
ref|XP_003564684.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    216   1e-59    
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            216   1e-59    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    215   1e-59    
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     214   1e-59    
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       215   2e-59    
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    215   2e-59    
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             214   2e-59    
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  214   2e-59    
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         214   2e-59    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    214   2e-59    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    216   2e-59    
emb|CDO99875.1|  unnamed protein product                                209   2e-59    
ref|XP_004970691.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    214   3e-59    
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       214   4e-59    
ref|XP_008438010.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       214   8e-59    
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        213   8e-59    
ref|XP_008388212.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       213   1e-58    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          213   1e-58    
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         213   1e-58    
ref|XP_006466331.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       213   1e-58    
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       212   2e-58    
ref|XP_009382171.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       212   2e-58    
ref|XP_008233032.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    211   2e-58    
ref|XP_007051735.1|  UDP-Glycosyltransferase superfamily protein,...    211   3e-58    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             211   3e-58    
ref|XP_008349633.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    204   3e-58    
ref|XP_004306715.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    210   6e-58    
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            211   7e-58    
gb|ACE87855.1|  UDP-glucosyltransferase                                 210   8e-58    
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         210   1e-57    
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            210   1e-57    
ref|XP_009351089.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       209   1e-57    
ref|XP_006426251.1|  hypothetical protein CICLE_v10025508mg             210   2e-57    
gb|EAZ03128.1|  hypothetical protein OsI_25274                          210   2e-57    
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    209   2e-57    
emb|CDP21084.1|  unnamed protein product                                209   2e-57    
gb|KHN46708.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            209   2e-57    
ref|XP_007217954.1|  hypothetical protein PRUPE_ppa005180mg             209   2e-57    
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         209   2e-57    
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       209   3e-57    
emb|CDP21820.1|  unnamed protein product                                208   3e-57    
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   209   4e-57    
gb|AES67724.2|  UDP-glucosyltransferase family protein                  209   4e-57    
ref|XP_003593143.1|  UDP-glucosyltransferase                            208   4e-57    
ref|XP_002275824.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    208   4e-57    
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         208   4e-57    
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       208   5e-57    
ref|XP_006856967.1|  hypothetical protein AMTR_s01218p00004850          209   5e-57    
ref|XP_008232998.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    208   6e-57    
dbj|BAK03755.1|  predicted protein                                      208   1e-56    
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             206   1e-56    
emb|CDP04856.1|  unnamed protein product                                207   1e-56    
ref|XP_008342850.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       207   1e-56    
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    207   2e-56    
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                     206   2e-56    
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             206   2e-56    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          206   3e-56    
ref|XP_003597473.1|  Anthocyanidin 3-O-glucosyltransferase              211   4e-56    
gb|AFK35814.1|  unknown                                                 206   5e-56    
ref|XP_002311964.1|  hypothetical protein POPTR_0008s02530g             202   5e-56    
ref|XP_008362434.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       205   5e-56    
gb|KEH37740.1|  UDP-glucosyltransferase family protein                  205   6e-56    
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          205   7e-56    
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    206   7e-56    
dbj|BAJ86656.1|  predicted protein                                      205   7e-56    
ref|XP_003539949.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    205   8e-56    
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       205   9e-56    
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       205   9e-56    
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             204   1e-55    
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             205   1e-55    
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       205   1e-55    
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   204   1e-55    
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            204   1e-55    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    204   1e-55    
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    204   2e-55    
emb|CDP02132.1|  unnamed protein product                                204   2e-55    
gb|KHN07772.1|  UDP-glycosyltransferase 79B6                            204   2e-55    
ref|XP_008236324.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       204   2e-55    
ref|XP_003526249.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    204   2e-55    
gb|KCW66654.1|  hypothetical protein EUGRSUZ_F00432                     203   2e-55    
ref|XP_003556320.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    203   2e-55    
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            203   3e-55    
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    204   3e-55    
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       202   3e-55    
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    203   3e-55    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  203   3e-55    
dbj|BAJ97320.1|  predicted protein                                      203   3e-55    
dbj|BAO45905.1|  UDP-glycosyltransferase                                203   4e-55    
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         203   4e-55    
ref|XP_011080252.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       203   5e-55    
ref|XP_007134322.1|  hypothetical protein PHAVU_010G037600g             202   5e-55    
ref|XP_003518714.1|  PREDICTED: scopoletin glucosyltransferase-like     203   6e-55    
ref|XP_004486938.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       203   6e-55    
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein        203   7e-55    
ref|XP_008337731.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       202   8e-55    
gb|KHN00987.1|  Anthocyanidin 3-O-glucosyltransferase                   201   9e-55    
gb|KHN41619.1|  UDP-glycosyltransferase 79B6                            202   9e-55    
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           202   9e-55    
ref|XP_002270294.1|  PREDICTED: UDP-glycosyltransferase 91A1            202   1e-54    
ref|XP_010446317.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       201   1e-54    
ref|XP_003591655.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    201   1e-54    
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    202   1e-54    
ref|XP_003570831.2|  PREDICTED: UDP-glycosyltransferase 91C1-like       202   2e-54    
gb|EPS70335.1|  hypothetical protein M569_04423                         201   2e-54    
ref|XP_010047533.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       201   2e-54    
ref|NP_001051624.1|  Os03g0804900                                       202   2e-54    
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    201   2e-54    
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       201   2e-54    
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       201   2e-54    
emb|CAN81633.1|  hypothetical protein VITISV_034564                     201   2e-54    
gb|ABR17572.1|  unknown                                                 201   2e-54    
ref|XP_002458816.1|  hypothetical protein SORBIDRAFT_03g040840          201   2e-54    
ref|XP_006449434.1|  hypothetical protein CICLE_v10017784mg             201   3e-54    
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       202   3e-54    
ref|XP_008346533.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    201   3e-54    
ref|XP_002270260.1|  PREDICTED: UDP-glycosyltransferase 91A1            201   3e-54    
ref|XP_007144190.1|  hypothetical protein PHAVU_007G135800g             200   4e-54    
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       200   4e-54    
dbj|BAJ94055.1|  predicted protein                                      200   4e-54    
gb|KEH17945.1|  UDP-glucosyltransferase family protein                  200   4e-54    
ref|XP_003632051.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       201   4e-54    
ref|XP_006415140.1|  hypothetical protein EUTSA_v10007607mg             200   4e-54    
gb|AHL38585.1|  glycosyltransferase                                     206   4e-54    
ref|XP_003615305.1|  Anthocyanidin 3-O-glucosyltransferase              199   4e-54    
ref|XP_010927293.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    200   4e-54    
ref|XP_006650454.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       200   4e-54    
ref|XP_003564213.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       200   5e-54    
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       201   5e-54    
ref|XP_006847216.1|  hypothetical protein AMTR_s00017p00254910          200   5e-54    
dbj|BAJ98242.1|  predicted protein                                      200   5e-54    
gb|KEH20104.1|  UDP-glucosyltransferase family protein                  200   6e-54    
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    199   8e-54    
ref|XP_004981372.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    200   8e-54    
gb|KEH17952.1|  UDP-glucosyltransferase family protein                  199   9e-54    
ref|XP_006445992.1|  hypothetical protein CICLE_v10015045mg             200   9e-54    
ref|NP_001044898.1|  Os01g0865400                                       199   1e-53    
gb|EEE55719.1|  hypothetical protein OsJ_04191                          199   1e-53    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    199   1e-53    
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    199   1e-53    
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     199   1e-53    
ref|XP_004238163.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    198   1e-53    
emb|CDX81291.1|  BnaC09g07020D                                          198   1e-53    
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       199   1e-53    
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    199   2e-53    
ref|XP_007041734.1|  UDP-Glycosyltransferase superfamily protein,...    200   2e-53    
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    198   2e-53    
gb|AFJ52977.1|  UDP-glycosyltransferase 1                               198   2e-53    
ref|XP_010918860.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       198   3e-53    
gb|ABR16563.1|  unknown                                                 199   3e-53    
ref|XP_006848503.1|  hypothetical protein AMTR_s00013p00259270          198   3e-53    
ref|XP_008808452.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       198   3e-53    
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    197   3e-53    
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    197   3e-53    
gb|EPS67374.1|  hypothetical protein M569_07398                         197   3e-53    
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                197   3e-53    
gb|AID60125.1|  UDP-glucosyl transferase 73B2                           198   4e-53    
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    197   4e-53    
ref|XP_008674785.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    197   4e-53    
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       197   5e-53    
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    197   5e-53    



>dbj|BAG80557.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=454

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 338/453 (75%), Gaps = 7/453 (2%)
 Frame = +1

Query  103   MGTETMATRRS--VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ  276
             MGTE    + +  V+MFPWLAYGHI+PF+ +AK L DRGFL++LCST  NL S    IP+
Sbjct  1     MGTEVTVHKNTLRVLMFPWLAYGHISPFLNVAKKLVDRGFLIYLCSTAINLKSTIKKIPE  60

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
              YS SI+L+ELHLPE P+LPPHY TTNGLP HL+  L+K LKM++P+F+++L+ L PDL+
Sbjct  61    KYSDSIQLIELHLPELPELPPHYHTTNGLPPHLNHTLQKALKMSKPNFSKILQNLKPDLV  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+D++  WAE VA   NIP+V+  T+ AA+ SYF +++  PG E+PFPA+ LR+ E  K 
Sbjct  121   IYDLLQQWAEGVANEQNIPAVKLLTSGAAVLSYFFNLVKKPGVEFPFPAIYLRKNELEKM  180

Query  637   RELMNQETRNFKREETLD--TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ  810
              EL+ Q  ++ K  + +D     N  +ML+++SR +E KYIDY S L   KVV +G   Q
Sbjct  181   SELLAQSAKD-KEPDGVDPFADGNMQVMLMSTSRIIEAKYIDYFSGLSNWKVVPVGPPVQ  239

Query  811   APPPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF  987
              P   D  E EL DWL +K  +STVFVSFGSEYFL KED EEIA+GLE+S VNFIWV RF
Sbjct  240   DPIADDADEMELIDWLGKKDENSTVFVSFGSEYFLSKEDREEIAFGLELSNVNFIWVARF  299

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
             PKGEE ++E+ALPKGFLERIG+RGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ 
Sbjct  300   PKGEEQNLEDALPKGFLERIGDRGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDF  359

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPIIAMP+HLDQPMNARL+VE+G AVE+ RD+ GK+HREE+A  L++ + G++GE LK 
Sbjct  360   GVPIIAMPIHLDQPMNARLIVELGVAVEIVRDDYGKIHREEIAEILKDVIAGKSGENLKA  419

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLC-NKPE  1443
              ++ IS+NL+   + EMD    EL +LC N P+
Sbjct  420   KMRDISKNLKSIRDEEMDTAAEELIQLCKNSPK  452



>ref|XP_009616666.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=455

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/446 (56%), Positives = 328/446 (74%), Gaps = 2/446 (0%)
 Frame = +1

Query  100   TMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS  279
             T  TE   T   V+MFPWLAYGHI+PF+ ++K L DRGFL++LCSTP NL SI   IP+ 
Sbjct  3     TQVTERGNTNLRVIMFPWLAYGHISPFLNVSKKLVDRGFLIYLCSTPINLKSIVKKIPEK  62

Query  280   YSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             YS SI+L+E HLPESP+LPPHY TTNGLP HL+  L+K  K+++P+F+++LK L PDL++
Sbjct  63    YSVSIQLIEYHLPESPELPPHYHTTNGLPPHLNYTLQKASKLSKPNFSKILKNLKPDLVV  122

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTR  639
             +DV+  WAE VA   NIP+V+  T+ AA+ SY+ +++  PG E+PFPA+ LR  E  K  
Sbjct  123   YDVLQQWAEGVANEHNIPAVKLLTSGAAVFSYYFNLVKTPGIEFPFPAIYLRNIELVKLG  182

Query  640   ELMNQETRNFKREET-LDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
             E+M +  +  + ++  L T  N  +ML+++SR +E KYIDY SEL   KV+ +G   Q  
Sbjct  183   EVMAKSAKQKESDDVDLFTEGNMQIMLMSTSRIIEAKYIDYFSELSNWKVIPVGPPVQDS  242

Query  817   PPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                D  + E  DWL +K  +STVFVSFGSEYFL KED+EEIA+GLEIS VNFIWV+RFPK
Sbjct  243   MASDADDVEFFDWLGKKDENSTVFVSFGSEYFLTKEDMEEIAFGLEISNVNFIWVVRFPK  302

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             GEE ++E ALP+GFLERIGERGR+++ WAPQ +IL H + GGF+SHCGWNS+MES++ GV
Sbjct  303   GEEQNLENALPQGFLERIGERGRVLKKWAPQPRILNHPNIGGFISHCGWNSVMESVDFGV  362

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMP+HLDQP+NARLMVE+G A E+ RD+ GK++REE+A  L   + GE GE L++ V
Sbjct  363   PIIAMPIHLDQPLNARLMVELGVAAEIVRDDDGKIYREEIAQVLESVIAGEIGENLRKKV  422

Query  1354  KRISENLRLAGNREMDAVVAELEKLC  1431
             K +S+NL+     EMD V  EL + C
Sbjct  423   KDVSKNLKCIRGEEMDTVAEELIQFC  448



>ref|XP_009609108.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=454

 Score =   523 bits (1348),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 327/446 (73%), Gaps = 5/446 (1%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             +T  T+    +FPWLAYGHI+PF+ LAK L+DRGFL+ LCSTP NL+ I+  IPQSYS +
Sbjct  2     DTEHTKLKAFLFPWLAYGHISPFLELAKKLSDRGFLIELCSTPINLSFIQKRIPQSYSST  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+EL LPE P LPPHY TTNGLPLHL+  L K LK+A+P+   +LKT  PDL+I+DV+
Sbjct  62    IQLVELILPEFPQLPPHYHTTNGLPLHLNSTLHKALKLAKPNLFTILKTRKPDLIIYDVM  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM-  648
              LW   VA SLNIPS RFFT+ AAMCSYF H+  N   EYPFPAL L  YE  + R+L+ 
Sbjct  122   QLWTFGVASSLNIPSARFFTSGAAMCSYFVHLYKNLEVEYPFPALHLYDYEIERARKLVQ  181

Query  649   --NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-P  819
               ++E  N   +   + P  + +ML+++SRE+EGKY++YL+E++++++  IGT  Q P  
Sbjct  182   RNDKENENKDDQPEEEMPPQEGIMLISTSRELEGKYMNYLAEIIETRIFPIGTLVQDPVA  241

Query  820   PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
               D    +  WL  K   STVFVSFGSEYFL KE+ EEIA GLE+S VNFIWV+RFPKGE
Sbjct  242   SGDENMNIMQWLDSKKELSTVFVSFGSEYFLTKEEREEIALGLELSQVNFIWVVRFPKGE  301

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             + ++EEALP+GFLER+G+RG +VE WAPQAKIL H S GGFVSHCGWNSI ES+  GVPI
Sbjct  302   KQNLEEALPQGFLERVGDRGMIVE-WAPQAKILTHSSIGGFVSHCGWNSISESIEFGVPI  360

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             IA+PM LDQPMNA+L+VEIG A+EV RD+ G LHREE+A+ +++   GE+ E ++  V+ 
Sbjct  361   IAIPMQLDQPMNAKLLVEIGVALEVVRDDNGSLHREEIASVIKDVTSGESSETMRCKVRN  420

Query  1360  ISENLRLAGNREMDAVVAELEKLCNK  1437
             + +NLR     +MDA V EL +L  +
Sbjct  421   LGKNLRTKSVEDMDATVEELRELVGE  446



>ref|XP_006351221.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=473

 Score =   524 bits (1349),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 323/442 (73%), Gaps = 2/442 (0%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSI  294
             T +T+  V +FPWLAYGHI+PF+ LAK L DRGFLV LCS+  NL+ I+  IP++Y  SI
Sbjct  3     TKSTKWKVFLFPWLAYGHISPFLELAKKLVDRGFLVDLCSSSINLSFIRTRIPETYCSSI  62

Query  295   RLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVN  474
              L+EL LP+  +LPPHY T NGLPLHLH  L+K LKM++P+   +L+   PDLLIHDV  
Sbjct  63    HLVELQLPDLQELPPHYHTANGLPLHLHSTLQKALKMSKPNLLNILEARKPDLLIHDVKQ  122

Query  475   LWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ  654
             LW   VA +L+IP+VRFFT+ AAMCSYF+H+   P  E+PF ALRL  YE TK  +++ +
Sbjct  123   LWTAGVASTLDIPAVRFFTSCAAMCSYFSHLFVKPNVEFPFQALRLHPYELTKAHKVV-K  181

Query  655   ETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVDH  831
             E R     E         +ML+ +SRE+EGKYIDY+SE++K KV+ IGT  Q P   VD 
Sbjct  182   EHREDDDPEVRAPEEFTGVMLIGTSREMEGKYIDYMSEIIKFKVLPIGTLVQDPMTSVDG  241

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
               E+ +WL +K   ST+ VSFGS YFL  ++LEE+A+GLE+S VNFIWV+RFPKGE +S+
Sbjct  242   NMEIMEWLGKKDKFSTILVSFGSGYFLTNQELEEVAFGLELSQVNFIWVVRFPKGENLSL  301

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EEALP+GF ERIG RG ++ GWAPQAKIL H S GGFVSHCGWNSI ES++ G+PIIAMP
Sbjct  302   EEALPQGFFERIGHRGMVMGGWAPQAKILTHSSIGGFVSHCGWNSISESIDYGIPIIAMP  361

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             M LDQPMNA+L+VEIG A+EV RDE G LHRE +A  +++ + G++GE L+ NV+ + + 
Sbjct  362   MDLDQPMNAKLLVEIGVALEVLRDENGALHREGIARVIKDVICGKSGENLRCNVRNLGKK  421

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             LR     ++DA V EL +LC++
Sbjct  422   LRFKNVEDIDAAVMELTQLCHE  443



>dbj|BAG80553.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=454

 Score =   520 bits (1339),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 254/446 (57%), Positives = 328/446 (74%), Gaps = 5/446 (1%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             MGTE   +   V+MFPWLA+GHI+P++ ++K LADRG+ V+LCSTP NLN IK  I Q+Y
Sbjct  1     MGTE--GSTLKVLMFPWLAHGHISPYLTVSKKLADRGWYVYLCSTPVNLNFIKKRILQNY  58

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI+L+ELHLPE P+LPP Y TTNGLP HL+  LK+  KM++P+F+ +L+ L PDLLIH
Sbjct  59    SLSIQLVELHLPELPELPPSYHTTNGLPPHLNATLKRAAKMSKPEFSRILENLKPDLLIH  118

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             DVV  WA+ VA S NIP++   T  AA+ SYF H +  PG ++ +PA+ LR+ EQ + +E
Sbjct  119   DVVQPWAKGVANSHNIPAIPLITFGAAVISYFIHQMKKPGIDFRYPAIYLRKIEQQRLQE  178

Query  643   LMNQETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
             +M    ++   ++  D  A     ++L+ SS   E KYIDYL+EL +SK VS+G   Q P
Sbjct  179   MMKNVAKDKDPDDDEDPFAEDPTRIILLMSSSATEAKYIDYLTELTQSKYVSVGPPVQEP  238

Query  817   -PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                 D + +L DWL +K   STV+VSFGSEYFL KED+EEIAYGLE+S +NFIWV+RFPK
Sbjct  239   MNEDDGDMDLIDWLGKKDEHSTVYVSFGSEYFLTKEDMEEIAYGLELSNINFIWVVRFPK  298

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             GEE+ +EEALP+GFLERI  RGR+V GWAPQ +IL H STGGFVSHCGWNS+MES++ GV
Sbjct  299   GEEVKLEEALPQGFLERIENRGRVVSGWAPQPRILSHPSTGGFVSHCGWNSVMESIDFGV  358

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PII MPMHLDQP NARLMVE+G AVE++RD +GK+HREE+A  ++  +  E G+ L+  V
Sbjct  359   PIIPMPMHLDQPFNARLMVELGVAVEIDRDAEGKVHREEVAQVIKSVICKETGKNLREKV  418

Query  1354  KRISENLRLAGNREMDAVVAELEKLC  1431
             K ISENL+     EMD VV EL +LC
Sbjct  419   KDISENLKSMRQEEMDVVVEELIQLC  444



>ref|XP_004250485.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=442

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 255/439 (58%), Positives = 323/439 (74%), Gaps = 5/439 (1%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MAT   V+MFPWLAYGHI+PF+ +AK LADRGFL++LCST  NL SI   IP+ Y+ SI 
Sbjct  1     MATNLRVLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTRINLESIIKKIPEKYADSIH  60

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+EL LPE P+LPPHY TTNGLP HL+  L K LKM++P+F+ +L+ L PDLLI+DV+  
Sbjct  61    LIELQLPELPELPPHYHTTNGLPPHLNPTLHKALKMSKPNFSRILQNLKPDLLIYDVLQP  120

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WAE VA   NIP+ +  T+ AA+ SYF     NPG E+PFPA+ L + E+ K RE++ +E
Sbjct  121   WAEHVANEQNIPAGKLLTSCAAVFSYFFSFRKNPGVEFPFPAIHLPEVEKVKIREILAKE  180

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
                  R   LD   N+ MML+ +SR +E KYIDY +EL   KVV +G  FQ     D + 
Sbjct  181   PEEGGR---LDE-GNKQMMLMCTSRTIEAKYIDYCTELCNWKVVPVGPPFQDLITNDADN  236

Query  838   -ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              EL DWL  K  +STVFVSFGSEYFL KED+EE+A+ LE+S VNFIWV RFPKGEE ++E
Sbjct  237   KELIDWLGTKHENSTVFVSFGSEYFLSKEDMEEVAFALELSNVNFIWVARFPKGEERNLE  296

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS MES++ GVPIIAMP+
Sbjct  297   DALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESIDFGVPIIAMPI  356

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             H DQP+NA+LMVE+G AVE+ RD+ GK+HR E+A  L+  V GE GE L+  V+ IS+NL
Sbjct  357   HNDQPINAKLMVELGVAVEIVRDDDGKIHRGEIAETLKSVVTGETGEILRAKVREISKNL  416

Query  1375  RLAGNREMDAVVAELEKLC  1431
             +   + EMDAV  EL +LC
Sbjct  417   KSIRDEEMDAVAEELIQLC  435



>ref|XP_006367680.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   518 bits (1335),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 248/445 (56%), Positives = 326/445 (73%), Gaps = 6/445 (1%)
 Frame = +1

Query  109   TETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             TE   +  SVVMFPWLAYGHI+PF+ +AK LADRGFL++LCSTP NL S    IP+ Y+ 
Sbjct  6     TEHGTSNLSVVMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIKKIPEKYAD  65

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLPE P+LPPHY TTNGLP HL+  LKK LKM++P+F+++L+ L PDL+I+D+
Sbjct  66    SIQLIELHLPELPELPPHYHTTNGLPPHLNHTLKKALKMSKPNFSKILQNLKPDLVIYDI  125

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
             +  WAE+VA   NIP+VR  T   A+ SYF +++  PG E+PFPA+   + EQ K  E+M
Sbjct  126   MQQWAERVANEQNIPAVRLLTFGVAVLSYFFNLVKKPGVEFPFPAIYFSKIEQVKLGEMM  185

Query  649   NQETRNFK---REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
              +  ++ +    ++T D     A+M   +SR +E KYID+LSEL   KVV +G   Q   
Sbjct  186   ARSAKDQEPDDDDQTADGTTQIALMC--TSRIIEAKYIDFLSELSNWKVVPVGPPVQDLI  243

Query  820   PVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
               D  + EL DWL  K  +STVFVSFGSEYFL KED+EE+A+GLE+S V+FIWV RFPKG
Sbjct  244   TNDADDKELMDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVDFIWVARFPKG  303

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             EE ++E+ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ GVP
Sbjct  304   EEQNLEDALPKGFLERIGERGRVLDKFAPQLRILNHTSTGGFISHCGWNSVMESIDFGVP  363

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQPMNARL+VE+G AVE+ RD+ GK+HR E+   L++ +  + GE L+  ++
Sbjct  364   IIAMPMHLDQPMNARLIVELGVAVEIVRDDDGKIHRGEITETLKDVITEKTGENLRAKMR  423

Query  1357  RISENLRLAGNREMDAVVAELEKLC  1431
              IS+NL      EMDA   EL + C
Sbjct  424   DISKNLNSIRGEEMDAAAQELIQFC  448



>ref|XP_009775011.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=455

 Score =   518 bits (1334),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 326/447 (73%), Gaps = 4/447 (1%)
 Frame = +1

Query  100   TMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS  279
             T  TE   +   V+MFPWLAYGHI+PF+ +AK LAD+GFL++LCSTP NL S+   IP+ 
Sbjct  3     TQVTECGNSNLKVLMFPWLAYGHISPFLNVAKKLADKGFLIYLCSTPINLKSVVKKIPEK  62

Query  280   YSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             Y  SI+L+E HLPESP+LPPHY TTNGLP HL+  L+K LKM++P+F+++L+ L PDL++
Sbjct  63    YFVSIQLIEYHLPESPELPPHYHTTNGLPPHLNHTLQKALKMSKPNFSKILENLKPDLVV  122

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTR  639
             +D++  WAE VA   NIP+V+  T+ AA+ SYF +++  P  E+PFPA+ LR+ E  K  
Sbjct  123   YDILQQWAEDVANEQNIPAVKLLTSGAAVFSYFFNLVKKPEVEFPFPAVYLRKIELVKLG  182

Query  640   ELMNQETRNFKREETLD--TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
             E+M +  +  K  + +D  T  N  +ML+++SR +E KYIDY  EL    V+ +G   Q 
Sbjct  183   EMMAKSAKE-KESDDVDPFTEGNMQIMLMSTSRIIEAKYIDYFIELSNWNVIPVGPPVQD  241

Query  814   PPPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
                 D  + EL DWL +K  +STVFVSFGSEYFL KED EEIA+GLEIS VNFIWV+RFP
Sbjct  242   SMGNDTDDVELFDWLGKKDENSTVFVSFGSEYFLTKEDREEIAFGLEISNVNFIWVVRFP  301

Query  991   KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
             KGEE ++E ALP+GFLERIG+RG+++  WAPQ +IL H +TGGF+SHCGWNS+MES++ G
Sbjct  302   KGEEQNLENALPQGFLERIGKRGKVLNKWAPQPRILNHPNTGGFISHCGWNSVMESVDFG  361

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRN  1350
             VPIIAMPMHLDQP+NARL VE+G AVE+ RD+ GK+HREE+A  L   + G+ GE L+  
Sbjct  362   VPIIAMPMHLDQPLNARLTVELGVAVEIVRDDDGKIHREEIAQVLENVIAGKIGENLRTK  421

Query  1351  VKRISENLRLAGNREMDAVVAELEKLC  1431
             VK +S+ L+     EMDAV  EL + C
Sbjct  422   VKHVSKKLKSTRGEEMDAVAEELIQFC  448



>ref|XP_006367683.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   516 bits (1329),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 249/446 (56%), Positives = 329/446 (74%), Gaps = 10/446 (2%)
 Frame = +1

Query  109   TETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             TE ++T R V+MFP+LAYGHI+PF+ +AK LADR FL++LCSTP NL      IP+ Y+ 
Sbjct  6     TEPLSTLR-VLMFPFLAYGHISPFLNVAKKLADREFLIYLCSTPINLKYASKKIPEKYAD  64

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLPE P+LPPHY TTN LP HLH  L+K LKM++P+F+++L+ L PDL+I+D+
Sbjct  65    SIQLVELHLPELPELPPHYHTTNDLPPHLHSTLQKALKMSKPNFSKILQNLKPDLVIYDI  124

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
             +  WAE+VA   NIP+V+  T+ A + SYFT  L  PG  +PFP + LR+ EQ K    M
Sbjct  125   LQQWAERVANEHNIPAVKLLTSGATVFSYFTISLNKPGDVFPFPEIYLRKSEQVK----M  180

Query  649   NQETRNFKREETLD----TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
             N+  +  K+ E  D       N+ +ML+++SR +E KYIDY +E +  KV+ +G   Q  
Sbjct  181   NETLKCAKQIEPDDGDRQADGNRQIMLMSTSRIIEAKYIDYCTEFLNLKVIPVGPPVQDS  240

Query  817   PPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                D  + EL DWL  K   STVFVSFGSEYFL KED+EE+A+GLE+S VNFIWV RFPK
Sbjct  241   ITDDADDMELIDWLGTKDEDSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPK  300

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             GEE ++E+ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ GV
Sbjct  301   GEERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESIDFGV  360

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMPMHL+QPMNARL+VE+G AVE+ RD+ GK+H+ E+A  L+  + GE GEKL+  V
Sbjct  361   PIIAMPMHLEQPMNARLIVELGVAVEIVRDDDGKIHKGEIAEILKGVITGETGEKLRAQV  420

Query  1354  KRISENLRLAGNREMDAVVAELEKLC  1431
             + IS+NL+   + EMDA   EL +LC
Sbjct  421   RDISKNLKSVRDEEMDATAQELIQLC  446



>ref|XP_006367533.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   515 bits (1327),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 249/449 (55%), Positives = 324/449 (72%), Gaps = 3/449 (1%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
              T   V+MFPWLA+GHI+P++ ++K LADRGF + LCSTP NLN IK  IP+ YS SI+L
Sbjct  4     TTSLRVLMFPWLAHGHISPYLTVSKKLADRGFDILLCSTPVNLNLIKKRIPKKYSVSIQL  63

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +EL LPE PDLPP Y TTNGLP HL+  LKK +KM++P F+++L+ L PDL+IHDV+ +W
Sbjct  64    VELCLPELPDLPPEYHTTNGLPPHLNSTLKKAVKMSKPGFSKILRDLKPDLVIHDVLQVW  123

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ--  654
             A+++A S NIP++   T   A+ SYF H +  PG E+PFPA+ L + EQ + RE+M Q  
Sbjct  124   AKEIANSYNIPAITLVTFGGAVLSYFMHPMRKPGIEFPFPAIYLTKIEQKRMREMMEQVG  183

Query  655   ETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVDH  831
             + ++    +       Q ++L+++S  +E KYIDYL+EL ++K V +G   Q P    D 
Sbjct  184   KDKDPDDGDPFAEDPTQVILLMSTSLSIESKYIDYLNELTQAKYVPVGPPIQEPMNEDDG  243

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
             + EL DWL +K   STVFVSFGSEYFL KED++EIAYGLE S VNFIWV+RFPKGEE+++
Sbjct  244   DIELIDWLGKKEEHSTVFVSFGSEYFLTKEDMKEIAYGLEHSNVNFIWVVRFPKGEEVNL  303

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EEALP GFLERI  RGR+V GWAPQ +IL H STGGFVSHCGWNS+MES++ GVPIIAMP
Sbjct  304   EEALPTGFLERIENRGRVVNGWAPQPRILSHPSTGGFVSHCGWNSVMESIDFGVPIIAMP  363

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MH+DQP+NAR MVEIG AVE+ RDE+GK+HREE+A  +   +  + G  L+  VK ISE 
Sbjct  364   MHIDQPINARWMVEIGVAVEIVRDEEGKVHREEVAQVITSVICEKTGGNLREKVKEISEK  423

Query  1372  LRLAGNREMDAVVAELEKLCNKPERIAFA  1458
             L+     EMDA V  L + C   + I F+
Sbjct  424   LKSIREEEMDAAVEVLLQQCKNSKFIDFS  452



>ref|XP_004249995.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=453

 Score =   513 bits (1321),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 248/447 (55%), Positives = 325/447 (73%), Gaps = 4/447 (1%)
 Frame = +1

Query  100   TMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS  279
             T  TE   +   VVMFPWLAYGHI+PF+ +AK LADRGFL++LCSTP NL S    IP+ 
Sbjct  3     TQVTEHGTSNLRVVMFPWLAYGHISPFLYVAKKLADRGFLIYLCSTPINLKSTIEKIPEK  62

Query  280   YSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             Y+ SI L+ELHLPE P+LPPHY TTNGLP HL+  L+K LKM++P+ +++LK L PDL+I
Sbjct  63    YADSIHLIELHLPELPELPPHYHTTNGLPPHLNHTLQKALKMSKPNLSKILKNLKPDLMI  122

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTR  639
             +DV+  WAE+VA   +IP+VR  T  AA+ SYF +++  PG E+PFP + LR+ EQ K  
Sbjct  123   YDVLQQWAERVANEQSIPAVRLLTFGAAVFSYFCNLVKKPGVEFPFPDIYLRKIEQVKLG  182

Query  640   ELMNQETRNFK--REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
             E++ +  ++     EE L     Q + L+ +SR +E KYID+L EL   KVV +G+  Q 
Sbjct  183   EMLEKSAKDQDPDDEERLVDEYKQ-IALICTSRTIEAKYIDFLLELSNLKVVPVGSPVQD  241

Query  814   PPPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
                 D  + EL DWL  K  +STVFVSFGSEYFL KED+EE+A GLE+S VNF+WV RFP
Sbjct  242   LITNDADDMELIDWLGSKDENSTVFVSFGSEYFLSKEDMEEVALGLELSNVNFVWVARFP  301

Query  991   KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
             KGEE ++E+ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ G
Sbjct  302   KGEEQNLEDALPKGFLERIGERGRVLDKFAPQLRILNHTSTGGFISHCGWNSVMESIHFG  361

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRN  1350
             VPI+AMPMHLDQPMNARL+VE+G AVE+ RD+ GK++REE+A  L++ +    GE L+  
Sbjct  362   VPIVAMPMHLDQPMNARLIVELGVAVEIVRDDDGKIYREEIAKTLKDVITERIGENLRAK  421

Query  1351  VKRISENLRLAGNREMDAVVAELEKLC  1431
             ++ IS+NL      EMDA   EL + C
Sbjct  422   MREISKNLNSISGEEMDAAAHELIQFC  448



>ref|XP_004249992.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=470

 Score =   510 bits (1314),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/450 (55%), Positives = 330/450 (73%), Gaps = 7/450 (2%)
 Frame = +1

Query  100   TMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS  279
             T    TMAT + V+MFP+LAYGHI+P++ +AK LADRGFL++ CSTP NL S    IP+ 
Sbjct  18    TRSNHTMATLK-VLMFPFLAYGHISPYLNVAKKLADRGFLIYFCSTPINLKSTIEKIPEK  76

Query  280   YSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             Y+ SI L+ELHLPE P LPPHY TTNGLP +L+  L+K LKM++P+F+++L+ L PDL+I
Sbjct  77    YADSIHLIELHLPELPQLPPHYHTTNGLPPNLNQVLQKALKMSKPNFSKILQNLKPDLVI  136

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTR  639
             +D++  WA+ VA   NIP+V+  T+ AA+ SYF ++L  PG E+PFP + LR+ EQ +  
Sbjct  137   YDILQRWAKHVANEQNIPAVKLLTSGAAVFSYFFNVLKKPGVEFPFPGIYLRKIEQVRLS  196

Query  640   ELMNQETRNFKREETLD-----TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTT  804
             E+M++  +  + E+  D        N  +ML+++SR +E KYID+ + L   KVV +G  
Sbjct  197   EMMSKSDKEKELEDDDDDDDLLVDGNMQIMLMSTSRTIEAKYIDFCTALTNWKVVPVGPP  256

Query  805   FQAPPPVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVL  981
              Q     D  + EL DWL  K  +STVFVSFGSEYFL KED+EE+A+ LE+S VNFIWV 
Sbjct  257   VQDLITNDVDDMELIDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFALELSNVNFIWVA  316

Query  982   RFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESL  1161
             RFPKGEE ++E+ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS MES+
Sbjct  317   RFPKGEERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESI  376

Query  1162  NLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKL  1341
             + GVPIIAMPMHLDQPMNARL+VE+G AVE+ RD+ GK+HR E+A  L+  + G+ GEKL
Sbjct  377   DFGVPIIAMPMHLDQPMNARLIVELGVAVEIVRDDDGKIHRGEIAETLKGVITGKTGEKL  436

Query  1342  KRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             +  V+ IS+NL+   + EMDA   EL +LC
Sbjct  437   RAKVRDISKNLKTIRDEEMDAAAEELIQLC  466



>ref|XP_006367681.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=441

 Score =   508 bits (1307),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 324/439 (74%), Gaps = 6/439 (1%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MAT R V+MFPWLAYGHI+PF+ +AK LADRGFL++LCST  NL SI   IP+ YS+SIR
Sbjct  1     MATLR-VLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTLINLESIIKKIPEKYSESIR  59

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
              +ELHLPE P+LPPHY TTNGLP HL+  L K LKM++P+F+++L+ L PDL+I+D++  
Sbjct  60    FVELHLPELPELPPHYHTTNGLPPHLNHTLHKALKMSKPNFSKILQNLKPDLVIYDILQP  119

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WAE V    NIP+V+  T+ AA+ SYF + L NPG E+PFPA+ L + EQ K RE+  +E
Sbjct  120   WAEHVVNEQNIPAVKILTSGAALFSYFFNFLKNPGVEFPFPAIYLPKVEQVKMREMFEKE  179

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-HE  834
                   EE      N  +ML+ +SR +E KY+DY +EL   KVV +G  FQ P   D  +
Sbjct  180   PN----EEDRLAEGNMQIMLMCTSRTIEAKYLDYCTELSNWKVVPVGPPFQDPITNDVDD  235

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              EL DWL  K  +STVFV FGSEYFL +ED+EE+A+GLE+S VNFIWV RFPKGEE ++E
Sbjct  236   MELIDWLGTKDENSTVFVCFGSEYFLSREDMEEVAFGLELSNVNFIWVARFPKGEEQNLE  295

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MESL+ GVPIIAMPM
Sbjct  296   DVLPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESLDFGVPIIAMPM  355

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             H DQP+NA+L+VE+G A+E+ RD+ G +HR E+   L++ + GE GE L+  V+ IS+NL
Sbjct  356   HNDQPINAKLIVELGVAMEIVRDDDGNIHRGEITETLKDVITGETGEILRGKVRDISKNL  415

Query  1375  RLAGNREMDAVVAELEKLC  1431
             +     EM+A   EL +LC
Sbjct  416   KSIREEEMNAAAEELIQLC  434



>ref|XP_004234916.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=453

 Score =   508 bits (1308),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 243/440 (55%), Positives = 321/440 (73%), Gaps = 3/440 (1%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
             +T   V+MFPWLA+GHI+P++ ++K LADRGF + LCSTP NLN IK  IP+ YS SI+L
Sbjct  4     STSLRVLMFPWLAHGHISPYLTVSKKLADRGFDILLCSTPVNLNLIKKRIPKKYSVSIQL  63

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +EL LPE P+LPP Y TTNGLP HL+  LKK +KM++P+F+++L+ L PDL+IHDV+ +W
Sbjct  64    VELRLPELPNLPPEYHTTNGLPPHLNSTLKKAVKMSKPEFSKILQDLKPDLVIHDVLQVW  123

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ--  654
             A+K+A S NIP++   T   A+ SYF H +  PG E+PFPA+ L + EQ + RE+M Q  
Sbjct  124   AKKIANSYNIPAITLVTFGGAVLSYFMHPMRKPGTEFPFPAIYLTKIEQKRMREMMEQVY  183

Query  655   ETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH-  831
             + ++    +       Q ++L+++S  ++ KYIDYL+EL ++  V IG   Q P   D  
Sbjct  184   KDKDPDDGDPFAEDPTQVILLMSTSLSIDSKYIDYLNELTQANYVPIGPPIQEPMNEDGG  243

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
             + EL DWL +K   STVFVSFGSEYFL KED+EEIAYGLE S VNFIWV+RFPKGEE+ +
Sbjct  244   DIELIDWLGKKEEHSTVFVSFGSEYFLTKEDMEEIAYGLEHSNVNFIWVVRFPKGEEVDL  303

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EEAL  GFLERI  RGR+V+GWAPQ +IL H STGGFVSHCGWNS+MES++ GVPIIAMP
Sbjct  304   EEALSTGFLERIENRGRVVDGWAPQPRILSHPSTGGFVSHCGWNSVMESIDFGVPIIAMP  363

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MH+DQP+NAR MVEIG AVE+ RD++GK+HRE++A  +   +  + G  L+  VK ISE 
Sbjct  364   MHIDQPINARWMVEIGVAVEIVRDDEGKVHREDVAQVITSVICEKTGRNLREKVKEISEK  423

Query  1372  LRLAGNREMDAVVAELEKLC  1431
             L+    +E+DA V  L + C
Sbjct  424   LKSRREQEIDAAVEVLLQQC  443



>ref|XP_009763810.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=454

 Score =   507 bits (1306),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 323/443 (73%), Gaps = 5/443 (1%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             +T  T+    +FPWLAYGHI+PF+ LAK L+DRGFL+ LCSTP NL+ I+  IP+SYS +
Sbjct  2     DTENTKLKAFLFPWLAYGHISPFLELAKKLSDRGFLIELCSTPINLSFIQKRIPKSYSST  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+EL LPE P LP HY TTNGLPLHL+  L K LK+A+P+   +LKT  PD++I+DV+
Sbjct  62    IQLVELILPEFPQLPSHYHTTNGLPLHLNSILHKALKLAKPNLFTILKTRKPDIIIYDVM  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
              LW   +A  LNIPS +FFT+ AAMCSYF H+  N   EYPFPAL L  YE  + R+L++
Sbjct  122   QLWTFGIASLLNIPSAQFFTSGAAMCSYFVHLYKNLDVEYPFPALHLLDYEIERARKLVH  181

Query  652   ---QETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-P  819
                +E  N   +   + P  + +ML+++ RE+EGKY+DYL+E+++++++ IGT  Q P  
Sbjct  182   KNEKENENKDDQPEEEMPPQEGIMLISTCRELEGKYMDYLAEIIETRILPIGTLVQDPLA  241

Query  820   PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
               +    +  WL  K   STVFVSFGSEYFL KE+ EEIA GLE+S VNFIWV+RFPKGE
Sbjct  242   SGEGNMNIMQWLDSKKELSTVFVSFGSEYFLTKEEREEIALGLELSQVNFIWVVRFPKGE  301

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             + ++EEALP+GFLER+G+RG +VE WAPQAKIL H S GGFVSHCGWNSI ES+  GVPI
Sbjct  302   KQNLEEALPQGFLERVGDRGMIVE-WAPQAKILTHSSIGGFVSHCGWNSISESIEFGVPI  360

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             IA+PM LDQPMNA+L+VEIG A+EV RD+ G LHRE++A+ ++    GE+ + ++  V+ 
Sbjct  361   IAIPMQLDQPMNAKLLVEIGVALEVVRDDNGSLHREDIASVIKGVTSGESSDNMRCKVRS  420

Query  1360  ISENLRLAGNREMDAVVAELEKL  1428
             + +NLR     +MDA V EL +L
Sbjct  421   LGKNLRTKSVEDMDATVEELRQL  443



>ref|XP_004238697.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=446

 Score =   506 bits (1302),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 324/441 (73%), Gaps = 3/441 (1%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             M+T   V+MFP+LAYGHI+P++ +AK LADRGFL++LCSTP NL S  N IP+ Y+ SI+
Sbjct  1     MSTTLKVLMFPFLAYGHISPYLNVAKKLADRGFLIYLCSTPINLKSTINKIPEKYADSIQ  60

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLPE P+LPPHY TTNGLP +L+  L++ LKM++P+F+++++ L PDLLI+D++  
Sbjct  61    LIELHLPELPELPPHYHTTNGLPPNLNHILRRALKMSKPNFSKIMQNLKPDLLIYDILQQ  120

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WAE VA  LNIP+V+  T+  A+ SYF ++   P  E+P+PA+ LR+ E  +  E +++ 
Sbjct  121   WAEDVATELNIPAVKLLTSGVAVFSYFFNLTKKPEVEFPYPAIYLRKIELVRWCETLSKH  180

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ---APPPVD  828
              +  +  +      N  +ML+++S+ +E KYIDY  EL   KVV +G+  Q        D
Sbjct  181   NKEGEEHDDGLAYGNMQIMLMSTSKILEAKYIDYCIELTNWKVVPVGSLVQDSITNDAAD  240

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS  1008
              + EL DWL  K  +STVFVSFGSEYFL KED+EE+A+GLE+S VNFIWV+RFPKGEE +
Sbjct  241   DDMELIDWLGTKDENSTVFVSFGSEYFLSKEDVEEVAFGLELSNVNFIWVVRFPKGEEKN  300

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             +E+ LPKGF ERIGERGR+++ +APQ +IL H STGGF+SHCGWNS MES++ GVPI+AM
Sbjct  301   LEDVLPKGFFERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSAMESIDFGVPIVAM  360

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PM LDQPMNARL+VE+G AVE+ RD+ GK++R E+A  L+  + GE GE L+  V+ IS+
Sbjct  361   PMQLDQPMNARLIVELGVAVEIVRDDDGKIYRGEIAETLKGVITGEIGEILRAKVRDISK  420

Query  1369  NLRLAGNREMDAVVAELEKLC  1431
             NL+   + EMD    EL +LC
Sbjct  421   NLKAIKDEEMDVAAQELIQLC  441



>ref|XP_009793442.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=456

 Score =   504 bits (1299),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 247/459 (54%), Positives = 329/459 (72%), Gaps = 29/459 (6%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M TE    R  V+MFPWLA+GHI+P++ +AK LA RGF V+LCSTP NLN IK  IPQ Y
Sbjct  1     MDTEHSTLR--VLMFPWLAHGHISPYLTVAKKLACRGFYVYLCSTPVNLNFIKKKIPQKY  58

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI+L+E HLP+ P+LP  Y TTNG+P HL   LKK +KM++P+F ++++ L P++LI+
Sbjct  59    SISIQLVEFHLPDLPELPLSYHTTNGIPPHLVSTLKKAVKMSKPNFYKIIENLKPNMLIY  118

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D++  WA++VA S NIP+V   T  AAM SY  H +  PG E+PFPAL LR+ E+ +  E
Sbjct  119   DILQPWAKEVANSYNIPAVMLLTFCAAMLSYRLHPVKKPGTEFPFPALYLRKIERQQREE  178

Query  643   LMNQETRN--------FKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG  798
             ++ +  +         F  EET++      ++L+++SR  E KYIDY +EL++ K++ +G
Sbjct  179   MLEKAAKEKDPDDKDPFAEEETMN-----KIILMSTSRATEAKYIDYFTELIQWKIIPVG  233

Query  799   TTFQAPPPVDHET--------ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEI  954
                   PPV   T        +L DWL  K  +STVFVSFGS+YFL KEDLEEIA GLE+
Sbjct  234   ------PPVQETTNEYDGDVDDLIDWLGNKYENSTVFVSFGSQYFLSKEDLEEIALGLEL  287

Query  955   SGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHC  1134
             S VNFIWV+RFPKGEE+ VEEALP+GFLERIG+RGR+V+GWAPQ +IL H STGGFVSHC
Sbjct  288   SNVNFIWVVRFPKGEEVRVEEALPEGFLERIGDRGRVVDGWAPQLRILSHPSTGGFVSHC  347

Query  1135  GWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRET  1314
             GWNS+MES++  VPIIA+PMHLDQP+NARL+VE+G AVE+ RD++GK+HR E+A  ++  
Sbjct  348   GWNSVMESIDFRVPIIALPMHLDQPINARLIVELGVAVEIVRDDEGKVHRGEVAEIVKSI  407

Query  1315  VGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             +  + GE L+  V+ ISENL+     EMDA + EL +LC
Sbjct  408   ICEKTGENLRNKVREISENLKKEREEEMDAAIGELVQLC  446



>ref|XP_006361192.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=436

 Score =   496 bits (1276),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 323/439 (74%), Gaps = 11/439 (3%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MAT R V+MFPWLAYGHI+PF+ +AK LADRGFL++LCSTP NL S    IP+ Y+ SI+
Sbjct  1     MATLR-VLMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIKKIPEKYADSIQ  59

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLPE P+LPPHY TTNG P HL++ L K L+M++P+F+++L+ L PDL+I+D++  
Sbjct  60    LIELHLPELPELPPHYHTTNGFPPHLNNTLHKALEMSKPNFSKILQNLKPDLVIYDMLQQ  119

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WAE VA   NIP+V+  T  AA+ SY  +++  P A +PFPA+ L + EQ K        
Sbjct  120   WAEHVANEQNIPAVKLITFGAAVFSYLFYLVKKPEAVFPFPAINLSKIEQEKMY------  173

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-HE  834
              ++F+ +  +D   N  +ML+++SR +E KYID+ +EL+  KVV +G   Q P   +  +
Sbjct  174   AKDFE-DRLVD--GNIQIMLISTSRTIEAKYIDHCTELINWKVVPVGPPVQDPITNNADD  230

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              EL DWL  K  +STVFVSFGSEYFL KED+EE+A+GLE+S VNFIWV RFPKGE+ ++E
Sbjct  231   KELMDWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGEDQNLE  290

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ GVPIIAMP+
Sbjct  291   DALPKGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDFGVPIIAMPI  350

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
               DQP NARL+VE+G AVE+ RD+ GK+HR E+A  L++ + G+ GE L+  V+ IS+NL
Sbjct  351   QYDQPSNARLIVELGVAVEIVRDDDGKIHRGEIAETLKDVITGKTGENLRGKVRDISKNL  410

Query  1375  RLAGNREMDAVVAELEKLC  1431
             +     EMD     L +LC
Sbjct  411   KSIRGEEMDTAAEVLIQLC  429



>ref|XP_009593727.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=482

 Score =   497 bits (1280),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 254/460 (55%), Positives = 331/460 (72%), Gaps = 29/460 (6%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M TE    R  V+MFPWLAYGHI+P++ +AK LA RGF V+LCSTP NLN IK  IPQ Y
Sbjct  25    MDTEQSILR--VLMFPWLAYGHISPYLTVAKKLACRGFYVYLCSTPVNLNFIKKKIPQKY  82

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI+L+E HLP+ P+LPP Y TTNG+P HL+  LKK LKM++P+F ++++ L P++LI+
Sbjct  83    SFSIQLVEFHLPDLPELPPSYHTTNGIPPHLNYTLKKALKMSKPNFYKIIENLKPNMLIY  142

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D++  WA++VA S NIP+V   T SAAM SY  H +  PG E+PFPAL LR+ E+ +  E
Sbjct  143   DILQPWAKEVANSYNIPAVMLLTFSAAMLSYIFHPVKKPGTEFPFPALYLREIERQRREE  202

Query  643   LMNQETRN--------FKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG  798
             +M +  +         F  EE    P N+ ++L+++SR  E KYIDY +EL++ K+  +G
Sbjct  203   MMEKAAKEKDPDDKDPFAEEEE---PMNK-IILISTSRATEAKYIDYFTELIQWKIAPVG  258

Query  799   TTFQAPPPVDHETE---------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLE  951
                   PPV   T          L DWL +K  +STVFVSFGS+YFL KEDLEEIA GLE
Sbjct  259   ------PPVQETTNEYDGDLDDDLIDWLGKKYENSTVFVSFGSQYFLSKEDLEEIALGLE  312

Query  952   ISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSH  1131
             +S VNFIWV+RFPKGEE+ VEEALP+GFLERIG+RGR+V GWAPQ +IL H STGGFVSH
Sbjct  313   LSNVNFIWVVRFPKGEEVRVEEALPEGFLERIGDRGRVVNGWAPQLRILSHPSTGGFVSH  372

Query  1132  CGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRE  1311
             CGWNS+MES++ GVPIIA+PMHLDQP+NARL+VE+G A+E+ RD++GK+HR E+A  ++ 
Sbjct  373   CGWNSVMESIDFGVPIIALPMHLDQPINARLIVELGVAMEIVRDDEGKVHRGEVAQVVKS  432

Query  1312  TVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
              +  + GE L+  V+ ISENL+     EMDA V EL +LC
Sbjct  433   VICEKTGENLRNKVREISENLKKKREEEMDAAVGELVQLC  472



>ref|XP_004250484.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=436

 Score =   492 bits (1266),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 319/441 (72%), Gaps = 11/441 (2%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MAT + V+MFPWLAYGHI+PF+ +AK LADRGFL++LCSTP NL S    IP+ Y+ SI 
Sbjct  1     MATLK-VLMFPWLAYGHISPFLNVAKKLADRGFLIYLCSTPINLKSTIEKIPEKYADSIH  59

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLPE P+LPPHY TTNGLPLHL+  L K L+M++P+F ++L+ L PDL+I+D++  
Sbjct  60    LIELHLPELPELPPHYHTTNGLPLHLNHTLHKALEMSKPNFAKILQNLKPDLVIYDMLQQ  119

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WAE VA   NIP+V+  T  AA+ SY  +++  P A +PFPA+ L + EQ K        
Sbjct  120   WAEHVASEQNIPAVKLITFGAAVFSYLFYLVKKPEAVFPFPAINLSKNEQEKMYA-----  174

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-HE  834
               N   +  +D   N  +ML+++SR +E KYID+ +EL+  KVV +G   Q P   +  +
Sbjct  175   --NDFEDRLVD--GNIQIMLISTSRTIEAKYIDHCTELINWKVVPVGPPVQDPITNNADD  230

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              EL  WL  K  +STVFVSFGSEYFL KED+EE+A+GLE+S VNFIWV RFPKGE+ ++E
Sbjct  231   KELMQWLGTKDVNSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGEDQNLE  290

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALPKGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ GVPIIAMPM
Sbjct  291   DALPKGFLERIGERGRVLDKFAPQPRILNHLSTGGFISHCGWNSVMESVDFGVPIIAMPM  350

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
               DQP NARL+VE+G AVE+ RD+ GK+HR E+A  L++ + G+ G+ L+  V+ +S+ L
Sbjct  351   QYDQPSNARLIVELGVAVEIVRDDDGKIHRGEIAETLKDVIIGKKGKILRGKVRDLSKKL  410

Query  1375  RLAGNREMDAVVAELEKLCNK  1437
             +     EMDA    L +LC K
Sbjct  411   KSIRGEEMDAAAEVLIQLCKK  431



>ref|XP_006367682.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=447

 Score =   489 bits (1260),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/435 (54%), Positives = 320/435 (74%), Gaps = 10/435 (2%)
 Frame = +1

Query  130   RSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             + V+MFPWLAYGHI+PF+ +AK LADRGFL++LCSTP NL S    IP+ Y+ SI+L+EL
Sbjct  15    KMVLMFPWLAYGHISPFLNIAKKLADRGFLIYLCSTPINLKSTIKKIPEKYADSIQLIEL  74

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLPE P+LPPHY TTNGLP HL+  L K L+M++P+F+++L+ L PDL+I+D++  WAE 
Sbjct  75    HLPELPELPPHYHTTNGLPPHLNHTLHKALEMSKPNFSKILQNLKPDLVIYDMLQQWAEH  134

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             VA   NIP+V+  T  AA+ SY  +++  P A +PFPA+ L + EQ K         ++F
Sbjct  135   VANEQNIPAVKLITFGAAVFSYLFYLVKKPEAVFPFPAINLSKIEQEKMF------AKDF  188

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-HETELT  846
             + +  +D   N  +ML+++SR +E KYID+ +EL+  KVV +G   Q P   +  + EL 
Sbjct  189   E-DRLVD--GNIQIMLMSTSRTIEAKYIDHCTELINWKVVPVGPPVQDPIINNADDKELM  245

Query  847   DWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALP  1026
             +WL  K  +STVFVSFGSEYFL KED+EE+A+GLE+S VNFIWV RFPKGE+ ++E+ALP
Sbjct  246   NWLGTKDENSTVFVSFGSEYFLSKEDMEEVAFGLELSNVNFIWVARFPKGEDQNLEDALP  305

Query  1027  KGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQ  1206
             KGFLERIGERGR+++ +APQ +IL H STGGF+SHCGWNS+MES++ GVPIIAMP+  DQ
Sbjct  306   KGFLERIGERGRVLDKFAPQPRILNHPSTGGFISHCGWNSVMESVDFGVPIIAMPIQYDQ  365

Query  1207  PMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAG  1386
             P NARL+VE+G AVE+ RD+ GK+HR E+A  L++ + G+ GE L+  V+ IS+NL+   
Sbjct  366   PSNARLIVELGVAVEIVRDDDGKIHRGEIAETLKDVITGKTGENLRGKVRDISKNLKSIR  425

Query  1387  NREMDAVVAELEKLC  1431
               EMD     L +LC
Sbjct  426   GEEMDTAAEVLIQLC  440



>ref|XP_011084223.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=444

 Score =   488 bits (1256),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 318/446 (71%), Gaps = 5/446 (1%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             MG++    +  V+MFPWLA+GHITPF+ LAK L+DR F  ++CSTP NL SI N IPQ Y
Sbjct  1     MGSDKECLK--VLMFPWLAHGHITPFLELAKRLSDRNFHCYICSTPANLTSIANKIPQKY  58

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI LL LHLP SP LPPHY TTNGLPLHLH AL+  L+ A+PDF+ +L TL P LLIH
Sbjct  59    SNSIHLLHLHLPSSPHLPPHYHTTNGLPLHLHSALRSALRAAKPDFSNILTTLQPHLLIH  118

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D++  WA  +A   +IPSV FFT+ AAM SYF H+    G E+P+PA+RL ++E +    
Sbjct  119   DILLRWAGAIASKKDIPSVTFFTSGAAMFSYFCHLGQRRGVEFPYPAIRLTEFELSMAIG  178

Query  643   LMNQETRNFKREETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
              + + ++N +++   +   N    ++VNSSRE++GKY+DYLSE++  + V +G+  +   
Sbjct  179   AL-ESSKNEEKDPDEEAGWNSGRTIIVNSSREIDGKYMDYLSEMLNREFVPVGSLVRDYD  237

Query  820   PVDH-ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
               D  E  L DWL++K   S VFVSFG+EYFL++E++EE+AYGLE+S VNFIW+LRFPKG
Sbjct  238   DDDADEAVLMDWLSQKDKFSCVFVSFGTEYFLKREEIEEVAYGLELSNVNFIWILRFPKG  297

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             +  +V E LP GFLER+G RGR+VE WA QAKIL H S GGFVSHCGWNS+ ES+  GVP
Sbjct  298   DGTTVAETLPAGFLERVGGRGRIVEKWASQAKILNHSSVGGFVSHCGWNSLTESIEFGVP  357

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQPMNA+L+ E+G  VEV+RD +G+L REE+A  +R+ V GE+G +L+R V 
Sbjct  358   IIAMPMHLDQPMNAKLVAELGVGVEVKRDNEGRLQREEIAKVIRDVVVGESGGELRRQVV  417

Query  1357  RISENLRLAGNREMDAVVAELEKLCN  1434
                E +R     EMD    +L ++C 
Sbjct  418   ERRERIRSRSREEMDETAHKLAQICG  443



>ref|XP_011084222.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
isoform X1 [Sesamum indicum]
Length=444

 Score =   487 bits (1253),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 318/446 (71%), Gaps = 5/446 (1%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             MG++    +  V+MFPWLA+GHITPF+ LAK L+DR F  ++CSTP NL SI N IPQ Y
Sbjct  1     MGSDKECLK--VLMFPWLAHGHITPFLELAKRLSDRNFHCYICSTPANLTSIANKIPQKY  58

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI LL LHLP SP LPPHY TTNGLPLHLH AL+  L+ A+PDF+ +L TL P LLIH
Sbjct  59    SNSIHLLHLHLPSSPHLPPHYHTTNGLPLHLHSALRSALRAAKPDFSNILTTLQPHLLIH  118

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D++  WA  +A   +IPSV FFT+ AAM SYF H+    G E+P+PA+RL ++E +    
Sbjct  119   DILLRWAGAIASKKDIPSVTFFTSGAAMFSYFCHLGQRRGVEFPYPAIRLTEFELSMAIG  178

Query  643   LMNQETRNFKREETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
              + + ++N +++   +   N    ++VNSSRE++GKY+DYLSE++  + V +G+  +   
Sbjct  179   AL-ESSKNEEKDPDEEAGWNSGRTIIVNSSREIDGKYMDYLSEMLNREFVPVGSLVRDYD  237

Query  820   PVDH-ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
               D  E  L DWL++K   S VFVSFG+EYFL++E++EE+AYGLE+S VNFIW+LRFPKG
Sbjct  238   DDDADEAVLMDWLSQKDKFSCVFVSFGTEYFLKREEIEEVAYGLELSNVNFIWILRFPKG  297

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             +  +V E LP GFLER+G RGR+VE WA QAKIL H S GGFVSHCGWNS+ ES+  GVP
Sbjct  298   DGTTVAETLPAGFLERVGGRGRIVEKWASQAKILNHSSVGGFVSHCGWNSLTESIEFGVP  357

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQPMNA+L+ E+G  VEV+RD +G+L REE+A  +R+ V G++G +L+R V 
Sbjct  358   IIAMPMHLDQPMNAKLVAELGVGVEVKRDNEGRLQREEIAKVIRDVVVGKSGGELRRQVV  417

Query  1357  RISENLRLAGNREMDAVVAELEKLCN  1434
                E +R     EMD    +L ++C 
Sbjct  418   ERRERIRSRSREEMDETAHKLAQICG  443



>ref|XP_006361439.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=449

 Score =   487 bits (1253),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 316/444 (71%), Gaps = 15/444 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             S++M PWLA+GHI+PF+ LAK L +R F ++LCSTP NL+SIK N+ + Y +SI L+ELH
Sbjct  9     SILMLPWLAHGHISPFLELAKKLTNRNFHIYLCSTPINLSSIKKNVTKKYCESIELVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TTNGLP HL + LKK  + A P+F+++L+TLNPDL+I+D    WA + 
Sbjct  69    LPSLPNLPPHYHTTNGLPPHLMNTLKKAFENASPNFSKILQTLNPDLVIYDFNQPWAAEF  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTH--MLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
             A S+NIP+++F T SAA+ +      M    G ++PFP + LR++E  + ++ + +    
Sbjct  129   ASSMNIPAIQFLTFSAAIVALLALHIMFDKSGEKFPFPEIYLREHEMLQIKKSLEE----  184

Query  667   FKREETLDTPANQAM------MLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
               ++E    P N A+      +LV +SR+ EGKYIDYLS+L+  K+V +G+  Q     D
Sbjct  185   -SKDENYKDPFNDALRLSRDIVLVKTSRDFEGKYIDYLSKLVSKKIVPVGSLVQDSIDQD  243

Query  829   HETE--LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE  1002
             H+ E  +  WL +K   S+VFVSFGSEYFL KE++ E+A GLE S VNFIWV+RFP+GE+
Sbjct  244   HDHEEIIMQWLDKKEKCSSVFVSFGSEYFLSKEEMHEVAQGLEFSKVNFIWVIRFPQGEK  303

Query  1003  ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
              S+++ LP+GFLER+GERG ++E WAPQA IL HRSTGGFVSHCGW+S+MES+  GVPII
Sbjct  304   NSIQDVLPQGFLERVGERGMVLEKWAPQAAILQHRSTGGFVSHCGWSSVMESMKFGVPII  363

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             AMPMH+DQPMNAR++  IG  VE  RDE GKL  EE+A  +RE V  E+GE +++  K +
Sbjct  364   AMPMHIDQPMNARIVEYIGMGVEALRDENGKLQSEEIAKVMREVVIEESGEGVRKKTKEL  423

Query  1363  SENLRLAGNREMDAVVAELEKLCN  1434
             SE + + G+ E+D VV EL  LCN
Sbjct  424   SEKMNMKGDEEIDGVVEELVALCN  447



>ref|XP_009604940.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   479 bits (1234),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 229/435 (53%), Positives = 304/435 (70%), Gaps = 3/435 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI+PF+ LA  +A+R   +++CSTP NLNS+K  +   YS+SI L+ELH
Sbjct  9     SVLMLPWLAHGHISPFLELATKVANRNLHIYMCSTPVNLNSVKKRVAGMYSRSIELVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TT GLP HL   L K  +M+ P F+++L+TLNPDL+I+D    WA   
Sbjct  69    LPSFPDLPPHYHTTKGLPTHLISTLNKAFEMSTPFFSKILQTLNPDLVIYDFNLPWAADC  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ-ETRNF  669
             A S+NIP+V+F T SAA+ +   HM   PG  +PFP + L +YE    ++ ++Q   + F
Sbjct  129   ASSVNIPAVQFLTFSAAVIALGIHMYDKPGEMFPFPEIYLHEYEMLIIKKALDQLPGKKF  188

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
               +E L    ++ ++LV + R++EGKY+DYLS L+  KVV +G   Q     D   E+T 
Sbjct  189   PFDEALRR--SRDIILVKTCRDIEGKYMDYLSSLVSKKVVPVGALVQESIDQDGHEEITQ  246

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K   STVFVSFGSEYFL K+ +  +A GLE+S VNFIWV+RFP+GE IS ++ALP+
Sbjct  247   WLDKKDKGSTVFVSFGSEYFLSKDKIHVVAQGLELSKVNFIWVIRFPQGERISTQDALPE  306

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFLER+GERG ++EGWAPQAKIL H S GGFVSHCGWNS+MES+  GVPIIAMPM +DQP
Sbjct  307   GFLERVGERGMILEGWAPQAKILQHSSVGGFVSHCGWNSLMESMKFGVPIIAMPMQVDQP  366

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  +E  RDE G L  EE+A  +R+ V  E GE +++N + +SE +   G+
Sbjct  367   MNARLVEYIGIGMEAMRDENGNLQSEEIAKVIRKVVVDEIGEVVRKNARELSEKMNAKGD  426

Query  1390  REMDAVVAELEKLCN  1434
              E+D VV EL  LCN
Sbjct  427   EEIDGVVEELVALCN  441



>ref|XP_002271587.2| PREDICTED: crocetin glucoside glucosyltransferase-like [Vitis 
vinifera]
Length=434

 Score =   478 bits (1231),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 304/437 (70%), Gaps = 10/437 (2%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPE  321
             MFPWLA+GHI+PF+ LAK L+ R F ++ CSTP NL+ IK  + +SYS SI+L++LHLP 
Sbjct  1     MFPWLAHGHISPFLQLAKKLSKRNFSIYFCSTPVNLDPIKGKLSESYSLSIQLVKLHLPS  60

Query  322   SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALS  501
              P+LPP Y TTNGLP HL   LK    MA P+F+ +LKTL+PDLLI+D +  WA   A S
Sbjct  61    LPELPPQYHTTNGLPPHLMPTLKMAFDMASPNFSNILKTLHPDLLIYDFLQPWAPAAASS  120

Query  502   LNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREE  681
             LNIP+V+F +  A + S+  H    PG E+PF  + L  YE  +    +          +
Sbjct  121   LNIPAVQFLSTGATLQSFLAHRHRKPGIEFPFQEIHLPDYEIGRLNRFLEPSAGRISDRD  180

Query  682   TLDTPANQAM------MLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
                  ANQ +       L+ + RE+E KY+DY+S+L K K+V++G   Q P   D  T++
Sbjct  181   R----ANQCLERSSRFSLIKTFREIEAKYLDYVSDLTKKKMVTVGPLLQDPEDEDEATDI  236

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEAL  1023
              +WL +K  +S VFVSFGSEYF+ KE++EEIA+GLE+S V+FIWV+RFP GE+I +E+AL
Sbjct  237   VEWLNKKCEASAVFVSFGSEYFVSKEEMEEIAHGLELSNVDFIWVVRFPMGEKIRLEDAL  296

Query  1024  PKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLD  1203
             P GFL R+G+RG +VEGWAPQ KILGH S GGFVSHCGW+S+ME +  GVPIIAMPMHLD
Sbjct  297   PPGFLHRLGDRGMVVEGWAPQRKILGHSSIGGFVSHCGWSSVMEGMKFGVPIIAMPMHLD  356

Query  1204  QPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLA  1383
             QP+NA+L+  +G   EV+RDE  KL REE+A  ++E VG +NGE ++R  + +SE LR  
Sbjct  357   QPINAKLVEAVGVGREVKRDENRKLEREEIAKVIKEVVGEKNGENVRRKARELSETLRKK  416

Query  1384  GNREMDAVVAELEKLCN  1434
             G+ E+D VV EL++LC+
Sbjct  417   GDEEIDVVVEELKQLCS  433



>ref|XP_006365665.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=446

 Score =   478 bits (1230),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 235/444 (53%), Positives = 308/444 (69%), Gaps = 14/444 (3%)
 Frame = +1

Query  124   TRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             T   V+MFP+LAYGHITPF  LAK L+DRGF + LCSTP NL+ IK  I Q YS SI L+
Sbjct  7     TNVRVLMFPYLAYGHITPFFELAKKLSDRGFSIDLCSTPINLSLIKKKITQKYSCSIHLV  66

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             E HLP  P+LPPHY TTNGLP+HL   L K + M++P F E+LK   P++L+HDV+  WA
Sbjct  67    EFHLPNLPELPPHYHTTNGLPIHLQSTLYKAITMSKPQFYEILKDQKPNVLVHDVMQPWA  126

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               VA SLNIPS++F   S  MC YF H    PG E+PFPAL L+ YE    RE+    TR
Sbjct  127   AGVASSLNIPSIKFCLTSITMCCYFGHFFLKPGVEFPFPALYLKDYE----REI----TR  178

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
              +  E   +   N+A+MLVNSSR ++GKY+DYLSE+ K++++  G   Q     + + E+
Sbjct  179   PYDVEVKEELGENRAIMLVNSSRAIDGKYMDYLSEIGKTEILPTGVVIQDIAINEEQMEI  238

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-ISVEEA  1020
               WL  K  +STV+VSFGSE FL KE++EE+AYGLE+S V+FIWV+RFPK E+ +S+E+ 
Sbjct  239   IKWLGNKKENSTVYVSFGSENFLTKEEMEEVAYGLELSNVHFIWVVRFPKEEQVVSLEDV  298

Query  1021  LPKGFLER-IGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
             LP+GFL+R IGE+GR++E WAPQ  IL H S G F++HCGWNS +E +  GVPIIA+PM+
Sbjct  299   LPQGFLQRNIGEKGRIIECWAPQTTILKHPSIGAFLTHCGWNSTLECIEFGVPIIALPMN  358

Query  1198  L--DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGE--NGEKLKRNVKRIS  1365
                DQP+NARL+VE G AVE+ RD  GK+HR  +A  ++    GE   GE L+R VK + 
Sbjct  359   FYSDQPLNARLIVENGVAVEMARDGNGKIHRGNVAETIKNVFFGEKNTGEDLRRKVKGLR  418

Query  1366  ENLRLAGNREMDAVVAELEKLCNK  1437
             EN++L    EMD VV  L+++C K
Sbjct  419   ENIKLLREEEMDGVVKVLKQICEK  442



>gb|EYU38052.1| hypothetical protein MIMGU_mgv1a019912mg [Erythranthe guttata]
Length=471

 Score =   478 bits (1229),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 312/462 (68%), Gaps = 19/462 (4%)
 Frame = +1

Query  103   MGTETMATRR--SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ  276
             MG++    RR   VVMFPWLA+GHITPF+ LAK L+ R F+ HL STP NL SI N IPQ
Sbjct  1     MGSDNKQDRRLKVVVMFPWLAHGHITPFLELAKALSHRHFISHLVSTPANLTSIANKIPQ  60

Query  277   SYSQSIRLLELHLPE--SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPD  450
             +YS  I L+ELHLP   SP+LPPH  TTNGLPL+LH AL+K L+ A+PDF+ L++TLNPD
Sbjct  61    AYSAFIHLVELHLPSQNSPELPPHRHTTNGLPLNLHPALRKALRAAKPDFSNLVETLNPD  120

Query  451   LLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQT  630
             LLIHD++  WA  VA +  IPS  F T+ AA  SYF+H+ +  G E+PFPA+RL   E T
Sbjct  121   LLIHDILQPWAAAVASTHKIPSAAFSTSGAAAVSYFSHLGSRRGVEFPFPAIRLTASELT  180

Query  631   KT---RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
                   E    E R +  E+      N   MLVNSSRE+EGKYIDYLSEL+   ++ IG+
Sbjct  181   MAFGDIESHRSEEREYSDEDAAAFRNNNGFMLVNSSREIEGKYIDYLSELITKTIIPIGS  240

Query  802   TFQAPPPV-----------DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGL  948
                  P +                + DWL  K   S+VFVSFGSE+FL ++++EE+A+GL
Sbjct  241   LVNQDPLIIKNDDGDGDDDVDSDVIMDWLDEKDELSSVFVSFGSEFFLNEQEIEEVAHGL  300

Query  949   EISGVNFIWVLRFPKGEEIS-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFV  1125
             E+SG NFIW++RFP G       EALP+GF+ER+G RG ++E WAPQA+IL H S GGFV
Sbjct  301   ELSGANFIWIIRFPNGAGPGRAHEALPEGFVERVGGRGMILEKWAPQARILSHSSIGGFV  360

Query  1126  SHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAAL  1305
             SHCGWNS+ E L+LGVPI+A+PMHLDQPMNA+L+VEIG  VE  R   G+L REE+A  +
Sbjct  361   SHCGWNSLKEGLDLGVPIVAVPMHLDQPMNAKLVVEIGGGVEARRGGDGRLCREEIAKVV  420

Query  1306  RETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             ++ V G  GE+L+R V    E++RL    E++ V  +L +LC
Sbjct  421   KDVVFGTIGEELRRRVGEKWESVRLRSGVEVEEVALKLAQLC  462



>ref|XP_009601673.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=459

 Score =   475 bits (1223),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 233/438 (53%), Positives = 301/438 (69%), Gaps = 4/438 (1%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+MFPWL YGHI+PF+ LAK L+ R F ++LCSTP NL+SIK N+   +S SI+ LEL+L
Sbjct  13    VLMFPWLGYGHISPFLELAKKLSQRNFTIYLCSTPINLSSIKKNLSPEFSPSIQFLELNL  72

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
                P+LPP + TTNGLP HL + LK+   +A PDFT +LKTL PDLLI+D +  WA K A
Sbjct  73    QTLPNLPPCHHTTNGLPPHLMNTLKEAFDLASPDFTLILKTLKPDLLIYDFLQPWAPKAA  132

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQT---KTRELMNQETRN  666
               L IP+V F ++SA M SY  H+  NPG ++PF ++  R YE     K    M  E   
Sbjct  133   AELKIPAVEFISSSATMTSYMLHVFNNPGIKFPFSSICYRDYEMARIEKDESSMPVEKLE  192

Query  667   FKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
               ++   D    +  ++L+ S +E+EGKY DY++ L   KVV +G   Q P   D E+EL
Sbjct  193   EDKKRVRDCFYLSSDLVLIKSFKEIEGKYSDYITNLTGKKVVPLGPLVQEPTIDDGESEL  252

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEAL  1023
               WL  K   ST+FVSFGSEYFL KEDL EIAYGLE S VNFIW +RF KGE++ +EEAL
Sbjct  253   ITWLNEKEEKSTIFVSFGSEYFLSKEDLLEIAYGLEKSKVNFIWPIRFQKGEDLELEEAL  312

Query  1024  PKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLD  1203
             PKGF  R+G RG + +GWAPQAKIL H S GGFVSHCGW+S+MES+  GVPIIAMPMH+D
Sbjct  313   PKGFFNRVGNRGNVFKGWAPQAKILEHSSIGGFVSHCGWSSVMESMKYGVPIIAMPMHID  372

Query  1204  QPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLA  1383
             QP+N+RL+ E+G AVEV RD   KLHREE+AA + + V  ++GE +++  + + E LR  
Sbjct  373   QPVNSRLVEEVGIAVEVVRDSNAKLHREEVAAIINQVVVEKDGEFVRQKARDMKEMLRSK  432

Query  1384  GNREMDAVVAELEKLCNK  1437
             G+ E++ V  ELEKLC K
Sbjct  433   GDEEIEEVAKELEKLCAK  450



>dbj|BAH80312.1| UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase [Catharanthus 
roseus]
Length=454

 Score =   475 bits (1222),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 309/458 (67%), Gaps = 20/458 (4%)
 Frame = +1

Query  103   MGTETMATRRS--VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ  276
             M TE      S  ++MFPWLA+GHI+ F+ LAK L+DRGF  ++CSTP NL+SIKN I Q
Sbjct  1     MATEQQQASISCKILMFPWLAFGHISSFLQLAKKLSDRGFYFYICSTPINLDSIKNKINQ  60

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             +YS SI+L++LHLP SP LPP   TTNGLP HL   LK  L  A PD  +++ ++ PDL+
Sbjct  61    NYSSSIQLVDLHLPNSPQLPPSLHTTNGLPPHLMSTLKNALIDANPDLCKIIASIKPDLI  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+D+   W E +A   NIP+V F T +A   +Y  HM  NPG E+PF A+ L  +EQ + 
Sbjct  121   IYDLHQPWTEALASRHNIPAVSFSTMNAVSFAYVMHMFMNPGIEFPFKAIHLSDFEQARF  180

Query  637   RELMNQETRNFKREETLDTPANQ-------AMMLVNSSREVEGKYIDYLSELMKSKVV--  789
              E    +  + K + +   P  Q       +  +V SSRE+EGKY+DYLSE++KSKV+  
Sbjct  181   LE----QLESAKNDASAKDPELQGSKGFFNSTFIVRSSREIEGKYVDYLSEILKSKVIPV  236

Query  790   ----SIGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEIS  957
                 S+    Q     D E E+  WL +K   S+VFVSFGSEYFL  +++EEIA GLE+S
Sbjct  237   CPVISLNNNDQGQGNKD-EDEIIQWLDKKSHRSSVFVSFGSEYFLNMQEIEEIAIGLELS  295

Query  958   GVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCG  1137
              VNFIWVLRFPKGE+  +EE LP+GFL+R+  +GR+V GWAPQA+ILGH S GGFVSHCG
Sbjct  296   NVNFIWVLRFPKGEDTKIEEVLPEGFLDRVKTKGRIVHGWAPQARILGHPSIGGFVSHCG  355

Query  1138  WNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV  1317
             WNS+MES+ +GVPIIAMPM+LDQP NARL+VEIG  +EV RDE GKL RE +   ++E  
Sbjct  356   WNSVMESIQIGVPIIAMPMNLDQPFNARLVVEIGVGIEVGRDENGKLKRERIGEVIKEVA  415

Query  1318  GGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
              G+ GEKL++  K + + LR    ++ D + A L++LC
Sbjct  416   IGKKGEKLRKTAKDLGQKLRDREKQDFDELAATLKQLC  453



>sp|F8WKW8.1|UGT9_GARJA RecName: Full=Beta-D-glucosyl crocetin beta-1,6-glucosyltransferase; 
AltName: Full=UDP-glucose glucosyltransferase 9; Short=GjUGT9; 
AltName: Full=UDP-glycosyltransferase 94E5 [Gardenia 
jasminoides]
 dbj|BAK55744.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=444

 Score =   473 bits (1218),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 307/442 (69%), Gaps = 14/442 (3%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPE  321
             MFPWLAYGHI+P++ LAK L DRGF +++CSTP NL  IK  I   YS +I+L+ELHLP+
Sbjct  1     MFPWLAYGHISPYLELAKRLTDRGFAIYICSTPINLGFIKKRITGKYSVTIKLVELHLPD  60

Query  322   SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALS  501
             +P+LPPHY TTNGLP HL   LK+ L  A+P+ + +LKTL PD +I+D    W   + ++
Sbjct  61    TPELPPHYHTTNGLPPHLMATLKRALNGAKPELSNILKTLKPDFVIYDATQTWTAALTVA  120

Query  502   LNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREE  681
              NIP+V+F T+S +M +YF H+   PG E+PFPA+ L  +EQ K R    Q+ R    E 
Sbjct  121   HNIPAVKFLTSSVSMLAYFCHLFMKPGIEFPFPAIYLSDFEQAKART-AAQDARADAEE-  178

Query  682   TLDTPANQ-------AMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP---PPVDH  831
               + PA +       ++ LV SSR +EGKYIDYL +LMK K++ +G   + P      D+
Sbjct  179   --NDPAAERPNRDCDSIFLVKSSRAIEGKYIDYLFDLMKLKMLPVGMLVEEPVKDDQGDN  236

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
               EL  WL  K   STV VSFG+EYFL KE++EEIA+GLE+S VNFIWV+RF  G++I  
Sbjct  237   SNELIQWLGTKSQRSTVLVSFGTEYFLTKEEMEEIAHGLELSEVNFIWVVRFAMGQKIRP  296

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             +EALP+GFLER+G+RGR+VEGWAPQ+++L H STGGF+ HCGWNS++ES+  GVP+IAMP
Sbjct  297   DEALPEGFLERVGDRGRIVEGWAPQSEVLAHPSTGGFICHCGWNSVVESIEFGVPVIAMP  356

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MHLDQP+NARL+VEIGA +EV RDE GK  R+E+A A+++ +  + GE  +  +  +   
Sbjct  357   MHLDQPLNARLVVEIGAGMEVVRDETGKFDRKEIARAIKDAMVEKTGENTRAKMLDVKGR  416

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             + L   +E+D V   L +L  +
Sbjct  417   VELKEKQELDEVAELLTQLVTE  438



>ref|XP_004243636.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=441

 Score =   473 bits (1216),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/440 (53%), Positives = 309/440 (70%), Gaps = 15/440 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             +VM P+LAYGHITPF+ LAK L++RGF +H+CS+P NL+ IK  IP+ YS SI L+ELHL
Sbjct  6     IVMLPYLAYGHITPFLELAKKLSNRGFSIHICSSPINLSFIKAKIPEKYSSSIHLVELHL  65

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P+LPPH+ TTNGLP HL   L K LKM +P   ++L  L PD  I+D++ LW+  VA
Sbjct  66    PNLPELPPHHHTTNGLPNHLKQTLFKTLKMTKPQLHQILSDLKPDFFIYDIMLLWSAVVA  125

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTK-TRELMNQETRNFK  672
              SLNIPS+RF+T +AA+ SYF H   NPG E+PFPAL +R YE  K T E+ +       
Sbjct  126   SSLNIPSLRFYTVNAAIFSYFFHFYFNPGEEFPFPALYMRDYELAKMTHEVADDAEVEVD  185

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP----PVDH-ET  837
             R++  ++      +LV+S++ ++GKY+DYL    ++KVV IGT  ++P      VD  + 
Sbjct  186   RDKVTES---DKFVLVHSTKSIDGKYMDYLCGTGQAKVVPIGT--ESPEDGVGDVDKIDI  240

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             EL  WL +K   STV+VSFGSEYFL KE++EE+AYGLE+SGV+FIWV+R+ KGE++    
Sbjct  241   ELVKWLEKKTEHSTVYVSFGSEYFLSKEEMEEVAYGLEVSGVDFIWVVRYQKGEQLE---  297

Query  1018  ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
              LP+GF ERIG+RGR++EGWAPQ +IL H S GGFV+HCGWNS +ES+  GVPIIAMPM 
Sbjct  298   -LPQGFKERIGDRGRIIEGWAPQQRILKHSSIGGFVTHCGWNSTLESIEFGVPIIAMPML  356

Query  1198  LDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLR  1377
              DQP+NARLMVE G AVEV RDEKG L R  +A  ++  +  E GE L++ +  + EN+R
Sbjct  357   YDQPLNARLMVENGVAVEVPRDEKGNLDRVNIAEKIKHVIRDETGENLRKKMNNLGENVR  416

Query  1378  LAGNREMDAVVAELEKLCNK  1437
                  EMD VV  ++ L ++
Sbjct  417   SQREEEMDGVVKVIQLLIDE  436



>ref|XP_006367679.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=443

 Score =   473 bits (1216),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/435 (52%), Positives = 305/435 (70%), Gaps = 3/435 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI PF+ LAK LA + F ++LCSTP NLNSIK  + + YSQSI L+ELH
Sbjct  9     SVLMLPWLAHGHINPFLELAKKLASKNFHIYLCSTPVNLNSIKKRVSEKYSQSIELIELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             L   PDLPPHY TTNGLP HL + LK   ++A P+F+++L+TL+PDL+IHD    W    
Sbjct  69    LLSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLHPDLVIHDYNQPWVTDS  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ-ETRNF  669
             A S+NIP+V+F T SA + +   HM  N   ++PFP + LR++E    ++ +++  ++ F
Sbjct  129   ASSMNIPAVQFPTFSATVVALAIHMSDNTEEKFPFPEIYLREHEMISLKKDIDEVPSKKF  188

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
               +E +    +  ++LV + R+ EGKYIDYLS L   K+V +G+  Q     D   E+  
Sbjct  189   PYDEAIRR--SHDIILVKTCRDFEGKYIDYLSNLTSKKIVPVGSLVQESMDQDDYEEIAQ  246

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K  SSTVFVSFGSEYFL KE++  +A GLE+S VNFIWV+RFP+GE +++ +ALP+
Sbjct  247   WLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFPQGERLNIRDALPE  306

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             G+LER+GERG ++EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  307   GYLERVGERGMIMEGWAPQALILQHPSIGGFVSHCGWSSFMESMKFGVPIIAMPMHIDQP  366

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  +DE GKL  EE+A A+RE +  E+GE +++  K +SE +    +
Sbjct  367   MNARLVEYIGVGVEAAKDEDGKLQSEEIAKAIREVLVEESGEAVRKKAKELSEKMNAKED  426

Query  1390  REMDAVVAELEKLCN  1434
              E+D V  EL  LC+
Sbjct  427   EEIDGVAEELVALCS  441



>emb|CDO99873.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   471 bits (1212),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 226/449 (50%), Positives = 305/449 (68%), Gaps = 24/449 (5%)
 Frame = +1

Query  103   MGTETMA--TRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ  276
             MGTE +A  ++  V+MFPWLAYGHI+P + LAK L DRGF +++CSTP NL  IK  I  
Sbjct  1     MGTEPVAVTSQLKVLMFPWLAYGHISPSLELAKRLTDRGFSIYICSTPINLGFIKQKIAG  60

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
              YS +I+L+ELHLP++P+LP HY TTNGLP HL   LK+ L  A+P+ + +LKTL PDL+
Sbjct  61    KYSATIKLVELHLPDTPELPSHYHTTNGLPPHLMSTLKRALNRAKPELSSILKTLKPDLV  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+DV   W   +  + NIP+V+F T++ +M +YF+H    PG E+PFPA+ L    +   
Sbjct  121   IYDVTQTWTGALTAAHNIPAVKFLTSTVSMMAYFSHSFMKPGLEFPFPAIYLDPAAERPN  180

Query  637   RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
             RE                      ++L  SSR +EGKYIDYL +L K K++ +GT  + P
Sbjct  181   REC-------------------DRIILTKSSRAIEGKYIDYLFDLTKLKMLPVGTLLEEP  221

Query  817   ---PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF  987
                   D+  EL  WL  K   STVFVSFG+EYFL +E++EEIAYGLE+S VNFIWV+RF
Sbjct  222   IKDDQGDNNDELIQWLGTKSERSTVFVSFGTEYFLTREEMEEIAYGLELSDVNFIWVVRF  281

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
             P G +   EEALP+GFLER+G+RGR+ EGWAPQAK+L H  T GFV HCGWNS++ES+  
Sbjct  282   PLGHKTRPEEALPEGFLERVGDRGRIAEGWAPQAKVLAHPGTAGFVCHCGWNSVVESIEF  341

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPIIAMP+ LDQP+NARL+VEIGA +EV RDE GK  R+E+A  +++ V  E GE ++ 
Sbjct  342   GVPIIAMPVQLDQPLNARLVVEIGAGIEVVRDENGKFDRKEIARVIKDVVAEEMGENVRG  401

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              ++ +S+ ++L   +E+D V   L +L +
Sbjct  402   KMRDVSQKIKLKEKQELDEVAELLTQLVS  430



>ref|XP_004250486.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=443

 Score =   469 bits (1207),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 226/433 (52%), Positives = 301/433 (70%), Gaps = 3/433 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI PF+ LAK LA + F ++LCST  NL SIK  + + YS+SI L+ELH
Sbjct  9     SVLMLPWLAHGHINPFLELAKKLASKNFDIYLCSTLVNLLSIKKRVGEKYSESIELIELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TTNGLP HL + LK   ++A P+F+++L+TL PDL+IHD    W    
Sbjct  69    LPSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLRPDLVIHDYNQPWVTDS  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ-ETRNF  669
             A S+NIP+V+F T SA + +   HM  N   ++PFP + LR++E    ++ +N+  ++ F
Sbjct  129   ASSMNIPAVQFPTFSATVVALSIHMSENTTEKFPFPEIYLREHEMISLKKDINEVPSKKF  188

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
               +E +    +  ++LV + R+ EGKYIDYLS L   KVV +G+  Q     D   E+  
Sbjct  189   PYDEAIRR--SHDIILVKTCRDFEGKYIDYLSNLTSKKVVPVGSLVQETMDQDDYKEIAQ  246

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K  SSTVFVSFGSEYFL KE++  +A GLE+S VNFIWV+RFP+GE +++ +ALPK
Sbjct  247   WLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFPQGERMNIRDALPK  306

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
              +LER+GERG ++EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  307   EYLERVGERGMVIEGWAPQATILQHPSIGGFVSHCGWSSFMESMKFGVPIIAMPMHIDQP  366

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  +DE GKL  EE+A A+RE V  E+GE +++ VK +SE +    +
Sbjct  367   MNARLVEYIGVGVEAAKDEDGKLQSEEIAKAIREVVAEESGEDVRKKVKEVSEKMNAKED  426

Query  1390  REMDAVVAELEKL  1428
              E+D V  EL  L
Sbjct  427   EEIDGVAEELMAL  439



>emb|CDP00191.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   469 bits (1207),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 221/434 (51%), Positives = 298/434 (69%), Gaps = 3/434 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             +V+M PWLA+GH++P++ LA  L  R F V+LCS+P  L+S+++ + + +SQSI L+ELH
Sbjct  8     NVLMLPWLAHGHVSPYLELAMKLTARNFNVYLCSSPATLSSVRSKLTEKFSQSIHLVELH  67

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP+ P+LP  Y TTNGLP HL   LK    MA+P+F  +LK+L PDLLI+D++  WA + 
Sbjct  68    LPKLPELPAEYHTTNGLPPHLMPTLKDAFDMAKPNFCNVLKSLKPDLLIYDLLQPWAPEA  127

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFP-ALRLRQYEQTKTRELMNQETRNF  669
             A + NIP+V F ++SA M S+  H   NPG +YP+   +  R YE      L  ++   +
Sbjct  128   ASAFNIPAVVFISSSATMTSFGLHFFKNPGTKYPYGNTIFYRDYESVFVENLKKRDRDTY  187

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             +    ++   +  ++L+   +E+EGKY DY S L   KVV +G   Q P   D +  +  
Sbjct  188   RVVNCMER--SSKIILIKGFKEIEGKYFDYFSCLTGKKVVPVGPLVQDPVLDDEDCRIMQ  245

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K   STVFVSFGSEYFL KED+EEIA+GLE+S V+FIWV+RFPKGE I +EE LPK
Sbjct  246   WLNKKEKGSTVFVSFGSEYFLSKEDMEEIAHGLELSNVDFIWVVRFPKGENIVIEETLPK  305

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GF ER+GERG +V GWAPQAKIL H + GGFVSHCGWNS+MES+  G+PI+AMPMHLDQP
Sbjct  306   GFFERVGERGLVVNGWAPQAKILTHPNVGGFVSHCGWNSVMESMKFGLPIVAMPMHLDQP  365

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             +NARL+ E+GA VEV RD KGKLHRE MA  + +     +GE  ++  + + E L L G+
Sbjct  366   INARLIEEVGAGVEVLRDSKGKLHRERMAETINKVTKEASGEPARKKARELQEKLELKGD  425

Query  1390  REMDAVVAELEKLC  1431
              E+D VV EL +LC
Sbjct  426   EEIDDVVKELVQLC  439



>ref|XP_009770958.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=443

 Score =   468 bits (1203),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 225/433 (52%), Positives = 304/433 (70%), Gaps = 3/433 (1%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             ++M PWLA+GHI+PF+ LAK L +R F +++ STP NL+SIK N+ + YSQSI L+ELHL
Sbjct  10    LLMVPWLAHGHISPFLELAKKLTNRNFHIYMYSTPVNLSSIKKNVTEKYSQSIELVELHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P+LPPHY TTNGLP HL + LK   +MA P F+++L+TLNPDL+I+D    W  ++A
Sbjct  70    PSLPNLPPHYHTTNGLPPHLMNTLKTAFEMAAPKFSKILETLNPDLVIYDYNQPWTAQLA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE-TRNFK  672
             LS+NIP+V+  T SAA+ +   HM  +   ++PFP + LR+YE    ++ +N+   + F 
Sbjct  130   LSMNIPAVQLLTFSAAVIALGIHMSEDKEEKFPFPEIYLREYEMLSLKKAINESPGKEFP  189

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
               E L    N  ++LV + R+ EGKY+DYLS L+  K+V +GT  Q     D   E+  W
Sbjct  190   FGEALRRSRN--IVLVKTCRDFEGKYMDYLSNLVTKKIVPVGTLVQEATDQDEHEEIMQW  247

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKG  1032
             L +K  SSTVFVSFGSEYFL  E++  +A GLE+S VNFIWV+RFP+GE IS+ + +P+ 
Sbjct  248   LDKKEKSSTVFVSFGSEYFLSNEEILAVAQGLELSKVNFIWVIRFPQGERISIADVVPEV  307

Query  1033  FLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPM  1212
             FLER+G+ G+++E WAPQA IL H STGGFVSHCGW+S MES+  GVPIIAMPMH+DQPM
Sbjct  308   FLERVGKSGKILEEWAPQANILQHPSTGGFVSHCGWSSFMESMKFGVPIIAMPMHIDQPM  367

Query  1213  NARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNR  1392
             NARL   IG  VE  RDE GKL  EE+A A+R+ V  E+GE +++  + +SE +   G+ 
Sbjct  368   NARLAEYIGLGVEAVRDENGKLQSEEIAKAIRKVVMEESGEPVRKKARELSEMMNEKGDE  427

Query  1393  EMDAVVAELEKLC  1431
             E+D VV EL  LC
Sbjct  428   EIDGVVEELVSLC  440



>ref|XP_009629528.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=445

 Score =   465 bits (1197),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/436 (50%), Positives = 312/436 (72%), Gaps = 3/436 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             S++M PWLA+GHI+PF+ LAK L  R F +++CS+P NLNSIK ++ + YS+SI L+ELH
Sbjct  9     SILMLPWLAHGHISPFLELAKRLTKRNFHIYMCSSPVNLNSIKKSVTEKYSKSIELVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPP+Y TTNGLP HL + LK   + + P+F+++L+TLNPDL+I+D +  WA   
Sbjct  69    LPSLPNLPPYYHTTNGLPPHLMNTLKTAFERSSPNFSKILQTLNPDLVIYDFIQPWAATF  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A S+NIP+V+F T SAA+ ++  HM    G ++PFP + LR+YE  + +++M +E+++ K
Sbjct  129   ASSMNIPAVQFLTFSAAVLAFAFHMFEKRGEDFPFPEIYLRKYEMVQMKKIM-EESKDDK  187

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
                      ++  +LV + +E EGKY+DY S L+  K+V +G+  Q     D+  E+T W
Sbjct  188   SPFDEALRKSRDFILVKTCKEFEGKYMDYFSSLVSKKIVPVGSLVQDSVNEDNNDEITQW  247

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG-EEISVEEALPK  1029
             L +K  SSTVFVSFGSEYFL KE++ E+A GLE+S VNFIWV+R P+G +  ++++ALPK
Sbjct  248   LDKKEKSSTVFVSFGSEYFLSKEEIHEVAQGLELSKVNFIWVIRVPQGVKNSTIQDALPK  307

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
              FLE++ +RG ++E WAPQA IL H+S GGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  308   EFLEKVEDRGMVLEKWAPQATILKHKSIGGFVSHCGWSSFMESVKFGVPIIAMPMHIDQP  367

Query  1210  MNARLMVEIGAAVEVER-DEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAG  1386
             MNA+L+  +G  +E  R D+ GKL  +E+A  +R+ V  E+GE +++ V+ +SE +   G
Sbjct  368   MNAKLVEYVGIGLEAVRDDDNGKLQSKEIAKVIRKVVVEESGEDVRKKVRELSEKMNAKG  427

Query  1387  NREMDAVVAELEKLCN  1434
             + E+D VV EL  LCN
Sbjct  428   DEEIDGVVEELVALCN  443



>ref|XP_009795814.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=451

 Score =   464 bits (1195),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 308/442 (70%), Gaps = 10/442 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLELH  312
             V+MFPWL +GHI+PF+ LAK L  R F+++LCSTP N  SIK   I ++ ++ I L+EL 
Sbjct  9     VLMFPWLGHGHISPFLELAKKLVTRNFIIYLCSTPANFTSIKQKLINENLTEKIYLVELR  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TTNGLP HL   LKK  KM+ P FT+++ T+ PDLL++D++  WA ++
Sbjct  69    LPSLPNLPPHYHTTNGLPPHLMSTLKKAFKMSNPMFTKIVNTIKPDLLLYDLLQPWAPRI  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             AL  NIP+V F T+S+ M SY  H    P +++PFP +  R YE T  R L NQ+    +
Sbjct  129   ALENNIPAVVFVTSSSVMFSYTFHTFRYPSSKFPFPFIYYRDYEIT--RMLENQDLEPIE  186

Query  673   REETLDTPA------NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-H  831
             +++  +T        +  ++L+   +E++GKY +YLS L K KV+ +G   Q P   D +
Sbjct  187   QQQKDNTSVKLCFGRSSNIVLIKGFKEIDGKYSNYLSRLTKKKVIPVGPLVQEPTSEDDN  246

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
              +++  WL +K   S+VFVSFGSEYFL KED EEIA+GLE SGVNFIWV+RFPKG ++ +
Sbjct  247   SSQILTWLNQKEKGSSVFVSFGSEYFLTKEDREEIAHGLEQSGVNFIWVVRFPKGGKLKL  306

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             E+ALP+GF +R+GERG +VE WAPQAKILG+ + GGF SHCGWNS+ME +  GVPIIAMP
Sbjct  307   EQALPEGFFKRVGERGMIVEDWAPQAKILGNPNIGGFFSHCGWNSVMEGMKFGVPIIAMP  366

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MHLDQP+NARL+ E+G  +EV RD+ G+L RE++AA +   V     E ++   K++SE 
Sbjct  367   MHLDQPLNARLVEEVGVGLEVVRDKDGRLDREQIAAMINRVVLDMRAEAVRTKAKKMSET  426

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             +R+ G+ E+D VV EL KLC +
Sbjct  427   IRVKGDEEIDVVVQELLKLCKR  448



>ref|XP_009596289.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=451

 Score =   464 bits (1194),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 307/442 (69%), Gaps = 10/442 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLELH  312
             V+MFPWL +GHI+PF+ LAK    R F+++LCSTP N  SIK   I ++ ++ I L+EL 
Sbjct  9     VLMFPWLGHGHISPFLELAKTFVTRNFIIYLCSTPANFTSIKQKLISENLTEKIYLVELR  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LP HY TTNGLP HL   LKK  KM+ P FT+++ T+ PDLL++D++  WA + 
Sbjct  69    LPSLPNLPSHYHTTNGLPPHLMSTLKKAFKMSNPMFTKIINTIKPDLLLYDLLQPWAPRD  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             AL  NIP+V F T+S+ M SY  H    P +++PFP++  R YE   TR L NQ+    +
Sbjct  129   ALENNIPAVVFVTSSSVMFSYMFHTFRYPSSKFPFPSIYYRDYE--ITRMLENQDLEPIE  186

Query  673   REETLDTPA------NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD-H  831
             +++  +T        +  ++L+   +E++GKY +YLS L K K++ +G   Q P   D +
Sbjct  187   QQQKDNTSVKLCFGRSSNIVLIKGFKEIDGKYSNYLSRLTKKKIIPVGPLVQQPTSEDDN  246

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
              +++  WL +K   S+VFVSFGSEYFL KED EEIA+GLE SGVNFIWV+RFPKG  + +
Sbjct  247   SSQILTWLNQKEKGSSVFVSFGSEYFLTKEDKEEIAHGLEQSGVNFIWVVRFPKGGNLKL  306

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             E+ALP+GF +R+G+RG +VE WAPQAKILG+ + GGFVSHCGWNS+ME +  GVPIIAMP
Sbjct  307   EQALPEGFFKRVGQRGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVMEGMKFGVPIIAMP  366

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MHLDQP+NARL+ E+G  +EV RD+ GKL RE++AA +   V    GE ++   K++SE 
Sbjct  367   MHLDQPLNARLVEEVGVGLEVVRDKDGKLEREQIAAMINRVVLDMRGEAVRAKAKKMSET  426

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             +R+ G+ E+D VV EL KLC +
Sbjct  427   IRVKGDEEIDVVVQELLKLCKR  448



>ref|XP_010658725.1| PREDICTED: crocetin glucoside glucosyltransferase-like isoform 
X1 [Vitis vinifera]
Length=450

 Score =   463 bits (1192),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 225/441 (51%), Positives = 303/441 (69%), Gaps = 3/441 (1%)
 Frame = +1

Query  124   TRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             +R  V++ PWLA+GHI+PF+ L+K L  + F ++ CS+P NL+ IK  +  +YS SI+L+
Sbjct  8     SRIKVLVLPWLAHGHISPFLELSKQLMKQKFYIYFCSSPVNLSRIKGKLTGNYSHSIQLV  67

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             ELHLP  P+LPPHY TTNGLP HL   LK  L MA P FT +LKTL+PDLLI+D +  WA
Sbjct  68    ELHLPSLPELPPHYHTTNGLPPHLMPTLKMALDMASPSFTNILKTLSPDLLIYDFIQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
                A SL IPSV+F +  AA  ++  H +  PG E+PFP + LR YE +     +     
Sbjct  128   PAAAASLGIPSVQFLSNGAAATAFMIHFVKKPGNEFPFPEIYLRDYETSGFNRFVESSAN  187

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVDHE  834
               K +E       Q+  ++L+ S +E+E ++ID+LS L    VV +G   Q      D E
Sbjct  188   ARKDKEKARQCLEQSSNVILIRSFKEIEERFIDFLSNLNAKTVVPVGPLLQDQLDEEDAE  247

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
             TE+ +WL++K  +S+VFVSFGSEYFL KE+LEE+AYGLE+S VNFIWV+RFP G++  VE
Sbjct  248   TEMVEWLSKKDPASSVFVSFGSEYFLSKEELEEVAYGLELSKVNFIWVVRFPMGDKTRVE  307

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             EALP+GFL R+G++G +VEGWAPQ KIL H S GGFVSHCGW S+MES+N GVPI+AMPM
Sbjct  308   EALPEGFLSRVGDKGMVVEGWAPQKKILRHSSIGGFVSHCGWGSVMESMNFGVPIVAMPM  367

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP NA+L+   G  +EV+RDE GKL REE+A  ++E V  + GE +++  +  SEN+
Sbjct  368   HLDQPFNAKLVEAHGVGIEVKRDENGKLQREEIAKVIKEVVVKKCGEIVRQKAREFSENM  427

Query  1375  RLAGNREMDAVVAELEKLCNK  1437
                G+ E+  VV +L +LC K
Sbjct  428   SKKGDEEIVGVVEKLVQLCGK  448



>ref|XP_004250482.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   463 bits (1192),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 222/438 (51%), Positives = 309/438 (71%), Gaps = 8/438 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             +VVM PW+A+GHI+PF+ LAK L+ R F ++LCSTP NL+SIK NI + YSQSI L+ELH
Sbjct  9     NVVMLPWIAHGHISPFLELAKKLSKRNFHIYLCSTPINLSSIKKNITKEYSQSIELVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP SP+ PPHY TTNGLP HL + L +    A P F+++L+TLNPDL+I+D+   W  ++
Sbjct  69    LPSSPNFPPHYHTTNGLPHHLKETLVEAFFSAGPAFSKILQTLNPDLVIYDLNITWVAEL  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A S+NIP+V+F T S  M   F HM + PG E+PFP + LR++E    ++L    + N  
Sbjct  129   ASSINIPAVQFLTFSIGMIVLFLHMFSKPGVEFPFPEIYLREHEVIPMQKLAKGYS-NIN  187

Query  673   REETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ-APPPVD-HETE  840
              ++T      Q+  ++LV   ++ E KY+DY S+L+  K+V IG+    +   +D H   
Sbjct  188   IKDTFMESIRQSRDIILV---KDFEVKYMDYFSQLVSKKIVPIGSLVNNSIDQIDEHALS  244

Query  841   LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEA  1020
             +T WL +K   S+VFVSFGSE+FL KE++ ++A GLE+S VNF+WV+RFP+ E+IS+++ 
Sbjct  245   ITQWLDKKEKGSSVFVSFGSEWFLSKEEIHQVAQGLELSKVNFVWVIRFPQDEKISIDDV  304

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP+GFLER+GERG +++ WAPQ+ IL H+S GGFVSHCGW SI ES+  GVPIIAMP++ 
Sbjct  305   LPQGFLERVGERGMVLDKWAPQSTILQHKSIGGFVSHCGWGSITESMKFGVPIIAMPIYN  364

Query  1201  DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRL  1380
             DQP+NAR++  IG  VE  RDE GKL  EE+A A+RE V  E+GE L++  K +SE + +
Sbjct  365   DQPINARIVEHIGVGVEALRDENGKLQSEEIAKAIREVVIEESGEGLRKKAKELSEKMEM  424

Query  1381  AGNREMDAVVAELEKLCN  1434
              G+ E+D VV EL  LCN
Sbjct  425   KGDEEIDGVVKELIALCN  442



>ref|XP_009593691.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   462 bits (1190),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 223/435 (51%), Positives = 303/435 (70%), Gaps = 4/435 (1%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+PF+ LAK L  R F +++CSTP NL+SI+ N+ + YS+SI L+E+HL
Sbjct  10    VLMVPWLAHGHISPFLELAKRLTKRNFHIYMCSTPVNLSSIQKNVTEKYSESIELVEIHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TTNGLP HL + LK   +M+ P F+++L+TLNPDL+I+D    W  ++A
Sbjct  70    PSLPDLPPHYHTTNGLPPHLMNTLKTAFEMSSPKFSKILQTLNPDLVIYDYNQPWTAQLA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE-TRNFK  672
             LS+NIP+V+  T SAA+ +   HM  +   ++PFP +  R+YE     + +N+   + F 
Sbjct  130   LSMNIPAVQLLTFSAAVIALGFHMSGDKEEKFPFPEIYQREYEMLLLMKAINESPGKEFP  189

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
               E L    ++ ++LV + R+ EGKY++YLS L+  K+V +GT  Q     D   E   W
Sbjct  190   FCEALRR--SRDIVLVKTCRDFEGKYMNYLSRLVSKKIVPVGTLVQESTDQDEHEETIQW  247

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VEEALPK  1029
             L +K  SSTVFVSFGSEYFL KE++  +A GLE+  VNFIWV+RFP+GE+ S +E+ALP 
Sbjct  248   LDKKGKSSTVFVSFGSEYFLSKEEIHAVAQGLELRKVNFIWVIRFPQGEKTSTIEDALPD  307

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFL R+GERG+++EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  308   GFLGRVGERGKIMEGWAPQATILQHASIGGFVSHCGWSSFMESVKFGVPIIAMPMHIDQP  367

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  RD  GKL  EE+A A+R+ V  E+GE +++  + + E +   G+
Sbjct  368   MNARLVEYIGMGVEAVRDVNGKLQSEEIAKAIRKVVMEESGEAVRKKARELREKMNEKGD  427

Query  1390  REMDAVVAELEKLCN  1434
              E+D VV EL  LC 
Sbjct  428   EEIDGVVEELVALCG  442



>ref|XP_004249996.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   462 bits (1190),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 307/443 (69%), Gaps = 4/443 (1%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             E    + S++M PWLA+GHI+PF+ LAK L +R F +++CSTP NL+SIK NI + Y +S
Sbjct  2     EAKKNKMSILMLPWLAHGHISPFLELAKKLTNRNFHIYMCSTPINLSSIKKNITKKYFES  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+E HLP  P+LPPHY TTNGLP HL + LK   + A P+F+++L+TLNPDL+I+D  
Sbjct  62    IELVEFHLPSLPNLPPHYHTTNGLPPHLMNTLKTAFENASPNFSKILQTLNPDLVIYDFN  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA + A S+NIP+V+F T  AA+ S   HM  +   ++PFP + L +YE    +E + 
Sbjct  122   QPWAAESASSVNIPAVQFLTFGAAVVSLAIHMFEDTEDKFPFPEIYLHEYEMLSLKEAVK  181

Query  652   QETRN-FKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ-APPPV  825
             +   N +  +E +    ++ ++LV + R+ EGKY+DYLS L+  K+V +G+  Q +    
Sbjct  182   EAPGNKYSFDEAIRL--SRDIVLVKTCRDFEGKYVDYLSNLVSKKIVPVGSLVQESIARD  239

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
             D++ E+  WL +K    TVFVSFGSEYFL KED+  +A GLE+S VNFIWV+RF +GE I
Sbjct  240   DNDEEIMQWLDKKEKGLTVFVSFGSEYFLSKEDIFVVARGLELSKVNFIWVIRFSQGERI  299

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
             S+++ALP+G+LER+GERG ++EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIA
Sbjct  300   SIQDALPEGYLERVGERGMVIEGWAPQAMILQHPSIGGFVSHCGWSSFMESMKFGVPIIA  359

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPMH+DQPMNARL+  I   VE  RDE GKL  EE+A  +R+ +  E+GE ++   K +S
Sbjct  360   MPMHIDQPMNARLVEYIRMGVEAARDENGKLQSEEIANTIRKVLVEESGEDVRNKAKELS  419

Query  1366  ENLRLAGNREMDAVVAELEKLCN  1434
               +   G+ E+D VV EL  LC+
Sbjct  420   GKMNAKGDEEIDGVVEELMALCS  442



>ref|XP_011076906.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=454

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/451 (53%), Positives = 316/451 (70%), Gaps = 13/451 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             MGTE    +  V+M PWLAYGHI+PF+ LAK L++R    +LCSTP NL+SIKN IP  Y
Sbjct  1     MGTENSCWK--VMMLPWLAYGHISPFLELAKRLSNRNIQTYLCSTPANLSSIKNKIPGKY  58

Query  283   SQSIRLLELHLPES-PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             S SI LLELHLP+  P LPPH  TTNGLP +L   L+K L  ++ DF+ ++K+L PDLLI
Sbjct  59    SSSIHLLELHLPDFLPQLPPHNHTTNGLPPNLISILRKALDSSKLDFSTIMKSLQPDLLI  118

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTKT  636
             HD +  WA  VA S NIPSV F T+ AAM S++ H L  P   EYPFPA++    E    
Sbjct  119   HDTLIEWAAGVAFSNNIPSVSFLTSGAAMFSFYYHSLMKPDVVEYPFPAIKFTGPEH---  175

Query  637   RELMNQETRNFKR---EETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF  807
              +++N    +F++   E  LD      ++L+ SS+E+EGKYIDYLS+L + K+V +G   
Sbjct  176   -DMINGNIESFRKRSQERDLDNQEATELLLIKSSKEIEGKYIDYLSQLTERKIVPVGPLV  234

Query  808   QAP-PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
              A   P D  ++L +WL +K   STVFVSFGSEYFL+ E++EEIAY LE+S VNF+WV+R
Sbjct  235   SADRGPDDENSDLMEWLGKKSEFSTVFVSFGSEYFLKTEEIEEIAYALELSDVNFVWVVR  294

Query  985   FPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLN  1164
             FP  EE  V++ALP GFLER  E+G+++E WAPQAKILGH S GGFVSHCGWNS++ES++
Sbjct  295   FPGDEEKRVQDALPGGFLERTQEKGKIMEKWAPQAKILGHPSVGGFVSHCGWNSVIESIH  354

Query  1165  LGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLK  1344
              GVPIIAMPM  DQP+NA+L+VE+G  VEV+RDE+G+  RE+++  +++ V G  GE+L+
Sbjct  355   FGVPIIAMPMQFDQPINAKLVVELGVGVEVDRDERGRFRREDISKVIKDVV-GIIGEELR  413

Query  1345  RNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
             R V    E LR  G  E+D +V E+ +LC K
Sbjct  414   RKVGEKRETLRANGEEEIDELVQEIAQLCGK  444



>ref|XP_009796593.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=458

 Score =   461 bits (1186),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 303/442 (69%), Gaps = 10/442 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLELH  312
             ++MFPWL +GHI+PF+ LAK L  R F + LCSTP N  SIK   I ++ ++ I ++EL 
Sbjct  15    ILMFPWLGHGHISPFLELAKKLITRNFTIFLCSTPANFISIKQKLINENLTEKIHVVELR  74

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TTNGLP HL   LKK    + P F+++L T+ PDLL++D++  WA K+
Sbjct  75    LPSFPDLPPHYHTTNGLPPHLMSTLKKAFAKSRPIFSQILNTVEPDLLLYDLLQPWAPKL  134

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPA-LRLRQYEQTKTRELMNQETRNF  669
             AL  NIP+V F T+SA M SY  H    P  E+PF + +  R YE T  R L NQ+    
Sbjct  135   ALEKNIPAVVFVTSSATMFSYMFHTFRYPNMEFPFSSSIYYRDYELT--RMLKNQDLEPI  192

Query  670   KREETLDTPANQA------MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH  831
             ++++   T           ++L+   +E++GKY DY+S L K K++ +G   Q P   D 
Sbjct  193   EQQQKDKTSVKLCFKRSFDIVLIKGFKEIDGKYCDYISSLTKKKIIPVGPLVQEPTSEDG  252

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
              +++  WL +K   STVFVSFGSEYFL +ED EEIA+GLE S VNFIWVLRFPKGE++ +
Sbjct  253   NSQILTWLNQKEKGSTVFVSFGSEYFLSQEDREEIAHGLEQSRVNFIWVLRFPKGEKLKL  312

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             E+ALP+GF +++GERG +VE WAPQAKILG+ + GGFVSHCGWNS+MES+ LGVPIIAMP
Sbjct  313   EQALPQGFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVMESMKLGVPIIAMP  372

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MHLDQP+N RL+ E+G  +EV RD+ GKL RE+++  +   V  + GE ++   +++SE 
Sbjct  373   MHLDQPLNTRLVEEVGVGLEVVRDKDGKLDREKISQVINFVVLDQRGESIRAKARKMSET  432

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             +R+ G+ E+D VV EL KLC +
Sbjct  433   IRVKGDEEIDEVVQELLKLCKR  454



>ref|XP_006355167.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   461 bits (1186),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/452 (50%), Positives = 298/452 (66%), Gaps = 11/452 (2%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M T   + R  + M PWLA+GHITPF+ LAK L++R F +++CST  N+NS K  I + Y
Sbjct  1     MDTRNRSIR--IAMLPWLAHGHITPFIELAKALSNRNFYIYICSTQVNINSFKQTISEKY  58

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             S SI+++E+HLP  P+LPPHY TTNGLP HL   LK  + MA P F  +L TL PDL+I+
Sbjct  59    SISIKIVEIHLPNLPNLPPHYHTTNGLPPHLMSTLKNAMDMARPSFYHILTTLKPDLVIY  118

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTR  639
             D +  W   +A SLNIPSV F T  AA  SY  H+    P +EYPFPA+ LR YE  + R
Sbjct  119   DFLQPWVPTMAASLNIPSVLFLTPGAAAGSYLFHIGKKKPVSEYPFPAIYLRDYEYERNR  178

Query  640   ELMNQETRNFKREETLDT--------PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSI  795
              +      +   +   DT          +  ++L+ S R++EGKYIDYLS +   + V +
Sbjct  179   CMFEPTEEDEGNDGFTDTQRRVNGCIDGSSQIILIKSIRQLEGKYIDYLSSVHNKRYVPV  238

Query  796   GTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIW  975
             G   ++P       E+ DWL  K   STVF SFG+EYFL KE+ EE+A GLE+S VNF+W
Sbjct  239   GPLVRSPETETEHLEIMDWLNSKERCSTVFASFGTEYFLSKEETEELALGLELSKVNFLW  298

Query  976   VLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIME  1155
             V+RFP G+ +++EEALPKGFLER+G RG++V+GWAPQ  IL H S GGFVSHCGW+S+ME
Sbjct  299   VIRFPVGQNMNLEEALPKGFLERVGNRGKVVQGWAPQLTILSHWSIGGFVSHCGWSSVME  358

Query  1156  SLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGE  1335
              L LGVPII MPMHLDQP+NA+L+V+ G   EV RD+ G + R E+A  +RE V  ++G 
Sbjct  359   GLKLGVPIIGMPMHLDQPLNAKLIVDAGVGEEVVRDKDGNVDRHEVAKVIREVVAEKSGP  418

Query  1336  KLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             +L++  +  SE ++  G RE+D VV EL  LC
Sbjct  419   RLRKKAREFSEIMKSNGEREIDEVVKELLNLC  450



>ref|XP_011094502.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   460 bits (1183),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 310/449 (69%), Gaps = 5/449 (1%)
 Frame = +1

Query  112   ETMATRRS---VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             E++AT +    V+MFPWLA+GHI+P++ LAK L  R F++HLCSTP NL+SIK+ I + +
Sbjct  2     ESLATDQKTIHVLMFPWLAHGHISPYLELAKRLTKRDFIIHLCSTPANLSSIKHKIGEKF  61

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             + SIRL+E+HLP  P+LPP Y TTNGLP  L   LK    MA+P+F  +L ++ PDLLI+
Sbjct  62    AFSIRLVEIHLPSLPNLPPCYHTTNGLPPDLMPTLKLAFDMAKPNFLRILASVKPDLLIY  121

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D +  WA   A    IP+V F T+S+ M +Y  H    P   +PF  +R R YE     +
Sbjct  122   DFLQPWAPLAASRYKIPAVEFITSSSTMTAYMFHFFMKPKVAFPFETIRYRDYELVHQAK  181

Query  643   LMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             L+  + R  +RE       +  ++L+   RE+E KY DYLS L+  K++ +G   Q P  
Sbjct  182   LLAPDDR-VRREAFEGVRRSNRIVLIKGFREIELKYSDYLSTLLGKKIMPVGPLVQNPSQ  240

Query  823   VDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE  1002
                 +E+ +WL +K   STVFVSFGSEYFL++E++EE+A+GLE+S VNFIWV+RFPKG++
Sbjct  241   EVGCSEIIEWLDKKAKCSTVFVSFGSEYFLKQEEMEELAHGLELSNVNFIWVVRFPKGKK  300

Query  1003  ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
             I+++EALP GFL+R+G+RG +VEGWAPQA+ILGH S GGFVSHCG +S+MES+  GVPII
Sbjct  301   ITLKEALPLGFLDRVGQRGMVVEGWAPQAQILGHESIGGFVSHCGCSSMMESMKFGVPII  360

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG-GENGEKLKRNVKR  1359
             AMPMHLDQP+NARL+VEIG   EV R+  G+L +EE+AA +   V  G  GE +++N + 
Sbjct  361   AMPMHLDQPLNARLVVEIGVGDEVLRNSSGRLEKEEVAAVICRVVAEGGRGEVVRKNARA  420

Query  1360  ISENLRLAGNREMDAVVAELEKLCNKPER  1446
             +SE +   G+ E+D VV EL  +C+  ++
Sbjct  421   MSEKMMAKGDEEIDEVVKELVMICSTKKK  449



>ref|XP_006352206.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=450

 Score =   459 bits (1182),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 300/434 (69%), Gaps = 4/434 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI P++ LA+ LA+R F +++CSTP  L SIK  + + YSQSI L++ H
Sbjct  19    SVLMLPWLAHGHINPYLELARKLANRNFHIYICSTPVCLRSIKKRVTEEYSQSIDLVDFH  78

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TTNGLP HL   LK   +M+ P+F+ +L+TL+PDL+I+D    WA   
Sbjct  79    LPSLPNLPPHYHTTNGLPPHLMTTLKNTFEMSTPNFSRILQTLHPDLVIYDFNLPWAADC  138

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A S+NIP+V+F T SAA+ +   HM   PG  +PFP L LR+ E    +  +      F 
Sbjct  139   ASSVNIPAVQFLTFSAAVIALGIHMYDRPGEMFPFPELYLREQEILSLKNTV--PGWKFP  196

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
              +E L    +Q ++L+ + R+ EGKY+DYL+ L+  K+V +GT  Q     D   E+  W
Sbjct  197   FDEGLRR--SQDIVLMKTCRDFEGKYMDYLASLVSKKIVPVGTLVQESTNKDDSEEIMQW  254

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKG  1032
             L +K   STVFVSFGSEYFL KE++ E+A GLE+S VNF+WV+RFP+GE I++ +ALP+G
Sbjct  255   LDKKHRGSTVFVSFGSEYFLSKEEIHEVAQGLELSKVNFVWVIRFPQGERINIRDALPEG  314

Query  1033  FLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPM  1212
             FLER+GERG ++EG APQA IL H S GGFVSHCGW+S MES+  GVPIIAMPM  DQPM
Sbjct  315   FLERVGERGIIIEGLAPQATILQHTSIGGFVSHCGWSSFMESMKCGVPIIAMPMQGDQPM  374

Query  1213  NARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNR  1392
             NA+L+  IG  +EV RDEKGKL  EE+A A+R+ V  + GE +++  K +SE +   G+ 
Sbjct  375   NAKLVEYIGMGMEVVRDEKGKLQSEEIAKAIRKVVVEKGGEAMRKKAKELSEYMNAKGDE  434

Query  1393  EMDAVVAELEKLCN  1434
             E+D VV EL  LCN
Sbjct  435   EIDGVVEELLALCN  448



>emb|CDO99874.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   460 bits (1183),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 304/442 (69%), Gaps = 11/442 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWLA+GHI+PF+ LAK L+ R F V+LCSTP  L SIK  + +++S SI+L+ELH
Sbjct  9     SVLMFPWLAHGHISPFLELAKKLSQRNFKVYLCSTPACLVSIKPKLAENFSASIQLVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P LPP Y TTNGLP HL   LK+   MA P+F ++L+T+ PDLL++D++  WA   
Sbjct  69    LPTLPGLPPEYHTTNGLPSHLMATLKQAFDMASPNFIKILETIEPDLLVYDMLQPWAPTA  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHML-TNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             A +LNIP+V F ++S  M S+  H+L  NPG ++PF  +     E     +L   +   F
Sbjct  129   ASALNIPAVEFISSSTTMTSFMLHVLKNNPGTKFPFSNIFHGDLEAILANKL--HDDVKF  186

Query  670   KREE----TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV----  825
             + +E          +  ++L+ S +E+EGKYIDYLS L   KVV +G   Q P       
Sbjct  187   RSKEINRVVQSLQLSSKIILIKSFKEIEGKYIDYLSLLSGKKVVPVGPLVQDPSSTHGNS  246

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
             D   E+ +WL +K   STVFV FG+EYFL +ED EEIA+GLE+S VNFIW +R+PKGE +
Sbjct  247   DDNLEIMEWLDKKEKKSTVFVCFGTEYFLSQEDREEIAHGLELSNVNFIWAIRYPKGENL  306

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
              +EEALPKGFL R+GERG +V+GW PQAKILGH S GGFVSHCGWNS+MES+  GVPI+A
Sbjct  307   QLEEALPKGFLARVGERGMVVDGWVPQAKILGHSSVGGFVSHCGWNSVMESMKSGVPIVA  366

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             +PMHLDQP+NARL+ E+GA VEV R++ G L RE++AA +++ +  E G+ ++   + +S
Sbjct  367   IPMHLDQPVNARLIEEVGAGVEVLREDDGTLGREKVAAVIKQVMHEEIGQLVRERARSLS  426

Query  1366  ENLRLAGNREMDAVVAELEKLC  1431
               + + G+ E+D VV EL +LC
Sbjct  427   NKIEVKGDEEIDVVVDELVQLC  448



>ref|XP_006342241.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=457

 Score =   459 bits (1182),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 300/439 (68%), Gaps = 9/439 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLELH  312
             V+MFPWL +GHI+PF  LAK L  R F + LCSTP N  SIK   I +  ++ I L++L 
Sbjct  14    VLMFPWLGHGHISPFFELAKKLVKRNFTIFLCSTPANFISIKQKLINEDLTEKIHLVDLR  73

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TTNGLP HL   LKK    A P FT+++ ++ PDLLI+D++  WA KV
Sbjct  74    LPSLPDLPPHYHTTNGLPSHLMSTLKKAFAKARPIFTQIINSIEPDLLIYDLLQPWAPKV  133

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A   NIPSV F T+SA M SY  H    P +E+PF ++  R YE    R + NQE    +
Sbjct  134   AAEKNIPSVVFVTSSATMFSYMFHTFRYPNSEFPFSSIYYRDYELA--RMVKNQELEPIE  191

Query  673   REETLDTPA------NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE  834
             +++  +T        +  ++L+   +E++G+Y DY+S L K +VV +G   Q P   D  
Sbjct  192   QQQKDNTSVKLCFKRSSNIVLIKGFKEIDGQYCDYISSLTKKRVVLVGPLVQEPTSEDGN  251

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
             +++  WL +K   ST+FVSFGSEYFL +ED EEIA+GLE S VNFIWV+RFPKGE++ +E
Sbjct  252   SQILTWLNQKSKGSTIFVSFGSEYFLSQEDREEIAHGLEKSRVNFIWVVRFPKGEKLKLE  311

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALP+GF +++GERG +VE WAPQAKILG+ + GGFVSHCGWNS+MES+ +GVPIIAMPM
Sbjct  312   QALPRGFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVMESMKIGVPIIAMPM  371

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+NARL+ E+G  +EV RD+ GKL  E+++  + + V  + GE ++   K +SE +
Sbjct  372   HLDQPLNARLVEEVGIGLEVVRDKDGKLDGEQISEIINKVVLEKEGESIREKAKIMSETI  431

Query  1375  RLAGNREMDAVVAELEKLC  1431
             R+ G+ E+D VV EL  LC
Sbjct  432   RVKGDEEIDDVVQELFNLC  450



>ref|XP_010327003.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=452

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/443 (50%), Positives = 295/443 (67%), Gaps = 12/443 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             +V+MFPWL YGHI+PF+ LAK L+ R F++ LCSTP  LN I+  +   +S SI LLEL+
Sbjct  13    NVLMFPWLGYGHISPFLELAKKLSQRNFIICLCSTPVILNCIEKKLSPEFSPSIHLLELN  72

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             L   PDLPP + TTNGLP HL + LK+   +A PDF  +LKTL PDLLI+D +  WA K 
Sbjct  73    LQNLPDLPPSHHTTNGLPPHLMNTLKEAFDLASPDFALILKTLKPDLLIYDFLQPWAPKA  132

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQ--------TKTRELM  648
             A  L IP+V F ++S+ M +Y  H    PG ++PF ++  R YE+        T + E +
Sbjct  133   AAELKIPAVEFISSSSTMTAYMLHEFNKPGIKFPFSSICYRDYEKARIEKQEATMSVEKL  192

Query  649   NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
              ++ R  +    L       ++L+ S +E+EGKY DY++ L   +VV +G   Q P   D
Sbjct  193   EEDKRRVRECFYLSC----DIVLIKSFKEIEGKYSDYITNLTGKRVVPLGPLVQEPTLED  248

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS  1008
              E+EL  WL  K   ST+FVSFGSEYFL KED  EIAYGLE S VNFIW +RF KGE + 
Sbjct  249   SESELITWLNEKEKRSTIFVSFGSEYFLSKEDFVEIAYGLENSKVNFIWPIRFQKGENLE  308

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             +EE LPKGF  R+G RG++  GWAPQAKIL H S GGFVSHCGW+S+MES+  GVPIIAM
Sbjct  309   LEETLPKGFFNRVGNRGKVFNGWAPQAKILEHSSIGGFVSHCGWSSVMESMKYGVPIIAM  368

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMH+DQP+N RL+ ++G AVEV R+  GKLHREE+AA + + V  ++GE +++  K + E
Sbjct  369   PMHIDQPINCRLVEDVGIAVEVVRNSDGKLHREEVAAIINQVVLDKDGEFVRQKAKDMKE  428

Query  1369  NLRLAGNREMDAVVAELEKLCNK  1437
              L + G+ E++ V  EL KLC K
Sbjct  429   KLCMKGDEEIEQVAKELRKLCAK  451



>ref|XP_006360518.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=437

 Score =   456 bits (1174),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 221/435 (51%), Positives = 301/435 (69%), Gaps = 9/435 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI PF+ LAK LA++  L+       NLNSIK  + + YSQSI L+ELH
Sbjct  9     SVLMLPWLAHGHINPFLELAKKLANKYNLM------VNLNSIKKRVSEKYSQSIELIELH  62

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TTNGLP HL + LK   ++A P+F+++L+TL+PDL+IHD    W    
Sbjct  63    LPSLPDLPPHYHTTNGLPPHLMNTLKTAFELASPNFSKILQTLHPDLVIHDYNQPWVTDS  122

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ-ETRNF  669
             A S+NIP+V+F T SA + +   HM  N   ++PFP + LR++E    ++ +++  ++ F
Sbjct  123   ASSMNIPAVQFPTFSATVVALAIHMSENTEEKFPFPEIYLREHEMISLKKDIDEVPSKKF  182

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
               +E +    +  ++LV + R+ EGKYIDYLS L   K+V +G+  Q     D   E+  
Sbjct  183   PYDEAISR--SHDIILVKTCRDFEGKYIDYLSNLTSKKIVPVGSLVQESMDQDDYEEIAQ  240

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K  SSTVFVSFGSEYFL KE++  +A GLE+S VNFIWV+RFP+GE +++ +ALP+
Sbjct  241   WLDKKEKSSTVFVSFGSEYFLSKEEILAVAQGLELSKVNFIWVIRFPQGERLNIRDALPE  300

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             G+LER+GERG ++EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  301   GYLERVGERGMIMEGWAPQALILQHPSIGGFVSHCGWSSFMESMKFGVPIIAMPMHIDQP  360

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  +DE GKL  EE+A A+RE +  E+GE +++  K +SE +    +
Sbjct  361   MNARLVEYIGVGVEAAKDEDGKLQSEEIAKAIREVLVEESGEAVRKKAKELSEKMNAKED  420

Query  1390  REMDAVVAELEKLCN  1434
              E+D V  EL  LC+
Sbjct  421   EEIDGVAEELMALCS  435



>ref|XP_010318090.1| PREDICTED: LOW QUALITY PROTEIN: crocetin glucoside glucosyltransferase-like 
[Solanum lycopersicum]
Length=463

 Score =   457 bits (1176),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 294/441 (67%), Gaps = 9/441 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             + M PWLA+GHITPF+ LAK L++R F +++CST  N+NS K  I + +S SI+++E+HL
Sbjct  10    IAMLPWLAHGHITPFIELAKALSNRNFYIYICSTQVNINSFKQTISEKHSISIKIVEIHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P+LPPHY TTNGLP HL   LK  + MA+P F  +L TL PDL+I+D +  W   +A
Sbjct  70    PNLPNLPPHYHTTNGLPPHLMSTLKNAMDMAQPSFYHILTTLKPDLVIYDFLQPWVPTLA  129

Query  496   LSLNIPSVRFFTASAAMCSY-FTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
              SLNIPSV F T  AA CSY F +       EYPFP++ LR YE  + R +      +  
Sbjct  130   ASLNIPSVLFLTPGAAACSYLFXYWXKKTVCEYPFPSIYLRDYEYGRNRHMFEPTEEDEG  189

Query  673   REETLDT--------PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
              +   DT          +  ++L+ S R++EGKYIDYLS +   + V +G   +AP   D
Sbjct  190   NDGFTDTQRRVNGCIDGSSQIILIKSIRQLEGKYIDYLSNIQNKRYVPVGPLVRAPETED  249

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS  1008
               +E+ +WL  K   STVF SFG+EYFL KE+ E +A GLE+S VNF+WV+RFP G+  +
Sbjct  250   EHSEIMEWLNSKTRCSTVFASFGTEYFLSKEETEVVALGLELSKVNFLWVIRFPVGQNRN  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             +EEALPKGFLER+G RG++V+GWAPQ  IL H S GGFVSHCGW+S+ME L LGVPII M
Sbjct  310   LEEALPKGFLERVGNRGKIVQGWAPQLTILSHWSIGGFVSHCGWSSVMEGLKLGVPIIGM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NA+L+V+ G   EV RD+ G +   ++A  +RE V  ++G++L++  +  SE
Sbjct  370   PMHLDQPLNAKLIVDAGVGEEVVRDKDGNIDEHQVAKVVREVVAEKSGQRLRKKAREYSE  429

Query  1369  NLRLAGNREMDAVVAELEKLC  1431
              ++  G+ E+D VV EL  LC
Sbjct  430   IMKGNGDEEIDEVVKELLNLC  450



>ref|XP_009775012.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=470

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/451 (50%), Positives = 314/451 (70%), Gaps = 5/451 (1%)
 Frame = +1

Query  109   TETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             TE   T   V+MFPWLAYGHI+PF+ LAK LAD+GFL+ +CSTP +L SI   IP+ YS 
Sbjct  18    TERRNTNLKVLMFPWLAYGHISPFLNLAKKLADKGFLIRVCSTPISLESIGKEIPEKYSA  77

Query  289   SIRLLELHLPESPDL-PPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
             SI+++ELHLP+ P L  PH  TTN LP +L   ++K LK ++P+F+++L+ L PDL+I+D
Sbjct  78    SIKIVELHLPKLPQLLAPHCHTTNDLPPNLDHIVQKALKFSKPNFSKILENLKPDLVIYD  137

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTREL  645
             ++  WAE VA   NIPS++F T  AA+ SYF + L  P  E+PFP +  ++ E  K  E 
Sbjct  138   ILLQWAEVVANEHNIPSIKFITCGAAIFSYFFNSLRKPEVEFPFPDIYPKESELVKWGE-  196

Query  646   MNQETRNFKREETLDTPANQAM--MLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
             M+ +    K  + +D  A  +M  ML+++SR +E KYIDYLSEL   KV+ +G   + P 
Sbjct  197   MSAKFAKEKDPDDVDPFAKGSMQFMLMSTSRIIEAKYIDYLSELSNWKVIPVGLPIKDPM  256

Query  820   PVD-HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
               D  + EL  WL +K  +STVFV+FGSE+ L KED+EEIA+GLE S VNFIWV+RF KG
Sbjct  257   TNDADDVELIHWLEKKDENSTVFVNFGSEHLLTKEDMEEIAFGLEFSNVNFIWVVRFSKG  316

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             EE ++EE LP+GFLERIGERG++++ W  +++IL H S GGF+S+C W+S+++ L+ GVP
Sbjct  317   EEQNLEEVLPQGFLERIGERGKVLDKWEQKSRILNHTSIGGFISYCDWSSVIKCLDFGVP  376

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             +IAMP++LDQPMN RLMVE+G AVE+ RD++ K+HREE+A  L   + G+ G  ++  VK
Sbjct  377   MIAMPIYLDQPMNTRLMVELGVAVEIVRDDESKIHREEIAQVLESVIRGKIGGNMRTKVK  436

Query  1357  RISENLRLAGNREMDAVVAELEKLCNKPERI  1449
              IS+NL+     EMD    EL +LC    +I
Sbjct  437   DISKNLKSIRGEEMDGAAEELIQLCKNSIKI  467



>dbj|BAH80313.1| UDP-glucose:flavonoid glucoside 1,6-glucosyltransferase [Catharanthus 
roseus]
Length=468

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/463 (49%), Positives = 307/463 (66%), Gaps = 19/463 (4%)
 Frame = +1

Query  103   MGTETMATRRS--VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ  276
             M TE      S  ++MFPWLA+GH++PF+ LAK L+DRGF +++CSTP NL+SIKNNI Q
Sbjct  1     MATEQQEAPNSLKILMFPWLAFGHVSPFLQLAKKLSDRGFYIYICSTPINLDSIKNNISQ  60

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             +YS SI+L+ LHLP SP LPP   TTN LP HL   LK  L  A+P+  +++ +L PDL+
Sbjct  61    NYSSSIQLVHLHLPNSPQLPPSLHTTNALPPHLMSTLKSALIEAKPELCKIMASLKPDLI  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             IHDV   W   +A   NIP+V F T +A   +Y  HM   PG+E+PF A+ L  +E+ + 
Sbjct  121   IHDVHQQWTAVLASKQNIPAVSFSTMNAVSFAYIMHMFMQPGSEFPFKAIYLSDFEKARL  180

Query  637   RELMNQE--------TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVS  792
              E +  +         ++ + E T  +  N A  +V SSRE+EGKY+DY++E  K KV+ 
Sbjct  181   WERLKSDHDQASSAKEKDPEIEGTKGSDFNSAF-IVRSSREIEGKYLDYITEFSKRKVMP  239

Query  793   IGTTFQAPPPVDHE-------TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLE  951
             +     +P   +H+        EL  WL  K   S+VFVSFGSEYFL K++ EEI+ GLE
Sbjct  240   VCLA-NSPDNNNHQEQSNKDGDELIQWLETKSERSSVFVSFGSEYFLNKQEFEEISLGLE  298

Query  952   ISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSH  1131
             +S VNFIWVLRFPKGE+  +E+ LP+G+LER+  RGR+V+GWAPQAKILGH + GGFVSH
Sbjct  299   LSNVNFIWVLRFPKGEDKKIEQVLPEGYLERVEGRGRIVQGWAPQAKILGHPNIGGFVSH  358

Query  1132  CGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRE  1311
             CGWNS+MES+ +GVPIIA+PM  DQP NARL VEIG  VEV R+E GK+ RE +A A++E
Sbjct  359   CGWNSVMESIEIGVPIIAIPMITDQPFNARLAVEIGVGVEVRREENGKVKRESVAEAIKE  418

Query  1312  TVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
              V     EKL++     S+ ++     E+D VV  L++L N P
Sbjct  419   VVVMGKVEKLRKTANDFSKKMKNREKEELDEVVGLLKQLRNGP  461



>dbj|BAO51835.1| UDP-glycosyltransferase 94P1 [Camellia sinensis]
Length=453

 Score =   456 bits (1172),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 312/444 (70%), Gaps = 4/444 (1%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             ++  ++ +V+M PWLA GHITPF+ LAK L ++ F ++ CSTP NL SIK  I   YS S
Sbjct  2     DSKKSKMNVLMLPWLAQGHITPFLELAKKLTNKNFHIYFCSTPINLISIKKRITDKYSLS  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+E+HLP  P+LPPHY TTNGLP+HL+  LK   +MA   F+ +L TL+PDL+I+DV 
Sbjct  62    IELVEIHLPSLPELPPHYHTTNGLPIHLNSTLKTAFEMASTSFSTILNTLSPDLVIYDVS  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTKTRELM  648
               WA+  ALS +IP+V+     A + S+  HM+ + G+ E+PFPA++L+ + +T+ R  +
Sbjct  122   PSWAQSTALSFDIPAVQLMITGATVVSFGQHMIKHCGSVEFPFPAIKLQGFHETQFRHFV  181

Query  649   NQETRNF--KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
                 + +  K+  +++   +   ML N+ RE+EGKYIDYL  + + KVV +G   Q    
Sbjct  182   ETVVKEYNDKQVASVNDQPSCNFMLYNTFRELEGKYIDYLPVIGEKKVVPVGPLVQGIDD  241

Query  823   VDHE-TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
              ++E +E+  WL  K   ST+FVSFGSEYF+ KE++EEIA+GLE+S VNFIWV+RFP+ E
Sbjct  242   DENEHSEIIQWLDNKGEYSTLFVSFGSEYFMSKEEIEEIAHGLELSMVNFIWVVRFPEVE  301

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             ++ +EEALPKGF++R+GERG +VEGWAPQA+IL H STGGFVSHC WNS++ESL  GVP+
Sbjct  302   KVELEEALPKGFIDRVGERGLVVEGWAPQARILTHSSTGGFVSHCEWNSVLESLKFGVPM  361

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             +A+PM  +QP+NA+L+ E+G A EV RD  G+L+REE+A  +R+ V  ++GE ++   + 
Sbjct  362   VAIPMQYEQPLNAKLVEEVGVAAEVNRDINGRLNREEIAQVIRKVVVEKSGEDIRIKARI  421

Query  1360  ISENLRLAGNREMDAVVAELEKLC  1431
               + +R+ G+ E+D  V  L +LC
Sbjct  422   FGDKIRMKGDEEIDEAVEVLLQLC  445



>ref|XP_008375610.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=457

 Score =   454 bits (1167),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 296/446 (66%), Gaps = 7/446 (2%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             + SV+M PWLA+GHI+PF+ L+K L  RG F +  CSTP NLNSIK  +PQ YS  I L+
Sbjct  8     KTSVLMLPWLAHGHISPFLELSKKLTSRGNFHIFFCSTPVNLNSIKPKLPQKYSHCIELV  67

Query  304   ELHLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             ELHLP  E P+LPPHY TTNGLP HL   LKK   MA  +F+ +LKTL PDLLI+D +  
Sbjct  68    ELHLPYXELPELPPHYHTTNGLPPHLMPTLKKAFDMASXNFSNILKTLKPDLLIYDFLQP  127

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTRELMNQ  654
             WA   ALS NIP+V+F+ + AAM S+  H     P A +PFP++ LR YE  K   L   
Sbjct  128   WAPXRALSKNIPAVQFYPSCAAMASFGBHRRCKXPSARFPFPSIYLRDYELMKFNNLGKS  187

Query  655   ETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
              +      E +     Q+  ++L+ +SRE+E KYIDYL  L+   +V +G+  Q P   +
Sbjct  188   PSNGLSDGERVQKCTEQSCKIILIKTSREIEAKYIDYLCGLLGKVIVPVGSLVQEPLDGE  247

Query  829   -HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
               ETE+  WL  +  SS VFVSFG+EYFL K +++EIA GLE+S V FIWV+RFP GE  
Sbjct  248   GEETEIIKWLNTRERSSVVFVSFGTEYFLSKXEIQEIALGLELSNVCFIWVIRFPVGETT  307

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
              +EE LP+GF+ER+GERG +VEGWAPQAKIL H S GGFVSHCGW+S+MES+   VPIIA
Sbjct  308   KIEELLPEGFMERVGERGMVVEGWAPQAKILQHSSIGGFVSHCGWSSVMESIKFCVPIIA  367

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             +PMHLDQP+NARL+ E+G  +EV R   G L REE+A  + E +  + G+ L      +S
Sbjct  368   IPMHLDQPLNARLVEEVGVGLEVRRTGSGSLEREEVAKVITEVLVEKIGQILXGKAMELS  427

Query  1366  ENLRLAGNREMDAVVAELEKLCNKPE  1443
             EN++   + E D VV EL +LC   E
Sbjct  428   ENMKNKEDEEXDGVVEELRQLCRTRE  453



>ref|XP_009775013.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score =   451 bits (1161),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 303/435 (70%), Gaps = 2/435 (0%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             S++M PWLA+GHI+PF+ LAK L  R F +++CSTP NLNSIK ++ + YSQSI L+ELH
Sbjct  9     SILMLPWLAHGHISPFLELAKRLTKRNFHIYMCSTPVNLNSIKKSVTEKYSQSIELVELH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPP+Y TTNGLP HL + LK   +M+ P+F++       DL+I+D +  WA   
Sbjct  69    LPSLPNLPPYYHTTNGLPPHLMNTLKIAFEMSSPNFSKXXXXXXXDLVIYDFIQPWAATF  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A S+NIP+V+F T SA + ++  HM   PG ++PFP + LR+YE  + ++ M +E++  K
Sbjct  129   ASSVNIPAVQFLTFSAGVLAFAFHMFEKPGEDFPFPEIYLREYEMLQMKKTM-EESKEDK  187

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
                      ++  +LV + +E EGKY+ Y S L+  K+V +G+  Q     D   E+T W
Sbjct  188   SPFDEALRKSRDFILVKTCKEFEGKYMGYFSSLVSKKIVPVGSLIQDTVSRDDNEEITQW  247

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVEEALPK  1029
             L +K  +S VFVSFGSEYFL KE+L E+A GLE+S VNFIWV+ FP+GE   S++++LPK
Sbjct  248   LDKKEKNSGVFVSFGSEYFLSKEELHEVAQGLELSKVNFIWVISFPQGENNSSIKDSLPK  307

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFL+R+ +RG ++EGWAPQA IL H S GGFVSHCGW+S MES+N GVPIIAMPMHLDQP
Sbjct  308   GFLQRVEDRGMVLEGWAPQATILKHISIGGFVSHCGWSSFMESVNFGVPIIAMPMHLDQP  367

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  RD+ GKL  EE+A  +R+ V  E+GE +++ V+ + E + + G+
Sbjct  368   MNARLVEYIGFGVEAVRDDNGKLQSEEIAKVIRKVVMEESGEDVRKKVRELREKMNMKGD  427

Query  1390  REMDAVVAELEKLCN  1434
              E+D VV EL  LCN
Sbjct  428   EEIDEVVEELVALCN  442



>ref|XP_009768067.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=459

 Score =   451 bits (1159),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 220/451 (49%), Positives = 298/451 (66%), Gaps = 8/451 (2%)
 Frame = +1

Query  118   MATRRS---VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             M TR+    + M PWLA+GHI PF+ LAK L+ R F +++CSTP N+NS K  I +  S 
Sbjct  1     MDTRQRSIRIAMLPWLAHGHICPFIELAKALSKRNFYIYICSTPVNINSFKQTISEKDSI  60

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+++ELHLP  P+LPPHY TTNGLP HL   LK  L MA+P F  +L TL PDL+++D 
Sbjct  61    SIKIVELHLPNLPELPPHYHTTNGLPPHLMSTLKNALDMAKPSFFHILSTLKPDLVMYDF  120

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTREL  645
             +  W   +A S NIPSV F T  AA   Y  H+    P +EYPF A+ LR +E  + R++
Sbjct  121   LQPWVPTMAASQNIPSVLFLTPGAAASCYLFHIGRKKPVSEYPFSAIYLRDHEYDRNRDM  180

Query  646   M----NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
                  +    + +R        +  ++L+ + RE+EGKY+D+LS L + + V +G   + 
Sbjct  181   FEPTEDDGYTDTQRRVNGCIDGSSEIILIKTIRELEGKYMDFLSTLCEKRYVPVGPLVRE  240

Query  814   PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
             P      +E+  WL  K   STV  SFGSEYFL KE++EE+AYGLE+S VNF+WV+RFP 
Sbjct  241   PETEHEHSEVMKWLNSKQRCSTVLASFGSEYFLSKEEMEELAYGLELSNVNFLWVVRFPV  300

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             G  IS+EEALPKGFL+RIG RG++V+GWAPQ +IL H S GGFVSHCGW+S+ME L LG+
Sbjct  301   GTNISLEEALPKGFLDRIGNRGKIVQGWAPQLRILQHSSIGGFVSHCGWSSVMEGLQLGI  360

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMPMHLDQP+NA+L+V+ G   E  RD+ G L R+E+A  +R+ V  + G++L++  
Sbjct  361   PIIAMPMHLDQPLNAKLVVDAGVGEEAVRDKYGNLDRQEVAKVIRKVVAEKIGQRLRKRA  420

Query  1354  KRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             +  SE L   G +E++ VV EL KLC    R
Sbjct  421   REYSEFLESNGAKEINEVVEELLKLCRVTRR  451



>ref|XP_010032103.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=452

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 216/444 (49%), Positives = 301/444 (68%), Gaps = 2/444 (0%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             E M     V+M PWLA+GHI+PF+ LAK L+ R F +HLCSTP NL+SIK  I   YS S
Sbjct  2     ENMQRPIKVLMLPWLAHGHISPFLELAKRLSTRNFHIHLCSTPVNLSSIKPKISDKYSSS  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+ELHLP  PDLPPHY TT GLP HL + LK    MA   F++++K+L PDLLI D+ 
Sbjct  62    IELVELHLPSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASLGFSDIVKSLGPDLLICDLF  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA +VA S  +P+V FF   A   S+  HM+ N  +++PF A+R   YE  K  +  +
Sbjct  122   QPWAAEVAKSHGLPTVVFFIVGARTISFMFHMIKNASSKFPFEAIRFHDYELAKIGKAAD  181

Query  652   QETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV  825
               T   K E+ +     ++   +L+ + RE++GKY+DYLS L   KV+++G   + P  +
Sbjct  182   DSTARVKDEDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLSGKKVLTVGPLVEDPDNM  241

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
             +    + +WL ++  SST+FVSFGSEYFL +++ EEIA+GLE+S VNFIWV+RFP GE I
Sbjct  242   EDGDSIIEWLDKREQSSTIFVSFGSEYFLTEKEREEIAHGLELSNVNFIWVIRFPVGESI  301

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
              +EEALPKGFLER+ +RG +++GWAPQ KIL H S GGFVSHCGW S+MES+  GVPIIA
Sbjct  302   ELEEALPKGFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSLMESMKSGVPIIA  361

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPM  DQP+NAR++ E+G  +EV+R+E G+L R E+   +++ V  ++G+ +++  K +S
Sbjct  362   MPMLHDQPLNARMVEEVGVGLEVKRNESGELERLEIGKVIKDVVVEKDGDSVRKKTKEMS  421

Query  1366  ENLRLAGNREMDAVVAELEKLCNK  1437
             + +R  G  E+D VV  L +LC +
Sbjct  422   DIIRNKGEEELDEVVDALVQLCAR  445



>ref|XP_010321591.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=444

 Score =   449 bits (1155),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 297/445 (67%), Gaps = 17/445 (4%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
              T  SV+MFP+LAYGH TPF+ LAK L+DRGFL+  CSTP NL+ IK  IP  YS SI+L
Sbjct  4     TTNLSVLMFPYLAYGHFTPFLELAKKLSDRGFLIDFCSTPINLSYIKKKIPHKYSCSIQL  63

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +ELHL + P+LPPHY TT  LP HL   L K L M E  F ++LK   PD+L+ D++  W
Sbjct  64    VELHLQDLPELPPHYHTTKDLPFHLQTTLYKALMMEEAQFHQILKDQKPDVLVFDIMQPW  123

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQET  660
             + + A SLNIP++++  ASAA C YF ++   PG E+PF AL L+ YEQ   R +     
Sbjct  124   SVRAASSLNIPAIKYCIASAATCCYFGNLKLKPGVEFPFTALYLKDYEQEIKRHI-----  178

Query  661   RNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD--HE  834
                + EE       + +ML+N+SR ++ KY+DYLSE+ +  ++  G   Q         E
Sbjct  179   -ELQVEE-----GGENIMLLNTSRAIDAKYLDYLSEIGQGNILPTGVVIQDLEDEGDIEE  232

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-ISV  1011
             T+L  W+ +    STV+VSFGSE  + KE++EE+AYGLE+S V+FIWV+R P+GE+ + +
Sbjct  233   TQLIKWIGKNKEHSTVYVSFGSECVMTKEEMEEVAYGLEVSNVHFIWVVRIPRGEQVVRL  292

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EE LP+GFLERIGERGR+VEGW PQAKIL H S G FV+HCGWNS +ES+  GVPIIA+P
Sbjct  293   EEVLPQGFLERIGERGRIVEGWVPQAKILKHASIGAFVTHCGWNSTLESIEFGVPIIALP  352

Query  1192  MHL--DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV-GGENGEKLKRNVKRI  1362
             ++   DQP+NARL+VEIG A E+ RD  GKLHR  +A  ++E + G E GE L++ V  +
Sbjct  353   INFCSDQPINARLVVEIGIATEIARDGDGKLHRGYIAETIKEVIFGKEIGENLRKKVNSL  412

Query  1363  SENLRLAGNREMDAVVAELEKLCNK  1437
              EN+ L     MD V   +++L  K
Sbjct  413   RENVTLLREEHMDGVAKVIKQLREK  437



>ref|XP_008345567.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=464

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 307/446 (69%), Gaps = 9/446 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLAD-RGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L   R F + +CSTP NL+SIK  +PQ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTSLRDFHIFICSTPVNLSSIKPKLPQKYSHCIEFVEL  70

Query  310   HLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP  E P+LPPHY TTNGLP HL   LKK   M+  +F+++LKTL PDLLI+D +  WA
Sbjct  71    HLPHDELPELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSDILKTLKPDLLIYDFLQPWA  130

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +ALS NIP+V F T +AA+ S   H L NP A++P+ ++ LR YE  K   L+     
Sbjct  131   PSLALSHNIPAVEFITTNAALMSLSVHQLKNPNAQFPYTSIYLRDYEAKKFSNLLESSAN  190

Query  664   NFKREE--TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
               K  E   L +  ++ ++LV +S E+E KY+DYLSELM+ K+V +G+  Q P    VD 
Sbjct  191   GIKDGERVLLSSDRSRNIILVKTSGEIESKYVDYLSELMEKKIVPVGSLVQDPMDQKVDE  250

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EIS  1008
             E+ +  WL  +  SS VFVSFGSEYFL KE+++EIA+GLE+S V+FIWV+RFPK E   S
Sbjct  251   ESXIIKWLNERERSSVVFVSFGSEYFLSKEEIQEIAHGLELSQVSFIWVIRFPKEERSTS  310

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LPKGF ER+GERG ++EGWAPQ KIL H S GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  311   VEEVLPKGFGERVGERGVIMEGWAPQXKILKHSSVGGFVSHCGWSSVLESIKFGVPIIAM  370

Query  1189  PMHLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             PM LDQP+NARL+ E+G  VEV R  E G L REE+A  +R+ V  + G+ ++     + 
Sbjct  371   PMQLDQPVNARLVEEVGVGVEVIRTGEGGSLQREEVAKVIRDVVVEKIGDCVRIRALELR  430

Query  1366  ENLRLAGNREMDAVVAELEKLCNKPE  1443
             +N+++  + E+D VV EL +LC K E
Sbjct  431   DNMKMKEDEELDWVVEELXQLCTKTE  456



>ref|XP_010032098.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=453

 Score =   449 bits (1155),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 298/434 (69%), Gaps = 2/434 (0%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+P++ LAK L+ R F V+ CSTP NL+SIK  I + YS  + L+ELHL
Sbjct  10    VLMLPWLAHGHISPYLELAKRLSTRNFHVYFCSTPVNLSSIKPKISEKYSSCVELVELHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GLP HL + LK    MA P F++++K+L PDLLIHD +  WA +VA
Sbjct  70    PSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASPGFSDIVKSLGPDLLIHDFLQPWAAEVA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
              S  +PSV FF+  A   S+  HM+ N   E+PF A+RL  YEQ K  ++++  T +   
Sbjct  130   KSHGLPSVVFFSVGAGTLSFMFHMIKNTSIEFPFKAIRLHDYEQAKLTDMIDDSTGSVSN  189

Query  676   EETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             ++       ++   +L+ + RE++GKY+DYLS L+   VV +G   + P  ++    + +
Sbjct  190   KDRCLQCVERSSNFILLKTFRELDGKYMDYLSSLLGKIVVPVGPLVEVPSNIEDGDGIIE  249

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL  +  SST+FVSFG+EYFL +++ EEIAYGLE+S VNFIWV+RFP GE I +EEALP+
Sbjct  250   WLDEREESSTIFVSFGTEYFLNEKEREEIAYGLELSNVNFIWVIRFPVGESIELEEALPE  309

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GF  R+ +RG +++GWAPQ  IL H S GGFVSHCGW+SIMES+  GVPIIA+PM  DQP
Sbjct  310   GFFGRVRDRGLVIDGWAPQGMILEHPSIGGFVSHCGWSSIMESMKSGVPIIAIPMQFDQP  369

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             +NAR++ ++G  +EV+R++ G+L R E+A  +++ V  ++G+ ++R  K + +++R  G 
Sbjct  370   LNARMVKDVGVGLEVKRNKNGELERSEIAKVIKDVVVEKDGDGVRRKAKEMGDSVRNKGE  429

Query  1390  REMDAVVAELEKLC  1431
              E+D V   L +LC
Sbjct  430   GELDEVADALVQLC  443



>ref|XP_007220462.1| hypothetical protein PRUPE_ppa005532mg [Prunus persica]
 gb|EMJ21661.1| hypothetical protein PRUPE_ppa005532mg [Prunus persica]
Length=456

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 315/450 (70%), Gaps = 16/450 (4%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWLA+GHI+P++ LAK L +R F ++ CSTP NL SIK  + + YS+ I L++LH
Sbjct  10    SVLMFPWLAHGHISPYLELAKKLTNRNFHIYFCSTPVNLRSIKPQLSEKYSRCIELVQLH  69

Query  313   LP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LP  + P+LPPHY TTNGLP HL   LK     A P+F+ +LKTL+PDLLI+D +  WA 
Sbjct  70    LPYDDLPELPPHYHTTNGLPPHLMSTLKTAFDRASPNFSNILKTLHPDLLIYDFLQPWAP  129

Query  487   KVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
              +AL  NIP++ FFT SAAM S  TH    PG ++PFP++    YE +K + L+   +  
Sbjct  130   SLALLQNIPAIEFFTTSAAMMSVCTHHGEKPGVKFPFPSI---YYETSKIKMLLESSSNG  186

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ--APPPVD-H  831
                 +     ++++  ++LV SSRE+E KYIDYLS+L+  K+V +G+  Q      VD  
Sbjct  187   ISDGDRAKQCSDRSCKIVLVKSSREIEAKYIDYLSDLIGKKIVPVGSLVQDLIEQEVDSE  246

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-IS  1008
             ET++  WL  +  SS V+VSFGSEYFL KE++EEIA+GLEIS V+FIWV+RFPK E+   
Sbjct  247   ETKIMKWLNTRERSSVVYVSFGSEYFLSKEEIEEIAHGLEISKVSFIWVIRFPKEEKGTR  306

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GF ER+GE+G +V+GWAPQAK+L H S GGFVSHCGW+S++ES+  GVPI+AM
Sbjct  307   VEEVLPEGFFERVGEKGIIVDGWAPQAKVLKHSSAGGFVSHCGWSSVLESIKFGVPIVAM  366

Query  1189  PMHLDQPMNARLMVEIGAAVEVER-----DEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PMHLDQP+NAR++ ++G  VEV+R     +E G+L R+E+A  +R+ V  ENG+ LKR  
Sbjct  367   PMHLDQPINARIVEDVGVGVEVKRMGGGGNENGRLKRDEIAKVIRDVVVEENGQGLKRKA  426

Query  1354  KRISENLRLAGNREMDAVVAELEKLCNKPE  1443
               + +N++   + E+D VV +L +LC + E
Sbjct  427   MELRDNMKKREDEEIDGVVEQLIQLCMRKE  456



>ref|XP_008231982.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=456

 Score =   447 bits (1151),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 229/450 (51%), Positives = 313/450 (70%), Gaps = 16/450 (4%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWLA+GHI+P++ LAK L +R F ++ CSTP NL SIK  + + YS  I L++LH
Sbjct  10    SVLMFPWLAHGHISPYLELAKKLTNRNFHIYFCSTPVNLRSIKPKLSEKYSCCIELVQLH  69

Query  313   LP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LP  + P+LPPHY TTNGLP HL   LK    MA P+F+ +LKTLNPDLLI+D +  WA 
Sbjct  70    LPYEDLPELPPHYHTTNGLPPHLMSTLKTAFDMASPNFSNILKTLNPDLLIYDFLQPWAP  129

Query  487   KVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
              +AL  NIP++ F T SAAM S  TH    PG ++PFP++    YE +K + L+   +  
Sbjct  130   SLALLQNIPAIEFVTTSAAMMSVCTHHGEKPGVKFPFPSI---YYETSKIKMLLESSSNG  186

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ--APPPVDHE  834
                 +     ++ +  ++LV SSRE+E KYIDYLS+L+  K+V +G+  Q      VD E
Sbjct  187   ISDGDRAKQCSDHSCKIVLVKSSREIEAKYIDYLSDLIGKKIVPVGSLVQDLIEQEVDSE  246

Query  835   -TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-IS  1008
              T++  WL  +  SS V+VSFGSEYFL KE++EEIA+GLE+S V+FIWV+RFPK E+   
Sbjct  247   KTKIMKWLNTRERSSVVYVSFGSEYFLSKEEIEEIAHGLELSRVSFIWVIRFPKEEKGTR  306

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFLER+GE+G +V+GWAPQAKIL H S GGFVSHCGW+S++ES+  GVPI+AM
Sbjct  307   VEEVLPEGFLERVGEKGIIVDGWAPQAKILKHSSAGGFVSHCGWSSVLESIKFGVPIVAM  366

Query  1189  PMHLDQPMNARLMVEIGAAVEVER-----DEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PMHLDQP+NAR++ ++G  VEV+R     +E G+L REE+A  +R+ V  ENG+ LKR  
Sbjct  367   PMHLDQPINARIVEDVGVGVEVKRTGGGGNENGRLKREEIAKVIRDVVVEENGQGLKRKA  426

Query  1354  KRISENLRLAGNREMDAVVAELEKLCNKPE  1443
               + +++    + E+D VV +L +LC + E
Sbjct  427   MELRDSMTKREDEEIDGVVEQLIQLCMRKE  456



>gb|KCW51498.1| hypothetical protein EUGRSUZ_J01015, partial [Eucalyptus grandis]
Length=443

 Score =   447 bits (1149),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 210/434 (48%), Positives = 300/434 (69%), Gaps = 2/434 (0%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GH++P++ LAK L+ R F ++LCSTP NL+SIK  I + YS SI L+ELHL
Sbjct  10    VLMLPWLAHGHVSPYLELAKRLSTRNFHIYLCSTPVNLSSIKPKISEKYSSSIELVELHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GLP HL + LK    MA P F +++ +L PDLLIH+ +  WA +VA
Sbjct  70    PSLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFGDIVTSLGPDLLIHEFLQPWAAEVA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQET-RNFK  672
              S  +PSV  F   A   S+  HM+ N G ++PF A+RL  YE  K R+  +  T R  +
Sbjct  130   KSHGLPSVVLFNVGAGTISFMFHMIKNTGNKFPFEAIRLHDYELAKIRKAADDSTARVNE  189

Query  673   REETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             ++  L +    +  +L+ + RE++GKY+DYLS L+  KV+++G   + P   +    + +
Sbjct  190   KDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLLGKKVLTVGPLVEDPSNTEDGDSIIE  249

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL ++  SST+FVSFG+EYFL +++ EEIA+GLE+S VNFIWV+RF   E + ++EALPK
Sbjct  250   WLDKREKSSTIFVSFGTEYFLTEKEREEIAHGLELSNVNFIWVIRFSVEESVELKEALPK  309

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFLER+ +RG +++GWAPQ KIL H S GGFVSHCGW SIMES+  GVPIIAMPM  DQP
Sbjct  310   GFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSIMESMKSGVPIIAMPMQHDQP  369

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             +NAR++ E+G A+EV+R++ G+L R E+A  ++  V  ++G+ +++  K +S+++R  G 
Sbjct  370   LNARMVEEVGVAMEVKRNKSGELERLEIAKVIKHVVAEKDGDSVRKKTKEMSDSIRNKGE  429

Query  1390  REMDAVVAELEKLC  1431
              E+D V   L +LC
Sbjct  430   EELDEVAEALVQLC  443



>ref|XP_010034309.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=452

 Score =   447 bits (1149),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 210/434 (48%), Positives = 300/434 (69%), Gaps = 2/434 (0%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GH++P++ LAK L+ R F ++LCSTP NL+SIK  I + YS SI L+ELHL
Sbjct  10    VLMLPWLAHGHVSPYLELAKRLSTRNFHIYLCSTPVNLSSIKPKISEKYSSSIELVELHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GLP HL + LK    MA P F +++ +L PDLLIH+ +  WA +VA
Sbjct  70    PSLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFGDIVTSLGPDLLIHEFLQPWAAEVA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQET-RNFK  672
              S  +PSV  F   A   S+  HM+ N G ++PF A+RL  YE  K R+  +  T R  +
Sbjct  130   KSHGLPSVVLFNVGAGTISFMFHMIKNTGNKFPFEAIRLHDYELAKIRKAADDSTARVNE  189

Query  673   REETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             ++  L +    +  +L+ + RE++GKY+DYLS L+  KV+++G   + P   +    + +
Sbjct  190   KDRVLQSVERSSNFILLKTFREMDGKYMDYLSSLLGKKVLTVGPLVEDPSNTEDGDSIIE  249

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL ++  SST+FVSFG+EYFL +++ EEIA+GLE+S VNFIWV+RF   E + ++EALPK
Sbjct  250   WLDKREKSSTIFVSFGTEYFLTEKEREEIAHGLELSNVNFIWVIRFSVEESVELKEALPK  309

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFLER+ +RG +++GWAPQ KIL H S GGFVSHCGW SIMES+  GVPIIAMPM  DQP
Sbjct  310   GFLERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSIMESMKSGVPIIAMPMQHDQP  369

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             +NAR++ E+G A+EV+R++ G+L R E+A  ++  V  ++G+ +++  K +S+++R  G 
Sbjct  370   LNARMVEEVGVAMEVKRNKSGELERLEIAKVIKHVVAEKDGDSVRKKTKEMSDSIRNKGE  429

Query  1390  REMDAVVAELEKLC  1431
              E+D V   L +LC
Sbjct  430   EELDEVAEALVQLC  443



>ref|XP_010110161.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
 gb|EXC25399.1| Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase [Morus notabilis]
Length=465

 Score =   447 bits (1150),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 299/447 (67%), Gaps = 12/447 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS-------  291
             S++M PWLA+GH++P++ LAK LA++ F V+ CSTP NL SIK  IP  YS         
Sbjct  12    SILMLPWLAHGHVSPYLELAKRLAEKNFHVYFCSTPANLVSIKTKIPNKYSDHENHSLGI  71

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+ELHLPE PDLP HY TTNGLP HL   LKK   M+ P F ++L  L P+LLI+D +
Sbjct  72    IELVELHLPELPDLPRHYHTTNGLPPHLMPTLKKAFDMSSPSFEKILDDLEPELLIYDFL  131

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA  +A   NIP+V F + SA+M S+  H  +  G E+PFP + L+ YE +    L+ 
Sbjct  132   QPWAPTLASQRNIPAVEFLSCSASMTSFCLHWRSKRGVEFPFPTIHLKGYEVSGFNNLLE  191

Query  652   QETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF---QAP  816
                 + K ++ +   + Q+  ++LV S  +VE KYIDYLS L+  K+V +G+     +  
Sbjct  192   SSANDVKDKDRVRRCSEQSCTIVLVKSFSDVEDKYIDYLSVLLGKKIVPVGSLVDDGKDS  251

Query  817   PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
               +     +  WL  K  SS VFVSFGSEYFL K+++ EIAYGLE+SGV+FIWV+RFP G
Sbjct  252   NDLQDYNNVIKWLDSKEKSSVVFVSFGSEYFLSKDEMREIAYGLELSGVSFIWVVRFPVG  311

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             E++++EEALP GFL+R+  +G ++E WAPQ ++L  +S GGFVSHCGW+S+MES+  GVP
Sbjct  312   EKMNIEEALPNGFLKRVERKGMIIEKWAPQREVLKSKSIGGFVSHCGWSSVMESMKFGVP  371

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQP+NARL+ E+G   EVERDE G++  EE+A A+R+ V  ++GE ++    
Sbjct  372   IIAMPMHLDQPINARLVEEVGVGFEVERDENGRIQSEELAKAVRKVVLEKSGESVRNKAV  431

Query  1357  RISENLRLAGNREMDAVVAELEKLCNK  1437
              + E +R  G+ EM+ VV EL +LC K
Sbjct  432   EMGEKMRRRGDEEMEEVVKELVQLCGK  458



>ref|XP_010034308.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=435

 Score =   446 bits (1146),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 214/428 (50%), Positives = 292/428 (68%), Gaps = 2/428 (0%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPE  321
             M PWLA+GHI+PF+ L K L++R F ++LCSTP NL+SIK  I + YS SI L+ELHLP 
Sbjct  1     MLPWLAHGHISPFLELGKRLSERNFHIYLCSTPVNLSSIKPKISEKYSSSIELVELHLPS  60

Query  322   SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALS  501
              PDLPPHY TT GLP HL + LK    MA P F+ ++K LNP+L+++D +  WA ++A  
Sbjct  61    LPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFSNIIKKLNPNLIVYDFLQPWAPEIARL  120

Query  502   LNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREE  681
              N+P+V F++  A M S+F H + N G  +PF A+RL  YEQ K   L          ++
Sbjct  121   HNVPAVNFWSVGAGMVSFFFHAVQNVGEGFPFEAVRLHDYEQWKFDRLFENSAGGITDKD  180

Query  682   TLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWL  855
                  A ++   +L+ + RE+EGKY+DYLS L+  KV+ +G   Q P       ++  WL
Sbjct  181   RALQCAGRSSGFILMKTFRELEGKYLDYLSSLVGKKVIPVGPLVQDPGEEGGNDDIIKWL  240

Query  856   ARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGF  1035
               K   S+VFVS G+EYFL  ++ EEIAYGLE+S VNFIWV+RFP GE + +EEALP GF
Sbjct  241   DEKEECSSVFVSCGTEYFLTVKEREEIAYGLELSNVNFIWVIRFPIGESMELEEALPAGF  300

Query  1036  LERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMN  1215
             LER+G+RG + EGWAPQ KIL H S GGFVSHCGW+SIMES+  GVPIIAMPM LDQP+N
Sbjct  301   LERVGDRGLVREGWAPQTKILEHPSIGGFVSHCGWSSIMESMKSGVPIIAMPMQLDQPLN  360

Query  1216  ARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNRE  1395
             AR++ E+G  +EV+R++ G+L REE+A  ++  V  ++GE +++  K +S+++   G RE
Sbjct  361   ARIVEEVGVGLEVKRNKSGELEREEIAKVIKGVVVEKDGESVRKRAKEMSDSIGNEGGRE  420

Query  1396  MDAVVAEL  1419
             +D VV  L
Sbjct  421   LDEVVNAL  428



>emb|CDP13368.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   445 bits (1144),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 292/441 (66%), Gaps = 35/441 (8%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             E   T  S++M PWLA+GH++P++ LAK L  R F ++LCSTP NL+SI++ I   + +S
Sbjct  2     EENQTISSILMLPWLAHGHVSPYLELAKKLTARNFNIYLCSTPINLSSIRSKISPKFGKS  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+EL+LP  P+LPP Y TTNGLP HL   LK+  +MA P+F ++L+TL PDLLI+D++
Sbjct  62    IQLIELNLPTLPNLPPQYHTTNGLPPHLMVTLKEAFEMASPNFCKILRTLMPDLLIYDLL  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPA-LRLRQYEQTKTRELM  648
               WA + A   NIP+V F T SA M S   H    PG ++P+ + +  R Y+        
Sbjct  122   QPWAPEAASYYNIPAVEFITCSATMTSCMLHFFQTPGIQFPYSSTIFFRDYD--------  173

Query  649   NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
                   FK                    E+EGKY DY+S L   KVV +G   Q P   +
Sbjct  174   ------FK--------------------EIEGKYNDYVSCLSGKKVVPVGPLVQDPVHDN  207

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS  1008
              ++ + +WL  K   STVFVSFGSEYFL KEDLE +A+GLE+S +NF+WV+RFPKGE I 
Sbjct  208   EDSTIMEWLNTKGKYSTVFVSFGSEYFLSKEDLEGVAHGLELSSLNFVWVVRFPKGENII  267

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEEALPKGFL+R+GERG++V GWAPQAKIL H S GGFVSHCGWNS++E +  GVPIIA+
Sbjct  268   VEEALPKGFLKRVGERGKIVNGWAPQAKILNHSSIGGFVSHCGWNSVLEGMRFGVPIIAV  327

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+ E+GA +EV R   GK+H E+MA  + + V G  GE +++  + + E
Sbjct  328   PMHLDQPVNARLLEEVGAGMEVVRGSTGKIHGEDMAEIINQVVKGPRGEPVRKKARDLRE  387

Query  1369  NLRLAGNREMDAVVAELEKLC  1431
              L L G+ E+D VV EL +LC
Sbjct  388   KLELKGDEEIDEVVKELVQLC  408



>ref|XP_004238624.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=454

 Score =   445 bits (1144),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 295/439 (67%), Gaps = 9/439 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLELH  312
             V+MFPWL +GHI+PF  LAK L  R F + L STP N  SIK   I ++    I L +L 
Sbjct  11    VLMFPWLGHGHISPFFELAKKLVKRNFTIFLVSTPANFISIKQKLIHENLCDKIHLFDLR  70

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLPPHY TTNGLP HL   LKK    + P FT+++ T+ PDLL++D++  WA KV
Sbjct  71    LPSLPDLPPHYHTTNGLPPHLMSTLKKAFAKSRPIFTQIMNTIEPDLLLYDLLQPWAPKV  130

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A   NIPSV F T+SA M SY  H    P +++PF ++  R YE T  R + NQE    +
Sbjct  131   AKEKNIPSVVFVTSSATMFSYMFHNFRYPNSQFPFSSIYYRDYELT--RLIKNQEMETIE  188

Query  673   REETLDTPANQA------MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE  834
             + +  +            ++L+   +E++G+Y +Y+S L K +VV +G   Q     D+ 
Sbjct  189   QHQRDNKSVKMCFKRSTNIVLIKGFKEIDGQYCEYISSLTKKRVVPVGPLVQEQTSEDNN  248

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
             +++  WL +K   ST+FVSFGSEYFL +ED EEIA+GLE S VNFIWV+RFPKGE++ +E
Sbjct  249   SQILTWLNQKSKGSTIFVSFGSEYFLSQEDREEIAHGLEQSRVNFIWVVRFPKGEKLKLE  308

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALP+ F +++GERG +VE WAPQAKILG+ + GGFVSHCGWNS++ES+ +GVPIIAMPM
Sbjct  309   QALPRDFFKKVGERGMVVEDWAPQAKILGNPNIGGFVSHCGWNSVLESMKIGVPIIAMPM  368

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+NARL+ E+G  +EV RD+ GKL  E+++  + + V  + GE ++   K++SE +
Sbjct  369   HLDQPLNARLVEEVGIGLEVVRDKDGKLDGEQISEIINKVVLEKEGESIREKAKKMSETI  428

Query  1375  RLAGNREMDAVVAELEKLC  1431
             R+ G+ E+D VV EL  LC
Sbjct  429   RVKGDEEIDDVVQELVNLC  447



>ref|XP_009337015.1| PREDICTED: LOW QUALITY PROTEIN: crocetin glucoside glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=457

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 226/446 (51%), Positives = 296/446 (66%), Gaps = 7/446 (2%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             + S++M P LA+GHI+PF+ L+K L  RG F +  CSTP NLNSIK  +PQ YS  I L+
Sbjct  8     KTSILMTPXLAHGHISPFLELSKKLTSRGNFHIFFCSTPVNLNSIKPKLPQKYSHCIELV  67

Query  304   ELHLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             ELHLP  E P+LPPHY TTNGLP HL  ALKK   MA  +F+ +LKTL PDLLI+D +  
Sbjct  68    ELHLPCNELPELPPHYHTTNGLPPHLMPALKKAFDMASENFSNILKTLKPDLLIYDFLQP  127

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTRELMNQ  654
             WA   ALS NIP+V+FF + AAM S+  H    +P A +PFP++ LR YE  K   L   
Sbjct  128   WAPSRALSKNIPAVQFFPSCAAMASFGNHRHCKSPSARFPFPSIYLRDYELMKFNNLGKS  187

Query  655   ETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
                     E +     Q+  ++L+ +S+E+E KYIDYL  L+   +V +G+  Q P   +
Sbjct  188   PPNGLNDGERVQKCIEQSCKIILIKNSKEIEAKYIDYLRGLLGKVIVPVGSLVQEPLDGE  247

Query  829   -HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
               ETE+  WL  +  SS VFVSFG+EYFL KE+++EIA GLE+S V FIWV+RFP GE  
Sbjct  248   GEETEIIKWLNTRERSSVVFVSFGTEYFLSKEEIQEIALGLELSNVCFIWVIRFPVGETT  307

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
              +EE L +GF+ER+GERG +VEGWAPQAKIL H S GGFVSHCGW+S++ES+   VPIIA
Sbjct  308   KIEEVLQEGFMERVGERGLVVEGWAPQAKILQHSSIGGFVSHCGWSSVVESIKFCVPIIA  367

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             +PMHLDQP+NARL+ E+   +EV R   G L REE+A  + + +  + G+ LK     +S
Sbjct  368   IPMHLDQPLNARLVEEVSVGLEVRRTGSGSLEREEVAKVITDVLVEKIGQTLKGKAMELS  427

Query  1366  ENLRLAGNREMDAVVAELEKLCNKPE  1443
             EN +   + E+D VV EL +LC   E
Sbjct  428   ENXKNKEDEEIDGVVEELGQLCRTGE  453



>ref|XP_009608408.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 219/464 (47%), Positives = 299/464 (64%), Gaps = 9/464 (2%)
 Frame = +1

Query  76    PPILQRRLTMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNS  255
             P  +    +M T   + R  + M PWLA+GHI PF+ LAK L+ R F +++CSTP N+NS
Sbjct  12    PLFVVSNFSMDTRQRSIR--IAMLPWLAHGHICPFIELAKALSKRNFYIYICSTPVNINS  69

Query  256   IKNNIPQSYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLK  435
              K  I +  S SI+++ELH P  P+LPPHY TTNGLP  L   LK  L MA+P F  +L 
Sbjct  70    FKQTISEKDSISIKIVELHFPNLPELPPHYHTTNGLPPLLMSTLKNALDMAKPSFFHILN  129

Query  436   TLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRL  612
             TL PDL+++D +  W   +A S NIPSV F T  AA   Y  H+    P +EYPF A+ L
Sbjct  130   TLKPDLVMYDFLQPWVPTMAASQNIPSVLFLTPGAAASCYLFHIGRKKPVSEYPFSAIYL  189

Query  613   RQYEQTKTRELM----NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKS  780
             R +E  + R +     +    + +R        +  ++L+ + RE+EGKY+D+LS L + 
Sbjct  190   RDHEYDRNRHMFEPTEDDGYTDTQRRVNGCIDGSSEIILIKTIRELEGKYMDFLSTLCEK  249

Query  781   KVVSIGTTFQAPPPVDHETE--LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEI  954
             + V +G   +AP          +  WL  K   ST+  SFGSEYFL KE++EE+AYGLE+
Sbjct  250   RYVPVGPLVRAPETEHEHEHSEVMKWLNSKQRCSTILASFGSEYFLSKEEMEELAYGLEL  309

Query  955   SGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHC  1134
             S VNF+WV+RFP GE+IS+EEALPKGFL+RIG  G++V+GWAPQ +IL H S GGFVSHC
Sbjct  310   SKVNFLWVVRFPMGEKISLEEALPKGFLDRIGNTGKVVQGWAPQLRILQHSSIGGFVSHC  369

Query  1135  GWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRET  1314
             GW+S+ME L LG+PIIAMPMHLDQP+NA+L+V+ G   E  RD+ G L R+E+A  +R+ 
Sbjct  370   GWSSVMEGLKLGIPIIAMPMHLDQPLNAKLVVDAGVGEEAVRDKNGNLDRQEVAKVIRKV  429

Query  1315  VGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             V  + G++L++  +  SE L+  G +E+D VV EL KLC    R
Sbjct  430   VAEKTGQRLRKRAREYSEILKSNGAKEIDQVVEELLKLCRLTRR  473



>ref|XP_004244816.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=440

 Score =   442 bits (1137),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/434 (50%), Positives = 290/434 (67%), Gaps = 4/434 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI P++ LAK LA+R   +++CSTP  L+SIK  + Q YSQSI L++ H
Sbjct  9     SVLMLPWLAHGHINPYLELAKKLANRNLHIYICSTPVCLSSIKKRVTQEYSQSIDLVDFH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TTNGLP HL   LK   +M+ P+F+++L+TL PDL+I+D    WA   
Sbjct  69    LPSLPNLPPHYHTTNGLPPHLMTTLKSTFEMSTPNFSKILQTLQPDLVIYDFNLPWAADC  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A S+NIP+V F T  AA+ +   H+   P   +PF    L + E    +  +      F 
Sbjct  129   ASSVNIPAVLFLTFGAAVIALGIHVCDRPEEMFPFTEFYLHEQEILSLKNTV--PGWKFP  186

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDW  852
              +E L    +Q ++L+ + R  EGKYIDYLS L+  K+V +GT  Q     D   ++  W
Sbjct  187   FDEGLRR--SQDIVLIKTCRGFEGKYIDYLSSLVFKKIVPVGTLVQESTNKDDSEDIMQW  244

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKG  1032
             L +K   S VFVSFGSEYFL KE++ E+A GLE+S VNFIWV+RFP+GE   + +ALP+G
Sbjct  245   LDKKHRGSAVFVSFGSEYFLSKEEIHEVAQGLELSKVNFIWVIRFPQGERTKIRDALPEG  304

Query  1033  FLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPM  1212
             FLER+GERG + EGWAPQA IL H S GGFVSHCGW+S MES+  GVPIIAMPM  DQPM
Sbjct  305   FLERVGERGIIFEGWAPQATILQHTSIGGFVSHCGWSSFMESMKCGVPIIAMPMQADQPM  364

Query  1213  NARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNR  1392
             NA+L+  IG  +EV R+E+GKL  EE+A A+R+ V  + GE +++  K +SE + + G+ 
Sbjct  365   NAKLVEYIGMGMEVVREERGKLQSEEIAKAIRKVVVEKGGEVMRKKAKELSEYMNVIGDE  424

Query  1393  EMDAVVAELEKLCN  1434
             E+D VV EL  LC 
Sbjct  425   EIDGVVEELLALCK  438



>ref|XP_010658726.1| PREDICTED: crocetin glucoside glucosyltransferase-like isoform 
X2 [Vitis vinifera]
Length=419

 Score =   437 bits (1124),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 292/439 (67%), Gaps = 30/439 (7%)
 Frame = +1

Query  124   TRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             +R  V++ PWLA+GHI+PF+ L+K L  + F ++ CS+P NL+ IK  +  +YS SI+L+
Sbjct  8     SRIKVLVLPWLAHGHISPFLELSKQLMKQKFYIYFCSSPVNLSRIKGKLTGNYSHSIQLV  67

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             ELHLP  P+LPPHY TTNGLP HL   LK  L MA P FT +LKTL+PDLLI+D +  WA
Sbjct  68    ELHLPSLPELPPHYHTTNGLPPHLMPTLKMALDMASPSFTNILKTLSPDLLIYDFIQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
                A SL IPSV+F +  AA  ++  H +  P  E              K R+ + Q + 
Sbjct  128   PAAAASLGIPSVQFLSNGAAATAFMIHFVKKPDKE--------------KARQCLEQSSN  173

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVDHETE  840
                            ++L+ S +E+E ++ID+LS L    VV +G   Q      D ETE
Sbjct  174   ---------------VILIRSFKEIEERFIDFLSNLNAKTVVPVGPLLQDQLDEEDAETE  218

Query  841   LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEA  1020
             + +WL++K  +S+VFVSFGSEYFL KE+LEE+AYGLE+S VNFIWV+RFP G++  VEEA
Sbjct  219   MVEWLSKKDPASSVFVSFGSEYFLSKEELEEVAYGLELSKVNFIWVVRFPMGDKTRVEEA  278

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP+GFL R+G++G +VEGWAPQ KIL H S GGFVSHCGW S+MES+N GVPI+AMPMHL
Sbjct  279   LPEGFLSRVGDKGMVVEGWAPQKKILRHSSIGGFVSHCGWGSVMESMNFGVPIVAMPMHL  338

Query  1201  DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRL  1380
             DQP NA+L+   G  +EV+RDE GKL REE+A  ++E V  + GE +++  +  SEN+  
Sbjct  339   DQPFNAKLVEAHGVGIEVKRDENGKLQREEIAKVIKEVVVKKCGEIVRQKAREFSENMSK  398

Query  1381  AGNREMDAVVAELEKLCNK  1437
              G+ E+  VV +L +LC K
Sbjct  399   KGDEEIVGVVEKLVQLCGK  417



>gb|KCW51493.1| hypothetical protein EUGRSUZ_J01009 [Eucalyptus grandis]
Length=420

 Score =   437 bits (1124),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/427 (50%), Positives = 287/427 (67%), Gaps = 24/427 (6%)
 Frame = +1

Query  139   VMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLP  318
             +M PWLA+GHI+PF+ L K L++R F ++LCSTP NL+SIK  I + YS SI L+ELHLP
Sbjct  11    LMLPWLAHGHISPFLELGKRLSERNFHIYLCSTPVNLSSIKPKISEKYSSSIELVELHLP  70

Query  319   ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVAL  498
               PDLPPHY TT GLP HL + LK    MA P F+ ++K LNP+L+++D +  WA ++A 
Sbjct  71    SLPDLPPHYHTTKGLPPHLMNTLKAAFDMASPGFSNIIKKLNPNLIVYDFLQPWAPEIAR  130

Query  499   SLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKRE  678
               N+P+V F++  A M S+F H + N G  +PF A+RL  YEQ K           F R 
Sbjct  131   LHNVPAVNFWSVGAGMVSFFFHAVQNVGEGFPFEAVRLHDYEQWK-----------FDR-  178

Query  679   ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLA  858
                         L  +S E+EGKY+DYLS L+  KV+ +G   Q P       ++  WL 
Sbjct  179   ------------LFENSAELEGKYLDYLSSLVGKKVIPVGPLVQDPGEEGGNDDIIKWLD  226

Query  859   RKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFL  1038
              K   S+VFVS G+EYFL  ++ EEIAYGLE+S VNFIWV+RFP GE + +EEALP GFL
Sbjct  227   EKEECSSVFVSCGTEYFLTVKEREEIAYGLELSNVNFIWVIRFPIGESMELEEALPAGFL  286

Query  1039  ERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNA  1218
             ER+G+RG + EGWAPQ KIL H S GGFVSHCGW+SIMES+  GVPIIAMPM LDQP+NA
Sbjct  287   ERVGDRGLVREGWAPQTKILEHPSIGGFVSHCGWSSIMESMKSGVPIIAMPMQLDQPLNA  346

Query  1219  RLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREM  1398
             R++ E+G  +EV+R++ G+L REE+A  ++  V  ++GE +++  K +S+++   G RE+
Sbjct  347   RIVEEVGVGLEVKRNKSGELEREEIAKVIKGVVVEKDGESVRKRAKEMSDSIGNEGGREL  406

Query  1399  DAVVAEL  1419
             D VV  L
Sbjct  407   DEVVNAL  413



>gb|AHK12770.1| flavanone-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
protein 4 [Litchi chinensis]
Length=449

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/443 (50%), Positives = 294/443 (66%), Gaps = 8/443 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+M PWLA+GHI+P++ L+K LA R   ++ CSTP NLNSIK  +   +S SI+L+EL 
Sbjct  9     SVLMLPWLAHGHISPYLELSKKLASRNVRIYFCSTPVNLNSIK--LSPKHSNSIQLVELR  66

Query  313   LPES-PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             LP S PDLPPHY TTNGLP HL   LK    MA   F+ LL+ L PDL+I+D V  WA  
Sbjct  67    LPSSFPDLPPHYHTTNGLPPHLMTTLKHAFDMAASAFSNLLQNLKPDLVIYDFVQPWASA  126

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTN-PGAEYPFPALRLRQYEQTKTRELMNQETRN  666
             VA +LNIP+V F   SA   S+  H   N     +PF ++ +  Y + K   L+   +  
Sbjct  127   VASALNIPAVHFLVFSAVTTSFLVHFSRNHADCPFPFSSIFVHDYMKPKVTHLLESSSNG  186

Query  667   FKREETL--DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ--APPPVDHE  834
              + +E        ++ ++L  + RE+EGKYID LS L+  K+V +G           D E
Sbjct  187   IQDKERYFQSFELSRNVILAKTFRELEGKYIDLLSVLVNKKIVPVGPIVADIIEDQEDDE  246

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              E+  WL +K  SSTVFVSFGSEYFL KE+ EE A+GLE+S VNFIWVLRFP GE++ V+
Sbjct  247   MEIMKWLDKKERSSTVFVSFGSEYFLSKEEREETAHGLELSQVNFIWVLRFPNGEKMEVK  306

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             EALP GFLER  ERG+++E WAPQAKILGH S GGFVSHCGW+S++ES+ LGVPI+A PM
Sbjct  307   EALPLGFLERTKERGKIIENWAPQAKILGHTSIGGFVSHCGWSSVIESMKLGVPIVATPM  366

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+NARL+ ++G  +EV R E G + R+E +  +RE V  +NGEK++R  + +SE +
Sbjct  367   HLDQPLNARLVEDVGVGLEVIRRENGSIERDEFSRVIREVVVDKNGEKIRRKAREMSELM  426

Query  1375  RLAGNREMDAVVAELEKLCNKPE  1443
             +  G  E+D VV EL +L  K E
Sbjct  427   KKKGEEEIDEVVNELVQLSVKRE  449



>ref|XP_008231997.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=459

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 224/443 (51%), Positives = 305/443 (69%), Gaps = 8/443 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+P++ LAK L + R F + +CSTP NL SIK  + Q YS  I  +EL
Sbjct  10    TILMLPWLAHGHISPYLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSQKYSHCIEFVEL  69

Query  310   HLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP  E P+LPPHY TTNGLP HL   LK+   M+  +F+ +L TL PDLLI+D +  WA
Sbjct  70    HLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTTLKPDLLIYDFLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   NIPSV F T SAA+ S+  H L NP A++PFP++ LR YE  K   L+   + 
Sbjct  130   PSLASLQNIPSVEFITTSAALTSFGVHHLKNPSAKFPFPSIYLRDYEAQKFNNLLECSSN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--PVDH  831
               K  + L   ++ +  ++L  +SRE+E KY+DYLS LM  K+V +G   Q P    VD 
Sbjct  190   GIKDGDRLQKCSDLSSDIILEKTSREIEAKYVDYLSGLMGKKIVPVGPLVQEPMDLKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-IS  1008
             ET +  WL ++  +S V+V FGSEYFL KE++EEIA+GLE+S V+FIWV+RFPK E+   
Sbjct  250   ETWIMKWLNKRERASVVYVCFGSEYFLTKEEIEEIAHGLELSKVSFIWVIRFPKEEKGRR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFL+R+GE+G +VEGWAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  310   VEEVLPEGFLKRVGEKGIIVEGWAPQAKILKHFSVGGFVSHCGWSSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+N+RL+ E+G  VEV+R  +G L REE+A  +R+ V  + GE +++    I +
Sbjct  370   PMHLDQPINSRLVEEVGVGVEVKRTAEGSLQREEVAKVIRDVVVEKIGEGVRQKALEIRD  429

Query  1369  NLRLAGNREMDAVVAELEKLCNK  1437
             +++   + E+D VV EL +L  K
Sbjct  430   SIKKNEDAEIDGVVEELMQLWTK  452



>ref|XP_002264771.2| PREDICTED: crocetin glucoside glucosyltransferase [Vitis vinifera]
Length=455

 Score =   437 bits (1123),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 215/437 (49%), Positives = 294/437 (67%), Gaps = 5/437 (1%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SVVM PWLA+GHI+PF+ LAK L+ R F ++ CSTP NL  IK  + Q  S+SI L+ELH
Sbjct  8     SVVMLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLGCIKGKLNQENSRSIHLVELH  67

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP SPDLPPHY TTNGLP HL   LKK    A   F ++LK+L PDLLI+D++  WA   
Sbjct  68    LPSSPDLPPHYHTTNGLPPHLMPTLKKAFDTANHSFADILKSLKPDLLIYDILQPWAPTA  127

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPAL-RLRQYEQ-TKTRELMNQETRN  666
             A SL+IP++ FF+  AA+ S   H+   PG  YPFP +  L+ + + T+   +      N
Sbjct  128   ASSLDIPAILFFSTGAAVLSIILHLGKRPGTVYPFPEIFHLQDFRRTTELNRVTGSGANN  187

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE  840
              K EE       Q+  ++L+ + RE+ GKYIDY+S L + K++ +G              
Sbjct  188   MKDEERAAECLKQSSNVILIKTFREMGGKYIDYISALSEKKLIPVGPLVADSTEEFENAA  247

Query  841   LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI-SVEE  1017
             + DWL +K   S V VSFGSEYF+ KE++EEIA+GLE+S V+FIWV+R  +G +I + EE
Sbjct  248   IIDWLNKKDKLSAVLVSFGSEYFMSKEEMEEIAHGLELSRVSFIWVVRILQGNKINNAEE  307

Query  1018  ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
             ALP+G++ R+GERG +VEGWAPQ KILGH S GGFVSHCGW+SIMES+  GVPI+A+PM 
Sbjct  308   ALPEGYIRRVGERGMVVEGWAPQKKILGHTSIGGFVSHCGWSSIMESIKFGVPIVAIPMQ  367

Query  1198  LDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLR  1377
             +DQP NA+L+  +G  VEV+R+E  +L REE+A  ++E V  ++GE ++R V+ +SEN+R
Sbjct  368   IDQPFNAKLLEAVGVGVEVKRNEDRRLEREEIARVIKEVVVEKSGENVRRKVREMSENMR  427

Query  1378  LAGNREMDAVVAELEKL  1428
                + E+  V  EL +L
Sbjct  428   KKADEEIAEVAEELVRL  444



>ref|XP_010033637.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=448

 Score =   436 bits (1121),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 214/447 (48%), Positives = 302/447 (68%), Gaps = 13/447 (3%)
 Frame = +1

Query  118   MATRR---SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             MAT R   SV+M PWLA+GHI PF+ LAK L+ R F + LCS+P NL+SIK  IP  Y  
Sbjct  1     MATTRRTISVLMLPWLAHGHIGPFLELAKKLSKRNFHIFLCSSPVNLSSIK--IPHEYCS  58

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             +I L+ELH+P  P LPP Y TT GLP HL   LK    MA P+ ++++    P++LI D 
Sbjct  59    AIELVELHVPSLPGLPPQYHTTRGLPPHLMPKLKMAFDMAGPNLSDIISDRQPNMLIFDY  118

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
             +  W  +VA S  IP++ F + +A   S+  H +  PG EYPF A+ L+ +   K R  M
Sbjct  119   LLPWVPEVARSHGIPAINFASVAAGASSFALHSIKRPGDEYPFKAMSLQDHWMAKYRNQM  178

Query  649   NQETRNFKRE-----ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
              Q + +   +       +D P+   ++ + + RE+EGKYIDYLS+L++ KVV +G   Q 
Sbjct  179   EQASESGMSDTERIMRCIDQPS--GLIFLKTFRELEGKYIDYLSDLLEKKVVPVGPLVQD  236

Query  814   PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
             P   D +  +T+WL +K  SST+FVSFG+EYFL +++ EEIAYGLE+S VNFIW ++FP 
Sbjct  237   PVQEDGD-HITEWLDKKERSSTIFVSFGTEYFLTEKEREEIAYGLELSSVNFIWAVKFPV  295

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
              E I++EEALP+ FLER+ +RG+++EGWAPQA+IL H+S GGFVSHCGW+S+MES+  GV
Sbjct  296   EEHITLEEALPREFLERVRDRGQVIEGWAPQARILAHQSVGGFVSHCGWSSVMESMKFGV  355

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMPMHLDQP++AR++ ++G  +EV R+E G+L R+E+A  ++  V  E GE+++  V
Sbjct  356   PIIAMPMHLDQPLDARIVEDVGVGLEVMRNESGELERKEIAKVIKAVVVEEGGERVRNKV  415

Query  1354  KRISENLRLAGNREMDAVVAELEKLCN  1434
             K +S  +R  G+ E+D V   + KLC 
Sbjct  416   KEVSIGIRNKGDEEIDEVEDAIVKLCG  442



>gb|AHZ30598.1| ufgt, partial [Prunus domestica]
Length=423

 Score =   435 bits (1119),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 213/422 (50%), Positives = 289/422 (68%), Gaps = 8/422 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+P++ LAK L  +  F V +CSTP NL+SIK  + Q YS  I  +EL
Sbjct  1     TILMLPWLAHGHISPYLELAKKLTTKSNFHVFICSTPVNLSSIKPKLSQKYSHCIEFVEL  60

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPPHY TTNGLP HL   LK    M+  +F+ +LKTL+PDLLI+DV+  WA
Sbjct  61    HLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFDMSSNNFSNILKTLSPDLLIYDVLQPWA  120

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   N PS+ F    AA+ S+    L NP  ++PFP++ L+ YE  K   L      
Sbjct  121   PSLASLQNFPSIEFIPMGAALTSFSIQHLKNPSVKFPFPSIYLQDYEAEKFNNLSESSAN  180

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
               K  + L     ++  ++LV +SRE+E KYIDYLS+LM  K+V +GT  Q P    VD 
Sbjct  181   GIKDGDRLQQCGARSCNIILVKTSREIEEKYIDYLSDLMGKKIVPVGTLVQEPMDQKVDE  240

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL +   SS V+V FGSEYFL KE +EEIA+GLE+S V+FIWV+RFPK E  + 
Sbjct  241   ETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFPKAERSTR  300

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFL+R+GE+G ++EGWAPQA+IL H S GGFVSHCGWNS++ES+  GVPIIA+
Sbjct  301   VEEVLPEGFLQRVGEKGVIMEGWAPQARILQHSSVGGFVSHCGWNSVLESIKFGVPIIAV  360

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+ E+G  +EV+R  +G L REE+A  +R+ V  + G+ +++   +IS+
Sbjct  361   PMHLDQPINARLVEEVGVGMEVKRTGEGSLQREEVAKVIRDVVVEKIGKGVRKKALKISD  420

Query  1369  NL  1374
             N+
Sbjct  421   NV  422



>ref|XP_008231988.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=451

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/442 (50%), Positives = 300/442 (68%), Gaps = 8/442 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+PF+ LAK L + R F + +CSTP NL SIK  +   YS  I  +EL
Sbjct  10    TILMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHCIEFVEL  69

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPP Y TTNGLP HL   LK+   M+  +F+ +L  L PDLLI+D +  WA
Sbjct  70    HLPHDDLPELPPQYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTALKPDLLIYDFLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   NIPSV F T SAA+ S+  H L NP  ++PFP++ LR YE  K   L+   + 
Sbjct  130   PSLASLQNIPSVEFITTSAALTSFSVHHLRNPSDKFPFPSIYLRDYEAKKFNNLLESSSN  189

Query  664   NFKREETL--DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--PVDH  831
               K  + +   +  +  ++LV +SRE+E KY+DYLS LM  K+V +G   Q P    VD 
Sbjct  190   GIKNGDRVLQCSDLSSGIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLVQEPMDLKVDD  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL ++  SS V+V FGSEYFL +E +EE+A+GLE+S V+FIWV+RFPK E+ + 
Sbjct  250   ETWIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSKVSFIWVIRFPKEEKGNR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFLER+GE+G +VEGWAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  310   VEEVLPEGFLERVGEKGVIVEGWAPQAKILKHSSVGGFVSHCGWSSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+N+RL+ E+G  VEV+R  +G L R+E+A  +R+ V  + GE +++    I E
Sbjct  370   PMHLDQPINSRLVEEVGVGVEVKRTAEGSLERKEVAKVIRDVVAQKIGEGVRKKALEIRE  429

Query  1369  NLRLAGNREMDAVVAELEKLCN  1434
             N++   + E++ VV EL +LC 
Sbjct  430   NMKKKEDEEINGVVEELMQLCT  451



>gb|AEJ88222.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Prunus persica]
Length=456

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 300/445 (67%), Gaps = 8/445 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLA-DRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+P++ LAK L   R F + +CSTP NL+SIK  + Q YS  I  +EL
Sbjct  10    TILMLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHCIEFVEL  69

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPPHY TTNGLP HL   LK    M+  +F+ +LKTL+PDLLI+DV+  WA
Sbjct  70    HLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFSMSSNNFSNILKTLSPDLLIYDVLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   N PS+ F T  AA  S+    L NP  ++PFP++ L+ YE  K   L+     
Sbjct  130   PSLASLQNFPSIEFTTMGAAFTSFSIQHLKNPSVKFPFPSIYLQHYEAEKFNNLLESSAN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
               K  + +   + ++  ++LV +S E+E KYIDYLS+L   K+V +GT  Q P    VD 
Sbjct  190   GIKDGDRVQQCSARSCNIILVKTSSEIEEKYIDYLSDLTGKKIVPVGTLVQEPMDQKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL +   SS V+V FGSEYFL KE +EEIA+GLE+S V+FIWV+RF K E  + 
Sbjct  250   ETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFSKEERSTR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFL+R+GE+G ++EGWAPQAKIL H S GGFVSHCGWNS++ES+  GVPIIAM
Sbjct  310   VEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+ E+G  VEV+R  +G L REE+A  +R+ V  + GE +++   +IS+
Sbjct  370   PMHLDQPINARLVEEVGVGVEVKRTGEGSLQREEVAKVIRDVVVEKFGEGVRKKALKISD  429

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             N+    + E+D VV EL ++C   E
Sbjct  430   NVNKKEDEEIDGVVEELIQVCTGRE  454



>ref|XP_008231983.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=460

 Score =   434 bits (1116),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/449 (49%), Positives = 303/449 (67%), Gaps = 10/449 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +V+M PWLA+GHI+PF+ LAK L + R F + +CSTP NL SIK  +   YS  I  +EL
Sbjct  10    TVLMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHCIEFVEL  69

Query  310   HLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP  E P+LPPHY TTNGLP HL   LK+   M+  +F+ +L TL PDL+I+D +  WA
Sbjct  70    HLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTTLKPDLVIYDFIPPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   NIPSVRF T SAA+ S   H L NP   +PFP++ LR YE  K   L+   + 
Sbjct  130   PSLASLQNIPSVRFVTTSAALSSLRVHHLKNPRVNFPFPSIYLRDYEAKKFNNLLEPSSN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--PVDH  831
             +    + +   + ++  ++LV +SRE+E KY+DYLS LM  K+V +G   Q P    VD 
Sbjct  190   DINDGDRVQQCSARSCNIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLVQEPMDLKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-IS  1008
             ET +  WL ++  SS V+V FGSEYFL +E +EE+A+GLE+S V+FIWV+RFPK E+   
Sbjct  250   ETWIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSNVSFIWVIRFPKEEKGKR  309

Query  1009  VEEALPKGFLERIGERGRMV-EGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
             VEE  P+GFLER+GE+G +V EGWAPQA IL H S GGFVSHCGW+S++ES+  GVPIIA
Sbjct  310   VEEVFPEGFLERVGEKGIIVLEGWAPQANILKHSSVGGFVSHCGWSSVLESIKFGVPIIA  369

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPMHLDQP+NARL+ E+G  VEV+R  +G L REE+A  +R+ V  + GE +++    + 
Sbjct  370   MPMHLDQPINARLVEELGVGVEVKRTGEGILQREEVAKVIRKVVVEKIGEGVRKKALELR  429

Query  1366  ENLRLAGNREMDAVVAELEKLCNKPERIA  1452
             EN++   + ++D VV EL +   + ++I+
Sbjct  430   ENMK-NKDGDVDGVVEELMQFVGEGKQIS  457



>ref|XP_007220460.1| hypothetical protein PRUPE_ppa005520mg [Prunus persica]
 gb|EMJ21659.1| hypothetical protein PRUPE_ppa005520mg [Prunus persica]
Length=456

 Score =   434 bits (1116),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 300/445 (67%), Gaps = 8/445 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLA-DRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             ++++ PWLA+GHI+P++ LAK L   R F + +CSTP NL+SIK  + Q YS  I  +EL
Sbjct  10    TILLLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHCIEFVEL  69

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPPHY TTNGLP HL   LK    M+  +F+ +LKTL+PDLLI+DV+  WA
Sbjct  70    HLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFSMSSNNFSNILKTLSPDLLIYDVLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   N PS+ F T  AA  S+    L NP  ++PFP++ L+ YE  K   L+     
Sbjct  130   PSLASLQNFPSIEFTTMGAAFTSFSIQHLKNPSVKFPFPSIYLQHYEAEKFNNLLESSAN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
               K  + +   + ++  ++LV +S E+E KYIDYLS+L   K+V +GT  Q P    VD 
Sbjct  190   GIKDGDRVQQCSARSCNIILVKTSSEIEEKYIDYLSDLTGKKIVPVGTLVQEPMDQKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL +   SS V+V FGSEYFL KE +EEIA+GLE+S V+FIWV+RF K E  + 
Sbjct  250   ETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFSKEERSTR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFL+R+GE+G ++EGWAPQAKIL H S GGFVSHCGWNS++ES+  GVPIIAM
Sbjct  310   VEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+ E+G  VEV+R  +G L REE+A  +R+ V  + GE +++   +IS+
Sbjct  370   PMHLDQPINARLVEEVGVGVEVKRTGEGSLQREEVAKVIRDVVVEKFGEGVRKKALKISD  429

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             N+    + E+D VV EL ++C   E
Sbjct  430   NVNKKEDEEIDGVVEELIQVCTGRE  454



>ref|XP_008231981.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=455

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 301/445 (68%), Gaps = 9/445 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLA-DRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+P++ LAK L   R   + +CSTP NL+SIK  + Q YS  I  +EL
Sbjct  10    TILMLPWLAHGHISPYLELAKKLTTKRNLHIFICSTPVNLSSIKPKLSQKYSHCIEFVEL  69

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPPHY TTNGLP HL   LK    M+  +F+ +LKTL+PDLLI+DV+  WA
Sbjct  70    HLPHDDLPELPPHYHTTNGLPPHLMSTLKTAFDMSSNNFSNILKTLSPDLLIYDVLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   N PS+ F    AA+ S+    L NP  ++PFP++ L+ YE  K   L      
Sbjct  130   PSLASLQNFPSIEFIPMGAALTSFNIQHLKNPSVKFPFPSIYLQDYEAEKFNNLSESSAN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
               K  + L   + ++  ++LV +SRE+E KYIDYLS+LM  K+V +GT  Q P    VD 
Sbjct  190   GIKDGDRLQQCSARSCDIILVKTSREIEEKYIDYLSDLMGKKIVPVGTLVQEPMDQKVD-  248

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL +   SS V+V FGSEYFL KE +EEIA+GLE+S V+FIWV+RFPK E  + 
Sbjct  249   ETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFPKAERSTR  308

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFL+R+GE+G ++EGWAPQAKIL H S GGFVSHCGWNS++ES+  GVPIIAM
Sbjct  309   VEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSVLESIKFGVPIIAM  368

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHL QP+NARL+ E+G  VEV+R  +G L RE++A  +R+ V  + GE +++   +IS+
Sbjct  369   PMHLAQPINARLVEEVGVGVEVKRTGEGSLQREKVAKVIRDVVVEKFGEGVRKKALKISD  428

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             N+    + E+D VVAEL ++C   E
Sbjct  429   NVNKKEDEEIDGVVAELIQVCTGRE  453



>ref|XP_007220461.1| hypothetical protein PRUPE_ppa005526mg [Prunus persica]
 gb|EMJ21660.1| hypothetical protein PRUPE_ppa005526mg [Prunus persica]
Length=456

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 300/447 (67%), Gaps = 8/447 (2%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLA-DRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLL  303
             + +++M PWLA+GHI+P++ LAK L   R F + +CSTP NL+SIK  + Q YS  I  +
Sbjct  8     KLTILMLPWLAHGHISPYLELAKKLTTKRNFHIFICSTPVNLSSIKPKLSQKYSHCIEFV  67

Query  304   ELHLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             ELHLP    P+LPPHY TTNGLP HL   LK+   M+  +F+ +LKTL+PDLLI+D +  
Sbjct  68    ELHLPHDDLPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSNILKTLSPDLLIYDFLQP  127

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WA  +A   N PS+ F T  AA  S+    L NP  ++PFP++ L+ YE  K   ++   
Sbjct  128   WAPSLASLQNFPSIEFITMGAAFTSFSIQHLKNPSVKFPFPSIYLQDYEAEKFNNVLESS  187

Query  658   TRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPV  825
                 K  + +   + ++  ++LV +SR +E KYIDYLS+LM  K+V +GT  Q P    V
Sbjct  188   ANGIKDGDRVQQCSARSCNIILVKTSRGIEEKYIDYLSDLMGKKIVPVGTLVQEPVDQKV  247

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-  1002
             D ET +  WL +   SS V+V FGSEYFL KE +EEIA+GLE+S V+FIWV+RF K E+ 
Sbjct  248   DEETWIMKWLNKMERSSVVYVCFGSEYFLSKEQIEEIAHGLELSKVSFIWVIRFSKEEKN  307

Query  1003  ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
               VEE LP+GFL+R+GE+G ++EGWAPQAKIL H S GGFVSHCGWNS++ES+  GVPII
Sbjct  308   TRVEEVLPEGFLQRVGEKGVIMEGWAPQAKILQHSSVGGFVSHCGWNSVLESIKFGVPII  367

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             AMPMHLDQP+NARL+ E+G  VEV+R  +G L REE+A  +R+    + GE +++   +I
Sbjct  368   AMPMHLDQPINARLVEEVGVGVEVKRTGEGSLQREEVAKVIRDVFVEKIGEGVRKKALKI  427

Query  1363  SENLRLAGNREMDAVVAELEKLCNKPE  1443
              +N+    + E+D VV EL ++C   E
Sbjct  428   RDNMNKKEDEEIDGVVEELMQVCTGRE  454



>ref|XP_007219141.1| hypothetical protein PRUPE_ppa016015mg [Prunus persica]
 gb|EMJ20340.1| hypothetical protein PRUPE_ppa016015mg [Prunus persica]
Length=451

 Score =   432 bits (1110),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 300/442 (68%), Gaps = 8/442 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++M PWLA+GHI+PF+ LAK L + R F + +CSTP NL SIK  +   YS  I  +EL
Sbjct  10    TILMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHCIEFVEL  69

Query  310   HLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP    P+LPP Y TTNGLP HL   LK+   M+  +F+ +L  L PDLLI+D +  WA
Sbjct  70    HLPHDDLPELPPQYHTTNGLPPHLMSTLKRAFDMSSNNFSTILTALKPDLLIYDFLQPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
               +A   NIPSV F T SAA+ S+  H L NP  ++PFP++ LR YE  K   L+   + 
Sbjct  130   PSLASLQNIPSVEFITTSAALTSFSVHHLRNPIDKFPFPSIYLRDYEAKKFNNLLESSSN  189

Query  664   NFKREETL--DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--PVDH  831
               K  + +   +  +  ++LV +SRE+E KY+DYLS LM  K+V +G   Q P    VD 
Sbjct  190   GIKDGDRVLQCSDLSSGIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLVQEPMDLKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             ET +  WL ++  SS V+V FGSEYFL +E +EE+A+GLE+S V+FIWV+RFPK E+ + 
Sbjct  250   ETWIMKWLNKRERSSVVYVCFGSEYFLSREQIEELAHGLELSKVSFIWVIRFPKEEKGNR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+ FLER+GE+G +VEGWAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  310   VEEVLPEAFLERVGEKGVIVEGWAPQAKILNHSSVGGFVSHCGWSSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+N+RL+ E+G  VEV+R  +G L R+E+A A+R+ V  + GE +++    I +
Sbjct  370   PMHLDQPINSRLVEEVGVGVEVKRTAEGSLERKEVAKAIRDVVAKKIGEGVRKKALEIRD  429

Query  1369  NLRLAGNREMDAVVAELEKLCN  1434
             N++   + E++ VV EL +LC 
Sbjct  430   NMKNKEDEEINGVVEELMQLCT  451



>ref|XP_006363504.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=446

 Score =   430 bits (1106),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/447 (51%), Positives = 291/447 (65%), Gaps = 22/447 (5%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWL YGHI+PF+ LAK L+ R F++HLCST  NL  I+    Q  S SI+LLEL 
Sbjct  8     SVLMFPWLGYGHISPFLELAKKLSQRNFIIHLCSTKANLTPIRAK--QYSSSSIKLLELP  65

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             L  + +LPPH  TTNG P HL D LK+    + P FT++LKTL PDLLI+D +  WA   
Sbjct  66    LLTT-NLPPHQHTTNGFPPHLMDTLKQAFDSSTPQFTKILKTLKPDLLIYDFLQPWAPLA  124

Query  493   ALSLNIPSVRFFTASAAMCSYFTH-MLTNP-GAEYPFPA-LRLRQYEQTKTRELMNQETR  663
             A  LNIP+V F ++S+ M +Y  H +L  P G E+PF + +  R YE         + ++
Sbjct  125   ASQLNIPAVEFISSSSTMTAYMWHDLLKKPKGIEFPFSSTIYYRDYEMASI-----ERSK  179

Query  664   NFKREETLDTPANQA---------MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
                  E ++   N+          ++L+ S  E+EGKY +Y++ L   K+V +G   Q P
Sbjct  180   AVIPLEKIEADKNRVGQSFVLSNHIVLIKSFDEIEGKYSNYITSLTGKKIVPVGPLVQEP  239

Query  817   PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
              P D  + L  WL  K   STVFVSFGSEYFL  EDL EIAYGLE S VNFIW LRF K 
Sbjct  240   TPDDTNSNLIKWLNTKDKRSTVFVSFGSEYFLSNEDLLEIAYGLESSKVNFIWPLRFAK-  298

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             EE+ +EEALPKGF+ R+G+RGR+ +GWAPQAKIL H S GGFVSHCGW+S+MES+  GVP
Sbjct  299   EEVEIEEALPKGFVNRVGDRGRVFKGWAPQAKILEHSSIGGFVSHCGWSSVMESMKYGVP  358

Query  1177  IIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             IIAMPMHLDQPMN+RL+V E+G AVEV RD +GKLH +E+A  +   V  E GE ++   
Sbjct  359   IIAMPMHLDQPMNSRLIVEEVGMAVEVVRDGEGKLHWKEVADVINHVVVEEGGELVREKA  418

Query  1354  KRISENLRLAGNREMDAVVAELEKLCN  1434
               + E +R  G+ E+D V  ELE L N
Sbjct  419   NHMKEIIRFKGDEEIDQVAKELEMLLN  445



>gb|AFK79036.1| glycosyltransferase UGT4 [Bupleurum chinense]
Length=453

 Score =   430 bits (1105),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 299/457 (65%), Gaps = 12/457 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             MG +  + R  V+M PWLA+GHI+PF+ L+K L +R   ++ CSTP NLN+IK  +  ++
Sbjct  1     MGEQETSLR--VLMLPWLAHGHISPFLHLSKKLINRNIFIYFCSTPVNLNTIKKKV-DNF  57

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             SQSI L+ELHLP  PDLPP+  TTNGLP HL   L     +++   +  +K L PD++I 
Sbjct  58    SQSIELVELHLPSLPDLPPNQHTTNGLPPHLIPTLHMAYSLSKEKMSNTVKNLKPDVVIC  117

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D    W E V LSL IP   F T+SA   SYF+++L+  G EYP+P + +R+YE      
Sbjct  118   DASQPWVEGVVLSLGIPCCFFNTSSAVTVSYFSNLLSGAGVEYPYPEIFVREYEMAAIHA  177

Query  643   LMNQE-----TRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
             ++ Q+     TRN   E  E L   +   ++ V +  E+EGKYI YL +L K KV+ +G 
Sbjct  178   IIAQKDSLSRTRNNDDEGKECLSRESCN-VVFVKTFEEIEGKYIKYLGQLSKMKVIPVGP  236

Query  802   TFQ-APPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWV  978
               +      D + E+ +WL  K   STVFVSFGSEYFL  +D+EEIA GLE+S VNFIWV
Sbjct  237   LVEDVVDNDDTDAEILEWLNEKNPCSTVFVSFGSEYFLSNKDMEEIAQGLELSNVNFIWV  296

Query  979   LRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMES  1158
             +RF  GE+ S+E+ LPKGF ER+ +RG +VEGWAPQAKIL H S GGFV+HCGWNSI+ES
Sbjct  297   VRFTAGEKHSLEDVLPKGFKERVRDRGIIVEGWAPQAKILKHSSVGGFVTHCGWNSILES  356

Query  1159  LNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEK  1338
             + LGV I+A PM LDQ  NARL+V++G   EV RD +G+L REE+A  +RE V    GE 
Sbjct  357   MKLGVAIVATPMQLDQYFNARLVVDLGVGKEVVRDIEGRLQREEVAKVIREVVVENIGEN  416

Query  1339  LKRNVKRISENLRLAGNREMDAVVAELEKLCNKPERI  1449
             ++   K +S+ +R  G+ E+D VV EL ++C K ++I
Sbjct  417   VREKAKELSKCMRDKGDEEIDDVVEELFQVCGKSKQI  453



>gb|KCW51492.1| hypothetical protein EUGRSUZ_J01008, partial [Eucalyptus grandis]
Length=412

 Score =   428 bits (1101),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 280/402 (70%), Gaps = 2/402 (0%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+P++ LAK L+ R F V+ CSTP NL+SIK  I + YS  + L+ELHL
Sbjct  10    VLMLPWLAHGHISPYLELAKRLSTRNFHVYFCSTPVNLSSIKPKISEKYSSCVELVELHL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GLP HL + LK    MA P F++++K+L PDLLIHD +  WA +VA
Sbjct  70    PSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASPGFSDIVKSLGPDLLIHDFLQPWAAEVA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
              S  +PSV FF+  A   S+  HM+ N   E+PF A+RL  YEQ K  ++++  T +   
Sbjct  130   KSHGLPSVVFFSVGAGTLSFMFHMIKNTSIEFPFKAIRLHDYEQAKLTDMIDDSTGSVSN  189

Query  676   EETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             ++       ++   +L+ + RE++GKY+DYLS L+   VV +G   + P  ++    + +
Sbjct  190   KDRCLQCVERSSNFILLKTFRELDGKYMDYLSSLLGKIVVPVGPLVEVPSNIEDGDGIIE  249

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL  +  SST+FVSFG+EYFL +++ EEIAYGLE+S VNFIWV+RFP GE I +EEALP+
Sbjct  250   WLDEREESSTIFVSFGTEYFLNEKEREEIAYGLELSNVNFIWVIRFPVGESIELEEALPE  309

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GF  R+ +RG +++GWAPQ  IL H S GGFVSHCGW+SIMES+  GVPIIA+PM  DQP
Sbjct  310   GFFGRVRDRGLVIDGWAPQGMILEHPSIGGFVSHCGWSSIMESMKSGVPIIAIPMQFDQP  369

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGE  1335
             +NAR++ ++G  +EV+R++ G+L R E+A  +++ V  ++G+
Sbjct  370   LNARMVKDVGVGLEVKRNKNGELERSEIAKVIKDVVVEKDGD  411



>gb|KCW53337.1| hypothetical protein EUGRSUZ_J02585, partial [Eucalyptus grandis]
Length=432

 Score =   429 bits (1102),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 297/436 (68%), Gaps = 13/436 (3%)
 Frame = +1

Query  118   MATRR---SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             MAT R   SV+M PWLA+GHI PF+ LAK L+ R F + LCS+P NL+SIK  IP  Y  
Sbjct  1     MATTRRTISVLMLPWLAHGHIGPFLELAKKLSKRNFHIFLCSSPVNLSSIK--IPHEYCS  58

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             +I L+ELH+P  P LPP Y TT GLP HL   LK    MA P+ ++++    P++LI D 
Sbjct  59    AIELVELHVPSLPGLPPQYHTTRGLPPHLMPKLKMAFDMAGPNLSDIISDRQPNMLIFDY  118

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
             +  W  +VA S  IP++ F + +A   S+  H +  PG EYPF A+ L+ +   K R  M
Sbjct  119   LLPWVPEVARSHGIPAINFASVAAGASSFALHSIKRPGDEYPFKAMSLQDHWMAKYRNQM  178

Query  649   NQETRNFKRE-----ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
              Q + +   +       +D P+   ++ + + RE+EGKYIDYLS+L++ KVV +G   Q 
Sbjct  179   EQASESGMSDTERIMRCIDQPS--GLIFLKTFRELEGKYIDYLSDLLEKKVVPVGPLVQD  236

Query  814   PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
             P   D +  +T+WL +K  SST+FVSFG+EYFL +++ EEIAYGLE+S VNFIW ++FP 
Sbjct  237   PVQEDGD-HITEWLDKKERSSTIFVSFGTEYFLTEKEREEIAYGLELSSVNFIWAVKFPV  295

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
              E I++EEALP+ FLER+ +RG+++EGWAPQA+IL H+S GGFVSHCGW+S+MES+  GV
Sbjct  296   EEHITLEEALPREFLERVRDRGQVIEGWAPQARILAHQSVGGFVSHCGWSSVMESMKFGV  355

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMPMHLDQP++AR++ ++G  +EV R+E G+L R+E+A  ++  V  E GE+++  V
Sbjct  356   PIIAMPMHLDQPLDARIVEDVGVGLEVMRNESGELERKEIAKVIKAVVVEEGGERVRNKV  415

Query  1354  KRISENLRLAGNREMD  1401
             K +S  +R  G+ E+D
Sbjct  416   KEVSIGIRNKGDEEID  431



>emb|CDO99872.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   428 bits (1100),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/439 (48%), Positives = 301/439 (69%), Gaps = 9/439 (2%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPE  321
             M PWLA+GH++PF+ LAK LA + F ++LCST  NL+SIKN I   YS SI  +EL LP 
Sbjct  1     MLPWLAHGHMSPFLELAKRLAKKNFHIYLCSTSVNLSSIKNQIAGKYSDSIEPVELQLPC  60

Query  322   SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALS  501
              PDLPPHY TTNGLP HL   LK   +M+ P+F+ +L TL+PDL+++D    WA ++A S
Sbjct  61    LPDLPPHYHTTNGLPPHLMTTLKTAYEMSAPNFSNILTTLHPDLVMYDFNQPWAAEIASS  120

Query  502   LNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTREL---MNQETRNFK  672
              NIP+V+F    A+M ++  +M+  PG E P+P + +R YE  K R     +N  +   +
Sbjct  121   QNIPAVQFLPFGASMTAFGLYMIKYPGKELPYPEIYIRDYEIAKVRSRDARVNDVSDGQR  180

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA---PPPVDHETEL  843
               + LD      ++LV S +E+E +++D+LS     KVV +G   Q        D E E+
Sbjct  181   FLQGLDLSCK--ILLVKSFKEIEERFMDFLSVASGKKVVPVGPLVQDISLDDIQDEEMEI  238

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEAL  1023
              +WL +K  +S VFVSFGSEYFL +++  EIA GLE+S VNFIWV+RFP G +I+VE+AL
Sbjct  239   INWLDQKENASVVFVSFGSEYFLTEDERSEIARGLELSNVNFIWVIRFPFGGKITVEKAL  298

Query  1024  PKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLD  1203
             P+GFLER+G+RG++V+GWAPQA+IL H +TG F+SHCGW+S+MES+  GVP+IA+PM++D
Sbjct  299   PEGFLERVGDRGKIVDGWAPQARILKHANTGAFLSHCGWSSMMESMKFGVPMIALPMNID  358

Query  1204  QPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLA  1383
             QP+NARL+  +G  +E  RDEKG L  EE+A  +R+ +  E+G+ ++R  K +SE + + 
Sbjct  359   QPLNARLIEAVGVGLEPLRDEKGNLQSEEIAKVIRKVLVEESGKNVRRKAKELSEQMEMR  418

Query  1384  GN-REMDAVVAELEKLCNK  1437
             G+  E+D +V E+ +LC K
Sbjct  419   GDEEEIDNLVEEVVQLCQK  437



>ref|XP_007220458.1| hypothetical protein PRUPE_ppa005471mg [Prunus persica]
 gb|EMJ21657.1| hypothetical protein PRUPE_ppa005471mg [Prunus persica]
Length=459

 Score =   427 bits (1099),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/448 (50%), Positives = 303/448 (68%), Gaps = 9/448 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +V+M PWLA+GHI+PF+ LAK L + R F + +CSTP NL SIK  +   YS  I  +EL
Sbjct  10    TVLMLPWLAHGHISPFLELAKKLTSKRNFHIFICSTPVNLTSIKPKLSPKYSHCIEFVEL  69

Query  310   HLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             HLP  E P+LPPHY TTNGLP HL   LK+   M+  +F+ +L TL PDLLI+D +  WA
Sbjct  70    HLPHEELPELPPHYHTTNGLPPHLMSTLKRAFDMSSNNFSNILTTLKPDLLIYDFIPPWA  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
                A   NIPSVRF T SAA+ S   H L NP  ++PFP++ LR YE  K   L+   + 
Sbjct  130   PSQASLQNIPSVRFITTSAALSSLRVHHLKNPRVKFPFPSIYLRDYEAKKFNNLLEPSSN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--PVDH  831
             +    + +   + ++  ++LV +SRE+E KY+DYLS LM  K+V +G   Q P    VD 
Sbjct  190   DINDGDRVQQCSARSCNIILVKTSREIEAKYVDYLSGLMGKKIVPVGPLVQEPMDLKVDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-IS  1008
             ET +  W+ ++  SS V+V FGSEYFL +E +EE+A+GLE+S V+FIWV+RFPK E+   
Sbjct  250   ETWIMKWMNKRERSSVVYVCFGSEYFLSREQIEEVAHGLELSKVSFIWVIRFPKEEKGKR  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LP+GFLER+GE+G +VEGWAPQA IL H   GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  310   VEEVLPEGFLERVGEKGIIVEGWAPQANILKHSRVGGFVSHCGWSSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+ E+G  VEV+R  +G L REEMA  +R+ V  + GE +++    + +
Sbjct  370   PMHLDQPINARLVEEVGVGVEVKRTGEGILQREEMAKVIRKVVVEKIGEGMRKKALELRD  429

Query  1369  NLRLAGNREMDAVVAELEKLCNKPERIA  1452
             N++   + E+D VV EL +   + ++I+
Sbjct  430   NMK-NKDGEIDGVVEELMQFVGEGKQIS  456



>gb|EYU31926.1| hypothetical protein MIMGU_mgv1a021717mg, partial [Erythranthe 
guttata]
Length=456

 Score =   424 bits (1091),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 296/442 (67%), Gaps = 10/442 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+MFPWLA+GHI+P++ LAK L+ R F++HLCST  NL+SIK+ I   +S SIRL+EL L
Sbjct  11    VLMFPWLAHGHISPYLELAKRLSKRNFIIHLCSTKANLSSIKSKIGDKFSHSIRLVELDL  70

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
               +  LP  Y TTNGLP +L  +LK   + ++P F+ +L ++ PDLL++D +  WA  VA
Sbjct  71    G-TDLLPSCYHTTNGLPPNLMPSLKLAFENSKPQFSNILASIKPDLLVYDFLQPWAPLVA  129

Query  496   LSLNIPSVRFFTASAAMCSY-FTHMLTNPGAEYPFPAL-RLRQYEQTKTRELMNQETRNF  669
                ++P+V F T+S+ M +Y F      P  E+P   L   R YE      L+       
Sbjct  130   SIHHVPAVEFITSSSTMTAYMFNFFKGKPMTEFPHHDLIAYRDYEFVHRANLL-ASNEAV  188

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE---  840
             KR   L    +  ++L+   +E+EG+YIDYL  L+  K+V +G   Q P    HETE   
Sbjct  189   KRNAFLGIARSNRIILIKGFKEIEGEYIDYLGNLLGKKIVPVGPLVQDP---THETEGSK  245

Query  841   LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEA  1020
             + +WL  K   STV+VSFGSEYFL+ EDL E+A GLE+SGVNF+WV+RFPKGE+ ++EE+
Sbjct  246   IMEWLDGKGKCSTVYVSFGSEYFLKPEDLRELALGLELSGVNFVWVVRFPKGEKKTLEES  305

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP GFLER+G RG +VEGWAPQA+IL H S GGFVSHCG +S+MES+  GVPIIAMPMHL
Sbjct  306   LPLGFLERVGGRGLVVEGWAPQAQILVHESIGGFVSHCGCSSMMESMKFGVPIIAMPMHL  365

Query  1201  DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRL  1380
             DQP+NARL+ +IG  VEV R   G L +EE+AA +R  VGG+  E ++R  + +SE ++ 
Sbjct  366   DQPLNARLVGKIGVGVEVGRSGDGLLEKEEVAAVIRRVVGGDEAESVRREARVMSEKIKA  425

Query  1381  AGNREMDAVVAELEKLCNKPER  1446
              G+ E+D VV E  KLC+  ++
Sbjct  426   KGDEEIDVVVEEFVKLCSTTKK  447



>ref|XP_006436669.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
 gb|ESR49909.1| hypothetical protein CICLE_v10033610mg [Citrus clementina]
Length=435

 Score =   423 bits (1088),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 219/444 (49%), Positives = 293/444 (66%), Gaps = 31/444 (7%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
              V+MFPWLA+GH+ PF+ L K    R  F ++ CSTP  L+SIK  +  ++S SI+L+EL
Sbjct  9     CVLMFPWLAHGHVFPFLELTKKFTKRSNFYIYFCSTPAILDSIK--LSDNFSLSIQLIEL  66

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP  P+LPPHY TT GLPLHL   LKK   MA   F  +LK +NPDLLI+D +  WA  
Sbjct  67    HLPSLPELPPHYHTTKGLPLHLMPTLKKAFDMASSSFFNILKNVNPDLLIYDFIQPWAPT  126

Query  490   VALSLNIPSVRFFTASAAMCSYFTHML----TNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             +ALSLNIPSV F T+SA M  +  H      +    E+PF ++ + +Y + K   L++  
Sbjct  127   LALSLNIPSVLFLTSSATMGGFLFHTFEKTPSEDDGEFPFSSIFIHEYMKPKFSHLVDSS  186

Query  658   TRNFKREE----TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PP  822
             +   K ++      D+  N  ++L+ + R+++GKYIDYLS LMK K+V +G   + P   
Sbjct  187   SNGIKDKDKFLQCCDSSCN--VILIKTFRDLQGKYIDYLSVLMKKKLVPVGPLVEDPVEE  244

Query  823   VDHE--TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
              DHE   E+  WL +K  SSTVFVSFGSEYFL KE++E IA GLE SGV+FIWV+RFP G
Sbjct  245   DDHEEGIEIIQWLDKKERSSTVFVSFGSEYFLPKEEMEGIALGLEFSGVDFIWVVRFPSG  304

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
              ++ V+E LPK FLER  ER  +VEG               FVSHCGW+S+MES+ LGVP
Sbjct  305   VKVKVDEELPKHFLERTKERAMVVEG---------------FVSHCGWSSVMESMKLGVP  349

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQP+NARL+ ++G  +EV R+E G++ REEMA  ++E V  +NGEKL+R  +
Sbjct  350   IIAMPMHLDQPLNARLVEDVGVGMEVRRNENGRIEREEMARVIKEVVVEKNGEKLRRKAR  409

Query  1357  RISENLRLAGNREMDAVVAELEKL  1428
              +SEN+R  G+ E+D VV EL +L
Sbjct  410   EMSENIRKKGDEEIDEVVDELSQL  433



>gb|KCW51496.1| hypothetical protein EUGRSUZ_J01013 [Eucalyptus grandis]
Length=423

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 286/434 (66%), Gaps = 24/434 (6%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+PF+ LAK L+ R F +HLCSTP NL+SIK  I   YS SI L+ELHL
Sbjct  7     VLMLPWLAHGHISPFLELAKRLSTRNFHIHLCSTPVNLSSIKPKISDKYSSSIELVELHL  66

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GLP HL + LK    MA   F++++K+L PDLLI D+   WA +VA
Sbjct  67    PSLPDLPPHYHTTKGLPPHLMNTLKVAFDMASLGFSDIVKSLGPDLLICDLFQPWAAEVA  126

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
              S  +P+V FF   A   S+  HM+ N           L+  E++           NF  
Sbjct  127   KSHGLPTVVFFIVGARTISFMFHMIKNASTRVKDEDRVLQSVERSS----------NF--  174

Query  676   EETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWL  855
                         +L+ + RE++GKY+DYLS L   KV+++G   + P  ++    + +WL
Sbjct  175   ------------ILLKTFREMDGKYMDYLSSLSGKKVLTVGPLVEDPDNMEDGDSIIEWL  222

Query  856   ARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGF  1035
              ++  SST+FVSFGSEYFL +++ EEIA+GLE+S VNFIWV+RFP GE I +EEALPKGF
Sbjct  223   DKREQSSTIFVSFGSEYFLTEKEREEIAHGLELSNVNFIWVIRFPVGESIELEEALPKGF  282

Query  1036  LERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMN  1215
             LER+ +RG +++GWAPQ KIL H S GGFVSHCGW S+MES+  GVPIIAMPM  DQP+N
Sbjct  283   LERVRDRGLVIDGWAPQGKILEHPSIGGFVSHCGWGSLMESMKSGVPIIAMPMLHDQPLN  342

Query  1216  ARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNRE  1395
             AR++ E+G  +EV+R+E G+L R E+   +++ V  ++G+ +++  K +S+ +R  G  E
Sbjct  343   ARMVEEVGVGLEVKRNESGELERLEIGKVIKDVVVEKDGDSVRKKTKEMSDIIRNKGEEE  402

Query  1396  MDAVVAELEKLCNK  1437
             +D VV  L +LC +
Sbjct  403   LDEVVDALVQLCAR  416



>ref|XP_009335994.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=466

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/448 (50%), Positives = 299/448 (67%), Gaps = 16/448 (4%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L DR  F + +CSTP NL+ IK  +PQ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTDRRDFHILICSTPVNLSCIKPKLPQKYSHCIEFVEL  70

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   +LPPHY TTNGLP HL   LKK   M+  +F+++L TL PDLLI+D +  WA  
Sbjct  71    HLPHD-ELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSQILSTLKPDLLIYDFLQPWAPS  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +A S NIP+V FFT SAA+ S++ H L NP   +P+P++ LR YE  K   ++       
Sbjct  130   LASSHNIPAVEFFTTSAAVISFYVHHLKNPNVLFPYPSIYLRDYETKKFSSVLESSANGI  189

Query  670   KREET--LDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
             K  E   L +  ++ ++LV +S E+E KYID LS+LM+ K+V +G+  Q P    VD E+
Sbjct  190   KDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVGSLVQDPMDQKVDEES  249

Query  838   ELTDWLARKPA-------SSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
              +  WL  +         +S VFVSFGSEYFL KE+++EIA GLE+S V+FIWV+RFPK 
Sbjct  250   SIIKWLNERERXXXXXERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPKE  309

Query  997   EEIS-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             E+ + VE+ LPKGF ER+GERG +VE WAPQAKIL H S GGFVSHCGW+S++ES+  GV
Sbjct  310   EKSTRVEDVLPKGFGERVGERGMIVEDWAPQAKILKHSSVGGFVSHCGWSSVLESIKFGV  369

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRN  1350
             PIIAMPM LDQP+NARL+ E+G  VEV R    G L REE+A  +R+ V  + GE ++  
Sbjct  370   PIIAMPMQLDQPLNARLVEEVGVGVEVIRTGGGGSLRREEVAKVIRDVV-EKIGEGVRIK  428

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCN  1434
                +S+ ++   + EMD V  EL ++C 
Sbjct  429   ALELSDKMKKKEDEEMDGVAEELMQICT  456



>ref|XP_008375609.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=460

 Score =   421 bits (1082),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 293/441 (66%), Gaps = 8/441 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L DR  F + +CS+P NL+SIK  +PQ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTDRRDFHILICSSPVNLSSIKPKLPQKYSHCIEFVEL  70

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   +LPPHY TTNGLP HL   LKK   M+  +F+ +L+TL PDLLI+D +  WA  
Sbjct  71    HLPHE-ELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILRTLKPDLLIYDFLQPWAPS  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +A S NIP+V FFT SAA+ S+  H L NP   +P+P++ LR YE  K   ++       
Sbjct  130   LASSHNIPAVEFFTTSAAVISFLVHHLKNPNVIFPYPSIYLRDYETKKFSSVLESSANGI  189

Query  670   KREE--TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
             K  E   L +  ++ ++LV +S E+E KYID LS+LM+ K+V + +  Q P    VD E+
Sbjct  190   KDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVSSLVQDPMDQKVDEES  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VE  1014
              +  WL  +  +S VFVSFGSEYFL KE+L+EIA GLE+S V+FIWV+RFPK E+ + VE
Sbjct  250   SIIKWLNERERASVVFVSFGSEYFLSKEELQEIALGLELSQVSFIWVIRFPKEEKSTRVE  309

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGF ER+GERG +VE WA   KIL H S GGFVSHCGW+ ++ES+  GVPIIAMPM
Sbjct  310   DVLPKGFGERVGERGMIVEDWAXXVKILKHSSVGGFVSHCGWSXVLESIKFGVPIIAMPM  369

Query  1195  HLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
              LDQP+NARL+ E+G  VEV R    G L REE A  +R+ V  + GE ++     +S+ 
Sbjct  370   QLDQPLNARLVEEVGVGVEVIRTGGGGSLXREEXAKVIRDVVVEKIGEGMRIKALELSDK  429

Query  1372  LRLAGNREMDAVVAELEKLCN  1434
             ++   + EMD V  EL ++C 
Sbjct  430   MKKKEDEEMDGVAEELMQICT  450



>ref|XP_010525697.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Tarenaya 
hassleriana]
Length=454

 Score =   419 bits (1077),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 293/441 (66%), Gaps = 9/441 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWLA+GH++PF+ LAK +++R F V+  ST  NLNS +  I   YS+ I+L+EL 
Sbjct  10    SVLMFPWLAHGHVSPFLELAKEMSERNFQVYFVSTLVNLNSFRPKIGSKYSEYIQLVELK  69

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP   +LPPHY TTNGLP HL + L K L MA  +F  LLKTLNPDL+I+D +  W  ++
Sbjct  70    LPNLSELPPHYHTTNGLPPHLINTLHKALDMASFNFLSLLKTLNPDLVIYDFMQQWVPEM  129

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
               SLNIPSV F ++SAA  SY  H    P  ++PFP L   Q    +    ++Q+  + +
Sbjct  130   VSSLNIPSVHFLSSSAAFTSYLLHPNLRPNEKFPFPNLSDIQGCLDRGIARISQKPSDNE  189

Query  673   REE----TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF-QAPPPVDHET  837
               +     +    +  ++LV S RE+EG+ +DYL  L+  K+V +G    Q+    + ET
Sbjct  190   VSDIERFAMSLERSSRLILVKSFRELEGECLDYLQSLLNKKMVPVGPLVRQSETDENDET  249

Query  838   E--LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV  1011
                  +WL +K   STVFVSFGSE FL  ED+EEIA+GLE+SGVNFIWV+RFP GEE + 
Sbjct  250   SKSCIEWLDKKEKGSTVFVSFGSEIFLSAEDIEEIAFGLELSGVNFIWVIRFPSGEEKTT  309

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             +E LPKGF ER+ ERG ++E WAPQA+IL H S GGF+SHCGW+SIMESL LGVPIIA P
Sbjct  310   KETLPKGFTERVNERGIIIEKWAPQARILRHESVGGFLSHCGWSSIMESLKLGVPIIASP  369

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKL-KRNVKRISE  1368
             +H DQP+NA+L+ E+G  +EV+R+EKG   R+E+A  + E V G NG KL K+    +S+
Sbjct  370   VHNDQPVNAKLVEEVGVGMEVKRNEKGGFERKEIAKVIEEVVKG-NGHKLVKKRAAEMSD  428

Query  1369  NLRLAGNREMDAVVAELEKLC  1431
              +   G++++D  V  L  LC
Sbjct  429   RISKNGDKDIDKAVEVLRSLC  449



>ref|XP_009336996.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=461

 Score =   419 bits (1076),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 296/445 (67%), Gaps = 8/445 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L + R F + +CSTP NL+SIK  +P+ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTSHRDFHIFICSTPVNLSSIKPKLPKKYSHFIEFVEL  70

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   +LPPHY TTNGLP HL   LKK   M+  +F+ +LKTL PDLLI+D +  WA  
Sbjct  71    HLPHD-ELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILKTLKPDLLIYDFLQPWAPS  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +ALS NIP+V F T SAA  S F H   NP  ++P P++ LR YE  +   L+       
Sbjct  130   LALSHNIPAVEFTTTSAASMSLFLHHHKNPNVQFPHPSIYLRDYETKEFSNLLESSANGI  189

Query  670   KREE--TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
                E   L +  ++ ++LV +S E+E K +DYLS+L + K+V +G+  Q P    VD E+
Sbjct  190   TNVERVLLCSDLSRNIILVKTSGEIESKCVDYLSQLTEKKIVPVGSLVQDPMDQQVDEES  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VE  1014
              +  WL     +S VFVSFGSEYFL KE+++EIA GLE+S V+FIWV+RFPK ++ + VE
Sbjct  250   SIIKWLXXXERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPKEDKSTRVE  309

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGF ER+GERG +V+ W PQAKIL H S GGFVSHCGW+S++ES+  GVPIIAMPM
Sbjct  310   DVLPKGFGERVGERGMIVDDWTPQAKILKHSSVGGFVSHCGWSSVLESIKFGVPIIAMPM  369

Query  1195  HLDQPMNARLMVEIGAAVEVERDEK-GKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
              LDQP+NARL+VE+G  VEV R  + G L REE+A  +R+ V  + GE +      + +N
Sbjct  370   QLDQPVNARLVVEVGVGVEVIRTGRGGSLQREEVAKVIRDVVVEKIGEGVMIKAFELRDN  429

Query  1372  LRLAGNREMDAVVAELEKLCNKPER  1446
             ++   + EMD VV EL +LC    R
Sbjct  430   MKKKDDEEMDRVVEELMQLCTATTR  454



>gb|AGR44632.1| UDP-glucosyltransferase 94B1 [Panax ginseng]
Length=442

 Score =   418 bits (1074),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 291/441 (66%), Gaps = 14/441 (3%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             R S+ + P+LA+GHI+PF  LAK LA R   V LCSTP NL+SIK+   +  S SI+L+E
Sbjct  7     RISIALLPFLAHGHISPFFELAKQLAKRNCNVFLCSTPINLSSIKD---KDSSASIKLVE  63

Query  307   LHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LHLP SPDLPPHY TTNGLP HL   L+   + A P F+E+LKTLNPDLLI+D    WA 
Sbjct  64    LHLPSSPDLPPHYHTTNGLPSHLMLPLRNAFETAGPTFSEILKTLNPDLLIYDFNPSWAP  123

Query  487   KVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTK-TRELMNQETR  663
             ++A S NIP+V F T +AA  S   H   NPG +YPFP      Y+ +  T E  + +  
Sbjct  124   EIASSHNIPAVYFLTTAAASSSIGLHAFKNPGEKYPFPDF----YDNSNITPEPPSADNM  179

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
                 +       +  ++L+ S RE+EGKYID LS L    +V +G   Q P     D +T
Sbjct  180   KLLHDFIACFERSCDIILIKSFRELEGKYIDLLSTLSDKTLVPVGPLVQDPMGHNEDPKT  239

Query  838   E-LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
             E + +WL ++  S+ VFV FGSEYFL  E+LEE+A GLEIS VNFIW +R  +GE+  + 
Sbjct  240   EQIINWLDKRAESTVVFVCFGSEYFLSNEELEEVAIGLEISTVNFIWAVRLIEGEKKGI-  298

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
               LP+GF++R+G+RG +VEGWAPQA+ILGH STGGFVSHCGW+SI ES+  GVP+IAM  
Sbjct  299   --LPEGFVQRVGDRGLVVEGWAPQARILGHSSTGGFVSHCGWSSIAESMKFGVPVIAMAR  356

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+N +L  E+G  +EV RDE GK  RE +A  +R+ V  ++GE ++R  + +SE +
Sbjct  357   HLDQPLNGKLAAEVGVGMEVVRDENGKYKREGIAEVIRKVVVEKSGEVIRRKARELSEKM  416

Query  1375  RLAGNREMDAVVAELEKLCNK  1437
             +  G +E+D  + EL ++C K
Sbjct  417   KEKGEQEIDRALEELVQICKK  437



>ref|XP_002523035.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis]
 gb|EEF39339.1| glucosyl/glucuronosyl transferases, putative [Ricinus communis]
Length=420

 Score =   417 bits (1072),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 209/403 (52%), Positives = 275/403 (68%), Gaps = 8/403 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SV+MFPWLA+GHI+PF+ LAK LA R F V+LCSTP NL+SIK N+   Y  SI+L+ELH
Sbjct  11    SVLMFPWLAHGHISPFLELAKKLAKRNFYVYLCSTPVNLDSIKQNLSPKYLLSIQLVELH  70

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  PDLP H  TT GLP HL   LK    MA P+F+ +L+TL PDLLI+D +  WA  +
Sbjct  71    LPSLPDLPSHCHTTKGLPPHLMTTLKTAFDMATPNFSNILETLRPDLLIYDFLQPWAAAL  130

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRELMNQETRNF  669
             ALS +IP+V F  +S AM ++  H   N   + +PFP +  +     K  E++   +   
Sbjct  131   ALSFDIPAVLFLCSSMAMSTFCRHFSENSSDDHFPFPEIYPKWCLDKKVLEVLESSSNER  190

Query  670   KREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ---APPPVDHE  834
             K +  ++    ++  ++L  + RE+EGKYIDYLS  +  K+V +G   Q    P   D +
Sbjct  191   KDKHRVNQCIERSYHLILAKTFRELEGKYIDYLSVKLMKKIVPVGPLVQEDNIPIHEDEK  250

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              E+  WL +K  SS VFVSFGSEYFL  E+ EEIA GLE+S VNFIWV+RFP GEEI +E
Sbjct  251   MEVIQWLEKKEPSSAVFVSFGSEYFLSSEEREEIANGLELSKVNFIWVVRFPAGEEIKLE  310

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             +ALPKG++ER+ E+G +VEGW PQAK+LGH S GGFVSHCGW+SIMES+  GVP+IAMPM
Sbjct  311   DALPKGYIERVKEKGLIVEGWLPQAKMLGHSSIGGFVSHCGWSSIMESMKFGVPVIAMPM  370

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKG--KLHREEMAAALRETV  1317
             +LDQP+NAR++ E G  +EV R+ K    L REE+A  +R+ V
Sbjct  371   NLDQPLNARVVEEAGVGIEVNRNIKSGEGLDREEIAKTIRKVV  413



>ref|XP_009337016.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=454

 Score =   418 bits (1074),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 296/441 (67%), Gaps = 14/441 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L DR  F + +CSTP NL+ IK  +PQ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTDRRDFHILICSTPVNLSCIKPKLPQKYSHCIEFVEL  70

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   +LPPHY TTNGLP HL   LKK   M+  +F+++L TL PDLLI+D +  WA  
Sbjct  71    HLPHD-ELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSQILSTLKPDLLIYDFLQPWAPS  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +A S NIP+V FFT SAA+ S++ H L NP   +P+P++ LR YE  K   ++       
Sbjct  130   LASSHNIPAVEFFTTSAAVISFYVHHLKNPNVLFPYPSIYLRDYETKKFSSVLESSANGI  189

Query  670   KREE--TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
             K  E   L +  ++ ++LV +S E+E KYID LS+LM+ K+V +G+  Q P    VD E+
Sbjct  190   KDVERALLCSDRSRNIILVKTSGEIESKYIDSLSKLMEKKIVPVGSLVQDPMDQKVDEES  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VE  1014
              +  WL     +  VFVSFGSEYFL KE+++EIA GLE+S V+FIWV+RFPK ++ + VE
Sbjct  250   SIIKWL-----NEIVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPKEDKSTRVE  304

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGF ER+GERG +V+ W PQAKIL H S GGFVSHCGW+S++ES+  GVPIIAMPM
Sbjct  305   DVLPKGFGERVGERGMIVDDWTPQAKILKHSSVGGFVSHCGWSSVLESIKFGVPIIAMPM  364

Query  1195  HLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
              LDQP+NARL+ E+G  VEV R    G L REE+A  +R+ V  + GE ++     +S+ 
Sbjct  365   QLDQPLNARLVEEVGVGVEVIRTGGGGSLRREEVAKVIRDVV-EKIGEGVRIKALELSDK  423

Query  1372  LRLAGNREMDAVVAELEKLCN  1434
             ++   + EMD V  EL ++C 
Sbjct  424   MKKKEDEEMDGVAEELMQICT  444



>ref|XP_008231995.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Prunus mume]
Length=441

 Score =   416 bits (1069),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 298/442 (67%), Gaps = 12/442 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG--FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             V+M PWLA+GHI+PF+ LAK LA++   F + +CSTP NL+SIK  + + YS  I  +EL
Sbjct  4     VLMLPWLAHGHISPFLELAKKLANKNNNFYIFICSTPVNLSSIKPKLSEEYSHCIEFVEL  63

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   DLPPHY TTNGLP HL   LKK   MA P+F+ +LKTL PDLLI+D +  WA  
Sbjct  64    HLPHD-DLPPHYHTTNGLPPHLMATLKKAFDMASPNFSNILKTLKPDLLIYDFLQPWAPS  122

Query  490   VALSLNIPSVRFFTASAAM-CSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
             +AL  NIP++ F   +AA+  S  TH   NP A++P   L LR Y+  K        +  
Sbjct  123   LALLQNIPAIEFSIMNAALLSSVCTHDFNNPTAKFP---LHLRDYDIRKFHNQCEFSSNG  179

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHE  834
              K  + +     ++  M+LV +SRE+E KY+DYLS L+K K+V +G   Q P    +D E
Sbjct  180   IKDGDRIQQCCARSCKMILVKTSREIEAKYVDYLSGLVKKKIVPVGPLVQDPMDQTLDEE  239

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-ISV  1011
             T +  WL ++  SS V+VSFGSEYFL KE++E+IA+GLE+S V+FIWV+RFPK E+   V
Sbjct  240   TWIMKWLNKRERSSVVYVSFGSEYFLSKEEIEDIAHGLELSKVSFIWVIRFPKEEKGTRV  299

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EE LP+GF ER+GE+G +VEGWAPQ+KIL H S GGFVSHCGW+S++ES+  GVPIIA+P
Sbjct  300   EEVLPEGFSERVGEKGMIVEGWAPQSKILEHYSVGGFVSHCGWSSVLESIKFGVPIIALP  359

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             M  DQP+NARL+ E+G  VEV+R  +G    EE+A  +R+ V  + GE +++    + +N
Sbjct  360   MLYDQPINARLVEEVGVGVEVKRTAEGSFQSEEVAKVIRDVVVDKIGEGVRKKALELRDN  419

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             ++   + E++ VV EL +LC +
Sbjct  420   MKKKEDEEINGVVEELMQLCTR  441



>ref|XP_008344699.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=461

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 298/445 (67%), Gaps = 8/445 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             S++M PWL +GHI+PF+ LAK L + R F + +CSTP NL+SIK  +P+ YS  I  +EL
Sbjct  11    SILMLPWLGHGHISPFLELAKKLTSHRDFHIFICSTPVNLSSIKPKLPKKYSHCIEFVEL  70

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
              LP   +LPPHY TTNGLP HL   LKK   M+  +F+ +LKTL PDLL++D +  WA  
Sbjct  71    LLPHD-ELPPHYHTTNGLPPHLMPTLKKAFDMSSDNFSHILKTLKPDLLVYDFLQPWAPS  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +ALS NIP+V F T SA++ S + H L NP  ++P+P++ LR YE  +   L+       
Sbjct  130   LALSHNIPAVEFTTTSASLMSLWFHHLKNPNVQFPYPSIYLRDYEIKEFSNLIESSANGI  189

Query  670   KREE--TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHET  837
                E   L +  ++ ++LV +S E+E K +DYLS+L + K+V +G+  Q P    VD E+
Sbjct  190   TNGERVLLCSHRSRNIILVKTSGEIESKCVDYLSKLTEKKIVPVGSLVQDPMDQKVDEES  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VE  1014
              +  WL  +  +S VFVSFGSEYFL KE+++EIA GLE+S V+FIWV+RFPK E+ + VE
Sbjct  250   SIIKWLNERERASVVFVSFGSEYFLSKEEIQEIALGLELSQVSFIWVIRFPKEEKSTRVE  309

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGF ER+GERG +VE WAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIAMPM
Sbjct  310   DVLPKGFGERVGERGMIVEDWAPQAKILKHSSVGGFVSHCGWSSVLESIKFGVPIIAMPM  369

Query  1195  HLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
              LDQP+NARL+ E+G  VEV R    G L R+E+A  + + V  + GE ++     + +N
Sbjct  370   QLDQPVNARLVEEVGVGVEVIRTGGGGNLQRQEVAKVIIDVVVEKIGEGVRIKALELRDN  429

Query  1372  LRLAGNREMDAVVAELEKLCNKPER  1446
             ++   + EMD VV EL +LC    R
Sbjct  430   MKKKEDEEMDGVVEELMQLCTATTR  454



>ref|XP_011032817.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Populus 
euphratica]
Length=436

 Score =   414 bits (1064),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/444 (48%), Positives = 283/444 (64%), Gaps = 21/444 (5%)
 Frame = +1

Query  121   ATRRSVV---MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             AT R VV   MFPWLAY HI PF+ LAK L++R F ++LCS+P NL  IK N+ +    S
Sbjct  3     ATNRRVVRVLMFPWLAYSHIHPFLELAKKLSERNFYIYLCSSPANLGHIKENLLEMNFPS  62

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+ELHLP SPDLPPHY TT GLP HL   L +    A   F+ +L TL PDLLI D  
Sbjct  63    IQLVELHLPSSPDLPPHYHTTKGLPNHLLGNLMQAFDTASSSFSGILTTLRPDLLICDFF  122

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA  +ALSLNIP+V+F  +     S   H     G              Q   ++ + 
Sbjct  123   QPWAPALALSLNIPTVQFVVSGNKANSVAVHAFKKSGVVI-----------QDSAKDFLF  171

Query  652   QETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVD  828
                R  +  E      +  +MLV SSRE+EGKY+D LS +   +V+ +G   Q P    D
Sbjct  172   IRDRILQHLEQ-----SSGIMLVRSSREIEGKYLDDLSAVTMKRVLPVGPLVQDPIAEDD  226

Query  829   HETELTDWLARK-PASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
              +TE+T+WL R+ P SS ++V+FGSE +L KED EE+A GL +S V+FIWVLRFP+GEEI
Sbjct  227   KKTEITEWLNRRDPCSSVIYVAFGSENYLSKEDREELALGLLLSNVDFIWVLRFPRGEEI  286

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
             S  EALP+GF+E + ERG +VE WAPQ +IL H S GGF+SHCGW S++ES+  GVP+IA
Sbjct  287   SAREALPEGFIEMVSERGLIVEEWAPQKRILSHPSIGGFLSHCGWGSVLESMKFGVPLIA  346

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPMH+DQP+NA  +VEIG  +E++RD+ GK+ REE+A  +R+  G   GE L++  + +S
Sbjct  347   MPMHIDQPLNAEFLVEIGVGLEIKRDKNGKIEREEVARVIRDLAGERTGEHLRKKARELS  406

Query  1366  ENLRLAGNREMDAVVAELEKLCNK  1437
             + +R    +E+D VV +L  L  +
Sbjct  407   DCIRDKAGQEIDEVVNDLVHLVGR  430



>ref|XP_007218014.1| hypothetical protein PRUPE_ppa005830mg [Prunus persica]
 gb|EMJ19213.1| hypothetical protein PRUPE_ppa005830mg [Prunus persica]
Length=441

 Score =   413 bits (1062),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 296/441 (67%), Gaps = 12/441 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG--FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             V+M PWLA+GHI+PF+ LAK L ++   F + +CSTP NL+SIK  + + YS  I  +EL
Sbjct  4     VLMLPWLAHGHISPFLELAKKLTNKNKDFYIFICSTPVNLSSIKPKLSEEYSHCIEFVEL  63

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP   DLPPHY TTNGLP HL   LKK   MA P+F+ +LKTL PDLLI+D +  WA  
Sbjct  64    HLPHD-DLPPHYHTTNGLPPHLMATLKKTFDMASPNFSNILKTLKPDLLIYDFLQPWAPS  122

Query  490   VALSLNIPSVRFFTASAAM-CSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
             +AL  NIP++ F   +AA+  S   H L NP A++P   L LR Y+  K        +  
Sbjct  123   LALLQNIPAIEFSIMNAALLSSVCAHDLNNPTAKFP---LHLRDYDIRKFHNQCEFSSNG  179

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHE  834
              K  + +     ++  ++LV +SRE+E KY+DYLS+L+K K+V +G   Q P    +D E
Sbjct  180   IKDGDRIQQCCARSCKIILVKTSREIEAKYVDYLSDLVKKKIVPVGPLVQDPMGQTLDEE  239

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-ISV  1011
             T +  WL ++  SS V+VSFGSEYFL KE++E+IA+GLE+S V+FIWV+RFPK E+   V
Sbjct  240   TWIMKWLNKRERSSVVYVSFGSEYFLSKEEIEDIAHGLELSKVSFIWVIRFPKEEKGTRV  299

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EE LP+GF ER+GE+G +VEGWAPQ+KIL H S GGFVSHCGW+S++ES+  GVPIIA+P
Sbjct  300   EEVLPEGFSERVGEKGMIVEGWAPQSKILEHYSVGGFVSHCGWSSVLESIKFGVPIIALP  359

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             M  DQP+NARL+ E+G  VEV+R  +G    EE+A  +R+ V  + GE +++    + +N
Sbjct  360   MLYDQPINARLVEEVGVGVEVKRTAEGSFQSEEVAKVIRDVVVDKIGEGVRKKALELRDN  419

Query  1372  LRLAGNREMDAVVAELEKLCN  1434
             ++   + E D VV EL +LC 
Sbjct  420   MKNKEDAERDGVVEELMQLCT  440



>ref|XP_010248422.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nelumbo 
nucifera]
Length=531

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/444 (47%), Positives = 299/444 (67%), Gaps = 11/444 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             +V+M PWLA+GHI+PF+ + K L+ R F V+ CSTP NL SI++ + +    SI+L+E+H
Sbjct  9     TVLMLPWLAHGHISPFLEVGKRLSKRNFHVYFCSTPVNLCSIRDQLSEKIFPSIQLVEIH  68

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P LPPHY TT GLP HL   LK+   MA+P F  LL+TL PDLLI+D +  WA  +
Sbjct  69    LPTLPGLPPHYHTTKGLPPHLMPTLKQAFDMAKPSFLNLLRTLKPDLLIYDFIQPWAPTL  128

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A SL+IP+V+F     A  ++F H+  NPG ++PFPA+ L ++E  K  +L+        
Sbjct  129   ASSLDIPAVQFLITGGATSAFFYHICKNPGVKFPFPAIYLEKHEDRKITQLLESSANGLT  188

Query  673   REETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIG----TTFQAPPPVDHE  834
              +  L    +Q+   ++  + RE+E KYIDY S +   +++ +G     T Q     + +
Sbjct  189   DKVRLIQSIDQSSRFIMFKTFREIEEKYIDYYSVITGKEILPVGPLVLDTTQNED--NQQ  246

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
              E  +WL +K   S VFVSFGSE+FL K +LEE+AYGLE+SGV+FIWV+RFP+GE++S++
Sbjct  247   WESMEWLNKKDPCSVVFVSFGSEFFLSKAELEEMAYGLELSGVSFIWVVRFPEGEKMSLD  306

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             EALP+GFL ++GE+G +VEGWAPQA+IL H S GGFVSH G  S+ME +  GVP++AMPM
Sbjct  307   EALPEGFLGKVGEKGIVVEGWAPQAQILDHSSIGGFVSHSGSGSVMEGMKFGVPLVAMPM  366

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP N+R++VE+G  VEV+R++ G   R E A A++E V  + GE+++R  + +SE +
Sbjct  367   HLDQPTNSRVVVELGVGVEVKREKDGSFLRGEAAKAIKEVVVEKQGEEVRRKARELSEKI  426

Query  1375  RLAGNREMDAVVAELEKLCNKPER  1446
             R     EMD V  +L +LC+  +R
Sbjct  427   R---EEEMDMVAEKLGELCSNSKR  447



>ref|XP_002270285.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase 
[Vitis vinifera]
Length=453

 Score =   411 bits (1056),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 282/421 (67%), Gaps = 6/421 (1%)
 Frame = +1

Query  130   RSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ--SYSQSIRLL  303
             R V+M PWL +GHI+PF+ LAK LA R F ++LCSTP NL  +++N+    S   SI+L+
Sbjct  8     RRVLMLPWLGHGHISPFLELAKKLAQRNFYIYLCSTPINLKPLRDNLCHRGSTISSIQLI  67

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             ++HLP S +LP HY TT  LP HL   LK     A P F ++LKT+ P L+I+D +  WA
Sbjct  68    DIHLPSSSELPSHYHTTKDLPPHLMSTLKAAFDAARPAFCDILKTIKPSLVIYDYLQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTH-MLTNPGAEYPFPALRLRQYEQTKTRELMNQET  660
                A   NI ++ F ++ AA CS++ H  L NPG +YPFPAL   + E+ K  + ++   
Sbjct  128   SMAACEENIRAIVFLSSGAACCSFYCHGSLDNPGEKYPFPALCFPEIERRKITQFLHYTA  187

Query  661   RNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE  834
                   E       ++  ++L+ +S+E+E KYIDYLS L+   ++ +G   Q     D +
Sbjct  188   NGLTNMERFRGSMARSSNIVLIKTSKEIEAKYIDYLSVLVGKTIIPVGPLVQDAANRDDD  247

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
             T + DWL++K   S VFVSFG+EYFL  E++EEIA+GLE+S V F+WV+RF  G+E ++ 
Sbjct  248   TVIMDWLSKKNPFSVVFVSFGTEYFLSVEEIEEIAHGLELSTVGFLWVVRFHGGDEKTIH  307

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             E LP+GFL+RIGERG +VEGWAPQAKIL H S GGFVSHCGW+S +E++  GVPIIA PM
Sbjct  308   EVLPEGFLQRIGERGMVVEGWAPQAKILCHSSIGGFVSHCGWSSTLEAIMFGVPIIATPM  367

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+NA+L+V+IG  +EV+R  + +L  +E+A  +++ V  E G++L+R  K ++E L
Sbjct  368   HLDQPLNAKLVVDIGVGMEVKRVNE-RLDNKEVARVIKKAVVEEEGKELRRKAKELAERL  426

Query  1375  R  1377
             R
Sbjct  427   R  427



>ref|XP_010649358.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Vitis 
vinifera]
Length=450

 Score =   410 bits (1055),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 220/448 (49%), Positives = 300/448 (67%), Gaps = 19/448 (4%)
 Frame = +1

Query  118   MATRRS--VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             M  R S  VV+ PWLA+GHI+PF+ LAK L+ R F ++ CSTP NL+SIK  + +  S S
Sbjct  1     MDVRSSMKVVLLPWLAHGHISPFLELAKKLSRRNFYIYFCSTPVNLSSIKGKLTEEDSLS  60

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+E+HLP  PDLPPHYQTTNGLP HL   LKK   MA P F ++L TLNPDL+I+D++
Sbjct  61    IELVEIHLPSLPDLPPHYQTTNGLPPHLMPTLKKAFDMASPGFADILTTLNPDLIIYDIL  120

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA   A S NIP+V F +  A + S           E P   + L+  E+ K   ++N
Sbjct  121   QPWAPVAASSQNIPAVLFLSTGATLLSVLLQ-------EQPITGIPLQDSERIK---MLN  170

Query  652   QETRNFKREETLDTPANQAM------MLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
                 +   E T +  A Q +      +L+ + R++EGK+ID  S L + KVV +G   Q 
Sbjct  171   HLADSSANEITDEARAAQCLKLSSNIILMRTFRDLEGKHIDQASCLTQKKVVPVGPLVQH  230

Query  814   PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                   + E+ +WL +K  SSTV VSFGSEYFL KE++EE+A+ LE+S V+FIWVLRFP+
Sbjct  231   TTDEFEKEEIIEWLDKKEESSTVLVSFGSEYFLSKEEMEEMAHALELSTVSFIWVLRFPQ  290

Query  994   GEEI-SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
              ++I SVEEALP+GFL R+GERG++V+ WAPQ +IL H STGGFVSHCGW+S+MESL  G
Sbjct  291   RDKIASVEEALPEGFLSRVGERGKVVKDWAPQREILNHSSTGGFVSHCGWSSVMESLKFG  350

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRN  1350
             VPI+A+PMHLDQP+NA+++  +G  VEV+RDE G+L REE+A  +++ V  ++GE + R 
Sbjct  351   VPIVAIPMHLDQPLNAKVVESVGVGVEVKRDENGRLDREEIAKVIKQVVVEKSGENVSRK  410

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCN  1434
             V+ +SE++R     E+  VV EL +LC 
Sbjct  411   VREMSESMRKQAEEEIAEVVEELVQLCK  438



>ref|XP_008345539.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=451

 Score =   411 bits (1056),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 213/442 (48%), Positives = 290/442 (66%), Gaps = 9/442 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVH--LCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             S++M  WLA+GHI+PF+ LAK L  +   +H  +CSTP NL SIK  + + YS  I  +E
Sbjct  11    SILMLXWLAHGHISPFLELAKKLTHKRNNLHFYICSTPVNLTSIKPKLSEKYSHCIEFVE  70

Query  307   LHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LHLP   +LPPHY TTNGLP HL   LKK   M+  +F+ +L+TL PDLLI+D +  WA 
Sbjct  71    LHLPHD-ELPPHYHTTNGLPPHLISTLKKAFDMSSSNFSNILQTLKPDLLIYDFLQPWAP  129

Query  487   KVALSLNIPSVRFFTASAA-MCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              +ALS NIP+V F T +AA + S F     N   ++PFP + LR YE    +  M   + 
Sbjct  130   SLALSHNIPAVEFCTMNAATIISTFVIHFNNSSLKFPFPXIHLRDYEIKMXKNQMEFLSN  189

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDH  831
                  + +    + +  ++LV +SRE+E KYIDYLS L+  K+V +G   Q P     D 
Sbjct  190   GLXDGDRIQQCCSSSCNIILVKTSREIEAKYIDYLSXLVGKKIVPVGPLVQDPLGQKTDE  249

Query  832   ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-  1008
             E+ +  WL ++   S V+VSFGSEYFL KE++EEIA+GLE+S V+FIWV+RFPK ++ + 
Sbjct  250   ESPIIQWLNKREKCSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWVIRFPKEDKTTK  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             VEE LPK F+ER+GERG +VEGWAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIAM
Sbjct  310   VEEVLPKWFVERVGERGXIVEGWAPQAKILQHPSVGGFVSHCGWSSVLESIKFGVPIIAM  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PM LDQP+NA+ + E+   VE +R E G L RE +A  + E V  + GE ++R    + +
Sbjct  370   PMQLDQPVNAKXVEEVBVXVEAKRAEGGGLQREAIAEXIGEVVVKKIGEGVRRKALEVRD  429

Query  1369  NLRLAGNREMDAVVAELEKLCN  1434
             N++   + EMD VV +L +LC 
Sbjct  430   NMKKIEDEEMDNVVEQLLQLCT  451



>dbj|BAF99027.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltransferase [Sesamum 
indicum]
Length=469

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 211/452 (47%), Positives = 295/452 (65%), Gaps = 11/452 (2%)
 Frame = +1

Query  118   MATRRS---VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             M TR+    ++MFPWLA+GHI+ F+ LAK+LA R F++++CS+  NLNSI  N+    S 
Sbjct  1     MDTRKRSIRILMFPWLAHGHISAFLELAKSLAKRNFVIYICSSQVNLNSISKNMSSKDSI  60

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             S++L+ELH+P +  LPP Y TTNGLP HL   LK+ L  A P F+ LL+TL PDL+++D 
Sbjct  61    SVKLVELHIPTTI-LPPPYHTTNGLPPHLMSTLKRALDSARPAFSTLLQTLKPDLVLYDF  119

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFT-HMLTNPGAEYPFPALRLRQYEQTKTREL  645
             +  WA + A S NIP++ F +  AA  S+   H       EYPFPA+  R++E       
Sbjct  120   LQSWASEEAESQNIPAMVFLSTGAAAISFIMYHWFETRPEEYPFPAIYFREHEYDNFCRF  179

Query  646   MNQETRNFKREETLD-TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
              + ++    +    D    +  ++L+ + RE+EG+Y+D+LS+L + + V +G   Q    
Sbjct  180   KSSDSGTSDQLRVSDCVKRSHDLVLIKTFRELEGQYVDFLSDLTRKRFVPVGPLVQEVG-  238

Query  823   VDHETELTD---WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
              D E E  D   WL  K   STVF SFGSEYFL   ++EEIAYGLE+SG+NFIWV+RFP 
Sbjct  239   CDMENEGNDIIEWLDGKDRRSTVFSSFGSEYFLSANEIEEIAYGLELSGLNFIWVVRFPH  298

Query  994   GEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
             G+E I +EE LP+GFLER+  RG +VEGWA Q +IL H S GGF+SHCGW+S+ME +  G
Sbjct  299   GDEKIKIEEKLPEGFLERVEGRGLVVEGWAQQRRILSHPSVGGFLSHCGWSSVMEGVYSG  358

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRN  1350
             VPIIA+PMHLDQP NARL+  +G   EV R  +G L R E+A  +++ V G++GE L+R 
Sbjct  359   VPIIAVPMHLDQPFNARLVEAVGFGEEVVRSRQGNLDRGEVARVVKKLVMGKSGEGLRRR  418

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             V+ +SE +R  G  E+D++V EL  +  + ER
Sbjct  419   VEELSEKMREKGEEEIDSLVEELVTVVRRRER  450



>ref|XP_011076907.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=478

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 211/452 (47%), Positives = 295/452 (65%), Gaps = 11/452 (2%)
 Frame = +1

Query  118   MATRRS---VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             M TR+    ++MFPWLA+GHI+ F+ LAK+LA R F++++CS+  NLNSI  N+    S 
Sbjct  1     MDTRKRSIRILMFPWLAHGHISAFLELAKSLAKRNFVIYICSSQVNLNSISKNMSSKDSI  60

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             S++L+ELH+P +  LPP Y TTNGLP HL   LK+ L  A P F+ LL+TL PDL+++D 
Sbjct  61    SVKLVELHIPTTI-LPPPYHTTNGLPPHLMSTLKRALDSARPAFSTLLQTLKPDLVLYDF  119

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFT-HMLTNPGAEYPFPALRLRQYEQTKTREL  645
             +  WA + A S NIP++ F +  AA  S+   H       EYPFPA+  R++E       
Sbjct  120   LQSWASEEAESQNIPAMVFLSTGAAAISFIMYHWFETRPEEYPFPAIYFREHEYDNFCRF  179

Query  646   MNQETRNFKREETLD-TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
              + ++    +    D    +  ++L+ + RE+EG+Y+D+LS+L + + V +G   Q    
Sbjct  180   KSSDSGTSDQLRVSDCVKRSHDLVLIKTFRELEGQYVDFLSDLTRKRFVPVGPLVQEVG-  238

Query  823   VDHETELTD---WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
              D E E  D   WL  K   STVF SFGSEYFL   ++EEIAYGLE+SG+NFIWV+RFP 
Sbjct  239   CDMENEGNDIIEWLDGKDRRSTVFSSFGSEYFLSANEIEEIAYGLELSGLNFIWVVRFPH  298

Query  994   GEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
             G+E I +EE LP+GFLER+  RG +VEGWA Q +IL H S GGF+SHCGW+S+ME +  G
Sbjct  299   GDEKIKIEEKLPEGFLERVEGRGLVVEGWAQQRRILSHPSVGGFLSHCGWSSVMEGVYSG  358

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRN  1350
             VPIIA+PMHLDQP NARL+  +G   EV R  +G L R E+A  +++ V G++GE L+R 
Sbjct  359   VPIIAVPMHLDQPFNARLVEAVGFGEEVVRSRQGNLDRGEVARVVKKLVMGKSGEGLRRR  418

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             V+ +SE +R  G  E+D++V EL  +  + ER
Sbjct  419   VEELSEKMREKGEEEIDSLVEELVTVVRRRER  450



>gb|AED99884.1| glycosyltransferase [Panax notoginseng]
Length=454

 Score =   405 bits (1040),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 205/444 (46%), Positives = 295/444 (66%), Gaps = 6/444 (1%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             +T +    VVMFPWLAYGH++PF+ LAK L+ + F V+ CSTP  L  IKN I  S  +S
Sbjct  2     DTNSNSFRVVMFPWLAYGHVSPFLELAKKLSTKNFSVYFCSTPITLKPIKNKI--SNYKS  59

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD-V  468
             I L+E  L  +P+ PPH  T+NGLP HL   LKK  + A  +F++++KTL+P L+I+D +
Sbjct  60    IELVEYPLESTPEFPPHLHTSNGLPPHLMPTLKKYFENASHNFSQIIKTLSPHLVIYDYL  119

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN-PGAEYPFPALRLRQYEQTKTREL  645
             +  W  K A S  IP+V F     A  +YFT ++ + PG  +    + L+  E  K  + 
Sbjct  120   MPSWVPKFASSHQIPAVHFHIFGVANLAYFTCLVRDIPGFSFQSKTVCLKPSEIMKLVQA  179

Query  646   MNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV  825
                     + E +     +  M L+ S+RE+EGKY+D+ ++L K K+V +G  FQ     
Sbjct  180   PRDNVEAEENELSDCIIGSTEMFLIKSNREIEGKYLDFAADLFKKKIVPVGPLFQEISVN  239

Query  826   DHET--ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
             + E   E+  WL +K   STV+VSFG+E +L K+ +EE+A GLE+S VNFIWV++FP+GE
Sbjct  240   NQENDEEIFRWLNKKEEFSTVYVSFGTESYLSKKGMEELANGLELSKVNFIWVIKFPEGE  299

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             +I+  EALP+GFLER+GE+G +VE W PQAKILGH+S GGFVSHCGW+S+MES ++GVPI
Sbjct  300   KINAAEALPEGFLERVGEKGMIVERWVPQAKILGHKSIGGFVSHCGWSSVMESASVGVPI  359

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             IA+PMH DQP+NARL+VE+G  +EVE+DE  +  REE+A  ++E V  ++G +L++  K 
Sbjct  360   IALPMHHDQPVNARLVVEVGFGLEVEKDENVEFWREEVARVVKEVVIEKSGVELRKKAKE  419

Query  1360  ISENLRLAGNREMDAVVAELEKLC  1431
             +SE ++  G  E+D  + EL+ LC
Sbjct  420   LSEQMKAKGEEEVDLAIKELKTLC  443



>ref|XP_008449848.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis melo]
Length=455

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 291/445 (65%), Gaps = 11/445 (2%)
 Frame = +1

Query  124   TRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
             T  +++M PW+ YGH++ ++ LAK L+ R  FL++ CSTP NL+SIK  +  S S SI+ 
Sbjct  9     TPTTILMLPWIGYGHLSAYLELAKVLSKRNNFLIYFCSTPVNLDSIKRKVVPS-SSSIQF  67

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +ELHLP SP+ PPH  TTN LP  L   L K    A   F E+L+TL P LLI+D +  W
Sbjct  68    VELHLPSSPEFPPHLHTTNALPPRLTPTLHKAFAAAASPFEEILQTLCPHLLIYDSLQPW  127

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTK--TRELMNQ  654
             A ++A SLNIP++ F T +A++  +  H +  P  ++P     L  Y + K  T +  N 
Sbjct  128   APQIASSLNIPAINFNTTAASIICHALHNINYPDTKFPLSDWVLHNYWKGKYTTADPTNS  187

Query  655   ETRNFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH  831
             E     RE  L    A+  + L+NS RE+EG+Y+DYLS L+K KV+++G     P   + 
Sbjct  188   ERIRRVRESFLYCLSASHDVSLINSCREIEGEYMDYLSVLLKKKVIAVGPLAYEPREDED  247

Query  832   E-----TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
             E     + + +WL +K  SSTV VSFGSEYF  K+++E+I  GLE SG NFIWV+RFPKG
Sbjct  248   EEDEDYSRIKNWLDKKEVSSTVLVSFGSEYFPSKQEMEDIGNGLEESGANFIWVIRFPKG  307

Query  997   EE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             EE   VEEALP+GF+E+ GER  +++ WAPQ KIL HRS GGFVSHCGWNS+MES+ LGV
Sbjct  308   EENRRVEEALPEGFVEKAGERAMILKDWAPQGKILKHRSIGGFVSHCGWNSVMESILLGV  367

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             P+I +PMH+DQP NA L+ E G  VE +RD  G++ REE+A  +RE V  +N E L+  V
Sbjct  368   PVIGVPMHVDQPYNAGLVEEAGLGVEAKRDPDGRIQREEVAKLIREVVVNKNREDLRTKV  427

Query  1354  KRISENLRLAGNREMDAVVAELEKL  1428
             K +SE LR  G+ +++ +VA++  L
Sbjct  428   KEMSEILRSKGDEKIEEMVAQISLL  452



>gb|EYU39888.1| hypothetical protein MIMGU_mgv1a022198mg [Erythranthe guttata]
Length=458

 Score =   401 bits (1031),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 291/442 (66%), Gaps = 17/442 (4%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             VVMFPWL YGHITP++ LAK L  R F ++LCST   L  I+  I    S SI+L+ L L
Sbjct  13    VVMFPWLGYGHITPYLELAKKLTTRNFKIYLCSTIATLTCIEEKITPKLSHSIKLVPLLL  72

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P LP    TTNGLP HL   LK+ L  +  +F+ +L  + PDLLI+D +  WA  VA
Sbjct  73    PVLPGLPRKLHTTNGLPPHLMPKLKEALDSSVDEFSNILADIKPDLLIYDFLQPWAPLVA  132

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM----NQETR  663
                NIP+V+F T+S+ M  +  H   NP  E+P   +R R YE  K  +L+    N E R
Sbjct  133   NEQNIPAVQFITSSSTMTCFMFHYFKNPETEFPSKTIRFRDYESDKMEKLLACGRNLEER  192

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
                 +  +    +  ++L+   R++EG+YIDYL+EL+  K V +G   Q P P +   E+
Sbjct  193   T---KAVVGFERSLKIVLIKGFRDIEGEYIDYLTELVGKKFVPVGPLVQEPTPDEKGDEI  249

Query  844   TD----WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE---  1002
             +D    WL +K   STVFVSFGSEYFL K DL+EIAYGLE+S +NFIWV+RFPKG     
Sbjct  250   SDEILSWLDKKEEKSTVFVSFGSEYFLTKGDLDEIAYGLEMSKLNFIWVVRFPKGGSNGL  309

Query  1003  ---ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
                + +E+ LP+GFL+R+GERG +++GWAPQAKIL H S GGFVSHCGWNS++ES+N GV
Sbjct  310   SNGLLLEKTLPRGFLDRVGERGMVLQGWAPQAKILEHPSVGGFVSHCGWNSVLESMNFGV  369

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIA+PMHLDQP+NARL+ E+G  VEV RDEK +L +E++AA + E V G+ GE +++  
Sbjct  370   PIIAVPMHLDQPINARLVEEVGVGVEVVRDEKNRLRKEKLAAVINEVVVGDGGEFVRKRA  429

Query  1354  KRISENLRLAGNREMDAVVAEL  1419
               + ENLR   ++E+D VV +L
Sbjct  430   AEMKENLRTKKDQEIDDVVEQL  451



>ref|XP_004250483.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=437

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 288/434 (66%), Gaps = 11/434 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+MFPWLAYGHI+PF+ LA  LADRGF V +CST  + ++I   IP+ YS SI+++EL L
Sbjct  15    VLMFPWLAYGHISPFLDLAMKLADRGFSVRVCSTIISCDTINKQIPEKYSASIKMVELCL  74

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P+          TN +P+ L   + + LK+++ +F ++L+ L PDL+I+D++  WAE VA
Sbjct  75    PKL-----FKPITNEIPVDLDHIVLETLKLSKSNFAKILQKLKPDLVIYDLLLQWAEGVA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
                 I +++F    AA+ SYF   +  P  E+PF  +   Q E  K  EL+ + +R  K 
Sbjct  130   KKQGILAMKFVVMGAAVFSYFYTTIRKPEVEFPFHDIYPGQNELMKLNELIAESSRIEKY  189

Query  676   EETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWL  855
             E+      N  +ML+++SR +EGKYIDY ++L   KV+ +G   +    V ++ E+ DWL
Sbjct  190   EDAF-AEGNIQVMLMSTSRTIEGKYIDYFTKLSNWKVIPVGLPIKNR--VTNDVEVIDWL  246

Query  856   ARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGF  1035
               K   ST+ VSFG+EY L KE+ EE+A+GLE+S VNF+WV+RFP+ E  ++E+ LPKGF
Sbjct  247   GTKDEGSTILVSFGNEYILSKEEAEELAFGLELSNVNFVWVVRFPERETRNLEDVLPKGF  306

Query  1036  LERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMN  1215
              ERIGERG +++    +++IL H S GGFVS CGW++++E L+ GVPIIAMP+HLDQPMN
Sbjct  307   FERIGERGSVLDKCVLRSRILNHSSIGGFVSPCGWHNVIECLDFGVPIIAMPIHLDQPMN  366

Query  1216  ARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNRE  1395
             A+LMVE G AVE+ RD+ GK+HREE+A  L+  V   N   L+  V+ +S+NL+  GN E
Sbjct  367   AKLMVESGVAVEIVRDDDGKIHREEIAETLKGVVTRGN---LRAKVRDVSKNLKTIGNEE  423

Query  1396  MDAVVAELEKLCNK  1437
             MD    EL +LC K
Sbjct  424   MDTAAKELIQLCKK  437



>ref|XP_010034307.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=415

 Score =   397 bits (1020),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/434 (46%), Positives = 280/434 (65%), Gaps = 32/434 (7%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+PF+ LAK L+ R F +HLCSTP NL+SIK  I + YS SI L+ELH+
Sbjct  10    VLMLPWLAHGHISPFLELAKRLSARNFHIHLCSTPVNLSSIKPKISKKYSSSIELVELHI  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPHY TT GL    H+                    NP        + WA +VA
Sbjct  70    PSLPDLPPHYHTTKGLASPPHE--------------------NP--------HPWAPEVA  101

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM--NQETRNF  669
              S  +PSV FF + A   S+  H+  N   E+PF  + L  YE  K  +    +++  ++
Sbjct  102   KSHGVPSVVFFVSGAGSSSFLLHVTKNTCNEFPFGEIFLHDYELAKIIKAAEDSRDAADY  161

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTD  849
             +  + ++  +N   +L+ + RE+EGKYIDYLS     KVV +G   + P  ++    + +
Sbjct  162   RTPQCVERSSN--FILMKTFRELEGKYIDYLSSYSGKKVVPVGPLVEDPSNIEDGDSIIE  219

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL ++   STVFVSFG+EYFL ++D EEIA+GLE+S VNF+WV+RFP GE I +EEALP 
Sbjct  220   WLDKRDKLSTVFVSFGTEYFLTEKDREEIAHGLELSNVNFLWVIRFPVGESIELEEALPG  279

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
             GFLER+ +RG +++GWA Q KIL H S GGFVSHCGW S+MES+  GVPIIAMPM LDQP
Sbjct  280   GFLERVRDRGSVIDGWAAQGKILEHPSIGGFVSHCGWGSVMESMKSGVPIIAMPMQLDQP  339

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+ ++G  +EV+R++ G+L R E+A  +++ V  ++G+ +++  K +S+++R  G 
Sbjct  340   MNARLVEQVGVGLEVKRNKSGELERSEIAKVIKDVVVEKDGDSMRKKTKEMSDSIRKKGE  399

Query  1390  REMDAVVAELEKLC  1431
              E+D V  +L +LC
Sbjct  400   AELDEVADKLVQLC  413



>ref|XP_009775018.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=462

 Score =   399 bits (1024),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 220/460 (48%), Positives = 290/460 (63%), Gaps = 23/460 (5%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             ET      +VM PWLA+GHI PF+ LAK L+ R F+ +L +TP NL   K  +    S  
Sbjct  2     ETRMKNIRIVMLPWLAHGHICPFLELAKALSMRNFITYLFTTPVNLTFFKQRLSVKESIR  61

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+E+ LP  P LPPH+ TTNGLP HL + LKK   M++PDF  +L TL PDL+I+D +
Sbjct  62    IKLMEIQLPNLPQLPPHFHTTNGLPPHLMNTLKKAFLMSKPDFFTILDTLKPDLIIYDFL  121

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN-PGAEYPFPALRLRQYEQTKTRELM  648
                   +A +LNIP+V F T  AA  SY  H   N P ++YPF  +  R +E  K +E+ 
Sbjct  122   QPCIPTMAATLNIPAVLFLTPGAASNSYHYHGRNNNPISDYPFREIFFRDHEHRKNKEIF  181

Query  649   -----------NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSI  795
                        N  TR F+R        +  ++L+ + +E+EGKYIDYLS L K K V +
Sbjct  182   DSLENDGIDEKNGVTRCFER--------SHDIVLIKTFKELEGKYIDYLSVLFKKKFVPV  233

Query  796   GTTFQAPPPVDHE--TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNF  969
             G   +     D E   E+ +WL  K   ST+FVSFGSE FL  E++EE A GLE+S VNF
Sbjct  234   GPLVREIDQEDGEQHCEIIEWLNEKEKCSTIFVSFGSECFLSNEEIEEFALGLELSMVNF  293

Query  970   IWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSI  1149
             IWV+RFP GE+ ++ E LPKG+ ER+  RG ++EGWAPQ +IL H S GGFVSHCGW+S+
Sbjct  294   IWVVRFPMGEKKNILEVLPKGYFERVENRGIVIEGWAPQGRILEHSSIGGFVSHCGWSSV  353

Query  1150  MESLNLGVPIIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMAAALRETVGGE  1326
             MESLN GVPIIAMPM  DQP+NARL+V E+G  +E+ RDE+G L +EE+A  +RE V  +
Sbjct  354   MESLNYGVPIIAMPMQHDQPLNARLVVNEVGVGMEIHRDEEGNLGKEEVARVVREVVLEK  413

Query  1327  NGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             +GE L+  V   SE +R  G  ++D VV EL KL  K  R
Sbjct  414   SGEILREKVNEFSEIMRENGENDIDEVVEELHKLYKKTLR  453



>ref|XP_010034306.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=464

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 205/447 (46%), Positives = 283/447 (63%), Gaps = 9/447 (2%)
 Frame = +1

Query  124   TRRS--VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSI  294
             TRRS  V+M PWLA+GHI PF+ LAK L+ R F ++ CS+P NL SIK   +  +Y   I
Sbjct  4     TRRSIRVLMLPWLAHGHIAPFLELAKKLSKRNFHIYFCSSPVNLASIKPKLVGTTYFSKI  63

Query  295   RLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVN  474
              L+ELHLP  P+LPP   +T  LP HL   LKK   M+ P F ++LK L+P L+++D + 
Sbjct  64    ELVELHLPSLPELPPRNHSTKTLPPHLMPTLKKAFDMSSPGFADILKLLDPALVVYDFLQ  123

Query  475   LWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQ  654
              WA  +A S+ IP+V F   SA MC++  H    PG ++P+P + L  +E  +   L+  
Sbjct  124   PWAPAIASSMGIPAVEFLCTSATMCAFVNHANMKPGNKFPYPGIYLHDHEVDQFANLLEC  183

Query  655   ETRNFK-REETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
                  K R+        ++ M+++ S RE+EGKYIDYLS L+   VV +G   +     D
Sbjct  184   SANGIKDRDRVFQCYERSRDMIMIKSIREIEGKYIDYLSFLIDKSVVPVGPLVEDTAFED  243

Query  829   HE-TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
              E +E+ DWL  K   STVFVSFGSEYFL K+++ EIA+GLE S VNF+WV+RF  GE  
Sbjct  244   CEKSEILDWLDNKEEKSTVFVSFGSEYFLSKQEMTEIAHGLEASKVNFVWVVRFHDGERD  303

Query  1006  SV---EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             +    E  LP+GFL+R+  RG ++EGWAPQA IL H S GGFVSHCGW+S+MES+  GVP
Sbjct  304   AAANGESYLPEGFLKRVAGRGLVLEGWAPQAAILQHSSVGGFVSHCGWSSVMESMRFGVP  363

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             IIAMPMHLDQP+NAR++ E+G  VE  RDE G +   E+A ++R  +  + G ++++   
Sbjct  364   IIAMPMHLDQPVNARVVEEVGVGVEARRDETGTIRSAEVARSIRNVIVDKAGGRVRQRAT  423

Query  1357  RISENLRLAGNREMDAVVAELEKLCNK  1437
              +   +R  G+ E+D  V EL + C K
Sbjct  424   EMKGIMRRKGDEEVDGAVDELLRACRK  450



>ref|XP_006436664.1| hypothetical protein CICLE_v10033373mg [Citrus clementina]
 gb|ESR49904.1| hypothetical protein CICLE_v10033373mg [Citrus clementina]
Length=443

 Score =   396 bits (1017),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 214/447 (48%), Positives = 286/447 (64%), Gaps = 25/447 (6%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             SV+MFPWLA+GH  PF+ LAK LA R  F +  CSTP  LNSIK +    +S SI+L+EL
Sbjct  9     SVLMFPWLAHGHAFPFLELAKKLAKRSNFHICFCSTPSILNSIKQS--DKFSLSIQLIEL  66

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP SP+LPP Y TT GLP HL   LKK   MA   F  +LK L+PD+LI+D++  WA  
Sbjct  67    HLPSSPELPPQYHTTKGLPPHLMPTLKKAFDMASSSFFNILKNLSPDILIYDLIQPWAPA  126

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLT--------NPGAEYPFPALRLRQYEQTKTREL  645
             +A SLNIP+V F  +SAA  ++  H +         N   E+ F ++ +  Y        
Sbjct  127   LASSLNIPAVYFLVSSAATSAFMVHAIKKNSSGDAYNDDEEFSFSSIFMHYYYMKSYFSN  186

Query  646   MNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP-PP  822
             M +     +  +  +   N  ++L+ S RE+EGKYIDYLS+L+K KVV +G   Q P   
Sbjct  187   MVESPSTKRLLQCFERSCN--IVLIKSFRELEGKYIDYLSDLIKKKVVPVGPLVQDPIEQ  244

Query  823   VDHE---TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
              DHE   TE+  WL +K  SSTVFVSFGSEYFL KE++E+IA GLE+SGV+         
Sbjct  245   SDHEKGVTEIIQWLDKKERSSTVFVSFGSEYFLSKEEMEDIALGLELSGVSL--------  296

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             G ++ V+E LP+ FLER  ER  ++EGWAPQ KILGH S GGFVSH GW+S+MES+ LGV
Sbjct  297   GVKVKVDEELPESFLERTKERAMVIEGWAPQMKILGHPSIGGFVSHSGWSSVMESMKLGV  356

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PIIAMPMH+DQP+NARL+ ++G  +EV R++ G++ REEMA  ++E V    GEK +R  
Sbjct  357   PIIAMPMHVDQPLNARLVEDVGIGLEVRRNKCGRIQREEMARVIKEVVMEREGEKWERKT  416

Query  1354  KRISENLRLAGNREMDAVVAELEKLCN  1434
             + + E ++  G  E++ V  EL  +C 
Sbjct  417   REMGEKIKEKGEEEIEWVADELIHICG  443



>gb|KCW51489.1| hypothetical protein EUGRSUZ_J01005 [Eucalyptus grandis]
Length=465

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 200/442 (45%), Positives = 281/442 (64%), Gaps = 7/442 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNN-IPQSYSQSIRLLEL  309
             S++M PWLA+GHI+PF+ L+K  ADRG  ++ CS+P NL SIK   +  +Y   I L+EL
Sbjct  10    SILMLPWLAHGHISPFLELSKRFADRGIHIYFCSSPVNLASIKPKLVGTTYFSKIELVEL  69

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP  P+LPP   +T  LP HL   LKK   M+ P F ++LK L+P L+++D +  WA  
Sbjct  70    HLPSLPELPPRNHSTKTLPPHLMPTLKKAFDMSSPGFADILKLLDPALVVYDFLQPWAPA  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNF  669
             +A S+ IP+V F   SA MC++  H    PG ++P+P + L  +E  +   L+       
Sbjct  130   IASSMGIPAVEFLCTSATMCAFVNHANMKPGNKFPYPGIYLHDHEVDQFANLLECSANGI  189

Query  670   KREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE-TE  840
             K  + +     ++  M+++ S RE+EGKYIDYLS L+   VV +G   +     D E +E
Sbjct  190   KDRDRVFQCYERSRDMIMIKSIREIEGKYIDYLSFLIDKSVVPVGPLVEDTAFEDCEKSE  249

Query  841   LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISV---  1011
             + DWL  K   STVFVSFGSEYFL K+++ EIA+GLE S VNF+WV+RF  GE  +    
Sbjct  250   ILDWLDNKEEKSTVFVSFGSEYFLSKQEMTEIAHGLEASKVNFVWVVRFHDGERDAAANG  309

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             E  LP+GFL+R+  RG ++EGWAPQA IL H S GGFVSHCGW+S+MES+  GVPIIAMP
Sbjct  310   ESYLPEGFLKRVAGRGLVLEGWAPQAAILQHSSVGGFVSHCGWSSVMESMRFGVPIIAMP  369

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MHLDQP+NAR++ E+G  VE  RDE G +   E+A ++R  +  + G ++++    +   
Sbjct  370   MHLDQPVNARVVEEVGVGVEARRDETGTIRSAEVARSIRNVIVDKAGGRVRQRATEMKGI  429

Query  1372  LRLAGNREMDAVVAELEKLCNK  1437
             +R  G+ E+D  V EL + C K
Sbjct  430   MRRKGDEEVDGAVDELLRACRK  451



>ref|XP_011032816.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Populus 
euphratica]
Length=440

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 283/450 (63%), Gaps = 13/450 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M T + +  R V+MFPWLAY HI  F+ LAK L+   F ++LCSTP NL  IK   P   
Sbjct  1     MDTSSKSNIR-VLMFPWLAYSHIHAFLELAKKLSKSNFYIYLCSTPANLAHIKEKEP---  56

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
               S+  +ELHLP  P+LPPH  TT GLP HL   L K L M+   F+ +L  L PDLLI 
Sbjct  57    --SVEFVELHLPSLPELPPHNHTTKGLPRHLLSNLMKALDMSRCSFSGILTALKPDLLIS  114

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D +  WA   ALSL IP+V  F  SAAM   F   L         P      +E     +
Sbjct  115   DFLQPWAPAKALSLKIPTV-LFMVSAAMPYCFLLDLVKISGSTALPLRSNYPHEYDYEND  173

Query  643   LMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA-PP  819
              +  + R     + L+  +N  +ML+ S RE+EGKY+D LS L   K+V +G   Q    
Sbjct  174   NLTLQDRLL---QCLEGSSN--LMLIRSLRELEGKYVDELSVLAMKKIVLVGPLVQELSE  228

Query  820   PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
               D +TE+ +WL +K   S +FVSFGSE +L KED EE+A+GL +S V+FIWVL FP+GE
Sbjct  229   EEDEKTEIIEWLNKKDPCSVLFVSFGSECYLSKEDREELAHGLLLSNVSFIWVLSFPQGE  288

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             +IS EEALP+G +E + E+G ++E WAPQ +IL H S GGF+SHCGW SI+ES+  GVPI
Sbjct  289   KISAEEALPEGLVEMVAEKGFLIEDWAPQKRILDHPSIGGFLSHCGWGSIIESMKTGVPI  348

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             IAMPMH+DQP NA+L+ E+G A+E++R++ GKL +EE+A  +RE V  E GE+++R V+ 
Sbjct  349   IAMPMHVDQPCNAKLLQEVGVALEIKREQNGKLGKEEVAKVVREVVAEETGEQVRRKVRE  408

Query  1360  ISENLRLAGNREMDAVVAELEKLCNKPERI  1449
             + +++R   + +MD VV EL KLC +   I
Sbjct  409   LKDSIRGKEDGDMDEVVNELVKLCGREANI  438



>ref|XP_008344515.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=437

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 202/442 (46%), Positives = 286/442 (65%), Gaps = 30/442 (7%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADR--GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             S++M PWLA+GHI+PF+ LAK L  +      ++CSTP NL SIK  + + YS  I  +E
Sbjct  11    SILMLPWLAHGHISPFLELAKKLTHKRNNLXFYICSTPVNLTSIKPKLSEKYSHCIEFVE  70

Query  307   LHLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             LHLP  E P+LPPHY TTNGLP HL   LKK   M+  +F+ +L+TL PDLLI+D +  W
Sbjct  71    LHLPHDELPELPPHYHTTNGLPPHLMSTLKKAFDMSSSNFSNVLQTLKPDLLIYDFLQPW  130

Query  481   AEKVALSLNIPSVRFFTASAA-MCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             A  +ALS NIP+V F T +AA + S F +   N   ++PFP + LR YE    +  +   
Sbjct  131   APSLALSHNIPAVEFCTINAATIISIFANHFKNSSLKFPFPGIHLRDYEIRMFKNQVEFS  190

Query  658   TRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPV  825
             +   K  + +   ++ +  ++L  +SRE+E KYIDYLS+L+  K+V +G   Q P     
Sbjct  191   SNGLKDGDRIQQCSSSSCNIILAKTSREIEAKYIDYLSDLVGKKIVPVGPLVQDPLDQKT  250

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
             D E+ +  WL ++  SS V+VSFGSEYFL KE++EEIA+GLE+S V+FIWV+RFPK ++ 
Sbjct  251   DEESPIIQWLNKREKSSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWVIRFPKEDKT  310

Query  1006  S-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
             + VEE LPKGF+ER+GERG +VEG APQAKIL H S GGFVSHCGW+S++ES+  GVPII
Sbjct  311   TKVEEVLPKGFVERVGERGMIVEGXAPQAKILQHPSVGGFVSHCGWSSVLESIKFGVPII  370

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             A+PM LDQP+NA+L+ E+                     A+ + V  + GE ++     +
Sbjct  371   ALPMQLDQPVNAKLVEEV--------------------EAIGDVVVKKIGEGVRMKALEV  410

Query  1363  SENLRLAGNREMDAVVAELEKL  1428
              +N++   + E++ V+ +LE+L
Sbjct  411   RDNMKEIEDEEINDVLEQLEQL  432



>ref|XP_004142256.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 ref|XP_004169962.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 gb|KGN54051.1| hypothetical protein Csa_4G279800 [Cucumis sativus]
Length=452

 Score =   391 bits (1005),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 207/444 (47%), Positives = 286/444 (64%), Gaps = 12/444 (3%)
 Frame = +1

Query  124   TRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNN-IPQSYSQSIR  297
             T  +++M PW+ YGH++ ++ LAK L+ R  FL++ CSTP NL+SIK   IP S   SI+
Sbjct  9     TPTTILMLPWIGYGHLSAYLELAKVLSRRNNFLIYFCSTPVNLDSIKPRLIPSS---SIQ  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
              +ELHLP SP+ PPH  TTN LP  L   L K    A   F  +L+TL P LLI+D +  
Sbjct  66    FVELHLPSSPEFPPHLHTTNALPPRLTPTLHKAFAAAASPFEAILQTLCPHLLIYDSLQQ  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQY---EQTKTRELM  648
             WA ++A SLNIP++ F T +A++ S+  H +  P  ++P     L  Y   + T   E  
Sbjct  126   WAPQIASSLNIPAINFNTTAASIISHALHNINYPDTKFPLSDWVLHNYWKGKYTTANEAT  185

Query  649   NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
              +  R  +        A++ + L++S RE+EG+Y+DYLS L+K KV+++G     P   D
Sbjct  186   LERIRRVRESFLYCLSASRDITLISSCREIEGEYMDYLSVLLKKKVIAVGPLVYEPREDD  245

Query  829   HE---TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
              +   + + +WL +K A STV VSFGSE+F  KE++EEI  GLE SG NFIWV+R PKGE
Sbjct  246   EDEDYSRIKNWLDKKEALSTVLVSFGSEFFPSKEEMEEIGCGLEESGANFIWVIRSPKGE  305

Query  1000  EIS-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             E   VEEALP+GF+E+ GER  +V+ WAPQ KIL HRS GGFVSHCGWNS+MES+ LGVP
Sbjct  306   ENKRVEEALPEGFVEKAGERAMIVKEWAPQGKILKHRSIGGFVSHCGWNSVMESIMLGVP  365

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             +IA+PMH+DQP NA L+ E G  VE +RD  G + REE+A  +RE V  ++ E L+  V 
Sbjct  366   VIAVPMHVDQPYNAGLVEEAGLGVEAKRDPDGMIQREEVAKLIREVVVDKSREDLRTKVI  425

Query  1357  RISENLRLAGNREMDAVVAELEKL  1428
              + E LR  G+ ++D +VA++  L
Sbjct  426   EMGEILRSKGDEKIDEMVAQISLL  449



>emb|CDP12002.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   389 bits (1000),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/469 (45%), Positives = 291/469 (62%), Gaps = 24/469 (5%)
 Frame = +1

Query  100   TMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKN--NIP  273
             T   E+   R  V+MFPWLA+GH++PF+ L+K LA   F ++ CST  NL+ IK   N+ 
Sbjct  4     TSNDESNTRRFRVLMFPWLAHGHMSPFLELSKRLAQNNFQIYFCSTEVNLSFIKKDRNLD  63

Query  274   QSYS-QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPD  450
             + +S  SI L++L LP  P+LPPHY TT  LP HL+  L     M + +F  +L  L PD
Sbjct  64    EYFSDHSIELVQLDLPHFPELPPHYHTTKNLPPHLNPTLHVAFYMGKTNFQNILNILQPD  123

Query  451   LLIHDVVNLWAEKVALSLNIPSVRFFTASAAMC---SYFTHM----LTNPGAEYPFPALR  609
             LLI+DV   WA ++A  ++IPSV F  A   +C   SYF  +    L+     YPFPA+ 
Sbjct  124   LLIYDVFQAWASELASLIHIPSVLFLCA-GLVCRAWSYFYDVNNKGLSGVDGTYPFPAIV  182

Query  610   LRQYEQTKTRELMNQETRNFKREETLDTP----ANQAMMLVNSSREVEGKYIDYLSELMK  777
             L+ YE  K    + +  +N   E  L        +  ++L+ + RE+EGKYID+LS    
Sbjct  183   LKDYEIKKLAAFLQEFKKNIPEEVMLSLTKCLEVSSDIVLLKTCREIEGKYIDHLSSCCG  242

Query  778   SKVVSIGTTFQAP---PPVDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEI  936
              K+V++G   +        + ETE    + ++L  +  SS V+VSFGSE FL +E+ EE+
Sbjct  243   KKIVAVGPLIELKHDDTKTEEETENSSHIIEFLNGREESSVVYVSFGSECFLSEEEREEM  302

Query  937   AYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTG  1116
             AYGLE+S  NFIWV+RFP G  I++EEALP+GFLER+  RG +V+GWAPQAKIL H STG
Sbjct  303   AYGLELSNANFIWVVRFPVGHAIALEEALPEGFLERVKTRGVVVDGWAPQAKILEHPSTG  362

Query  1117  GFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMA  1296
             GFVSHCGW S +ES+  GVP++A+PM  DQP +ARL VEIG  +E+ RDE G++ RE +A
Sbjct  363   GFVSHCGWGSFLESIYYGVPLLALPMLYDQPHHARLAVEIGVGIEILRDEDGRIKRENVA  422

Query  1297  AALRETV--GGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
               ++E V    E GE +K+  K +S  LR  G  ++   V +L+ LC+K
Sbjct  423   KVIKEVVVEKTELGESVKQKAKELSHKLREEGEEQLHEAVEKLKSLCSK  471



>ref|XP_011075272.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   389 bits (998),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 212/440 (48%), Positives = 289/440 (66%), Gaps = 7/440 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+MFPWLAYGHITP++ LAK L  RGF + LCSTP  L  +   I    SQSI+L+ L L
Sbjct  11    VLMFPWLAYGHITPYLELAKKLTSRGFNISLCSTPATLCCVDKKITNKLSQSIKLVPLFL  70

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P LPP   TTNGLP H+  +LK+   ++  DF+ +LK L P +LI+D +  WA  VA
Sbjct  71    PPLPGLPPELHTTNGLPPHVMPSLKEAFDLSINDFSNILKQLKPHMLIYDFLQPWAPVVA  130

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
                 IP+V F T+S+ M S+  H    P  E+PFP +  R YE +  ++L+   +   +R
Sbjct  131   KEQKIPAVEFVTSSSTMSSFMFHYFRKPWIEFPFPNIYFRDYEYSNMKKLLRCASDPRER  190

Query  676   EETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE---L  843
             ++  +       ++L+   R++EGKYIDY++ L+  K V +G   Q P P + + E    
Sbjct  191   DKASEGVERSCKIVLIKGFRDIEGKYIDYVTSLVGKKFVPVGPLVQEPSPDEKDDESLCT  250

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS---VE  1014
               WL  K   STVFVSFGSEYFL KED++EIAYGLE+S +NFIWVLRFPKG       + 
Sbjct  251   FSWLDMKERKSTVFVSFGSEYFLTKEDIDEIAYGLELSKINFIWVLRFPKGANGHNGLLG  310

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LP+G LER+G+RG+++EGWAPQ KILGH S GGFVSHCGWNS++ES+N GVPIIA+PM
Sbjct  311   KTLPRGVLERVGDRGKILEGWAPQTKILGHESIGGFVSHCGWNSVIESMNFGVPIIAVPM  370

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             HLDQP+NARL+ E+G  VEV RD   +L R  +AA +++ V  + GE +++    + E L
Sbjct  371   HLDQPINARLVEEVGVGVEVVRDRNKRLSRGRLAAVIKQVVMEDCGEVVRQRAAEMREKL  430

Query  1375  RLAGNREMDAVVAELEKLCN  1434
             +  G++E+D VV EL  +CN
Sbjct  431   KSKGDQEIDEVVKELVIVCN  450



>dbj|BAM28984.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=454

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/444 (45%), Positives = 286/444 (64%), Gaps = 6/444 (1%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
             +T   ++MFPWLA+GHI+PF+ L+K L  + F ++ CST  NL+ IK ++ +S S ++RL
Sbjct  9     STSFRILMFPWLAHGHISPFLQLSKKLTQKNFQIYFCSTAINLSFIKKSLGESSSDNLRL  68

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +ELH P+  +LPP + TT  LP HL   L +  ++A+  F+  + TL PDL+I+D    W
Sbjct  69    VELHFPDVFELPPQHHTTKNLPPHLMSTLMRSFQIAQASFSSSITTLKPDLIIYDSFQSW  128

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLT--NPGAEYPFPALRLRQYEQTKTRELMNQ  654
             A  +A    IPSV F T+ AA  S+F H L+       +PF  +  R YE+ K   L+ +
Sbjct  129   ASTLAAIHGIPSVHFSTSGAASMSFFYHQLSLRRDSGTFPFSEIFQRDYERDKFESLV-E  187

Query  655   ETRNFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH  831
               R    +    +   +  ++L+ S   +E KY+DYLS L   K+V+ G   Q     ++
Sbjct  188   SNRGVAEDFAFRSFELSSEIVLMKSCIGLEDKYLDYLSFLCGKKMVTTGPLIQESHNYEN  247

Query  832   ETE--LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
               +  + ++L +K  SS VFVSFGSEY+L  E+ EEIAYGLE+S ++FIWV+RFP G   
Sbjct  248   SDDVGIIEFLNKKDQSSVVFVSFGSEYYLSAEEREEIAYGLELSNLSFIWVVRFPLGNTT  307

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
             SVEEALP+GFLER+ ERG +V+ WAPQAKIL H ST GFVSHCGW+S+MESL  GVP+IA
Sbjct  308   SVEEALPEGFLERVKERGMVVDKWAPQAKILEHPSTCGFVSHCGWSSVMESLYYGVPVIA  367

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPMHLDQP NAR +VEIG A+EV R E G++ +EE+A  ++     +NGE+++   + +S
Sbjct  368   MPMHLDQPTNARFLVEIGVAMEVLRGENGQIRKEEVARVIKLVALEKNGEEIRGKARELS  427

Query  1366  ENLRLAGNREMDAVVAELEKLCNK  1437
             + LR     E+D  + EL  LC+K
Sbjct  428   KMLRTKAEEELDEALEELRNLCSK  451



>ref|XP_011090843.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   384 bits (987),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 286/456 (63%), Gaps = 27/456 (6%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ-SYSQ  288
             E      S++MFPW+ +GH+ P++ LAKNL+   F +  CST  NL+S+ + +   S S 
Sbjct  2     EAKQANLSILMFPWIGHGHVFPYLELAKNLSTHNFDIFFCSTAVNLSSVNDVLANTSSSV  61

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLP +P+LPP Y TT   P HL   L +  +M+   F++++ +LNPD+LI+D 
Sbjct  62    SIQLVELHLPSAPELPPCYHTTKNAPPHLLPKLHEAFQMSNSSFSDIITSLNPDMLIYDG  121

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA K+A SL IP+V F TA A   S++ H   +  + +P+  + LR YE+ K  E M
Sbjct  122   FQPWAAKIASSLGIPAVHFATAGAVPYSFYFHSFISATSAFPYEEIYLRDYER-KAYETM  180

Query  649   NQETRNFKREETLDTPANQ-----AMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
                    K+ + LD+          ++LV + R +EGKY+DYLS L K K+V +G     
Sbjct  181   VFSDLGVKKND-LDSAIGHFTLSCDVVLVKTCRAIEGKYMDYLSVLCKKKLVPVG-----  234

Query  814   PPPVDHE-------TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
              P V H         E+ +WL++K   STVF+SFGSE +L K+ + EIA GLE S VNFI
Sbjct  235   -PLVTHSNSEEGKHAEIVEWLSQKNKFSTVFISFGSENYLSKDQMVEIAKGLEASDVNFI  293

Query  973   WVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             WV+RFP GE +S+EE +PKGFL+R+ +RG +++GWAPQ +IL H STG F+SHCG +SI+
Sbjct  294   WVVRFPPGERVSIEEVVPKGFLDRVQDRGMILQGWAPQTQILAHPSTGAFLSHCGMSSII  353

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENG  1332
             ES+  GVP+IAMP+ LDQP NARL+VE G  +EV+RDE G     ++A A+ + +  E G
Sbjct  354   ESIYFGVPVIAMPLKLDQPFNARLVVEAGVGIEVKRDENGGFGGADVADAINKVIVKETG  413

Query  1333  EKLKRNVKRISENLRLAGNREMDAV---VAELEKLC  1431
             E ++     +SE ++   N E DA+     +L ++C
Sbjct  414   EDIRLKAAELSEKMK---NEEEDAINEAADQLRRVC  446



>ref|XP_011090910.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=466

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/444 (45%), Positives = 285/444 (64%), Gaps = 7/444 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS--IRLLEL  309
             ++MFPWLA+GHI PF+ LAK L+ R F ++LCST  NL+SI+ N  +  S    I+L+EL
Sbjct  10    ILMFPWLAHGHIFPFLELAKRLSRRNFSIYLCSTAINLDSIRTNTGKDVSDDPLIQLVEL  69

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             H+P S +LPP   TT  LP +L   L + L+M+   F+ ++ ++NPDLLI+D    WA K
Sbjct  70    HIPPSSELPPELHTTKNLPSNLLTTLIQALQMSSSSFSNIMNSVNPDLLIYDFFQPWAPK  129

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLT-NPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
             +A S  IPSV F +A A + +++ H+ T    + +P+ A+ L  +E    R  +    ++
Sbjct  130   LASSKGIPSVFFSSAGATLFAFYHHIYTEGASSTFPYQAIYLLDHENNNFRGRVLPNLKD  189

Query  667   FKREETL-DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE--T  837
                +    +   +  ++L+ SSR VEGKYIDYLS   K ++V  G         D E  +
Sbjct  190   ADEDFAFGNFKLSTDVILMKSSRAVEGKYIDYLSSRCKKQIVPTGPLIADASGDDDEKFS  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             E+  WL+ K   ST+++SFGSE FL K+ +E IA GL +  VNF+WV+RFP GE+ S++E
Sbjct  250   EIMRWLSEKQEYSTIYISFGSECFLSKDQIEVIAKGLALCNVNFLWVVRFPIGEKSSIKE  309

Query  1018  ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
             A+P GFLE + +RG +V GWAPQ KIL H STGGFVSHCGW SIMES+  GVP+IAMPM 
Sbjct  310   AMPAGFLETVKDRGIIVPGWAPQTKILAHPSTGGFVSHCGWGSIMESMYFGVPVIAMPMQ  369

Query  1198  LDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRE-TVGGENGEKLKRNVKRISENL  1374
              DQP+NARL+VE GA VEVERD  G    E +A A+ + TV     E+L+   KR+S+++
Sbjct  370   ADQPINARLVVETGAGVEVERDGNGHYLAEGLAKAINKVTVEKPFCEELRDRGKRLSDSI  429

Query  1375  RLAGNREMDAVVAELEKLCNKPER  1446
             + +  +E+D V  +L K+C K ++
Sbjct  430   KESDEQEVDEVAEQLLKICMKNKK  453



>emb|CDP11999.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 203/454 (45%), Positives = 283/454 (62%), Gaps = 22/454 (5%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKN--NIPQSYS-QSIRLLELH  312
             MFPWLA+GH++PF+ L+K LA   F V+ CST  NL+ IK   N+ + +S  SI L++L 
Sbjct  1     MFPWLAHGHMSPFLELSKRLAQNNFQVYFCSTEVNLSFIKKDRNLDEYFSDHSIELVQLD  60

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TT  LP HL+  L     M + +F  +L TL PDLLI+D+   WA K+
Sbjct  61    LPHFPELPPHYHTTKNLPPHLNPTLHVAFYMGKTNFQSILDTLKPDLLIYDIFQPWASKL  120

Query  493   ALSLNIPSVRFFTASAAMCSY-FTHMLTNPG-----AEYPFPALRLRQYEQTKTRELMNQ  654
             A  ++IP V F    A   S+ + +   N G       YPFPA+ L+ YE   +  ++ +
Sbjct  121   ASLIHIPYVLFMAVGAVYWSWSYFYDAINKGYSGIDGTYPFPAIVLKDYEIKNSAAILQE  180

Query  655   ETRNFKREETLDTP----ANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ----  810
               +N   E  L T      +  ++L+ + RE+EGKYID+LS     K+V++G   +    
Sbjct  181   FKKNASEEVLLSTTKSFEVSSDIVLLKTWREIEGKYIDHLSSCCGKKIVAVGPLAELKHD  240

Query  811   ---APPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVL  981
                     ++ + L  +L  +  SS V+VSFGSE FL +E+ EE+AYGLE+S  +FIWV+
Sbjct  241   DTKKEEEEENSSHLIKFLNDRSESSVVYVSFGSECFLSEEESEEMAYGLELSNADFIWVV  300

Query  982   RFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESL  1161
             RFP G  I++EEALP+GFLER+  RG +V+GWAPQAKIL H STGGFVSHCGW S MES+
Sbjct  301   RFPVGHAIALEEALPEGFLERVKTRGVVVDGWAPQAKILEHPSTGGFVSHCGWGSFMESI  360

Query  1162  NLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV--GGENGE  1335
               GVP++A+PM  DQP +ARL VEIG  +E+ RDE G++ RE +A  ++E V    E GE
Sbjct  361   YYGVPLLALPMLYDQPHHARLAVEIGVGIEILRDEDGRIKRENVAKVIKEVVVEKIELGE  420

Query  1336  KLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
              +K+  K +S  LR  G  E+   V +L+ LC+K
Sbjct  421   SVKQKAKELSHKLREEGEDELHEAVEKLKSLCSK  454



>gb|EYU18697.1| hypothetical protein MIMGU_mgv1a006194mg [Erythranthe guttata]
Length=453

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 201/441 (46%), Positives = 278/441 (63%), Gaps = 13/441 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADR--GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             V+MFPWLAYGHITP++ LAK L  +   F V++CSTP  L  I   +PQ+ S SI+L+  
Sbjct  14    VLMFPWLAYGHITPYLELAKKLVTKNDSFAVYMCSTPATLTCIDKKVPQNLSNSIKLVPF  73

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP +  LP ++ TTNGLP HL   L+++L  +  +F+ +L+ L PDL+I+D    WA  
Sbjct  74    HLPNTQGLPSNFHTTNGLPSHLIPTLREMLDSSANEFSRVLEKLTPDLVIYDCFQPWAAS  133

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFP-ALRLRQYEQTKTRELMNQETRN  666
             VA    I +V F T+ AA   +  H L +PG E+PF  ++  R Y+       + +   +
Sbjct  134   VAKDRKIAAVEFLTSGAASTGHLYHQLLHPGIEFPFSKSIYHRDYDDMT---FVLETIAS  190

Query  667   FKREETLDTPA--NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF----QAPPPVD  828
              +R + +   A  +  ++L+   RE+EGKYIDY S LM  K V +G        + P   
Sbjct  191   VERTKNVLEGARVSDKIVLIKGCREIEGKYIDYASSLMGKKFVPVGPLVILESSSNPNDG  250

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EI  1005
              +  +  WL +K   STVFVSFGSE F+ KED+ E+AYGLE+S  NFIWV+R PKG+   
Sbjct  251   KDNGIMSWLDKKEKKSTVFVSFGSECFITKEDIYEVAYGLELSKTNFIWVVRLPKGDASS  310

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
             S+EE LP GFL+R+  RGR++EGWAPQ  ILGH + GGFVSHCGWNS+MES+  GVPIIA
Sbjct  311   SIEEILPIGFLDRVKGRGRVLEGWAPQTMILGHANVGGFVSHCGWNSLMESMYFGVPIIA  370

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MPMH+DQP+NARL+ E+G  VEV RD+  +  RE +AA +R  V  ++G  ++     + 
Sbjct  371   MPMHVDQPVNARLVEEVGVGVEVLRDKNRRFRRETVAAVIRSVVVEDSGRFVRERAAYMK  430

Query  1366  ENLRLAGNREMDAVVAELEKL  1428
             E L+  G  E+D VV E+  L
Sbjct  431   EKLKYNGCEEIDEVVKEVVGL  451



>emb|CDP12003.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   380 bits (976),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 281/454 (62%), Gaps = 22/454 (5%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKN--NIPQSYS-QSIRLLELH  312
             MFPWLA+GH++PF+ L+K LA   F ++ CST  NL+ IK   N+ + +S  SI L++L 
Sbjct  1     MFPWLAHGHMSPFLELSKRLAKNNFQIYFCSTEINLSFIKKDRNLDEYFSDHSIELVQLD  60

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             LP  P+LPPHY TT  LP HL+  L     M   +F  +L  L PDLLI+D+   WA ++
Sbjct  61    LPRFPELPPHYHTTKNLPPHLNPTLHVAFYMGRTNFQNILNILQPDLLIYDMFQAWASEL  120

Query  493   ALSLNIPSVRFFTASAAMCSY-FTHMLTNPG-----AEYPFPALRLRQYEQTKTRELMNQ  654
             A   +IP+V F    A   S+ + + + N G       YPFPA+ LR YE  +    + +
Sbjct  121   ASMFHIPAVLFLGGGAVFWSWSYFYDIINKGYSGIDGTYPFPAIFLRDYEIKRMAAFLQE  180

Query  655   ETRNFKREETLDTP----ANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
                   +E  L        +  ++L+ + RE++GKYID+LS     K++++G   +    
Sbjct  181   SKEKVPQEVVLSKTKGFEVSSDIVLLKACREIDGKYIDHLSSSRGKKILAVGPLIELKHD  240

Query  823   VDHETE-------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVL  981
                E E       + ++L  +  SS V+V FGSEYFL +E+ EE+AYGLE+S  NF+WV+
Sbjct  241   DTKEEEKDENSSHIIEFLNGREESSVVYVCFGSEYFLSEEEREEMAYGLELSNANFVWVV  300

Query  982   RFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESL  1161
             RFP G  I++EEALP+GFLER+ +RG +V+GWAPQAKIL H STGGFVSHCGW+S MESL
Sbjct  301   RFPVGHAIALEEALPEGFLERVKDRGVVVDGWAPQAKILEHPSTGGFVSHCGWSSFMESL  360

Query  1162  NLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV--GGENGE  1335
               GVP++A+PM  DQP+ ARL VEIG  +E+ RDE G++ RE +A  ++E V    E GE
Sbjct  361   YYGVPLLALPMLYDQPLQARLAVEIGVGIEILRDEDGRIKRENVAKVIKEVVVEKIELGE  420

Query  1336  KLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
              +K+  K +S  LR  G  ++   V +L+ LC+K
Sbjct  421   SVKQKAKELSHKLREEGEGQLHEAVEKLKSLCSK  454



>ref|XP_008456584.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis melo]
Length=507

 Score =   380 bits (977),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 292/458 (64%), Gaps = 27/458 (6%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY--SQSIRLLEL  309
             ++M PWLA+GH++PF+ L+K LA + F +  CST   L+SI++ +PQ+   S +I L+EL
Sbjct  16    ILMLPWLAHGHVSPFLELSKLLATKNFHIFFCSTSIILHSIQSKLPQNLLSSSNIELVEL  75

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
              LP S DLP    TT GLP HL  +LK+    A   F  +++ L PDL+I+D +  WA  
Sbjct  76    TLPTSADLPRCRHTTAGLPPHLMFSLKRAFDSAASAFDSIVRNLRPDLVIYDFLQPWAPA  135

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYP--FPALRLRQYEQTKTRELMNQETR  663
             VALS +IP+V F    A M +  T+ML  P +++P  FP +RL  +E  + + L      
Sbjct  136   VALSADIPAVMFQCTGALMAALVTNMLKFPNSDFPSMFPEIRLSVFEIKQLKNLFRSSVN  195

Query  664   NFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
             + K ++ +     ++  ++L+ S RE+E KYID+LS  ++ KV+ +G      P V+ + 
Sbjct  196   DAKDKQRIQECYERSCGILLLKSFREIEAKYIDFLSTSLQIKVIPVG------PLVEEQD  249

Query  838   E--------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
             E        +  WL +K   S + VSFGSE++L K D+EEIA+GLE+S +NFIWV+RFP 
Sbjct  250   EDIEVLAESIEKWLNKKEKKSCILVSFGSEFYLSKGDMEEIAHGLELSHLNFIWVVRFPA  309

Query  994   GEE------ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIME  1155
               E       +VEE LPKGFLER+GERG +VE W PQA+IL HRSTGGF+SHCGW+S++E
Sbjct  310   SGEGERKKRNNVEEELPKGFLERVGERGMVVEEWVPQAQILKHRSTGGFLSHCGWSSVLE  369

Query  1156  SLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGE  1335
             SL  GVPIIA PM LDQP+NARL+  +G  V VER   G+L   E+A A+RE V  E+G+
Sbjct  370   SLKFGVPIIAAPMQLDQPLNARLVEHLGVGVVVERSCGGRLCWTEVARAVREVVAEESGK  429

Query  1336  KLKRNVKRISENLRLAGNR-EMDAVVAELEKLCNKPER  1446
              ++  +K  ++ ++  G++ EM+ V  E+ KLC + ++
Sbjct  430   GVREKMKEFAKIMKEKGDKDEMEVVAEEITKLCRRKKK  467



>ref|XP_011090908.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=457

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 202/453 (45%), Positives = 281/453 (62%), Gaps = 10/453 (2%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFL-VHLCSTPDNLNSIKNNIPQS  279
             MGTE   T  S++MFPWLA+GHI P++ LAK +  R  L ++ CSTP N  SIKN I ++
Sbjct  1     MGTEN--TSFSILMFPWLAHGHIFPYLELAKAILKRKNLRIYFCSTPINFGSIKNFIDKN  58

Query  280   Y-SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
               + SI L++LHL   P+LPPHY TT  LP  L+ AL K  + +   F+E++ TL PDL+
Sbjct  59    LLNNSIELVQLHLEPFPELPPHYHTTKNLPPDLNFALLKAFQTSNSSFSEIISTLRPDLV  118

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+DV   WA KVA S   P+V F    A + S+  H  T   A +PFPA+    YE    
Sbjct  119   IYDVFQPWAAKVASSQGFPAVYFSIYGAFLFSFLHHQYTFGKAGFPFPAIHFEDYELKSL  178

Query  637   RELMNQETRN-FKREETL---DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTT  804
              EL      N F  ++     +   +  ++L  +SR  EG++IDYLS L   K+V +G  
Sbjct  179   EELFEFLYANIFDVDQDFLFGNFKQSCDIILSKTSRGFEGEHIDYLSALCNKKIVPVGPL  238

Query  805   FQAPPPVDHE-TELTDWLAR-KPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWV  978
                    + E +++  WL++ K   STV +SFGSEYFL K ++EEI  GLE+  VNFIW+
Sbjct  239   ISDDNQNNEEHSDIIQWLSKNKNPHSTVLISFGSEYFLSKIEIEEIVKGLELCDVNFIWI  298

Query  979   LRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMES  1158
             +RFP G  I++EEALPKGF +R GERG ++ GWAPQA IL H +TGGF+SHCGW+SIMES
Sbjct  299   IRFPVGVTITLEEALPKGFTDRAGERGIVITGWAPQADILAHPNTGGFMSHCGWSSIMES  358

Query  1159  LNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEK  1338
             +  GVP+IAMPM LDQP+NAR++   G  VEV  +E      EE+A A+++    E+G+ 
Sbjct  359   MYYGVPVIAMPMKLDQPINARMLSAAGGCVEVPGNENEVFKGEEIAKAIKKVFMEESGDG  418

Query  1339  LKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
             L+R  + + E ++    + +D V  +L +LC K
Sbjct  419   LRRRARELGETMKTEKEQVLDEVADQLWQLCLK  451



>gb|EPS69530.1| hypothetical protein M569_05234, partial [Genlisea aurea]
Length=430

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 202/438 (46%), Positives = 272/438 (62%), Gaps = 20/438 (5%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             ++M PWLAYGH +PFV LAK LA RGF++++CS+P NL+S+++++    + S+  +ELHL
Sbjct  2     ILMLPWLAYGHTSPFVELAKALARRGFIIYICSSPANLHSVRDSVS---TASVEFIELHL  58

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             PES +LPP Y TTNGLP HL   LK+ L  A P F E+L++LNPDL+I+D +  WA + A
Sbjct  59    PESRELPPRYHTTNGLPPHLMADLKEALIRARPGFAEILRSLNPDLVIYDFIQPWAAEEA  118

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKR  675
              SL IP+V F     A  S F H L    +EYPFPA+  R +E        N+    F  
Sbjct  119   SSLGIPAVFFNIFGEASSSLFGHRLWRSESEYPFPAIHYRGHELG----FFNRIVDGF--  172

Query  676   EETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE---  840
              E L     ++  ++LV + RE+EGKYIDY SEL K + V +G   + P     E E   
Sbjct  173   -ELLRGSVGRSSEIILVRTFRELEGKYIDYHSELTKKRHVPVGHLVRDPEEAYDEEEEKK  231

Query  841   -----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI  1005
                  +  WL  +   STVF SFG+EYFL  E++E IA GLE S  NFIWVL    G++ 
Sbjct  232   AECDAIMKWLDERTEKSTVFASFGTEYFLSDEEMEGIAGGLETSEANFIWVLTSHMGDDD  291

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
                E LP GFL R   RG ++  WAPQ +IL HRS GGF+SHCG +S++E L  GVPI+A
Sbjct  292   DAPERLPDGFLRRTRSRGLVLAKWAPQLRILSHRSVGGFLSHCGRSSVIEGLYCGVPIVA  351

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             +PMHLDQP+NARL+ E G A E  R E+GK+   E+A A+++ V  E+GE L+R V  +S
Sbjct  352   LPMHLDQPLNARLLTEAGLAEEASRTEEGKIDGMEVARAVKKAVSEESGEGLRRRVAEMS  411

Query  1366  ENLRLAGNREMDAVVAEL  1419
               ++  G  E+   V EL
Sbjct  412   RVMKGKGEEEIGGAVEEL  429



>gb|KCW51491.1| hypothetical protein EUGRSUZ_J01007, partial [Eucalyptus grandis]
Length=410

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 187/417 (45%), Positives = 267/417 (64%), Gaps = 11/417 (3%)
 Frame = +1

Query  187   LAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPESPDLPPHYQTTNGLP  366
             LAK L+ R F +HLCSTP NL+SIK  I + YS SI L+ELH+P  PDLPPHY TT GL 
Sbjct  1     LAKRLSARNFHIHLCSTPVNLSSIKPKISKKYSSSIELVELHIPSLPDLPPHYHTTKGLA  60

Query  367   LHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAM  546
                H+     L+    + +     L            WA +VA S  +PSV FF + A  
Sbjct  61    SPPHENPHPWLQQYRQEVSARFARLT-------FSKPWAPEVAKSHGVPSVVFFVSGAGS  113

Query  547   CSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM--NQETRNFKREETLDTPANQAMMLV  720
              S+  H+  N   E+PF  + L  YE  K  +    +++  +++  + ++  +N   +L+
Sbjct  114   SSFLLHVTKNTCNEFPFGEIFLHDYELAKIIKAAEDSRDAADYRTPQCVERSSN--FILM  171

Query  721   NSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGS  900
              + RE+EGKYIDYLS     KVV +G   + P  ++    + +WL ++   STVFVSFG+
Sbjct  172   KTFRELEGKYIDYLSSYSGKKVVPVGPLVEDPSNIEDGDSIIEWLDKRDKLSTVFVSFGT  231

Query  901   EYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWA  1080
             EYFL ++D EEIA+GLE+S VNF+WV+RFP GE I +EEALP GFLER+ +RG +++GWA
Sbjct  232   EYFLTEKDREEIAHGLELSNVNFLWVIRFPVGESIELEEALPGGFLERVRDRGSVIDGWA  291

Query  1081  PQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVER  1260
              Q KIL H S GGFVSHCGW S+MES+  GVPIIAMPM LDQPMNARL+ ++G  +EV+R
Sbjct  292   AQGKILEHPSIGGFVSHCGWGSVMESMKSGVPIIAMPMQLDQPMNARLVEQVGVGLEVKR  351

Query  1261  DEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             ++ G+L R E+A  +++ V  ++G+ +++  K +S+++R  G  E+D V  +L +LC
Sbjct  352   NKSGELERSEIAKVIKDVVVEKDGDSMRKKTKEMSDSIRKKGEAELDEVADKLVQLC  408



>gb|EYU19795.1| hypothetical protein MIMGU_mgv1a019121mg [Erythranthe guttata]
Length=479

 Score =   375 bits (964),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 292/448 (65%), Gaps = 10/448 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+M PWLA+GHI+PF+ LAK+LA R F+ ++CS+P NL SI+  +   +S SI+L++LH+
Sbjct  10    VLMLPWLAHGHISPFLELAKSLAARNFVTYICSSPVNLASIRETLSPKHSISIKLVDLHI  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P + DLPPH  TTNGLP HL  +LK+ L  A P F+ LLKTL PDL+++D +  WA + A
Sbjct  70    PATADLPPHRHTTNGLPPHLMPSLKRALDKARPAFSTLLKTLKPDLVVYDFLQPWAPEEA  129

Query  496   LSLNIPSVRFFTASAAMCSYFT-HMLTNPGAEY--PFPALRLRQYEQTKTRELMNQETRN  666
                +IP+V FFT  AA  S    H    PG+EY  PFP +  R+ E      +++     
Sbjct  130   ALQDIPAVLFFTTGAATTSLLLYHWFREPGSEYNYPFPGIYFRENEFGIYSRMIHSAGGE  189

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF-QAPPPVDHET  837
                ++ +     ++  ++L+ +  ++EGKY+DYLS+L + K V  G    Q    +  + 
Sbjct  190   TNDDDRVRDCVKRSSDVVLIKTFGDLEGKYVDYLSQLCRKKFVPAGHLVNQDINNMKKDD  249

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE---EIS  1008
              L +WL  K   STVF SFG+EYFL + ++EEIA GLE+SGVNFIWV+RFP GE    I 
Sbjct  250   SLIEWLDEKERRSTVFASFGTEYFLSENEVEEIACGLEMSGVNFIWVVRFPAGEGRSRIE  309

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             +EE LP GFLER+G RG +VEGWAPQ +IL H S GGF+SHCGW+S+ME +  GVPI+A 
Sbjct  310   IEEKLPVGFLERVGGRGVVVEGWAPQRRILSHPSVGGFLSHCGWSSVMEGVYSGVPIVAA  369

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             PMHLDQP+NARL+VE G   EV R  +G+L REE+A  +R+ V   +GE+L+R V    E
Sbjct  370   PMHLDQPLNARLVVEAGLGEEVVRSGEGRLDREEVARVVRKVVVERSGEELRRRVVEFGE  429

Query  1369  NLRLAGNREMDAVVAELEKLCNKPERIA  1452
              +R     E+D VV E+ +LC +   +A
Sbjct  430   RMR-EKVEEIDGVVEEMVRLCKRENSMA  456



>gb|EYU43900.1| hypothetical protein MIMGU_mgv1a026213mg [Erythranthe guttata]
Length=454

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 281/441 (64%), Gaps = 3/441 (1%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS--YSQS  291
             M +  +++MFPWLA+GH+ P++ LAKNL+ + F +  CST   L+SIK  + ++     S
Sbjct  1     MESNFNILMFPWLAHGHVYPYLELAKNLSTKNFNIFFCSTSIILSSIKETLDRNSPCGIS  60

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+ELHLP SPDLP +Y TT  LP HL   L    + +   F+ ++ +L PD+LI+DV 
Sbjct  61    INLVELHLPSSPDLPQNYHTTKNLPPHLMPKLFDSFQNSNSSFSSIISSLKPDMLIYDVF  120

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA K+A SL+IP+V F T+ A   S++ H   +  + +P+  + LR YE+   + ++ 
Sbjct  121   QPWAAKIATSLSIPAVHFATSGATAYSFYHHHFIHKNSPFPYDGIYLRDYERKALQSMVL  180

Query  652   QETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG-TTFQAPPPVD  828
                +N +         +  ++L+ +   +EGKY+DYLS L K K+V +G    QA    +
Sbjct  181   SRDKNDQDFAFGHFSMSCEIVLMKTCNGLEGKYLDYLSVLCKKKIVPVGPLVTQADESDE  240

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS  1008
             + +++  WL+ K   STVF+SFGSE +L K+ + EIA GLE S VNFIWV+RFP GE +S
Sbjct  241   NHSDIMKWLSTKDRFSTVFISFGSENYLSKDQMGEIAKGLEFSNVNFIWVVRFPHGERVS  300

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             +EEALPKGFL+R+ +RG +V+GWAPQAKILGH S G FVSHCG +S +ES+  GVP+IA+
Sbjct  301   IEEALPKGFLDRVKQRGMIVQGWAPQAKILGHPSIGAFVSHCGMSSTIESVYFGVPVIAV  360

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             P+ LDQP+NARL+VE G  VEV RD  G L  +E+  A+   +  + GE ++    ++SE
Sbjct  361   PLKLDQPLNARLVVEAGIGVEVVRDANGHLSSDEIFNAINTAIFDKTGEVMRLKAAQMSE  420

Query  1369  NLRLAGNREMDAVVAELEKLC  1431
              ++      M+    +L ++C
Sbjct  421   MMKSEEAYAMNETAEQLRRIC  441



>ref|XP_011071477.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=460

 Score =   372 bits (956),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 288/459 (63%), Gaps = 16/459 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNI-PQ  276
             M ++T   R  ++MFPWLA+GHI P++ L+K L  R  F ++LCSTP N  SI   I   
Sbjct  1     MDSQTTTFR--ILMFPWLAHGHIFPYLELSKRLLIRKNFHIYLCSTPINFTSINAFIHNN  58

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             + S+SI++++LHL  S +LPPHY TT  LP  L   L K L+ A+  F++++ TL PDL+
Sbjct  59    NLSESIQVVQLHLQPSHELPPHYHTTKNLPSDLVFTLIKALQTAKSSFSDIITTLKPDLV  118

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN--PGAEYPFPALRLRQYEQT  630
             I DV   WA ++A S  +P+V F    AA  SY  H      PG ++ F  L L    + 
Sbjct  119   IFDVFQPWAARLASSQGVPAVHFAPLGAATRSYTYHHYVRRLPGGDFRFQELCLGDDHEK  178

Query  631   KTRELMNQETRNFKREETLDTP-----ANQAMMLVNSSREVEGKYIDYLSELMKSKVVSI  795
             K+ +   Q       EE  D        +  + L+ +SR +EGKYIDY+S +   K++S+
Sbjct  179   KSLDGFFQFLYYNVFEEDEDVVFVNYRLSTDIALLKTSRGLEGKYIDYVSAVCHRKLLSV  238

Query  796   GTTFQAPPPVDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
             G         D E E    + +WL++K   STV++SFGSEYFL K+++EEIA GLE+   
Sbjct  239   GPLVADVNKDDEEEEKYSDIMEWLSKKKQHSTVYISFGSEYFLSKQEIEEIAKGLELCDA  298

Query  964   NFIWVLRFPKGE-EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGW  1140
             NFIWV+RFP GE EISVE+ALPKGFLER+ ERG +V GWAPQA+IL H+ST  FVSHCGW
Sbjct  299   NFIWVIRFPLGEKEISVEDALPKGFLERVKERGIVVLGWAPQARILVHQSTASFVSHCGW  358

Query  1141  NSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG  1320
             +S+ ES+  GVP+I MPM L+  ++ R++VE GA VEV RDE G    EE+A A+++ V 
Sbjct  359   SSLNESVYFGVPVIGMPMKLNMFIDCRMLVEAGACVEVVRDENGVYKGEEIAKAIKKVVA  418

Query  1321  GENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
               +GE L++  + +SE +++  +RE+D V   L +LC K
Sbjct  419   ETSGEGLRQRAQELSEKMKMEEDRELDEVAEGLWQLCLK  457



>ref|XP_002311963.2| hypothetical protein POPTR_0008s02520g [Populus trichocarpa]
 gb|EEE89330.2| hypothetical protein POPTR_0008s02520g [Populus trichocarpa]
Length=419

 Score =   369 bits (947),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 255/433 (59%), Gaps = 48/433 (11%)
 Frame = +1

Query  121   ATRRSVV---MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             AT RSVV   MFPWLAY HI PF+ LAK L++R F +HLCS+P NL  IK N+ +    S
Sbjct  3     ATNRSVVRVLMFPWLAYSHIHPFLELAKKLSERNFYIHLCSSPANLGHIKENLLEMNFPS  62

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I+L+ELHLP SPDLPPHY TT GLP HL   L +    A   F+ +L TL P  L  D  
Sbjct  63    IQLVELHLPSSPDLPPHYHTTKGLPNHLLGNLMQAFDTASSSFSSILTTLRPYFLTCDFF  122

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA  +ALSLNIP+V+F  +     S   H     G              Q   ++ + 
Sbjct  123   QPWAPALALSLNIPTVQFVVSGNKANSVAAHAFKKSGVVI-----------QDSAKDFLF  171

Query  652   QETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV--  825
              + R                                L  L +S  + +   F   P    
Sbjct  172   IKDR-------------------------------ILQHLEQSSGIMLSVHFVQEPIAED  200

Query  826   DHETELTDWL-ARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE  1002
             D +TE+T+WL  R P SS ++V+FGSE +L KED EE+A GL +S VNFIWVLRFP+GEE
Sbjct  201   DKKTEITEWLNKRDPCSSVIYVAFGSENYLSKEDREELALGLLLSNVNFIWVLRFPRGEE  260

Query  1003  ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
             IS  EALP+GF+E + ERG +VE WAPQ +IL H S GGF+SHCGW S++ES+  GVP+I
Sbjct  261   ISAREALPEGFIEMVSERGLIVEEWAPQKRILSHPSIGGFLSHCGWGSVLESMKFGVPLI  320

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             AMPMH+DQP+NA  +VEIG  +E++RD+ GK+ REE+A  +R+  G   GE L++  + +
Sbjct  321   AMPMHIDQPLNAEFLVEIGVGLEIKRDKNGKIEREEVARVIRDLAGERTGEHLRKKAREL  380

Query  1363  SENLRLAGNREMD  1401
             S+ +R    +E+D
Sbjct  381   SDCIRDKAGQEID  393



>ref|XP_004140986.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
 gb|KGN46026.1| hypothetical protein Csa_6G045050 [Cucumis sativus]
Length=489

 Score =   371 bits (952),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 294/463 (63%), Gaps = 29/463 (6%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY--SQSIRL  300
             +  ++M PWLA+GH++PF+ L+K LA + F +  CST   L+SI++ +PQ    S +I+L
Sbjct  12    KMKILMLPWLAHGHVSPFLELSKLLATKNFHIFFCSTSIILHSIRSKLPQKLLSSSNIQL  71

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +EL LP S DLP    TT GLP HL  +LK+    A   F  +L+ L PDL+I+D +  W
Sbjct  72    VELTLPTSADLPRWRHTTAGLPSHLMFSLKRAFDSAASAFDGILQNLKPDLVIYDFLQPW  131

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEY--PFPALRLRQYEQTKTRELMNQ  654
             A  VALS NIP+V F    A M +  T+ML  P +++   FP + L ++E  + + L   
Sbjct  132   APAVALSANIPAVMFQCTGALMAAMVTNMLKFPNSDFLSTFPEIHLSEFEIKQLKNLFKS  191

Query  655   ETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
                + K ++ ++    ++  ++L+ S RE+E KYID++S  ++ K + +G      P V+
Sbjct  192   SVNDAKDKQRIEECYKRSCGILLLKSLREIEAKYIDFVSTSLQIKAIPVG------PLVE  245

Query  829   HETE--------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
              + E           WL +K   S + VSFGSE++L K D+EEIA+GLE+S VNFIWV+R
Sbjct  246   EQEEDIVVLAESFEKWLNKKEKRSCILVSFGSEFYLSKGDMEEIAHGLELSHVNFIWVVR  305

Query  985   FP--------KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGW  1140
             FP        K ++  VEE LPKGFLER+GERG +VE W PQ +IL HRSTGGF+SHCGW
Sbjct  306   FPGSGEQGERKKKKNVVEEELPKGFLERVGERGMVVEEWVPQVQILKHRSTGGFLSHCGW  365

Query  1141  NSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG  1320
             +S++ES+  GVPIIA PM LDQP+NARL+  +G  V VER + G+L R E+A A+RE V 
Sbjct  366   SSVLESIKSGVPIIAAPMQLDQPLNARLVEHLGVGVVVERSDGGRLCRREVARAVREVVA  425

Query  1321  GENGEKLKRNVKRISENLRLAGN-REMDAVVAELEKLCNKPER  1446
              E+G++++  VK +++ ++  G+  EM+ VV E+ KLC +  +
Sbjct  426   EESGKRVREKVKEVAKIMKEKGDEGEMEVVVEEITKLCRRKRK  468



>ref|XP_006342776.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=454

 Score =   370 bits (949),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 282/451 (63%), Gaps = 14/451 (3%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSI-KNNIPQSYS  285
             +T  T   V+M PWLA+GH+ P++ LAK L+    F ++ CSTP  LNSI + N+P++  
Sbjct  6     DTNPTTLKVLMVPWLAHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN--  63

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
               I+L+E  LP SP LP H  TTNGLP +L   L +    A   F ++L +L+PDLLI D
Sbjct  64    --IQLIEFPLPSSPQLPSHQHTTNGLPKNLLSTLIQTFGEAGSTFAKILDSLSPDLLIFD  121

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTKTRE  642
                 WA ++A S  IP++ F    +A  S+F H     G  ++PF  + L+ +E  K  +
Sbjct  122   GFQPWAPELASSRKIPAIDFLIIGSASVSFFYHHYLYAGKRDFPFSGIFLKDFE-AKQLQ  180

Query  643   LMNQETRNFKREETLD-TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
             L  +   +       +    +  ++L+N+  E+EGKY+DYLS L   KVV +G   +   
Sbjct  181   LTAEMNISIGPNVAFNGLEKSHEIILINTCNEIEGKYVDYLSTLSNKKVVPVGPLIREME  240

Query  820   PVDHE---TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
                     +++  WL +K  SS V+VSFGSEYFL KE++EEIA+ LE+S +NFIWVLRFP
Sbjct  241   TTTENEENSKIIQWLDKKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELNFIWVLRFP  300

Query  991   KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
              GEE ++E ALPKGFL+R+  +G +VE WAPQA+IL H S GGF+ HCGWNSI+ESL+ G
Sbjct  301   LGEETNIENALPKGFLDRVEGKGVIVEKWAPQARILEHPSVGGFLCHCGWNSILESLHFG  360

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK-GKLHREEMAAALRETVGGEN-GEKLK  1344
             VP+I MPMH DQ  ++R+ VE+G A+EV RD++ GKL++EE A  +R  V  +N GE +K
Sbjct  361   VPLITMPMHFDQHTHSRMTVELGTAMEVVRDDQNGKLNKEETAKVIRNVVMEKNGGENVK  420

Query  1345  RNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
               VK + + +R  G  E D VV +L  L  K
Sbjct  421   AKVKELRKKIREKGEEEFDQVVNKLLDLSTK  451



>gb|AGP25113.1| uridine diphosphate glycosyltransferase [Bupleurum chinense]
Length=444

 Score =   367 bits (942),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 272/436 (62%), Gaps = 11/436 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             ++VM P+LA GHI+P++ LAK L  R F +++CSTP NL SIKN + Q+   +I+L+ELH
Sbjct  10    TIVMVPYLAQGHISPYLELAKQLTKRSFNIYICSTPVNLASIKNRVLQN--DNIQLVELH  67

Query  313   LPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKV  492
             L  SPDLPP Y +TNGLP HL   L+  L+ A P+F  +LK +NP+L+I+D +  W  +V
Sbjct  68    LQSSPDLPPQYHSTNGLPSHLMPVLRDALEKAAPNFVSILKDINPNLVIYDFMPSWPAEV  127

Query  493   ALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             A+SLNIP+V F   +AA      H     G ++PFP + +   +Q      + +  RNF 
Sbjct  128   AMSLNIPAVYFTVNAAATSCIGLHPYKRAGEKFPFPEIFVPSVDQPPVSADVLRILRNF-  186

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP--VDHETELT  846
                 L    +   +LV S REVEGKYID+LS+L +  ++  G     P     D+  ++ 
Sbjct  187   ---LLCFERSCNFVLVKSCREVEGKYIDHLSDLAEKNMIPTGPLVHDPTENEDDNMKDIM  243

Query  847   DWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALP  1026
              WL +K   S VFV FGSE +L  E++ E+A  LE +  NFIW LR  +GEE      LP
Sbjct  244   KWLDKKKKYSVVFVCFGSENYLSAEEVIEMANALETTKCNFIWALRSIQGEE-EGSALLP  302

Query  1027  KGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQ  1206
              GF+ER+G+ G ++  WAPQ  IL H STGGF+SHCGW S++ES+  GVPIIAMPM +DQ
Sbjct  303   DGFVERVGDLG-LILSWAPQTMILRHPSTGGFLSHCGWGSMIESMKYGVPIIAMPMKVDQ  361

Query  1207  PMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAG  1386
             PMNARL  EIG ++E+ RD +GK   EE+   +R  +  E+GE ++R  + +  N++  G
Sbjct  362   PMNARLATEIGVSMEIVRDNEGKFKWEEIVRVIRMVLVEESGEGVRRKARELCLNMKERG  421

Query  1387  NRE-MDAVVAELEKLC  1431
               E +D   AELEK+C
Sbjct  422   EEEYLDKAAAELEKIC  437



>gb|AFJ53042.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=482

 Score =   368 bits (945),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 290/475 (61%), Gaps = 40/475 (8%)
 Frame = +1

Query  106   GTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYS  285
             G +    R +V++ P L  GHI+P++ L+K L+   F V+LCSTP NLN +K  +  + S
Sbjct  7     GGQQQMKRTTVLLLPSLGPGHISPYLELSKRLSSHNFNVYLCSTPANLNPLKPKL-LAES  65

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMA--EPDFTELLKTLNPDLLI  459
              +I L+ELHLP +P LPPHY TTNGLP HL   LK     A     F+ +L +++PDLLI
Sbjct  66    STITLVELHLPSTPQLPPHYHTTNGLPPHLMPHLKLAFDSAATRSAFSSILMSVSPDLLI  125

Query  460   HDVVNLWAEKVALSL-NIPSVRFFTASAAMCSY------FTHMLTNPGAEYPFP------  600
             +D +  WA ++A SL +IP+V F +  AAM ++      F     N  A +PF       
Sbjct  126   YDFLQPWAPQLASSLLHIPAVLFLSTGAAMFAFAAHAYKFGRDNINNEASFPFASSIYLR  185

Query  601   ------ALRLRQYEQTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYL  762
                   A   R  E T   E+ +       +E +       +++L+ + RE+EGKY+DY+
Sbjct  186   DDREERAFVSRMLEPTCGNEINDHNWVQLCQERSC------SIILIKTFREIEGKYLDYI  239

Query  763   SELMKSKVVSIGTTFQAPPPV--DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEI  936
             SEL   + V +G   Q       D    ++ WL  K  SSTVFVSFGSE+FL  + + EI
Sbjct  240   SELAGKRHVPVGPLLQKTTSSEEDGGRRISKWLDAKQTSSTVFVSFGSEFFLSPDLIHEI  299

Query  937   AYGLEISGVNFIWVLRFP----KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGH  1104
             A+GLE+SG NF+WVLRFP    K    +  EALP GFL+R+GE+G +VEGWAPQ+ IL H
Sbjct  300   AHGLELSGANFVWVLRFPLEDQKSPNSAAAEALPPGFLDRVGEKGLVVEGWAPQSAILAH  359

Query  1105  RSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK-GKLH  1281
              S GGFVSHCGW+S+MES+  GVPI+AMPMHLDQP+NARL+ EIG  VEV RD + GK  
Sbjct  360   DSVGGFVSHCGWSSVMESMWYGVPIVAMPMHLDQPLNARLVEEIGVGVEVTRDGRSGKAD  419

Query  1282  REEMAAALRETVGGEN-----GEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             R+E+A  +RE V G       GEK++R  + +SE ++  G+ E+D VV EL +LC
Sbjct  420   RKEVAKVIREVVMGVEGNNGVGEKVRRKAREMSEVMKKKGDLEIDDVVHELLQLC  474



>gb|EYU18696.1| hypothetical protein MIMGU_mgv1a006481mg [Erythranthe guttata]
Length=442

 Score =   367 bits (941),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 269/441 (61%), Gaps = 24/441 (5%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADR--GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             V+MFPWLAYGHITP++ LAK LA +   F++++ STP     I   +PQ+ S SI+L+  
Sbjct  15    VLMFPWLAYGHITPYLELAKKLATKNSSFIIYIYSTPATFTCIDKKVPQNLSNSIKLVPF  74

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP + +LP H  TT GL  HL   L+  L  +   F+++L+ L PDL I+D    WA  
Sbjct  75    HLPNTLELPSHLHTTRGLASHLIPKLEDALNSSANQFSDILEKLAPDLFIYDCFQSWAAL  134

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTK--TRELMNQETR  663
             +A   NI +V F T+ A    +  H+L   G E+PFP +     E  K     + + E  
Sbjct  135   LARDRNIRAVEFMTSGATSVGHLYHLLLRRGTEFPFPNIYQNGVEDDKRFVEIISSVEKT  194

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
             N   E       +  ++L+   RE+EGKYIDYLS LM  K V +G      P V  E+  
Sbjct  195   NAMLE---GARVSNKIVLIKGCREIEGKYIDYLSSLMGKKFVPVG------PLVVLES--  243

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE----ISV  1011
                 +++   STVFVSFGSE F+ KED+ E+AYGLE+S  NFIWVLR PKG +     S+
Sbjct  244   ----SKREKKSTVFVSFGSECFITKEDIHEVAYGLELSKCNFIWVLRLPKGGDNTNISSI  299

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             EE LP GFL+R   RGR++EGWAPQ KILGH S GGFVSHCGWNS+MES+  GVP+IAMP
Sbjct  300   EEMLPIGFLDRANGRGRVLEGWAPQTKILGHASVGGFVSHCGWNSLMESMYFGVPVIAMP  359

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             MH+DQP+NARL+ ++G  VEV RD+  +  RE +A  +R  V   +G+ +++    +   
Sbjct  360   MHVDQPINARLVEDVGVGVEVLRDKNKRFRREAVAEVIRSVVVESSGKFVRKRAADVGVK  419

Query  1372  LR-LAGNREMDAVVAELEKLC  1431
             LR   G+ E+D VV EL  LC
Sbjct  420   LRGKRGDEEIDEVVKELVGLC  440



>ref|XP_011091058.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   365 bits (938),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 288/456 (63%), Gaps = 27/456 (6%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ-  288
             E   T  S++MFPW+ +GH+ P++ LAKNL+++ F +  CST  NL+SI + + +S S  
Sbjct  2     EAKETNFSILMFPWIGHGHVFPYLELAKNLSNKNFDIFFCSTAVNLSSISDALEKSSSTI  61

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLP   +LPPH+ TT  +P  L   L +  +M+   F++++ ++ PD+LI+DV
Sbjct  62    SIQLVELHLPLLSELPPHFHTTKNVPPALMPKLFETFQMSTSSFSDIISSIRPDMLIYDV  121

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA K+ALSL IP+V F T+ AA  S++ H   +  + +PF A+ LR YE+     + 
Sbjct  122   FQPWAAKIALSLGIPAVHFATSGAAPYSFYLHYFISANSVFPFEAIYLRDYERKALEAMA  181

Query  649   NQETRNFKREETLDTPANQ-----AMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
               + RN ++++  D+  +       ++L+ + R +E KYID+LS L K K+V +G     
Sbjct  182   PSDRRNKQKDQ--DSGFDHFRLSCDIVLMRTCRAIERKYIDHLSFLCKRKLVPVG-----  234

Query  814   PPPVDH-------ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
              P V H         E+  WL++K   STVF+SFGSE +L K+ + EIA GLE   VNFI
Sbjct  235   -PLVTHANSEEAKHAEIMQWLSKKNQFSTVFISFGSENYLFKDQMVEIAKGLEACNVNFI  293

Query  973   WVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             WV+R P GE +S+EE LP GFL+R  + G +++GWAPQA IL H STG F+SHCG +SI+
Sbjct  294   WVVRSPLGERVSIEEVLPTGFLDRAKDTGMILQGWAPQANILAHPSTGAFLSHCGMSSII  353

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENG  1332
             ES+  GVP+IAMP+ LDQP+NARL+VE G +VEVERDE G      +A A+ + +  E G
Sbjct  354   ESIYFGVPVIAMPLKLDQPLNARLVVEAGVSVEVERDENGGFRGAGVADAINKVIMEETG  413

Query  1333  EKLKRNVKRISENLRLAGNREMDAV---VAELEKLC  1431
             E ++     +S+ ++   N E DAV     +L KLC
Sbjct  414   EVMRLKAAELSKKMK---NEEEDAVNDTADQLRKLC  446



>ref|XP_009589204.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=455

 Score =   365 bits (938),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/452 (43%), Positives = 283/452 (63%), Gaps = 11/452 (2%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             E+      V+M PWLA+GH TPF  LAK L+   F V+ CSTP  LN +K +    +S +
Sbjct  3     ESQRNSLKVLMVPWLAHGHATPFFELAKRLSKCNFYVYFCSTPIILNFLKKSQSNFFSNN  62

Query  292   -----IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
                  I+L+ELHLP + +LP  YQTT GLP HL   L    K A P F+ ++ TLNPDL+
Sbjct  63    HSNTKIQLIELHLPSTLELPLEYQTTKGLPRHLFPILLNSFKTAGPIFSNIVPTLNPDLI  122

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTK  633
             I+D+   WA K+A SL+IP+V +    A   S+F H+    G  ++PFP + L +YE  K
Sbjct  123   IYDIFQNWAPKIASSLHIPAVSYIILGATTASFFYHLYAFDGTKDFPFPEIFLPRYELEK  182

Query  634   TRELMNQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF  807
                  N     F  +   +     +Q ++L+N+ +  E KY++Y S L K  V+S+G   
Sbjct  183   LYS-ENASMTKFIDDIFASSGVAMSQDIILINNWKCTETKYMEYFSILTKKNVISVGPLI  241

Query  808   -QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
              +    V+   ++  WL +K  SST++V+FGSE  + KE++EEIA GLE+S VNF+WV+ 
Sbjct  242   GKTESRVEDSEDIIQWLDKKDPSSTLYVAFGSECVVNKEEIEEIARGLELSNVNFLWVVN  301

Query  985   FPKGEEIS-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESL  1161
             F   E+IS ++E LP+G+ ER+ E+GR+V  WAPQAKIL H +  GF++HCG NSI+ESL
Sbjct  302   FSLDEKISGIDEILPEGYNERVKEKGRIVTKWAPQAKILRHSNIVGFLNHCGSNSILESL  361

Query  1162  NLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKL  1341
             + GVPIIAMP+ +DQ +  R MVE+G  +EV+RD+ GK+  EE+A A++  +  + GE+L
Sbjct  362   HFGVPIIAMPVLVDQFIATRYMVELGVGLEVKRDQNGKVKAEEIAKAIKNVIVEKKGEEL  421

Query  1342  KRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
             +   + +SE ++    +E+D  V EL+KLC K
Sbjct  422   REKSRELSEKMKREEGKEIDEAVIELQKLCLK  453



>ref|XP_011090911.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=456

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 285/453 (63%), Gaps = 8/453 (2%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ-  288
             E   T+  V+MFPWLA+GHI PF+ LAK L+ R F V+LCST  NL+SI+ N  +  S  
Sbjct  2     EKKETKFRVLMFPWLAHGHIFPFLQLAKRLSRRNFSVYLCSTAVNLDSIRANTERDVSDD  61

Query  289   -SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
              SI L+ELH+P S +LPP   TT  LP +L  AL +  + +   F++++ ++NPDLLI+D
Sbjct  62    PSIELVELHIPPSSELPPELHTTKNLPSNLLPALLQAFQTSSFSFSDIMNSVNPDLLIYD  121

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRE  642
                 WA K+A S  IPSV F  A  A  +++ H+ T   +  +P+ A+ L  +E T    
Sbjct  122   FFQPWAPKLASSKVIPSVFFSCAGVAPYAFYHHLYTEGASSIFPYQAIYLLDHESTNVLA  181

Query  643   LMNQETRNFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
              +    ++ +++    +   +  ++L+ SSR VEGKYIDYLS   K ++V  G       
Sbjct  182   RIEPNIKDAEKDFAFGSFKLSTDIILMKSSRSVEGKYIDYLSNRCKKQIVPTGPLIADAS  241

Query  820   PVDHE--TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
               D E  +E+  WL+ K   ST+++SFGSEYFL K+ +E IA GL +  VNF+WV+RFP 
Sbjct  242   HYDDEKLSEIMRWLSEKQEYSTIYISFGSEYFLSKDQIEVIAKGLALCNVNFLWVVRFPT  301

Query  994   GEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
             GE+  S+EEALP  FLE + +RG +V  WAPQ KIL H STGGFVSHCGW+SIMES+  G
Sbjct  302   GEKSTSIEEALPAWFLETVKDRGIIVPEWAPQTKILAHWSTGGFVSHCGWSSIMESMYFG  361

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEKLKR  1347
             VP+IAMPM  DQP+NARL+VE GA +EVERD  G    E +A A+ + +  +   E L+ 
Sbjct  362   VPVIAMPMKSDQPINARLVVETGAGIEVERDGNGHYLAEGLARAINKVIVEKPFCEGLRD  421

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
               +R+SE ++ +  +EM+ V  +L ++C   E+
Sbjct  422   RAERLSELMKESEEQEMNEVEEQLLRICMDNEK  454



>emb|CDP05516.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   364 bits (935),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 275/449 (61%), Gaps = 30/449 (7%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIP---QSY  282
             E+ A R  ++MFPWLA+GHI+PF+ L+K LA   F V+LCST  NLN +K +      S 
Sbjct  7     ESNAPRFRILMFPWLAHGHISPFMELSKRLAKSNFQVYLCSTEINLNFMKRSAKFDENSS  66

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
               +I  ++L LP+ P+LPPHY TT  +P HL   LK+   MA+ +F  +L  L PDLL++
Sbjct  67    DHAIEFVQLDLPDLPELPPHYHTTKNIPPHLEPTLKRAFHMAKTNFQNILNNLKPDLLVY  126

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRE  642
             D    WA ++A   +IPSV F    A   S+                  L + +++K +E
Sbjct  127   DGFQPWASELAALNHIPSVLFLVVGAVNLSFKI----------------LAKLQESKAKE  170

Query  643   LMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--  816
                     FK  E      +  ++LV S R +EGKYID+LS     K+V++G        
Sbjct  171   --GDALDVFKSIEL-----SSDIVLVKSWRGIEGKYIDHLSSSCGKKLVAVGPLSNQEDN  223

Query  817   -PPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                 D  + + ++L  K  +S V+VSFGSEYFL KE+ EEIA GLE+S  NFIWV+RFP 
Sbjct  224   GKEADSYSLIIEFLNSKDEASVVYVSFGSEYFLSKEEREEIAVGLELSNANFIWVVRFPV  283

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             G  I +EEALP+GFLER+  RG +V GWAPQAKILGHRSTGGFVSHCGW S++ES+  GV
Sbjct  284   GHAIGLEEALPEGFLERVKGRGMVVNGWAPQAKILGHRSTGGFVSHCGWGSVIESIYYGV  343

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLK-RN  1350
             P++A+PMHLDQP++ARL VEIG  +E+ +DE G++ REE+A  + E V  +   KL+ + 
Sbjct  344   PLLALPMHLDQPLHARLAVEIGVGIEILKDEDGQIKREEIARVINEVVVKKTEGKLQGQK  403

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCNK  1437
                +S+ LR  G  E+   + +L  LC+K
Sbjct  404   AIELSKKLREEGEEELHEAIEKLRSLCSK  432



>sp|Q5NTH0.1|UGAT_BELPE RecName: Full=Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase; 
Short=BpUGAT; AltName: Full=UDP-glucuronic acid:anthocyanin 
glucuronosyltransferase [Bellis perennis]
 dbj|BAD77944.1| UDP-glucuronic acid:anthocyanin glucuronosyltransferase [Bellis 
perennis]
Length=438

 Score =   363 bits (932),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/439 (43%), Positives = 273/439 (62%), Gaps = 23/439 (5%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             VVM PWLAY HI+ F+  AK L +  F +++CS+  N+  +KNN+   YS+SI+L+EL+L
Sbjct  12    VVMLPWLAYSHISRFLVFAKRLTNHNFHIYICSSQTNMQYLKNNLTSQYSKSIQLIELNL  71

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P S +LP  Y TT+GLP HL   L    + + PDF  +L  LNP L+I+D   LWA +VA
Sbjct  72    PSSSELPLQYHTTHGLPPHLTKTLSDDYQKSGPDFETILIKLNPHLVIYDFNQLWAPEVA  131

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPG----AEYPFPALRLRQYEQTKTRELMNQETR  663
              +L+IPS++  +   A+ +   H+ T P     A++PFP +        K R++    ++
Sbjct  132   STLHIPSIQLLSGCVALYALDAHLYTKPLDENLAKFPFPEI------YPKNRDIPKGGSK  185

Query  664   NFKREETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV-DHET  837
               +R   +D       ++LV S+ E+EGKYIDYLS+ +  KV+ +G   Q    + D   
Sbjct  186   YIER--FVDCMRRSCEIILVRSTMELEGKYIDYLSKTLGKKVLPVGPLVQEASLLQDDHI  243

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
              +  WL +K  SS VFV FGSEY L   ++E+IAYGLE+S V+F+W +R         + 
Sbjct  244   WIMKWLDKKEESSVVFVCFGSEYILSDNEIEDIAYGLELSQVSFVWAIR--------AKT  295

Query  1018  ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
             +   GF++R+G++G +++ W PQA IL H STGGF+SHCGW+S MES+  GVPIIAMPM 
Sbjct  296   SALNGFIDRVGDKGLVIDKWVPQANILSHSSTGGFISHCGWSSTMESIRYGVPIIAMPMQ  355

Query  1198  LDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLR  1377
              DQP NARLM  +GA +EV RD +G+L REE+AA +R+ V  ++GE ++   K + E ++
Sbjct  356   FDQPYNARLMETVGAGIEVGRDGEGRLKREEIAAVVRKVVVEDSGESIREKAKELGEIMK  415

Query  1378  LAGNREMDAVVAE-LEKLC  1431
                  E+D +V E L KLC
Sbjct  416   KNMEAEVDGIVIENLVKLC  434



>ref|XP_009802399.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=365

 Score =   360 bits (925),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 240/357 (67%), Gaps = 4/357 (1%)
 Frame = +1

Query  379   DALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYF  558
             + LK+   +A P+FT +LKTL PDLLI+D +  WA  VA  L IP+V F ++S+ M +Y 
Sbjct  2     NTLKEAFDLACPEFTLILKTLKPDLLIYDFLQPWAPNVAAELKIPAVEFISSSSTMTAYM  61

Query  559   THMLTNPGAEYPFPALRLRQYEQTKTRE---LMNQETRNFKREETLDT-PANQAMMLVNS  726
              H    PG ++PF ++  R YE  + ++    M  E     ++   D    +  ++L+ S
Sbjct  62    LHDFNKPGIKFPFSSIYYRDYEMARIKKDESSMPVEKLEEDKKRVRDCFYLSSDIVLIKS  121

Query  727   SREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEY  906
              +E+EGKY DY+++L   KVV IG   Q P   D E+EL  WL  K   ST+FVSFGSEY
Sbjct  122   FKEIEGKYSDYITKLTGKKVVPIGPLVQEPTLDDGESELITWLNEKEEKSTIFVSFGSEY  181

Query  907   FLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQ  1086
             FL KEDL EIAYGLE S VNFIW +RF KGE+I +EEALP GF  R+G RG++ +GWAPQ
Sbjct  182   FLSKEDLLEIAYGLENSKVNFIWPIRFQKGEDIELEEALPNGFFNRVGNRGKVFKGWAPQ  241

Query  1087  AKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE  1266
             AKIL H S GGF+SHCGW+S+MES+  GV IIAMPMH+DQP+N+RL+ E+G AVEV RD 
Sbjct  242   AKILEHSSIGGFMSHCGWSSVMESMKYGVSIIAMPMHIDQPINSRLVEEVGIAVEVVRDS  301

Query  1267  KGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
              GKLHREE+AA + + V  + G+ +++  + + E LR  G+ E++ V  EL+KLC K
Sbjct  302   NGKLHREEVAAIINQVVVEKEGKFVRQKARDMKEMLRSKGDEEIEEVAKELKKLCAK  358



>ref|XP_009803961.1| PREDICTED: crocetin glucoside glucosyltransferase-like, partial 
[Nicotiana sylvestris]
Length=449

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/434 (44%), Positives = 271/434 (62%), Gaps = 14/434 (3%)
 Frame = +1

Query  157   AYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSI-KNNIPQSYSQSIRLLELHLPESPD  330
             ++GH+ P++ LAK L+    F ++ CSTP  LNSI + N+P++    I+L+E  LP S  
Sbjct  10    SHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN----IQLIEFPLPSSTQ  65

Query  331   LPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNI  510
             LP +  TTNGLP +L   L +    A   F ++L +LNPDLLI D    WA ++A S NI
Sbjct  66    LPSYNHTTNGLPKNLLSTLIQTFGEASSTFGKILDSLNPDLLIFDGFQPWAPQLASSRNI  125

Query  511   PSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTKTRELMNQETRNFKREETL  687
             P++ F    +A  S+  H     G   +PF  + L+ YE  K  +L  +   +       
Sbjct  126   PAIHFLIVGSASISFLYHHYLYVGTRNFPFSGIFLKDYE-AKQLQLAAKMNNSLGPNVAF  184

Query  688   D-TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV----DHETELTDW  852
             +    +  ++L+N+  E+EGKY+DYLS L K +V+ +G   +          +++++  W
Sbjct  185   NGVEKSHDIILINTCNEIEGKYVDYLSTLSKKEVIPVGPLIREMKITMENEGNDSKIITW  244

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKG  1032
             L +K  SS V+VSFGSEYFL KE++EEIA+ LE+S +NFIWVLRFP GEE ++E  LPKG
Sbjct  245   LDKKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELNFIWVLRFPLGEETNIENVLPKG  304

Query  1033  FLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPM  1212
             FL+R+ E+G +VE WAPQA+IL H S GGF+ HCGWNSI+ESL+ GVP+I MPMHLDQ  
Sbjct  305   FLDRVKEKGVIVEKWAPQARILEHTSVGGFLCHCGWNSILESLHFGVPLITMPMHLDQHT  364

Query  1213  NARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEKLKRNVKRISENLRLAGN  1389
             ++R+ VE+G  +EV RDE GKL+REE A  +R  V  +N GE +K  V+ +   +R  G 
Sbjct  365   HSRMAVELGTTMEVVRDENGKLNREETAKVIRNVVMEKNGGESVKAKVRELRNKIREKGE  424

Query  1390  REMDAVVAELEKLC  1431
              E D VV  L  LC
Sbjct  425   EEFDQVVTRLLHLC  438



>emb|CDP17151.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/459 (44%), Positives = 279/459 (61%), Gaps = 29/459 (6%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIK-------NNIPQSYSQSI  294
             ++MFPWLA+GHI+PF+ L+K LA   F ++ CST  NLN IK       N+   S   SI
Sbjct  9     ILMFPWLAHGHISPFIELSKRLAKNKFKIYFCSTEINLNFIKESKGFDENSSDHSIQLSI  68

Query  295   -RLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
              +L+ L LP+ P+LPPHY T   LP HL   LK   +M++  F+ +L TL PDL I+DV+
Sbjct  69    AKLVRLDLPDFPELPPHYHTIKNLPPHLTSTLKLAFRMSKTSFSNILNTLKPDLQIYDVL  128

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTH----MLTNPGAEYPFPALRLRQYEQTKT-  636
               WA ++A   +IPS       A   S+F H     ++     YPF  +  R YE  K  
Sbjct  129   QSWAAELAALNSIPSP--LIIGAVNISFFYHGTNCRVSGTNETYPFSEIFFRDYEMKKII  186

Query  637   ---RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF  807
                +EL   E+   +  +  +  ++  ++LV S  E+EG+YID+LS     KVVS+G   
Sbjct  187   ATYQELTKLESEEAEVFKCFELSSD--IVLVKSWTEIEGRYIDHLSLCSGKKVVSVGPLN  244

Query  808   QAPPPVDHETELTD------WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNF  969
                     E E  D      +L  K  SS V+VSFGSEYFL KE+ EEIAYGLE+S  NF
Sbjct  245   NQDDDTKEEEEQEDNSDSIKFLNSKDESSVVYVSFGSEYFLSKEEREEIAYGLELSNANF  304

Query  970   IWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSI  1149
             IWV+ FP G  +++EEALP+GFL R+ ERG +V+GWAPQAKIL H +TGGF+SHCGW S+
Sbjct  305   IWVVIFPMGHAVALEEALPEGFLHRVKERGIVVDGWAPQAKILQHPNTGGFLSHCGWGSV  364

Query  1150  MESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN  1329
             MES+  GVP++A+PM  DQP+NARL+V++G  +E+ RDE G+++REE+ A +   V  E 
Sbjct  365   MESIYDGVPLLALPMQHDQPLNARLVVDVGFGIEILRDEDGQINREEVVAKVINMVVVEK  424

Query  1330  ---GEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
                GE L +  + +S NLR  G  E +  V ++  LC K
Sbjct  425   TKAGELLTQKAREMSNNLREEGEEEWNEAVGKVRNLCRK  463



>emb|CDP06965.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/439 (42%), Positives = 275/439 (63%), Gaps = 9/439 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG--FLVHLCSTPDNLNSIKNNIPQSY--SQSIRLL  303
             ++M PWLA+GH++PF+ LA+ L  R   F V++CSTP NL+  + N+   +  S SI+ +
Sbjct  10    ILMLPWLAHGHVSPFLELARKLTSRNPNFQVYICSTPVNLSPFRENLAVKFELSSSIQFI  69

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             ++ LP + +LPP Y +T  LP HL  ALK     A+  F ++LK L P LLI+D +  WA
Sbjct  70    DILLPSTSELPPEYHSTKNLPPHLMPALKTAFDGAKDCFLDILKDLKPHLLIYDFLQPWA  129

Query  484   EKVALSLN-IPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQET  660
                A   N IPSV F + SA++ ++  H    P  +YP P L   +  + +  + M   +
Sbjct  130   PAAAQEENNIPSVHFMSCSASIGAFLFHCTEYPDLDYPIPELNFPEITRQELVQFMYNVS  189

Query  661   RNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE  834
                  +E       ++    LV +  E+E K++DY SE+ K +V+ +G   Q P     +
Sbjct  190   NGLTNKERYSQCIEKSTDFFLVKTLSEIEQKHMDYFSEMTKKEVIPVGPLVQEPENRSSD  249

Query  835   TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEI-SV  1011
                 +WL+++  SS VFVSFG+EYFL KE++E IA GLE+S V+FIWV+RF   E + S+
Sbjct  250   MVFLEWLSKRGPSSVVFVSFGTEYFLSKEEIEVIASGLELSMVSFIWVVRFHGRENVTSL  309

Query  1012  EEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
              E LP+GF +R+ ERG +VEGWAPQ KIL H S GGF SHCGW+S +ES+  GVPIIA+P
Sbjct  310   LEVLPEGFQKRVAERGMVVEGWAPQVKILSHPSIGGFASHCGWSSTLESIAFGVPIIAIP  369

Query  1192  MHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISEN  1371
             M LDQP+ +RL+ E+G  +EV R E GK   EE+A A+++ V  E G+++++ V+ +S  
Sbjct  370   MQLDQPLTSRLVAEVGVGIEVRR-ENGKFREEEIARAIKQVVLQEEGKEVRKKVRELSNK  428

Query  1372  LRLAGNREMDAVVAELEKL  1428
             ++  G++E+D VV +L +L
Sbjct  429   IKEKGDQEIDHVVEKLLQL  447



>ref|XP_011071476.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=460

 Score =   363 bits (931),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 202/459 (44%), Positives = 285/459 (62%), Gaps = 16/459 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNI-PQ  276
             M +ET   R  ++MFPWLA+GHI P++ L+K L  R  F ++LCSTP N  SI   I   
Sbjct  1     MDSETTNFR--ILMFPWLAHGHIFPYLELSKRLLIRKNFHIYLCSTPINFTSINAFIHNN  58

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             + S+SI ++ LHL  S +LPPHY TT  LP  L   L K  + A+  F++++ TL PDL+
Sbjct  59    NLSESIHVVPLHLQPSHELPPHYHTTKNLPSDLVFTLIKAFQTAKSSFSDIITTLKPDLV  118

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTH--MLTNPGAEYPFPALRLRQYEQT  630
             I D+   WA ++A S  +P+V F    AA  SY  H  +  +P  ++PFP L LR     
Sbjct  119   IFDLFQPWAARLASSQGVPAVHFAPLGAATRSYTYHHCLRRHPSGDFPFPELCLRDDRVK  178

Query  631   KTRELMNQETRNFKREETLDT-----PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSI  795
             K  +   Q       EE  D        +  + L+ +SR +EGKYIDY+S +   K++S+
Sbjct  179   KGLDGFFQFLYYNVFEEDEDVMLVNYRLSTDIALLKTSRALEGKYIDYVSAVSDRKLLSV  238

Query  796   GTTFQAPPPVDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
             G         + E E    + +WL++K   STV++SFGSEYFL K+++EEIA GLE+   
Sbjct  239   GPLVADVNKDEEEEEKYSDIMEWLSKKKQHSTVYISFGSEYFLSKQEIEEIAKGLELCDA  298

Query  964   NFIWVLRFPKGE-EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGW  1140
             NFIWV+RFP GE EISVE+ALPKGFLER+ ERG +V GWAPQA+IL H ST  FVSHCGW
Sbjct  299   NFIWVIRFPLGEKEISVEDALPKGFLERVKERGIVVLGWAPQARILVHHSTATFVSHCGW  358

Query  1141  NSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG  1320
             +S+ ES+  GVP+I MP+  +  ++ R++VE GA VEV RDE G    EE+A A+++ V 
Sbjct  359   SSLNESVYFGVPVIGMPVKQNMFIDCRMLVEAGACVEVVRDENGVYKGEEIAKAIKKVVV  418

Query  1321  GENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
               +GE L++  + +SE +++  ++E+D V   L +LC K
Sbjct  419   ETSGEGLRQRAQELSEKMKMEEDQELDEVAEGLWQLCLK  457



>gb|ADW20351.1| putative branch-forming glycosyltransferase [Citrus sinensis]
Length=452

 Score =   359 bits (922),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 288/458 (63%), Gaps = 18/458 (4%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M ++    + S++M PWLA+GHITP++ LAK L+ + F ++ CSTP NL S+  N+ + +
Sbjct  1     MESKLQNKKPSILMLPWLAHGHITPYLALAKKLSQQNFHIYFCSTPINLQSMSQNLQEKF  60

Query  283   SQSIRLLELHLPES-PDL-PPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             S SI+L++L LP + P+L  P+  TT  +P HL   L +    A+P F  +L+TL P L+
Sbjct  61    STSIQLIDLQLPCTFPELHDPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLETLKPTLV  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYE----  624
             I+D+   WA + A   +I +V F T +AA  S+F   L N   ++PFP   L + E    
Sbjct  121   IYDLFQPWAAEAAYQHDIAAVAFVTIAAASFSFF---LQNSSLKFPFPEFDLPESEIQKM  177

Query  625   -QTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
              Q K R +   E R+ +  + +D      ++LV +SRE+E K + YLS + K + + +G 
Sbjct  178   TQFKHRIVNGTENRD-RFLKAIDLSCK--LVLVKTSREIESKDLHYLSYITKKETIPVGP  234

Query  802   TFQAPPPVDH--ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIW  975
               Q P   D+  +T++ DWL+RK  SS V+VSFGSEYFL KE++ E+A GL +S V+FIW
Sbjct  235   LVQEPIYTDNNNDTKIMDWLSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLLSEVSFIW  294

Query  976   VLRFPKGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSI  1149
             V+RF      ++EEALP+GF E I    +G +V+GWAPQAKILGH S GGF+SHCGW S 
Sbjct  295   VVRFHSEGNFTIEEALPQGFAEEIQGNNKGMVVQGWAPQAKILGHGSIGGFISHCGWGST  354

Query  1150  MESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGE  1326
             +E +  GVPIIA+PM LDQ  NA+++ +IG  +EV RDE   ++ +EE+A   ++ V  E
Sbjct  355   VEGIMYGVPIIAVPMVLDQLFNAKMVADIGVGLEVPRDEINQRVRKEELARVFKQVVEQE  414

Query  1327  NGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
              G+++KR  K +SE+++  G+ E   VV +L +L   P
Sbjct  415   EGQQIKRKAKELSESIKKKGDDEEINVVEKLLELVKVP  452



>ref|XP_009630066.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=539

 Score =   362 bits (929),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 197/448 (44%), Positives = 275/448 (61%), Gaps = 17/448 (4%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSI-KNNIPQSYS  285
             +T  T   V+M PWLA+GH+ P++ LAK L+    F ++ CSTP  LNSI + N+P++  
Sbjct  6     DTNTTSLKVLMVPWLAHGHVIPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN--  63

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
               I+L+E  LP S  LP H  TTNGLP +L   L +    A   F ++L +LNPDLLI D
Sbjct  64    --IQLIEFPLPSSKQLPSHNHTTNGLPKNLLSTLIQTFGEASSTFGKILDSLNPDLLIFD  121

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYE--QTKT  636
                 WA + A S NI ++ F    +A  S+F H     G   +PF  + L+ YE  Q + 
Sbjct  122   GFQPWAPEFASSRNIHAIYFLVVGSASISFFYHHYLYVGTRNFPFSGIFLKDYEAKQLQL  181

Query  637   RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
                MN    N           +  ++L+N+  E+EGKY+DYLS L K KV+ +G   +  
Sbjct  182   AAKMNSLGPNVAFN---GVEKSHDIILINTCNEIEGKYVDYLSTLSKKKVIPVGPLIREM  238

Query  817   PPV----DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
                     +++++  WL  K  SS V+VSFGSEYFL KE++EEIA+ LE+S ++FIW+LR
Sbjct  239   KTSMENEGNDSKIIQWLDNKDESSCVYVSFGSEYFLSKEEIEEIAHSLELSELHFIWILR  298

Query  985   FPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLN  1164
             FP GEEI++E  L KGFL+R+ E+G +VE WAPQA+IL H S GGF+ HCGWNSI+ESL+
Sbjct  299   FPLGEEINIENVLSKGFLDRVKEKGVIVEKWAPQARILEHASVGGFLCHCGWNSILESLH  358

Query  1165  LGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEKL  1341
              GVP+I MPMHLDQ  ++R+ VE+G A+EV RDE GKL+REE A  +R  V  +N GE +
Sbjct  359   FGVPLITMPMHLDQHTHSRMTVELGTAMEVVRDENGKLNREETAKVIRNVVMEKNGGEIV  418

Query  1342  KRNVKRISENLRLAGNREMDAVVAELEK  1425
             K  V  +   +R +   E   ++  L +
Sbjct  419   KAKVIPVGPLVRDSNTDESSEIIQWLNE  446


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 96/217 (44%), Gaps = 65/217 (30%)
 Frame = +1

Query  640   ELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
             E++  E     REET       A ++ N   E  G       E++K+KV+ +G   +   
Sbjct  387   EVVRDENGKLNREET-------AKVIRNVVMEKNG------GEIVKAKVIPVGPLVR-DS  432

Query  820   PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
               D  +E+  WL  K  +STV VSFGS                          LR    E
Sbjct  433   NTDESSEIIQWLNEKDPASTVLVSFGS--------------------------LRLGLEE  466

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             E                          PQA+IL H S GGFVSHCGW+S+M+ +N  VPI
Sbjct  467   E-------------------------DPQARILAHSSIGGFVSHCGWSSVMDRINSRVPI  501

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREE  1290
             +AMP+  DQ +NARLM   GA VEV +   G L+ E+
Sbjct  502   MAMPLQFDQCINARLMGMAGAGVEVIKAGDGGLNTED  538



>ref|XP_011090909.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=453

 Score =   359 bits (921),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 273/447 (61%), Gaps = 7/447 (2%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY---SQSIR  297
             + S++MFPWLA+ H+ PF+GLAK L+ R F ++ CS+  NL+SI+NN+       + SI 
Sbjct  7     KFSILMFPWLAHSHVFPFLGLAKTLSKRSFHIYFCSSAINLDSIRNNMATYLPIATASID  66

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+EL LP  P+LP  + TT  LP +L   L +  +M+   F+E+L  L PDLLI+D    
Sbjct  67    LIELRLPSLPELPSQFHTTKNLPPNLLPILLQAFQMSSSSFSEVLNALRPDLLIYDFFQP  126

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLT-NPGAEYPFPALRLRQYEQTKTRELMNQ  654
             WA K+ALS  IPSV F T  AA  S+F H+ T      +P+  + L ++E+   R  +  
Sbjct  127   WAAKLALSQGIPSVYFATTGAAPFSFFYHLYTYGTTTTFPYQEIYLLEHEKVDLRAPVEP  186

Query  655   ETRNFKREETL-DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH  831
             + ++   +    +   +  ++LV S R VEGKYIDYLS L + KVV  G   Q P   D 
Sbjct  187   KVKDADEDFAFGNFKLSSNIVLVKSLRGVEGKYIDYLSALCQKKVVPTGPIVQEPNDEDE  246

Query  832   ET-ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-I  1005
                E+  WL+RK   STVF+ FGSE+FL KE + EIA GLE+   NFIW  RFP  EE +
Sbjct  247   GCWEILQWLSRKERFSTVFICFGSEHFLSKEQILEIAKGLELCESNFIWATRFPVEEETL  306

Query  1006  SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIA  1185
              +E+A P GFL+R+ ERG ++  WAPQAKIL   S GGFVSHCGW+SIMES+  G+P+IA
Sbjct  307   CIEDAFPSGFLDRVKERGLVLRKWAPQAKILSCPSIGGFVSHCGWSSIMESMYFGIPVIA  366

Query  1186  MPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRIS  1365
             MP+  DQP+NARL+VE  A VEV RDE G    + +A A+ + +   N   L+   +++S
Sbjct  367   MPIKFDQPINARLVVEASAGVEVGRDENGLFSAKAVAEAINKVIMETNEGGLRNGARKLS  426

Query  1366  ENLRLAGNREMDAVVAELEKLCNKPER  1446
             + ++    +  +    EL  LC K ++
Sbjct  427   QKMKNEEEQAENEAAQELLWLCKKSKQ  453



>gb|KDO39400.1| hypothetical protein CISIN_1g038300mg, partial [Citrus sinensis]
Length=401

 Score =   356 bits (913),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/392 (47%), Positives = 248/392 (63%), Gaps = 27/392 (7%)
 Frame = +1

Query  214   FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKK  393
             F +  CSTP  LNSIK      +S SI+L+ELHLP  P+LPP Y TT GLP HL   LK+
Sbjct  4     FHICFCSTPSILNSIKQL--DKFSLSIQLIELHLPSLPELPPQYHTTKGLPPHLMPTLKE  61

Query  394   VLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHML-  570
                MA P F  +LK L+PDLLI+D++  WA  +A SLNIP+V F  +SAA  ++  H + 
Sbjct  62    AFDMASPSFFNILKNLSPDLLIYDLIQPWAPALASSLNIPAVYFLVSSAATSAFMFHAIK  121

Query  571   -------TNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREETLDTPANQAMMLVNSS  729
                     +   E+P  ++ +  Y        M +     +  +  +   N  ++L+ S 
Sbjct  122   KNSLGDANDDDEEFPSSSIFIHDYYMKSYFSNMVESPTTKRLLQCFERSCN--IVLIKSF  179

Query  730   REVEGKYIDYLSELMKSKVVSIGTTFQAP-PPVDHETELTDWLARKPASSTVFVSFGSEY  906
             RE+EGKYIDYLS+L+K KVV +G   Q P    DHE   T+ +               EY
Sbjct  180   RELEGKYIDYLSDLIKKKVVPVGPLVQDPVEQTDHEKGATEII--------------HEY  225

Query  907   FLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQ  1086
             FL KE++E+IA GLE+SGVNFIWV+RFP G ++ V+E LP+ FLER  ER  ++EGWAPQ
Sbjct  226   FLSKEEMEDIALGLELSGVNFIWVVRFPCGAKVKVDEELPESFLERTKERAMVIEGWAPQ  285

Query  1087  AKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE  1266
              KILGH S GGFVSHCGW+S+MES+ LGVPIIAMPMH+DQP+NARL+ ++G  +EV R++
Sbjct  286   MKILGHPSIGGFVSHCGWSSVMESMRLGVPIIAMPMHVDQPLNARLVEDVGIGLEVRRNK  345

Query  1267  KGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
              G++ REEMA  ++E V    GEK+KR  + +
Sbjct  346   CGRIQREEMARVIKEVVMEREGEKIKRKTREM  377



>ref|XP_008449847.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis melo]
Length=451

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 194/449 (43%), Positives = 282/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLA-DRGFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             T  T  +++MFPWL YGH+TP++ L+K L+  + FL++ CSTP NL+SIK   IP   S 
Sbjct  8     THPTTTTILMFPWLGYGHLTPYLELSKALSRXKNFLIYFCSTPVNLDSIKPKLIP---SP  64

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+ +ELHLP SP+ PPH  TT  LPLHL  AL +    A P F  +LKTL+P LLI+D 
Sbjct  65    SIQFVELHLPSSPEFPPHLHTTKALPLHLTPALHQAFAAAAPLFETILKTLSPHLLIYDC  124

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+ A++ SY  H +  PG+++P     L  +  +K    +
Sbjct  125   FQSWAPRLASSLNIPAINFNTSGASIISYAFHSIHRPGSKFPISDFVLHNHWNSKYNSTL  184

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
              +     K    E L+T  ++ ++L NS +EVEG+Y+DY+S L K KV+ +G     P  
Sbjct  185   REHAHCVKEAFFECLNT--SRDVILTNSFKEVEGEYMDYISLLSKKKVIPVGPLVYEPNE  242

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV VS GSE +  +E+ EEI  GL  SG NFIWV R  
Sbjct  243   KDEEDEDYSRIKNWLDKKEALSTVLVSLGSESYASEEEKEEIVKGLVESGANFIWVERIN  302

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +V+GWAPQ KIL H S GGFVSHCGWNS++ES   
Sbjct  303   QKGDE--EQQIKRRELLEKGGERAMVVKGWAPQGKILKHGSIGGFVSHCGWNSVLESTVS  360

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP NA ++ E G  VE +RD  GK+ R+E+A  ++E V  ++ E+++ 
Sbjct  361   GVPIIGVPLFGDQPFNAGVVEEAGIGVEAKRDHDGKIQRQEVAKLIKEVVVEKSREEIRM  420

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+ +++ ++ ++ +L N
Sbjct  421   RVREMSEIVKRRGDEKIEELLTQISRLSN  449



>ref|XP_004229306.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=458

 Score =   357 bits (917),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 284/451 (63%), Gaps = 14/451 (3%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSI-KNNIPQSYS  285
             +T  T   V+M PWLA+GH+TP++ LAK L+    F ++ CSTP  LNSI + N+P++  
Sbjct  6     DTNPTTLKVLMVPWLAHGHVTPYLELAKKLSKTNLFFIYFCSTPIILNSINQENLPKN--  63

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
               I+L+E  LP SP LP H  TTNGLP +L   L +    A   F ++L +L PDLLI D
Sbjct  64    --IQLIEFPLPSSPLLPSHQHTTNGLPKNLLSTLIQTFGEAGSTFAKILDSLCPDLLIFD  121

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYEQTKTRE  642
                 WA ++A S  IP++ F    +A  S+F H     G  ++PF  + L+ YE  K  +
Sbjct  122   GYQPWAPELASSRKIPAIDFLIIGSASVSFFYHHYLYAGKRDFPFSGIFLKDYE-AKQLQ  180

Query  643   LMNQETRNFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ---  810
             L  +   +   +   +    +  ++L+N+  E+EGKY+DYLS L   KV+ +G   +   
Sbjct  181   LTAEMNISIGPDVAFNGLEKSHDIILINTCNEIEGKYVDYLSTLSNKKVIPVGPLIREMG  240

Query  811   APPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
                  +  +++  WL +K  SS V+VSFGSEYFL KE++EEI + LE+S +NFIWV+RFP
Sbjct  241   TTTENEENSKIIQWLDKKDESSCVYVSFGSEYFLSKEEIEEIGHSLELSELNFIWVVRFP  300

Query  991   KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
              GEE ++E ALPKGFL+R+  +G +VE WAPQA+IL H S GGF+ HCGWNSI+ESL+ G
Sbjct  301   LGEETNIENALPKGFLDRVEGKGVIVEKWAPQARILEHPSVGGFLCHCGWNSILESLHFG  360

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK-GKLHREEMAAALRETVGGEN-GEKLK  1344
             VP+I MPMH DQ  ++R+ VE+G A+EV RD+K GKL++E+ A  +R  V  +N GE +K
Sbjct  361   VPLITMPMHFDQHTHSRMAVELGTAMEVVRDDKNGKLNKEKTAEVIRNVVTEKNGGENVK  420

Query  1345  RNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
               VK +S+ +R  G  E D VV +L  L  K
Sbjct  421   AKVKELSKKIREKGEEEFDQVVNKLLDLSTK  451



>gb|AGO03777.1| non-smoky glycosyltransferase 1 [Solanum lycopersicum]
Length=450

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/443 (40%), Positives = 281/443 (63%), Gaps = 15/443 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS---YSQSIRLL  303
             S+++FPWL +GH+ PF+ LAK L+   F ++  STP  L SIK  + ++   Y+QSI+L+
Sbjct  10    SILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKETLDKNSTNYNQSIQLV  69

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             E HLP   +LPPHY TT  LP HL+  L +  +MA   F  +++TL P+L+I+D    W 
Sbjct  70    EFHLPYLHELPPHYHTTKDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYDGFQPWV  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE---YPFPALRLRQYEQTK--TRELM  648
               +A S NI ++ F+ +S +  +Y  H   +  +    +PF ++ L  +E  K   + + 
Sbjct  130   ATMASSYNIHAIMFYVSSTSGLAYLYHQFLHGSSSLTSFPFSSIYLHDHEIKKLGIQPIK  189

Query  649   NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
              ++ + F          +  ++L+N+ RE+EGKYIDY+S + K +++ IG   +    +D
Sbjct  190   PRDEKAFAYIILESFEQSHNIVLLNTCREIEGKYIDYVSTIGKKELIPIGPLIREAM-ID  248

Query  829   HETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
              E +   +  WL +K   S V+VSFGSE FL K+++EEIA GLE+S VNFIW ++FPKG 
Sbjct  249   EEEDWGTIQSWLDKKDQLSCVYVSFGSESFLSKQEIEEIAKGLELSKVNFIWTIKFPKGV  308

Query  1000  EISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
               ++EE +P+GFLE    +G ++EGWAPQ+ IL H S GGF++HCGWNSI+ES++ G+PI
Sbjct  309   NKTIEEMVPQGFLESTKGKGMVIEGWAPQSLILNHSSIGGFITHCGWNSILESMSFGIPI  368

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKR  1359
             IAMPM+ DQP+N+RL+ E+G  VE+ R E GK+ +EE+A  +R+ +  +  +++     +
Sbjct  369   IAMPMNHDQPLNSRLVEELGIGVEILRGENGKIMKEEVAKGIRKVIEEKPRKQIHLKAMQ  428

Query  1360  ISENLRLAGNREMDAVVAELEKL  1428
             +SE ++L   + +D  V +L KL
Sbjct  429   LSEKIKL---KAIDEGVKKLLKL  448



>ref|XP_004142254.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   354 bits (908),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 283/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             +  T  +++MFPWL YGH++P++ LAK L+ R  FL++ CSTP NL+SIK   IP   S 
Sbjct  7     STPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLIP---SP  63

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLP SPDLPPH  TTN LP HL   L +    A P F  +LKTL+P LLI+D 
Sbjct  64    SIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHLLIYDC  123

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+SAA+ S+  H    PG+++PF    L  + ++K     
Sbjct  124   FQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATHRPGSKFPFSDFVLHNHWKSKVDSNP  183

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             +++ R       E L+   ++ ++L+NS +EVEG+++DY+  L K KV+ +G     P  
Sbjct  184   SEQIRIVTESFFECLNK--SRDVILINSFKEVEGEHMDYIFLLSKKKVIPVGPLVYEPSE  241

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV  S GSE +  +E+ EEI  GL  S  NFIWV R  
Sbjct  242   NDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEANFIWVERIN  301

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +V+GWAPQ KIL H S GGFVSHCGWNS++ES+  
Sbjct  302   KKGDE--EQQIKRRELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSHCGWNSVLESIVS  359

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP+NA ++ E G  VE +RD  GK+ R+E+A  ++E V  +  E+L+ 
Sbjct  360   GVPIIGVPVFGDQPINAGVVEEAGIGVEAKRDPDGKIQRKEIARLIKEVVIEKRREELRM  419

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+ +++ ++ ++ +  N
Sbjct  420   KVREMSEVVKRKGDEKIEELLTQISRFFN  448



>ref|XP_009416699.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=486

 Score =   355 bits (911),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 274/472 (58%), Gaps = 32/472 (7%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             R  VVM PWLA+GH +PF+ LAK L+     VH CSTP NL S++     +   SIRL+E
Sbjct  9     RLRVVMLPWLAHGHASPFLELAKRLSRHDVFVHFCSTPANLVSMREQFDANAFPSIRLVE  68

Query  307   LHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             L LP  P LPP   TT  LP HL   LK+   +AEPDF  LL+ L+PDLLI+D +  WA 
Sbjct  69    LQLPALPGLPPDLHTTKHLPSHLMPTLKQAFDLAEPDFGLLLQALHPDLLIYDFLQPWAP  128

Query  487   KVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRN  666
               A   NIP+++F T +A+  ++F H +  P  E+PFPA+ L   E  +    MN+    
Sbjct  129   LSAHRRNIPAIQFLTTAASSAAFFCHCIKRPTEEFPFPAMSLGVKENLEHIATMNRFANG  188

Query  667   FKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV-----  825
                 E      +++   + + + RE+E KYIDYLS ++  +VV +G              
Sbjct  189   MSDGERFLRCMDRSSGFIAIRTFREIEAKYIDYLSCVLDKEVVPVGPLVPDDDDDDDDDG  248

Query  826   ----------DHETE--LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNF  969
                       D ETE  +  WL  K  SS V  +FGSEYF+ KE++ E+A GLE+SG++F
Sbjct  249   SSGRDRLTVKDRETERSIMSWLGAKEKSSVVLATFGSEYFMCKEEMREVARGLELSGLSF  308

Query  970   IWVLRFPK--------GEEISVEEALPKGFLERI--GE-RGRMVEGWAPQAKILGHRSTG  1116
             IWV+RFPK        G+  S   ALP GF+ER+  GE RG +VEGWAPQ KIL H   G
Sbjct  309   IWVVRFPKDGILPTVAGDSSSWATALPSGFVERVVKGEGRGLVVEGWAPQRKILSHPGVG  368

Query  1117  GFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK--GKLHREE  1290
             GF++HCGW+S++E++  GVPIIA+P+ LDQP NA+L+ E+G  + V + +   G+   EE
Sbjct  369   GFLTHCGWSSVVEAMKYGVPIIALPLQLDQPPNAKLVEELGVGMAVRKGKGVLGEFEGEE  428

Query  1291  MAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
             +A  +R+ V GE GE ++R  ++++  +    + E   +V ++  L    +R
Sbjct  429   VAKGIRDVVVGEQGESVRRKARQMARVISRRDDEETKVLVEKMAALGEAAKR  480



>gb|KGN54053.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltransferase [Cucumis 
sativus]
Length=452

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 283/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             +  T  +++MFPWL YGH++P++ LAK L+ R  FL++ CSTP NL+SIK   IP   S 
Sbjct  9     STPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLIP---SP  65

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLP SPDLPPH  TTN LP HL   L +    A P F  +LKTL+P LLI+D 
Sbjct  66    SIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHLLIYDC  125

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+SAA+ S+  H    PG+++PF    L  + ++K     
Sbjct  126   FQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATHRPGSKFPFSDFVLHNHWKSKVDSNP  185

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             +++ R       E L+   ++ ++L+NS +EVEG+++DY+  L K KV+ +G     P  
Sbjct  186   SEQIRIVTESFFECLNK--SRDVILINSFKEVEGEHMDYIFLLSKKKVIPVGPLVYEPSE  243

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV  S GSE +  +E+ EEI  GL  S  NFIWV R  
Sbjct  244   NDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEANFIWVERIN  303

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +VEGWAPQ KI  H S GGFVSHCGWNS++ES+  
Sbjct  304   KKGDE--EQQIRRRELLEKSGERAMVVEGWAPQGKIQKHGSIGGFVSHCGWNSVLESIVS  361

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP+NA ++ E G  VE +RD  GK+ R+E+A  ++E V  ++ E+L+ 
Sbjct  362   GVPIIGVPVFGDQPINAGVVEEAGIGVEAKRDPDGKIQRKEIARLIKEVVIEKSREELRM  421

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+ +++ ++ ++ +  N
Sbjct  422   KVREMSEVVKRKGDEKIEELLTQISRFFN  450



>ref|XP_004162020.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 283/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             +  T  +++MFPWL YGH++P++ LAK L+ R  FL++ CSTP NL+SIK   IP   S 
Sbjct  7     STPTTTTILMFPWLGYGHLSPYLELAKALSTRKNFLIYFCSTPVNLDSIKPKLIP---SP  63

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+L+ELHLP SPDLPPH  TTN LP HL   L +    A P F  +LKTL+P LLI+D 
Sbjct  64    SIQLVELHLPSSPDLPPHLHTTNALPPHLTPVLYQAFAAAAPLFETILKTLSPHLLIYDC  123

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+SAA+ S+  H    PG+++PF    L  + ++K     
Sbjct  124   FQPWAPRLASSLNIPAIHFNTSSAAIISFSFHATHRPGSKFPFSDFVLHNHWKSKVDSNP  183

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             +++ R       E L+   ++ ++L+NS +EVEG+++DY+  L K KV+ +G     P  
Sbjct  184   SEQIRIVTESFFECLNK--SRDVILINSFKEVEGEHMDYIFLLSKKKVIPVGPLVYEPSE  241

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV  S GSE +  +E+ EEI  GL  S  NFIWV R  
Sbjct  242   NDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEANFIWVERIN  301

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +VEGWAPQ KI  H S GGFVSHCGWNS++ES+  
Sbjct  302   KKGDE--EQQIRRRELLEKSGERAMVVEGWAPQGKIQKHGSIGGFVSHCGWNSVLESIVS  359

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP+NA ++ E G  VE +RD  GK+ R+E+A  ++E V  ++ E+L+ 
Sbjct  360   GVPIIGVPVFGDQPINAGVVEEAGIGVEAKRDPDGKIQRKEIARLIKEVVIEKSREELRM  419

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+ +++ ++ ++ +  N
Sbjct  420   KVREMSEVVKRKGDEKIEELLTQISRFFN  448



>ref|XP_006354527.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Solanum tuberosum]
Length=453

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/448 (40%), Positives = 275/448 (61%), Gaps = 10/448 (2%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQ---SYS  285
             T     S+++FPWL +GH+ PF+ LAK L+   F ++  STP  L SIK  + +   SY+
Sbjct  4     TKGNSPSILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKEILDKNSTSYN  63

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
              SI+L+E HLP   +LPPHY TTN LP HL+  L +  +MA   F  +++TL P+L+I+D
Sbjct  64    LSIQLVEFHLPYLHELPPHYHTTNDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYD  123

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHML---TNPGAEYPFPALRLRQYEQTK-  633
                 W   +A S NI ++ F+ +S +  +Y  H     T+     PF +L L  YE  K 
Sbjct  124   GFQPWVATMASSCNIHAIMFYVSSTSGLAYLYHQFLHGTSNLTSLPFSSLYLHDYEIKKL  183

Query  634   -TRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ  810
               + +  ++ + F          +  ++L+N+ RE+EGKYIDY+S + K +++ IG   +
Sbjct  184   DIKPIKPRDEQAFAYVVLKSFEHSHNIVLLNTCREIEGKYIDYVSTIGKKELIPIGPLIR  243

Query  811   APPPVDHET--ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
                  + E    +  WL +K   S V+VSFGSE FL K+++EEIA GLE+S V+FIW ++
Sbjct  244   EVTIGEEENWGTIQSWLDKKDRLSCVYVSFGSEVFLSKQEIEEIAKGLELSKVSFIWTIK  303

Query  985   FPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLN  1164
             F KG   ++E+ +P+GFLE    +G ++EGW PQ++IL H S GGFV+HCGWNS++ES++
Sbjct  304   FSKGLNTTIEKMVPQGFLESTKGKGMVIEGWVPQSQILNHSSIGGFVTHCGWNSMLESMS  363

Query  1165  LGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLK  1344
              G+PIIAMPM+ DQP+N+RL+ E+G  VE+ R E G++ +EE+A  ++  V  +  +++ 
Sbjct  364   FGIPIIAMPMNHDQPLNSRLVEELGIGVEILRGENGEIMKEEVAKGIKRVVEDKTRKQVN  423

Query  1345  RNVKRISENLRLAGNREMDAVVAELEKL  1428
                  +SE ++  G + +D  V  L KL
Sbjct  424   LKAMELSEKIKFKGEKAIDEGVKRLLKL  451



>ref|XP_009804830.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana sylvestris]
Length=466

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 280/462 (61%), Gaps = 32/462 (7%)
 Frame = +1

Query  130   RSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ----SIR  297
             + ++M P +A+GH TPF  LAK L+   F ++LCST   L+ +K +  + +S     +I 
Sbjct  12    QKILMVPMIAHGHATPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFSDVSNTNIE  71

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLP  PDLP HYQ+T GLP HL+  L    KMA   F+ ++  L+PDL+I D    
Sbjct  72    LVELHLPSMPDLPSHYQSTKGLPNHLYPPLFTAYKMAGESFSIIVNNLSPDLIIEDFFQA  131

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA--EYPFPALRLRQYE---------  624
             WA  +ALS NIP V F   SAA  S+  H+  + GA  +YPFP + L   E         
Sbjct  132   WAPDIALSKNIPIVSFSVVSAASYSFMYHIYLSDGATDDYPFPEICLSNNEIEIGLVSKP  191

Query  625   -QTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
               +     M +      R+++ D      ++L+N+ +E E KY+ YLS ++  K +S+G 
Sbjct  192   TGSSITVFMEKILVYSARKKSCD------IVLINNWKETEVKYMQYLSSIINKKTLSVGP  245

Query  802   TF---QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
                        D ++++ +WL ++   STV+  FGSE    KE+++EIA+G+E+S VNF+
Sbjct  246   LIGQTDESTQDDQDSDIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGIELSNVNFL  305

Query  973   WVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             WVLRFP  E   VE+ LP+GFL R+ ERG +V  W P AKI+ H+S GGF++HCGWNS +
Sbjct  306   WVLRFPGSE---VEQVLPEGFLNRVKERGMVVSRWVPHAKIMRHKSIGGFLNHCGWNSTV  362

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-  1329
             E ++ GVP+IAMP ++DQ + A   VE+G A++V+RDEKG L REE+A A+R  +  +  
Sbjct  363   ECIHFGVPLIAMPFNMDQFITANYAVELGMALKVQRDEKGGLKREEIAKAIRNVIMEKKM  422

Query  1330  GEKLKRNVKRISENLRLAGNREMDA-VVAELEKLC--NKPER  1446
             GE+L+   K +SE +R+   +E+D  VV EL  LC  NK E+
Sbjct  423   GEELRETSKELSEKIRIKEEKEIDQEVVEELRNLCLMNKKEK  464



>gb|KGN54052.1| hypothetical protein Csa_4G279810 [Cucumis sativus]
Length=452

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 194/449 (43%), Positives = 282/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             +  T  +++MFPWL YGH++P++ L+K L+ R  FL++ CSTP NL+SIK   IP   S 
Sbjct  9     STPTTTTILMFPWLGYGHLSPYLELSKALSTRKNFLIYFCSTPVNLDSIKPKLIP---SP  65

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+ +ELHLP SPD PPH  TTN LP HL  AL +    A P F  +LKTL+P LLI+D 
Sbjct  66    SIQFVELHLPSSPDFPPHLHTTNALPPHLTPALHQAFAAAAPLFETILKTLSPHLLIYDC  125

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+  +M SY  H + +P +++PF    L    ++K     
Sbjct  126   FQSWAPRLASSLNIPAINFSTSGTSMISYGFHSIHHPSSKFPFSDFVLHNPWRSKYNSTP  185

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             ++  R+ +    E L+T  ++ ++L+NS +EVEG+Y+DYLS L+K KV+ +G     P  
Sbjct  186   SEHARSVREAFFECLNT--SRDVILINSFKEVEGEYMDYLSLLLKKKVIPVGPLVYEPNE  243

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV VS GSE +  +E+ EEI  GL  S  NFIWV R  
Sbjct  244   KDEEDEDYSRIKNWLDKKEALSTVLVSLGSESYASEEEKEEIVQGLVESEANFIWVERIN  303

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +V+GWAPQ KIL H S GGFVSHCGWNS++ES+  
Sbjct  304   KKGDE--EQQIKRRELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSHCGWNSVLESIVS  361

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP NA ++   G  VE +RD  GK+ R+E+A  ++E V  +  E+L+ 
Sbjct  362   GVPIIGVPVFGDQPFNAGVVEFAGIGVEAKRDPDGKIQRKEVAKLIKEVVIEKRREELRM  421

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+  ++ ++A++    N
Sbjct  422   KVREMSEIVKRRGDVLIEEMLAQISHFSN  450



>gb|AGO03779.1| non-smoky glycosyltransferase 2 [Solanum lycopersicum]
Length=449

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/440 (39%), Positives = 274/440 (62%), Gaps = 7/440 (2%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQS---YSQSIRLL  303
             S+++FPWL +GH+ PF+ LAK L+   F ++  STP  L SIK  + ++   Y+QSI+L+
Sbjct  10    SILLFPWLGFGHVNPFLALAKKLSKMNFHIYFLSTPIILKSIKETLDKNSTNYNQSIQLV  69

Query  304   ELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             E HLP   +LPPHY TT  LP HL+  L +  +MA   F  +++TL P+L+I+D    W 
Sbjct  70    EFHLPYLHELPPHYHTTKDLPPHLNSTLIQAFQMASSKFPSIIETLKPNLIIYDGFQPWV  129

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTH-MLTNPGAEYPFPALRLRQYEQTKTRELMNQET  660
               +A S NI ++ F+ +S +  +Y  H  L    +   FP L   + ++   + +  ++ 
Sbjct  130   ATMASSYNIHAIMFYVSSTSGLAYLYHQFLYGSSSLTSFPFLHDYEIKKLDMKPIKPRDE  189

Query  661   RNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET-  837
             + F          +  ++L+N+ RE+EGKYIDY+S + K +++ IG   +     + E  
Sbjct  190   KAFGYVVLKSFEKSHNIVLLNTCREIEGKYIDYVSTIGKKELIQIGPLIREATLGEEENL  249

Query  838   -ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVE  1014
               +  WL  K   S V+VSFGSE+F+ K+++EEIA GLE+S V+FIW ++FPKG   ++E
Sbjct  250   GTIQSWLDNKDHISCVYVSFGSEFFMSKQEIEEIAKGLELSKVSFIWTIKFPKGVNTTIE  309

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             E +P+GFLE    +G ++EGW PQ+ IL H S GGFV+HCGWNS++ES++ G+P+IAMPM
Sbjct  310   EMVPQGFLESTKGKGMVIEGWVPQSLILNHSSIGGFVTHCGWNSMLESMSFGIPLIAMPM  369

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENL  1374
             + DQP+N+RL+ E+G  VE+ R E G++ +EE+A  +++ V     +++      +SE +
Sbjct  370   NHDQPLNSRLVEELGIGVEILRGENGEIMKEEVAKGIKKVVEDNTRKQVNLKAMELSEKI  429

Query  1375  RLAGNREMDAVVAE-LEKLC  1431
             +  G + +D  V + L+ LC
Sbjct  430   KFKGEKAIDEGVKKGLKLLC  449



>ref|XP_006424313.1| hypothetical protein CICLE_v10030271mg [Citrus clementina]
 gb|ESR37553.1| hypothetical protein CICLE_v10030271mg [Citrus clementina]
Length=453

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/455 (41%), Positives = 285/455 (63%), Gaps = 12/455 (3%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M T+    + S++M PWLA+GHITP++ LAK L+ + F ++ CST  NL SI  N+ +++
Sbjct  1     METKHHNRKPSILMLPWLAHGHITPYLALAKKLSQQNFHIYFCSTSINLQSISQNLGENF  60

Query  283   SQSIRLLELHLPES-PDL-PPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             S SI+L +L LP + P+L  P+  TT  +P  L   L      A+P F  +L+TL P L+
Sbjct  61    SASIQLTDLQLPCTFPELHDPYNHTTKNIPRCLIPTLIAAFDAAKPAFCNVLETLKPTLV  120

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+D+   WA + A   +I +V F T +AA  S+F H   N   ++PFP   L + E  K 
Sbjct  121   IYDLFQPWAAEAAYQHDIAAVAFLTTAAASFSFFLH---NSSLKFPFPEFDLPESEIQKM  177

Query  637   RELMNQETRNFKREETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQ  810
              +  ++     + ++      + +  ++L+ +SRE+E KY+DY S + K + + +G   Q
Sbjct  178   TQFKHRIVNGTENKDRFLKAIDLSCKLVLIKTSREIESKYLDYFSYITKKETIPVGPLVQ  237

Query  811   APPPVDH--ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
              P   D+  +T++ DWL+RK  SS V+VSFGSEYFL +E++ EIA GL +S V+FIWV+R
Sbjct  238   EPVYTDNNDDTKIMDWLSRKEPSSVVYVSFGSEYFLSQEEMNEIASGLLLSEVSFIWVVR  297

Query  985   FPKGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMES  1158
             F    + S+EEALP+ F + I    +G +V+GWAPQAKILGH S GGFVSHCGW S +E 
Sbjct  298   FHSEGKFSIEEALPQSFSKEIHGNNKGMVVQGWAPQAKILGHGSIGGFVSHCGWGSTVEG  357

Query  1159  LNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGE  1335
             +  GVPIIA+PM LDQ  NA+++ +IG  +EV R+E   ++ ++++A  +++ V  E G+
Sbjct  358   IMYGVPIIAVPMVLDQLFNAKMVADIGVGLEVPREEINQRVRKKDLARVIKQVVEQEEGQ  417

Query  1336  KLKRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
             ++KR  K +SE+++  G+ E   VV +L +L   P
Sbjct  418   QIKRKAKELSESIKKKGDDEEINVVEKLLQLVKAP  452



>ref|XP_009620256.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana tomentosiformis]
Length=465

 Score =   352 bits (904),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 195/470 (41%), Positives = 287/470 (61%), Gaps = 32/470 (7%)
 Frame = +1

Query  106   GTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYS  285
             G + +   + ++M PWLA+GH TPF  LAK L+   F ++LCST   L+ +K +  + +S
Sbjct  3     GKKQVDEPQKILMVPWLAHGHATPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFS  62

Query  286   Q----SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDL  453
                  +I L+ELHLP  P LP HYQ+T GLP HL+  L    +MA   F+ ++  +NPDL
Sbjct  63    DISSANIELIELHLPSMPQLPSHYQSTKGLPNHLYPLLLNAFQMAGQSFSNIVDNVNPDL  122

Query  454   LIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA--EYPFPALRLRQYE-  624
             +I D +  WA  +ALS NIP V F  +SAA  S+  H+  + GA  +YPFP + L   E 
Sbjct  123   IIEDFLQAWAPDIALSKNIPIVNFTVSSAASYSFMYHLYLHDGATDDYPFPEICLSNNEI  182

Query  625   ------QTKTRELMNQETRNF---KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMK  777
                    T TR +     R      R+++ D      ++L+N+ +E E KY+ YLS +  
Sbjct  183   EIGLVSGTTTRSITALLERILVYSARKKSND------IILINNWKETEAKYMQYLSSITN  236

Query  778   SKVVSIGTTF---QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGL  948
              K++S+G            D ++++ +WL ++   STV+  FGSE    KE+++EIA+G+
Sbjct  237   KKILSVGPLIGQTDESTQDDQDSDIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGI  296

Query  949   EISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVS  1128
             E+S VNF+WVLRFP  E   VE+ LP+GFL R+ ERG +V  W P AKI+ H S GGF++
Sbjct  297   ELSNVNFLWVLRFPGSE---VEQVLPEGFLNRVKERGMVVSRWVPHAKIMRHTSIGGFLN  353

Query  1129  HCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALR  1308
             HCGWNS +E ++ GVP+IAMP ++DQ + A   VE+G A++V+RDEKG+L REE+A A+R
Sbjct  354   HCGWNSTVECIHFGVPLIAMPFNMDQFITANYAVELGMALKVQRDEKGRLKREEIAKAIR  413

Query  1309  ETVGGEN-GEKLKRNVKRISENLRLAGNREMD-AVVAELEKLC--NKPER  1446
               +  +  GE+L+   K +SE +R+   +E+D A V EL  LC  NK E+
Sbjct  414   NVIMEKKIGEELREKSKELSEKIRIEEEKEIDQAAVEELRNLCLMNKKEK  463



>gb|AFK79037.1| glycosyltransferase UGT5 [Bupleurum chinense]
Length=456

 Score =   352 bits (903),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 191/449 (43%), Positives = 275/449 (61%), Gaps = 15/449 (3%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
               R  +VM P++++GHI+P++  AK L+ R  F +++CSTP NL SIKN +       +R
Sbjct  6     GKRMKIVMLPYVSHGHISPYLEFAKQLSKRNCFNIYICSTPINLASIKNRVDDGKDDDVR  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLP S +LPPH+ ++NGLP HL   L + L+MA P FTE+LKT+NPDL+I+D    
Sbjct  66    LVELHLPSSEELPPHFHSSNGLPSHLKPNLHRALEMAAPGFTEILKTINPDLVIYDFQPT  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             W  +VALSLNIP+V F T +AA    F     NP  + PFP + +R  E   T     + 
Sbjct  126   WPAQVALSLNIPAVFFATTAAANFCLFLFFCKNPDEDSPFPEIYVRNSENPPT-----ER  180

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKS-KVVSIGTTFQAPPPVDHE  834
             +    R   L    +  ++LV S REVEGKYID+LS ++ + KV+ +G   +  P    E
Sbjct  181   SHPVIRNMVLCFERSTDLVLVKSCREVEGKYIDHLSSVLATKKVIPVGPLVEEDPTEAVE  240

Query  835   -----TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
                   E+  WL +K  SS VFV FGSE +L  E + E+A  LE S  NFIW +R PKGE
Sbjct  241   DDKKINEIIKWLDKKNESSVVFVCFGSENYLFGEQVTEMANALESSKCNFIWAVRSPKGE  300

Query  1000  E--ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             +   S  + LP+GF+ER+G+ G ++EGWAPQ  IL H STGGF+SHCGWNS+ ES+  GV
Sbjct  301   QKGSSSLQLLPQGFVERVGDMGLVIEGWAPQKMILRHSSTGGFLSHCGWNSMNESIKYGV  360

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERD-EKGKLHREEMAAALRETVGGENGEKLKRN  1350
             PII MP+  DQP NAR+ V  G  +++ R+  +G   ++E+   +R+ +  E+G+ +++ 
Sbjct  361   PIIGMPITGDQPSNARIAVATGFGMQIVRNIAEGIYKKDEICDVIRKVMVDESGQSVRKK  420

Query  1351  VKRISENLRLAGNREMDAVVAELEKLCNK  1437
              K +S  +   G+  +D  V  L ++  K
Sbjct  421   AKELSLKIEEKGDEYIDKAVEALLQIFRK  449



>ref|XP_009774569.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Nicotiana sylvestris]
Length=498

 Score =   353 bits (906),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 191/462 (41%), Positives = 280/462 (61%), Gaps = 33/462 (7%)
 Frame = +1

Query  130   RSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS----IR  297
             + ++M P +A+GH+TPF  LAK L+   F ++LCST   L+ +K +  + +S +    I 
Sbjct  45    QKILMIPMIAHGHVTPFFELAKKLSKANFHIYLCSTSAVLSFLKQSQEKYFSDASNTNIE  104

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLP  PDLP HYQ+T GLP  L+  L    KMA   F+ ++  LNPDL+I D    
Sbjct  105   LIELHLPSMPDLPSHYQSTKGLP-SLYPPLFTAYKMAGESFSNIVDNLNPDLIIEDFFQA  163

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA--EYPFPALRLRQYE---------  624
             WA  +ALS NIP V F   SAA  S+  H+  + GA  +YPFP + L   E         
Sbjct  164   WAPDIALSKNIPIVSFSVVSAASYSFMYHIYLSDGATDDYPFPEICLSNNEIEIGLISKP  223

Query  625   -QTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
               +     + +      R+++ D      ++L+N+ +E E KY+ YLS ++  K +S+G 
Sbjct  224   TGSSITVFLEKILVYSARKKSCD------IVLINNWKETEVKYMTYLSSIINKKTLSVGP  277

Query  802   TF---QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
                        D ++++ +WL +K   STV+  FGSE    KE+++EIA+G+E+S VNF+
Sbjct  278   LIGQTDESTQDDQDSDIIEWLDKKDRFSTVYAVFGSENVWSKENIQEIAHGIELSNVNFL  337

Query  973   WVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             WVLRFP  E   VE+ LP+GFL R+ ERG +V  W P AKI+GH S GGF++HCGWNS +
Sbjct  338   WVLRFPGSE---VEQVLPEGFLNRVKERGMVVSRWVPHAKIMGHTSIGGFLNHCGWNSTV  394

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-  1329
             E ++ GVP+IAMP ++DQ + A   +E+G A++V+RDEKG L REE+A A+R  +  +  
Sbjct  395   ECIHFGVPLIAMPFNVDQFITANYAIELGMALKVQRDEKGGLKREEIAKAIRNVIMEKKM  454

Query  1330  GEKLKRNVKRISENLRLAGNREMDA-VVAELEKLC--NKPER  1446
             GE+L+   K +SE +R+   +E+D  VV EL  LC  NK E+
Sbjct  455   GEELREKSKELSEKIRIKEEKEIDQEVVEELRNLCLMNKKEK  496



>ref|XP_004142255.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
Length=450

 Score =   351 bits (901),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 281/449 (63%), Gaps = 16/449 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNN-IPQSYSQ  288
             +  T  +++MFPWL YGH++P++ L+K L+ R  FL++ CSTP NL+SIK   IP   S 
Sbjct  7     STPTTTTILMFPWLGYGHLSPYLELSKALSTRKNFLIYFCSTPVNLDSIKPKLIP---SP  63

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
             SI+ +ELHLP SPD PPH  TTN LP HL  AL +    A P F  +LKTL+P LLI+D 
Sbjct  64    SIQFVELHLPSSPDFPPHLHTTNALPPHLTPALHQAFAAAAPLFETILKTLSPHLLIYDC  123

Query  469   VNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELM  648
                WA ++A SLNIP++ F T+  +M SY  H + +P +++PF    L    ++K     
Sbjct  124   FQSWAPRLASSLNIPAINFSTSGTSMISYGFHSIHHPSSKFPFSDFVLHNPWRSKYNSTP  183

Query  649   NQETRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPP  822
             ++  R+ +    E L+T  ++ ++L+NS +EVEG+Y+DYLS L+K KV+ +G     P  
Sbjct  184   SEHARSVREAFFECLNT--SRDVILINSFKEVEGEYMDYLSLLLKKKVIPVGPLVYEPSE  241

Query  823   VDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-  987
              D E E    + +WL +K A STV  S GSE +  +E+ EEI  GL  S  NFIWV R  
Sbjct  242   NDEEDEDYSRIKNWLDKKEALSTVLASMGSESYASEEEKEEIVQGLVESEANFIWVERIN  301

Query  988   PKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNL  1167
              KG+E   ++   +  LE+ GER  +V+GWAPQ KIL H S GGFVSHCGWNS++ES+  
Sbjct  302   KKGDE--EQQIKRRELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSHCGWNSVLESIVS  359

Query  1168  GVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             GVPII +P+  DQP NA ++   G  VE +RD  GK+ R+E+A  ++E V  +  E+L+ 
Sbjct  360   GVPIIGVPVFGDQPFNAGVVEFAGIGVEAKRDPDGKIQRKEVAKLIKEVVIEKRREELRM  419

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCN  1434
              V+ +SE ++  G+  ++ ++A++    N
Sbjct  420   KVREMSEIVKRRGDVLIEEMLAQISHFSN  448



>ref|XP_006851566.1| hypothetical protein AMTR_s00040p00192700 [Amborella trichopoda]
 gb|ERN13147.1| hypothetical protein AMTR_s00040p00192700 [Amborella trichopoda]
Length=452

 Score =   350 bits (898),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/436 (41%), Positives = 267/436 (61%), Gaps = 7/436 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+MFPWLA+GHITPF  LAK L +R   V +CST  NL SIK+ + +++S SI+  E+ L
Sbjct  9     VLMFPWLAHGHITPFFELAKKLVEREITVTICSTASNLTSIKDQLRETHS-SIKTAEISL  67

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P+   L PH+QTT  LP HL   LK+   +++  F +LL++L P+ L+HD +  WA + A
Sbjct  68    PQVAGLSPHHQTTKDLPPHLMPHLKRAFHLSQNQFKDLLRSLKPNFLLHDFIQPWAPEAA  127

Query  496   LSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFK  672
             L L IPS  F T S +  S+  H+ L     E+PF  + L  +E  + + ++ Q+T   +
Sbjct  128   LELKIPSSVFLTFSVSCSSFLYHLVLGKKPNEFPFETMELHPHESQRIQPMLEQQTFGMR  187

Query  673   REETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELT  846
               E   +   Q+   +   S  ++EGK+I+YLS L   +V+ +G    +  P   +    
Sbjct  188   DLERYKSCVEQSTDFLTCRSMHDIEGKFINYLSALAGKRVIPVGPLVSSRTPATTDEFFR  247

Query  847   DWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VEEAL  1023
              WL  +P  S VF SFGSEYF+ +++++EIA GLE+S + FIWV+R    E I  + E L
Sbjct  248   QWLDARPEKSVVFTSFGSEYFMSEDEIKEIALGLELSNLPFIWVIRVSPNEVIKEINEVL  307

Query  1024  PKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLD  1203
             P GF+ER+ ERG +V GWAPQ +IL H + GGF++HCGW S MESL L  P+I +P+ LD
Sbjct  308   PLGFIERVKERG-LVVGWAPQGEILRHVAIGGFLTHCGWGSCMESLGLESPLITLPLQLD  366

Query  1204  QPMNARLMV-EIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRL  1380
             QP N+R+M  E+   VEVER+  G    E++A AL+  V    GE ++   +R++E ++ 
Sbjct  367   QPFNSRVMTREVRVGVEVERESDGGFKGEKVAKALKMVVLEREGELVRERARRLAEKIKE  426

Query  1381  AGNREMDAVVAELEKL  1428
              G++ +D +V E+ +L
Sbjct  427   DGDKGVDELVKEIRRL  442



>sp|Q8GVE3.2|FLRT_CITMA RecName: Full=Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase; 
AltName: Full=1,2 rhamnosyltransferase [Citrus maxima]
 gb|AAL06646.2| flavonoid 1-2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 175/445 (39%), Positives = 269/445 (60%), Gaps = 6/445 (1%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             + S++M PWLA+GHI P + LAK L+ + F ++ CSTP+NL S   N+ +++S SI+L+E
Sbjct  8     KPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFSSSIQLIE  67

Query  307   LHLPES-PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             L LP + P+LP   QTT  LP HL   L    + A+P F  +L+TL P L+++D+   WA
Sbjct  68    LQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMYDLFQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              + A   +I ++ F   SA  CS+  H + NP  +YPF     +  E       ++    
Sbjct  128   AEAAYQYDIAAILFLPLSAVACSFLLHNIVNPSLKYPFFESDYQDRESKNINYFLHLTAN  187

Query  664   -NFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
                 ++  L     +   + + +SRE+E KY+DY   LM ++++ +G   Q P   + +T
Sbjct  188   GTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPLIQEPTFKEDDT  247

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             ++ DWL++K   S V+ SFGSEYF  K+++ EIA GL +S VNFIW  R    E++++EE
Sbjct  248   KIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFRLHPDEKMTIEE  307

Query  1018  ALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             ALP+GF E I    +G +V+GW PQAKIL H S GGF+SHCGW S++E +  GVPII +P
Sbjct  308   ALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGSVVEGMVFGVPIIGVP  367

Query  1192  MHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             M  +QP NA+++V+ G  + V RD+   +L  EE+A  ++  V  E  ++++R    ISE
Sbjct  368   MAYEQPSNAKVVVDNGMGMVVPRDKINQRLGGEEVARVIKHVVLQEEAKQIRRKANEISE  427

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             +++  G+ EM  VV +L +L  K E
Sbjct  428   SMKKIGDAEMSVVVEKLLQLVKKSE  452



>gb|AFB73772.1| 1,2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/445 (39%), Positives = 269/445 (60%), Gaps = 6/445 (1%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             + S++M PWLA+GHI P + LAK L+ + F ++ CSTP+NL S   N+ +++S SI+L+E
Sbjct  8     KPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFSSSIQLIE  67

Query  307   LHLPES-PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             L LP + P+LP   QTT  LP HL   L    + A+P F  +L+TL P L+++D+   WA
Sbjct  68    LQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMYDLFQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              + A   +I ++ F   SA  CS+  H + NP  +YPF     +  E       ++    
Sbjct  128   AEAAYQYDIAAILFLPLSAVACSFLLHNIVNPSLKYPFFESDYQDRESKNINYFLHLTAN  187

Query  664   -NFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
                 ++  L     +   + + +SRE+E KY+DY   LM ++++ +G   Q P   + +T
Sbjct  188   GTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPLIQEPTFKEDDT  247

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             ++ DWL++K   S V+ SFGSEYF  K+++ EIA GL +S VNFIW  R    E++++EE
Sbjct  248   KIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFRLHPDEKMTIEE  307

Query  1018  ALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             ALP+GF E I    +G +V+GW PQAKIL H S GGF+SHCGW S++E +  GVPII +P
Sbjct  308   ALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGSVVEGMVFGVPIIGVP  367

Query  1192  MHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             M  +QP NA+++V+ G  + V RD+   +L  EE+A  ++  V  E  ++++R    ISE
Sbjct  368   MAYEQPSNAKVVVDNGMGMVVPRDKINQRLGGEEVARVIKHVVLQEEAKQIRRKANEISE  427

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             +++  G+ EM  VV +L +L  K E
Sbjct  428   SMKKIGDAEMSVVVEKLLQLVKKSE  452



>gb|ACX70154.1| 1,2 rhamnosyltransferase [Citrus maxima]
Length=452

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/445 (39%), Positives = 269/445 (60%), Gaps = 6/445 (1%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLE  306
             + S++M PWLA+GHI P + LAK L+ + F ++ CSTP+NL S   N+ +++S SI+L+E
Sbjct  8     KPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFSSSIQLIE  67

Query  307   LHLPES-PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWA  483
             L LP + P+LP   QTT  LP HL   L    + A+P F  +L+TL P L+++D+   WA
Sbjct  68    LQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMYDLFQPWA  127

Query  484   EKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              + A   +I ++ F   SA  CS+  H + NP  +YPF     +  E       ++    
Sbjct  128   AEAAYQYDIAAILFLPLSAVACSFLLHNIVNPNLKYPFFESDYQDRESKNINYFLHLTAN  187

Query  664   -NFKREETLDT-PANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
                 ++  L     +   + + +SRE+E KY+DY   LM ++++ +G   Q P   + +T
Sbjct  188   GTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPLIQEPTFKEDDT  247

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             ++ DWL++K   S V+ SFGSEYF  K+++ EIA GL +S VNFIW  R    E++++EE
Sbjct  248   KIMDWLSQKEPRSVVYASFGSEYFPSKDEIHEIASGLLLSEVNFIWAFRLHPDEKMTIEE  307

Query  1018  ALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             ALP+GF E I    +G +V+GW PQAKIL H S GGF+SHCGW S++E +  GVPII +P
Sbjct  308   ALPQGFAEEIERNNKGMIVQGWVPQAKILRHGSIGGFLSHCGWGSVVEGMVFGVPIIGVP  367

Query  1192  MHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGEKLKRNVKRISE  1368
             M  +QP NA+++V+ G  + V RD+   +L  EE+A  ++  V  E  ++++R    ISE
Sbjct  368   MAYEQPSNAKVVVDNGMGMVVPRDKINQRLGGEEVARVIKHVVLQEEAKQIRRKANEISE  427

Query  1369  NLRLAGNREMDAVVAELEKLCNKPE  1443
             +++  G+ EM  VV +L +L  K E
Sbjct  428   SMKKIGDAEMSVVVEKLLQLVKKSE  452



>gb|KDO51358.1| hypothetical protein CISIN_1g046033mg, partial [Citrus sinensis]
Length=434

 Score =   344 bits (882),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 186/439 (42%), Positives = 276/439 (63%), Gaps = 18/439 (4%)
 Frame = +1

Query  160   YGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPES-PDL-  333
             +GHITP++ LAK L+ + F ++ CSTP NL S+  N+ + +S SI+L++L LP + P+L 
Sbjct  1     HGHITPYLALAKKLSQQNFHIYFCSTPINLQSMSQNLQEKFSTSIQLIDLQLPCTFPELH  60

Query  334   PPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIP  513
              P+  TT  +P HL   L +    A+P F  +L+TL P L+I+D+   WA + A   +I 
Sbjct  61    DPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLETLKPTLVIYDLFQPWAAEAAYQHDIA  120

Query  514   SVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYE-----QTKTRELMNQETRNFKRE  678
             +V F T +AA  S+F   L N   ++PFP   L + E     Q K R +   E R+ +  
Sbjct  121   AVAFVTIAAASFSFF---LQNSSLKFPFPEFDLPESEIQKMTQFKHRIVNGTENRD-RFL  176

Query  679   ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH--ETELTDW  852
             + +D      ++LV +SRE+E K + YLS + K + + +G   Q P   D+  +T++ DW
Sbjct  177   KAIDLSCK--LVLVKTSREIESKDLHYLSYITKKETIPVGPLVQEPIYTDNNNDTKIMDW  234

Query  853   LARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKG  1032
             L+RK  SS V+VSFGSEYFL KE++ E+A GL +S V+FIWV+RF      ++EEALP+G
Sbjct  235   LSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLLSEVSFIWVVRFHSEGNFTIEEALPQG  294

Query  1033  FLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQ  1206
             F E I    +G +V+GWAPQAKILGH S GGF+SHCGW S +E +  GVPIIA+PM LDQ
Sbjct  295   FAEEIQGNNKGMVVQGWAPQAKILGHGSIGGFISHCGWGSTVEGIMYGVPIIAVPMVLDQ  354

Query  1207  PMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLA  1383
               NA+++ +IG  +EV RDE   ++ +EE+A   ++ V  E G+++KR  K +SE+++  
Sbjct  355   LFNAKMVADIGVGLEVPRDEINQRVRKEELARVFKQVVEQEEGQQIKRKAKELSESIKKK  414

Query  1384  GNREMDAVVAELEKLCNKP  1440
             G+ E   VV +L +L   P
Sbjct  415   GDDEEINVVEKLLQLVKVP  433



>ref|XP_004250481.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=463

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 181/459 (39%), Positives = 274/459 (60%), Gaps = 24/459 (5%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             +VMFPWLA GHI+ F+ LAK LA R F+ ++ +T  NL   K+ +    ++ ++L+++ L
Sbjct  10    IVMFPWLARGHISAFLELAKALAKRNFITYIYTTHANLAYFKDTLSPEETRHVKLMDIVL  69

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  P LP    TT GL  HL + LK +    +PDF  +L+TL PDL+I+D +      +A
Sbjct  70    PYLPHLPRTSHTTAGLHPHLINTLKLIFLKGKPDFFTILETLKPDLIIYDFLLPCIPLMA  129

Query  496   LSLNIPSVRFFTASAAMCSYFTHML-TNPGAEYPFPALRLRQYEQTKTRELM--------  648
              +L+ P+V F T+ AA  SY  H+   NP  +YPFP +  + +E  + + +         
Sbjct  130   STLHFPAVLFLTSGAAANSYHYHVRDNNPSIDYPFPEIFFKDHEHRRNKRIFDSLEDDGI  189

Query  649   ---NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
                N  TR F+R        ++ ++L+ + +E+EGK+IDYL+ L   + V +G   +A  
Sbjct  190   DEKNGITRCFER--------SKGIILIKTFKELEGKFIDYLTFLFNKRFVPVGPLVRAFD  241

Query  820   PVD---HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
               D   +  ++ +WL  K   ST+F+SFGSE +  KE ++E+A GLE+S VNFIWV+RFP
Sbjct  242   QTDSGEYNDKIIEWLNEKEKCSTIFISFGSELYFTKEQIQEMALGLELSMVNFIWVIRFP  301

Query  991   KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
                ++ + E LP+GF ER    G +VE WAPQ +IL H S  GFVSHCGWNS+ME+L  G
Sbjct  302   GTYKMEIREVLPEGFYERNWNTGLIVEEWAPQGRILKHSSIAGFVSHCGWNSVMEALGCG  361

Query  1171  VPIIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKR  1347
             VPIIA+P+  +QP+NARL+V E+   +E+ +DE+GK  +E +A  +RE V    GE +++
Sbjct  362   VPIIALPVQHEQPLNARLLVNEVRVGLEIPKDEEGKFSKEGVAKVVREMVFERRGESVRK  421

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCNKPERIAFAYE  1464
               K   E +R  G  +++ VV EL  L     R  + Y+
Sbjct  422   KAKEFGEKMRENGENDIERVVDELVDLYKNSLRPTYNYK  460



>dbj|BAI44134.1| flavonoid glycosyltransferase UGT94C2 [Veronica persica]
Length=460

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 266/445 (60%), Gaps = 13/445 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKN-LADRGFLVHLCSTPDNLNSIKNNIPQSY-SQSIRLLEL  309
             ++MFPWLA+GH+ P++ LAK  L  + F +++CSTP N  SI   I ++    SI+L+++
Sbjct  9     ILMFPWLAHGHVFPYLELAKRILKGKNFQIYICSTPINFTSINTFINKNLLENSIQLVDI  68

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
              L  S +LPPHY T   LP +L   L    +    +F+ ++ TL PDL+I+D+   WA K
Sbjct  69    QLQPSEELPPHYHTPKNLPPNLLFTLINAFQSTHSNFSNIIATLKPDLVIYDIFQPWAAK  128

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLTNP---GAEYPFPALRLRQYEQT---KTRELMN  651
             ++    IP+V F +  A + S+  H  T        +PFP L+ + +E     K  E + 
Sbjct  129   ISSLQGIPAVHFASIGAGVLSFIHHHYTPSDIISTPFPFPVLQCKDHEVKSIEKLLEFLY  188

Query  652   QETRNFKREETLDTPANQA-MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
             +   +  ++    +  +   ++LV +SR  E KY++Y+ E  K ++VS+G        + 
Sbjct  189   ENLHDVDQDFLFGSFKHSCNIVLVKTSRSFEQKYMNYIQEKCKKRIVSVGPLVSNSNNIT  248

Query  829   HETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE  999
             +E +   +  WL  K   STV++SFGSEYFL  +++EEIA GLE+   NFIWV+RFP G+
Sbjct  249   NEEDSESIIQWLNSKSLRSTVYISFGSEYFLNDKEVEEIAKGLELCDANFIWVIRFPAGD  308

Query  1000  E-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             + IS+E  LP+GFL R+ +RG +VEGWAPQ  IL H S   F SHCGW+S+MESL  GVP
Sbjct  309   KTISLENTLPRGFLNRVKDRGLVVEGWAPQVPILAHSSIACFASHCGWSSLMESLYYGVP  368

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             +IAMPM  DQP+NARL  E G ++EV+RDE G L  E +A  +      + GE+L+   K
Sbjct  369   VIAMPMQFDQPINARLAGEGGFSLEVDRDENGMLSGENIAKGINTVFEEKTGEELRFRAK  428

Query  1357  RISENLRLAGNREMDAVVAELEKLC  1431
              +SE +R     ++D V+ +L  LC
Sbjct  429   EVSEKMRRDEEEDLDEVIDQLLLLC  453



>ref|XP_010046728.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Eucalyptus 
grandis]
Length=389

 Score =   340 bits (872),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/445 (42%), Positives = 259/445 (58%), Gaps = 73/445 (16%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNI-PQSYSQS  291
             T   + S++M PWLA+GHI+PF+ L K L+ R F ++ CSTP NL  +++ I  Q    S
Sbjct  3     TTTQKPSILMLPWLAHGHISPFLELGKKLSHRDFHIYFCSTPINLKPLRDTILAQDCVPS  62

Query  292   IRLLELHLP--ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
             I+L++LHLP  E P LPPHY TT  LP HL   LK     A+  F ++L +L PDL+I D
Sbjct  63    IQLVDLHLPSDEFPQLPPHYHTTKDLPPHLMSTLKSAFNSAKSSFFDILGSLKPDLVIFD  122

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTREL  645
              +  WA   A  LNI +V                                  E  +  +L
Sbjct  123   YLQPWASVAASELNINAVS---------------------------------ENYRIAKL  149

Query  646   MNQETRNFKREE----TLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
             MN     +K +E     ++  +N  ++L+ +SR  EGKY+DYLSEL+K KVV++G   Q 
Sbjct  150   MNASANGYKNKERFWECMERSSN--IVLIKTSRVTEGKYVDYLSELVKRKVVTVGPLLQE  207

Query  814   PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
             P   D                              E+ E+IAYGLE+S V FIWVLRF  
Sbjct  208   PANKD------------------------------EEREKIAYGLELSNVGFIWVLRFHG  237

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             GE++++ EALP+GFL+RIG+RG +VEGWAPQA+ILGH S GGFVSHCGW+S +E++  GV
Sbjct  238   GEDVTIHEALPQGFLQRIGDRGLVVEGWAPQAEILGHPSIGGFVSHCGWSSTLEAILFGV  297

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PI+AMPMHLDQP+NA+L+VEIG  +EV+R   G   RE++A  +++ +  E G++ KRN 
Sbjct  298   PILAMPMHLDQPLNAKLVVEIGVGMEVDRG-SGGFRREKLARVIQQVMVEEKGKEAKRNA  356

Query  1354  KRISENLRLAGNREMDAVVAELEKL  1428
             + +   +R     EMD VV +L++L
Sbjct  357   QELGMRMREKQKEEMDDVVEKLKQL  381



>gb|AGA84058.1| UDP-glucosyltransferase isoform 2 [Picrorhiza kurrooa]
Length=484

 Score =   342 bits (877),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 200/473 (42%), Positives = 273/473 (58%), Gaps = 35/473 (7%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYS--  285
             E+   + S++MFPWLA+GHI PF+ LAK L+ R F V+LCS P NL+SIK N+ +  S  
Sbjct  2     ESEQAKFSILMFPWLAHGHIFPFLELAKRLSKRNFTVYLCSAPINLDSIKTNLAKDRSID  61

Query  286   -QSIRLLELHLPESPDLPPHYQTTNGLPLHLHD---ALKKVLKMAEPDFTELLKTLNPDL  453
               SI+L+EL   ESP LP  + TT  +P HL      L +  + +   F  ++ +LNPDL
Sbjct  62    DDSIKLIELEF-ESPQLPSEFHTTKNIPSHLSHLIPILIQDFQKSSSSFVGIVNSLNPDL  120

Query  454   LIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN-PGAEYPFPALRLRQYEQT  630
             LI D    WA K ALS  IP+V F    A   ++  H  T+   +  PF  + L  +E+ 
Sbjct  121   LILDYFQPWAFKYALSRGIPAVCFLVICATSFAFHHHEHTHGTSSPSPFKGIYLLDHERV  180

Query  631   KTRELMNQETRNFKREETLDTPA------NQAMMLVNSSREVEGKYIDYLSELMKSKVVS  792
                  M      F ++  LD  A      +  ++L NSS+ +EGKYIDYL+   +  VV 
Sbjct  181   DYGASMGA----FIKDADLDVFAFGTFNLSSDIILFNSSKGLEGKYIDYLTVQCEKPVVP  236

Query  793   IGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
              G         ++ +E+  WL+ K   STV+VSFGSEYFL  E++ E+A GLE+   NF+
Sbjct  237   TGPLIVRSNEGEN-SEIMKWLSGKDRFSTVYVSFGSEYFLSMEEVAEVAKGLELCKANFV  295

Query  973   WVLRFPKGEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSI  1149
             WVLRFP GE  +SVE ALP+GF ER  ERG +V  WAPQ  +L H STGGFVSHCGWNS+
Sbjct  296   WVLRFPLGENAMSVENALPRGFTERAKERG-LVVTWAPQTSVLDHESTGGFVSHCGWNSV  354

Query  1150  MESLNLGVPIIAMPMHLDQPMNARLMVEI--------------GAAVEVERDEKGKLHRE  1287
             MES   GVP+IAMPM ++QP++ R++VE+              G  VEV R E      E
Sbjct  355   MESAYFGVPVIAMPMRIEQPLSGRMLVELCLFSSTIMPMVTEAGCCVEVRRSENEGYKGE  414

Query  1288  EMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKPER  1446
              +A A+ + V  E+GE L     ++SE +R+   +EMD V  EL +LC K  +
Sbjct  415   YIAEAINKLVLEESGEGLWERANKLSEKMRMDEEKEMDVVTEELWELCLKKNK  467



>gb|AFJ53038.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=472

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 280/481 (58%), Gaps = 37/481 (8%)
 Frame = +1

Query  40    LSVFILFKQSFDPPILQRRLTMGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADR--G  213
             L + ++ + S   PI   +  +   T +    ++MFPWLA+GHI+PF+ LA  L  R   
Sbjct  7     LYITVMDEDSAQTPIHNSKSMVDEATNSGEIRILMFPWLAHGHISPFLELANKLVSRLPN  66

Query  214   FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKK  393
               VHLCS+P NL SI   I   +   I+L+EL+LP  PDLPPH  TT  LP HL   L K
Sbjct  67    VQVHLCSSPINLASITKLI--KHPSRIKLIELNLPSLPDLPPHSHTTKDLPTHLLLTLMK  124

Query  394   VLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSL-NIPSVRFFTASA-AMCSYFTHM  567
              L MA  DF+++L TL+PDLLI D    WA K+A SL  IP+V F T +A +    FT M
Sbjct  125   ALDMASSDFSQILTTLSPDLLICDFFQPWASKLAFSLLKIPTVLFMTIAAISTVVPFTSM  184

Query  568   LTNPGAEYPFPALR---LRQYEQTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREV  738
              ++   +  FP LR      YEQ ++  +M++  ++++R        +  ++LV S RE+
Sbjct  185   KSSGKFDCLFP-LRSNYFFDYEQVESPSIMDRVFQSWER--------SAGILLVKSFREI  235

Query  739   EGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE-----LTDWLARKPASSTVFVSFGSE  903
             E +YI  LSEL+   V+ +G      P  D E +     + +WL  K  SS V++SFGSE
Sbjct  236   EAEYIQRLSELVGKSVLPVGPLV---PGDDDENQQPDNDIINWLNNKAPSSVVYISFGSE  292

Query  904   YFLRKEDLEEIAYGLEI-----SGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMV  1068
              +L +  +EE+A+ L I       +NF+WVLRFP+GEE+++ EALP+GF   +GERG + 
Sbjct  293   SYLSRRQIEELAHALVILIEKAIPINFVWVLRFPQGEEVAISEALPEGFSAAVGERGYVT  352

Query  1069  EGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAV  1248
             E WAPQ +IL H S GGFVSHCGW+S+ME +  GVP++AMP+  DQ  NA L+ E G  +
Sbjct  353   EDWAPQRRILRHESVGGFVSHCGWSSVMEGMKYGVPMVAMPLQNDQSTNASLVEEAGVGL  412

Query  1249  EVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKL  1428
             +V     G++ R E+A  + E + G N   +K   K I   L   G+R++D  +  L  L
Sbjct  413   KV-----GEIERGELAKVIEEVMIGSNN-IIKDKAKEIKHCLLEKGDRDIDEAIDRLVHL  466

Query  1429  C  1431
             C
Sbjct  467   C  467



>gb|EYU45580.1| hypothetical protein MIMGU_mgv1a021692mg [Erythranthe guttata]
Length=458

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/457 (41%), Positives = 283/457 (62%), Gaps = 16/457 (4%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNIPQ-  276
             M +E    R  ++MFPWLA+GHI P++ LA+ ++ +  F +HLCST  N NSI + I + 
Sbjct  1     MDSEASCFR--ILMFPWLAHGHIFPYLELARRISKKKKFHIHLCSTAVNFNSINSFIEKN  58

Query  277   SYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLL  456
             S   SI  +ELHL    DLPPHY TT  LP +L   L K  + A+P F++ +  L PDL+
Sbjct  59    SLQNSIETVELHL--QSDLPPHYHTTKNLPSNLILTLLKSFQTAKPSFSDTIAALKPDLV  116

Query  457   IHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKT  636
             I+D+   WA ++A S  IP+V F   +AA  ++  H   +PG ++PFP L L  +E+   
Sbjct  117   IYDIFQPWAARIASSRGIPAVHFAAFAAATMAFVHHHYASPGGDFPFPELCLLDHEKRSI  176

Query  637   RELMN-QETRNFKREETL---DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG--  798
               L+    T  F+ ++ +   +   +   +++ +S   EGKYIDY+S++ + K++ +G  
Sbjct  177   DSLIQFLYTDVFEEDKEVIFQNYRLSSEFVMLKTSEGFEGKYIDYVSDVCRRKILPVGPL  236

Query  799   TTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISG--VNFI  972
              T       ++ +++  WL++K   STV++SFGSEYFL +E+++EIA GLE+    VNFI
Sbjct  237   VTGVCENAEENNSDVMKWLSKKEHHSTVYISFGSEYFLSEEEIDEIAKGLELCDERVNFI  296

Query  973   WVLRFPKGEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSI  1149
             WV+RFP GE+ I++EE LP+GFL R+  RG +V GWAPQA IL H STG FVSHCGW+S+
Sbjct  297   WVVRFPVGEKTITIEERLPRGFLNRVEGRGMVVSGWAPQANILAHPSTGAFVSHCGWSSL  356

Query  1150  MESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN  1329
              ES+  GVP+I MP  L+  ++AR++V  GA VEV  +E G    E +A  +R+ +  E 
Sbjct  357   TESIYYGVPVIGMPKKLNMFIDARMLVGAGACVEVPSEENGVFKGENIANVIRKVILEER  416

Query  1330  -GEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
              G+ L+   + +SE +R+   + +D    +L +LC K
Sbjct  417   IGQGLRLRSRELSEKMRIEEEQLIDETAEQLWQLCLK  453



>dbj|BAI44133.1| flavonoid glycosyltransferase UGT94F1 [Veronica persica]
Length=452

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 192/440 (44%), Positives = 271/440 (62%), Gaps = 11/440 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNI---PQSYSQSIRLLE  306
             ++MFPWLA+GHI PF+ LAK L+ R F +H CST  NL+SIK+N+   P     SI+LLE
Sbjct  11    ILMFPWLAHGHIFPFLELAKTLSKRNFTIHFCSTAINLDSIKSNLANDPSVLDDSIKLLE  70

Query  307   LHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             L + ESP+LPP   TT  LP H    L K  + ++  F  +  TL PD+LI+DV N WA 
Sbjct  71    LEI-ESPELPPELHTTKNLPPHQFPLLIKDFENSKSSFFSIFDTLKPDMLIYDVFNPWAA  129

Query  487   KVALSLNIPSVRFFTASAAMCSYFTHM-LTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
             K ALS   PSV F  + A +CS+  H  L   G+  P+  +    + + K     N +  
Sbjct  130   KHALSHGSPSVWFMASGATICSFHYHQHLHKTGSLVPYEGV---DFGEIKRHISPNTKGA  186

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETEL  843
             +F         ++  ++L+ +S+E+E KYIDYLS L + +++  G         D E E+
Sbjct  187   DFGGFILGSLNSSSEIILLKTSKELEKKYIDYLSFLCRKQIIPTGLLIANSDEKD-EPEI  245

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVEEA  1020
               WL  K   STV++SFGSE FL KE +EE+A GLE+S VNFIW++RFP+G+  ++VE A
Sbjct  246   MQWLDEKSERSTVYISFGSECFLSKEQIEEVAKGLELSNVNFIWIIRFPEGKNSMTVENA  305

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP+GFLER+  RG ++  +APQ +IL H+S GGFVSHCGW+SI ES+  GVPIIAMPM  
Sbjct  306   LPEGFLERVKGRGMVIWKFAPQTRILAHKSIGGFVSHCGWSSITESVYFGVPIIAMPMKF  365

Query  1201  DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG-GENGEKLKRNVKRISENLR  1377
             +Q +N  ++VE+G  VEVE+D  G+   EE+A AL +  G  E  ++++     +S+ +R
Sbjct  366   EQVVNGVVVVEVGVGVEVEKDGSGQYLGEEVAKALDKVFGDNEFSKEVRYRASNLSDKIR  425

Query  1378  LAGNREMDAVVAELEKLCNK  1437
                 +E D V  +L  LC K
Sbjct  426   ENEEQEEDKVAEQLMSLCAK  445



>ref|XP_011071677.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=455

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 185/445 (42%), Positives = 279/445 (63%), Gaps = 11/445 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG-FLVHLCSTPDNLNSIKNNI----PQSYSQ-SIR  297
             V+MFPWLA+GH+ P++ LA+ L+    F ++ CST  NL SI+N++    P S+   SI 
Sbjct  6     VLMFPWLAHGHVYPYLALAQRLSKTNKFHIYFCSTSVNLESIRNSLNQHSPSSWDHLSIE  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+EL LP  P LPPHY TT  +PL L   L    +++ P+F++++  LNPDLLI+D+   
Sbjct  66    LIELRLPPHPQLPPHYHTTKNIPLTLIPTLIHAFQLSAPNFSDIITRLNPDLLIYDMFQP  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA-EYPFPALRLRQYE---QTKTREL  645
             W+ K+A S  IP+V F    +   S+  H+ T+  A  +P PA+ L  YE   Q    EL
Sbjct  126   WSAKLASSQGIPAVHFNVGGSTALSFLHHLHTHKSAVTFPVPAIYLHDYERQNQMAEEEL  185

Query  646   MNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPV  825
             +  +  +      +   +   +++ +    +EG YIDYLS L + ++V +G   Q     
Sbjct  186   VKVQEDDEGLFFGVFKLSCDIVLINSCCMWIEGMYIDYLSTLSQRRIVPVGPLVQENAAD  245

Query  826   DHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-  1002
             + ++ + +WL++K  SST+++SFGSE +  +E ++EIA GLE+  VNFIWV R P G + 
Sbjct  246   ETDSWIMNWLSKKRESSTLYISFGSETYFSREQIQEIAKGLELCKVNFIWVARSPVGSDH  305

Query  1003  ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPII  1182
             I+VEEALP+GF++ + ERG +V+ WAPQA IL   + GGF+SHCGWN+I ES+  GVP++
Sbjct  306   INVEEALPEGFIDLVKERGILVQKWAPQAAILASPAVGGFMSHCGWNAIKESIYFGVPVV  365

Query  1183  AMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             A+P+  +QP+N+RL+VE    VEV RDEKGK   E +  A+ E + GE+GE+L+R V+ +
Sbjct  366   ALPLKFEQPLNSRLVVEAAFGVEVARDEKGKFDGEAVGRAIDEVMLGESGERLRRRVREM  425

Query  1363  SENLRLAGNREMDAVVAELEKLCNK  1437
             SE  ++        VV EL K+C K
Sbjct  426   SEKTKVEEEETFCGVVEELTKICVK  450



>gb|EYU43901.1| hypothetical protein MIMGU_mgv1a020989mg [Erythranthe guttata]
Length=467

 Score =   330 bits (845),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 276/463 (60%), Gaps = 16/463 (3%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADR-GFLVHLCSTPDNLNSIKNNIP-----  273
             E   T+ +++MFPWLAY H+ PF  LAK+L+ R  F ++ CS+  NL SI+NN+      
Sbjct  2     EKDETKFTILMFPWLAYSHVFPFFELAKSLSKRRTFHIYFCSSAANLGSIENNLNNHKLR  61

Query  274   --QSYSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNP  447
                    SI L+EL LP SP LPPH+ TT  LP +L   L +  + +   F+ +L  L P
Sbjct  62    CNDDDDVSIDLVELQLPPSPQLPPHFHTTKNLPPNLVPILLQTFQESSSSFSRILIDLKP  121

Query  448   DLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYE  624
             DLLI+D    WA K ALSL+IPS+ F TA AA  SYF H+ T+  A  +P+  + L   E
Sbjct  122   DLLIYDFFQPWAAKQALSLSIPSIYFATAGAAPFSYFHHLHTHGSASTFPYQEIYLSDRE  181

Query  625   QTKTRELMNQETRNFKREETL-DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
             +     ++  E ++  ++    +   +  ++L+ SS+ +E KYIDYLS L + KVV  G 
Sbjct  182   KADLNAVVAPEIKDADQDFAFGNFKLSCDIVLIKSSKGLEQKYIDYLSVLCRKKVVPTGP  241

Query  802   TFQAPPPVDHETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNF  969
               Q     D + +    +  WL+ K   STV + FGSE+ L KE + EIA GLE    NF
Sbjct  242   LVQESNIKDDDDDESEVIMQWLSEKDRFSTVLICFGSEHLLPKEQIVEIAKGLEQCCTNF  301

Query  970   IWVLRFPKGEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNS  1146
             IW++RF   E  + +E+ LP+GFLER+  RG +V+ WAPQAKIL H S GGFVSHCGW+S
Sbjct  302   IWIVRFIMDENALRLEDELPEGFLERVEGRGLVVQKWAPQAKILSHPSIGGFVSHCGWSS  361

Query  1147  IMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGE  1326
             IMESL  GVPIIA+P+  DQP+N RL+VE G  VE+ R E G    EE+A A+++ +  +
Sbjct  362   IMESLYFGVPIIALPIKFDQPINGRLVVEAGCGVEIGRGENGICSAEEVAKAIKKVIMED  421

Query  1327  NGEKLKR-NVKRISENLRLAGNREMDAVVAELEKLCNKPERIA  1452
             +GE L R N + + E ++       + V  EL  +C K ++ A
Sbjct  422   SGEGLIRYNARNLGEKMKTEKEIAANEVAEELLLICKKSKQHA  464



>ref|XP_008347175.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=354

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 221/334 (66%), Gaps = 17/334 (5%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SVVM PWLA+GHI+PF  LAK L+DR F +  CSTP  LNS+K  +P+ YS  I  +ELH
Sbjct  11    SVVMLPWLAHGHISPFXELAKKLSDRNFHIFFCSTPVILNSVKPKLPERYSHCIEFVELH  70

Query  313   LPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LP    P+L PHY TTNGLP HL   LKK L+MA P F+ +LKTLNPD LI+D V  WA 
Sbjct  71    LPHDVFPELAPHYHTTNGLPPHLMPTLKKALQMASPYFSNILKTLNPDFLIYDFVVPWAL  130

Query  487   KVALSLNIPSVRFFTASAAMCSYFTH-MLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              + L  NIP+++FF  SA   S+  H +   P   +PFPA+ LR YE +K   +M   + 
Sbjct  131   SLGLDQNIPTIQFFIFSAVSVSFLFHRLFKGPSVRFPFPAIYLRDYEISKFNSMMPPASS  190

Query  664   NFKREETLDTPA--------NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
             N  R++    P         +  ++L+ + RE+EGKY+DYL ELM SKVV +G     P 
Sbjct  191   NDNRKDDGVPPLQFLITIGHSCDLILLKTFREIEGKYVDYLYELMDSKVVRLGPLLHDPT  250

Query  820   P----VDHETE-LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
                   D ET+ +  WL ++  SS V++SFGSEYFL KE++EEIA+GL++S V+FIWV+R
Sbjct  251   KDQEDKDEETDHVIKWLNQRETSSVVYISFGSEYFLSKEEIEEIAHGLDLSKVSFIWVVR  310

Query  985   FPKGEEIS-VEEALPKGFLERIGERGRMVEGWAP  1083
             FPK E+++  +E LPKGF+ER+GERG +VEGWAP
Sbjct  311   FPKEEKVTRAKEVLPKGFVERVGERGMIVEGWAP  344



>ref|XP_009793589.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=333

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 219/330 (66%), Gaps = 4/330 (1%)
 Frame = +1

Query  379   DALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYF  558
             + LK+   +A PDFT +LKTL PDLLI+D +  WA K A  L IP+V F ++S+ M SY 
Sbjct  2     NTLKEAFDLASPDFTLILKTLKPDLLIYDFLQPWAPKAAAELKIPAVEFISSSSTMTSYM  61

Query  559   THMLTNPGAEYPFPALRLRQYEQT---KTRELMNQETRNFKREETLDT-PANQAMMLVNS  726
              H+   PG ++PF ++  R YE     K    M  E     ++   D    +  ++L+ S
Sbjct  62    LHVFNKPGIKFPFSSIYYRDYEIARIEKDESSMPMEKLEEDKKRVRDCFYLSSDIVLIKS  121

Query  727   SREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEY  906
              +E+EGKY DY++     KVV +G   Q P   D E+EL  WL  K   ST+FVSFGSEY
Sbjct  122   FKEIEGKYSDYVTNSTGKKVVPVGPLVQEPTLDDGESELITWLNEKEEKSTIFVSFGSEY  181

Query  907   FLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQ  1086
             FL KEDL EIA GLE S VNFIW +RF KG+++ ++EALPKGF  R+G RG++ +GWAPQ
Sbjct  182   FLSKEDLLEIACGLENSKVNFIWPIRFQKGKDVELQEALPKGFFNRVGNRGKVFKGWAPQ  241

Query  1087  AKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE  1266
             AKIL H S GGFVSHCGW+S+MES+  GVPIIAMPMH+DQP+N+RL+ EIG AVEV RD 
Sbjct  242   AKILEHSSIGGFVSHCGWSSVMESMKYGVPIIAMPMHIDQPINSRLVEEIGIAVEVVRDS  301

Query  1267  KGKLHREEMAAALRETVGGENGEKLKRNVK  1356
               KLHRE +AA + + V  + GE +++  +
Sbjct  302   NAKLHREVVAAIINQVVVEKEGEFVRQKAR  331



>gb|AFJ53040.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 268/462 (58%), Gaps = 37/462 (8%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADR--GFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             T + +  ++MFPWLA+GHI+PF+ LA  L  R   F V+LCS+P NL S    I   +  
Sbjct  6     TNSGKIRILMFPWLAHGHISPFLELANKLISRRPNFHVYLCSSPINLESTTKLI--KHPS  63

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDV  468
              I L+ELHLP  PDLPPH  TT GLP HL   L K + MA  +F ++L  L+PDLLI D 
Sbjct  64    RIELIELHLPSLPDLPPHSHTTKGLPAHLIPTLFKAMDMASGEFFQILTKLSPDLLICDF  123

Query  469   VNLWAEKVALS-LNIPSVRFFTASAAMCSY-FTHMLTNPGAEYPFPALR----LRQYEQT  630
             +  WA K+ALS L IP+V F T+ A +    FT M  +P     FP LR    +   E  
Sbjct  124   LQPWAPKLALSLLKIPTVCFMTSPAIVYDLAFTSMNASPQFNGAFP-LRSNYVIDYVEAE  182

Query  631   KTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG----  798
              T  L N+   + +R  T        M+L+ S R++E +YID +S+ +   +V++     
Sbjct  183   STPSLANRVVWSMERSST--------MVLIKSFRDIEARYIDRVSKFIGKSMVTVAPLVP  234

Query  799   -TTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEI------S  957
                       + +  + +WL  K  SS V++SFGSE +L    ++E+A+ L I       
Sbjct  235   DDDDDDEGDQETDNNVINWLNNKDKSSVVYISFGSECYLSTSQIQELAHALLILLVEKAY  294

Query  958   GVNFIWVLRFPKGEEISVEEALPKGFLERIGERGR--MVEGWAPQAKILGHRSTGGFVSH  1131
              +NFIWVLRFP GEE+ + +ALP+GF+E +G   +  M EGWAPQ +IL H + GGFVSH
Sbjct  295   PINFIWVLRFPIGEELGISKALPEGFMEAVGLENKVYMAEGWAPQRRILRHGNVGGFVSH  354

Query  1132  CGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRE  1311
             CGW+S+ME++  GVPI+ +P+  DQPMNARL+ EIG  ++VE+ E+G     E+A  + E
Sbjct  355   CGWSSVMEAMKYGVPIVGVPLRTDQPMNARLVEEIGVGLKVEKIERG-----ELAKVIEE  409

Query  1312  TVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
              V GE   + +   K I   L   G+R++D  +  L  LC++
Sbjct  410   VVVGERKVEFRDKAKEIKNCLVEKGDRDIDEAIERLVHLCSE  451



>gb|AFJ53039.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=456

 Score =   326 bits (835),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 187/454 (41%), Positives = 265/454 (58%), Gaps = 36/454 (8%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADR--GFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             ++MFPWLA+GHI+PF+ LA  L  R   F V+LCS+P NL S    I   +   I L+EL
Sbjct  14    ILMFPWLAHGHISPFLELANKLVSRRPNFHVYLCSSPINLQSTTKLI--KHPSRIDLIEL  71

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HLP  PDLPPH   T GLP HL   L K L MA  +F+++L  L+PDLLI D +  WA K
Sbjct  72    HLPSLPDLPPHSHATKGLPTHLIPTLLKALDMAGSEFSQILTKLSPDLLISDFLQPWAPK  131

Query  490   VALS-LNIPSVRFFTASAAMCSY-FTHMLTNP--GAEYPFPALRLRQYEQTK-TRELMNQ  654
             +ALS L IP+V F TA A +  + FT M  +      +P  +  +  Y   + T  L ++
Sbjct  132   LALSLLKIPTVCFMTAPAIVYDFGFTSMNASGQFNGHFPMRSNHVVDYGAAESTPSLTDR  191

Query  655   ETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG-----TTFQAPP  819
               R+ +R  T+        +L+ S R++E  YID +S+ +   +V+I             
Sbjct  192   FMRSMERSSTV--------VLIKSFRDIEAHYIDRVSKFIGKSMVTIAPLVPDDDDGEGD  243

Query  820   PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEI------SGVNFIWVL  981
                   E+ +WL +K  SS V++SFGSE +L    ++E+A+ L I        VNFIWVL
Sbjct  244   QEPDNNEIINWLNKKHKSSVVYISFGSECYLSASQIQELAHALLILLVEKACPVNFIWVL  303

Query  982   RFPKGEEISVEEALPKGFL-ERIGERGR--MVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             RFP+GEE+ + EALP+GF+ E +G   +  +VEGWAPQ +IL H S GGFVSHCGW+S+M
Sbjct  304   RFPRGEEVEISEALPEGFIDEMVGPDNKVYLVEGWAPQRRILRHGSVGGFVSHCGWSSVM  363

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENG  1332
             E++  GVPII +P+ +DQPMNARL+ EIG  ++VE+ E+G     E+A  + E V GE  
Sbjct  364   EAMKYGVPIIGVPLRMDQPMNARLVEEIGVGLKVEKIERG-----ELAKVIEEVVVGERN  418

Query  1333  EKLKRNVKRISENLRLAGNREMDAVVAELEKLCN  1434
              + +     I   L   G+ ++D  +  L  LC+
Sbjct  419   VEFRDKATEIQNCLLEKGDSDIDEAIERLVHLCS  452



>gb|EYU45579.1| hypothetical protein MIMGU_mgv1a006511mg [Erythranthe guttata]
Length=441

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/447 (40%), Positives = 268/447 (60%), Gaps = 28/447 (6%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRG---FLVHLCSTPDNLNSIKNNIPQ-SYSQSIRLLEL  309
             MFPWLA+GHI P++ LA+ ++ +    F +HLCST  N NSI + I + S   SI  +E+
Sbjct  1     MFPWLAHGHIFPYLELARRISKKNNNNFHIHLCSTAVNFNSINSFIEKNSLQNSIETVEI  60

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             HL    DLPPHY TT  LP +L+  L K  + A+  F++++ TL PDL+I+D+   WA  
Sbjct  61    HL--HSDLPPHYHTTKNLPTNLNFTLIKAFQTAKSSFSDIVTTLKPDLVIYDIFQPWAAG  118

Query  490   VALSLNIPSVRFFTASAAMCSYFTHMLT--NPGAEYPFPALRLRQYEQTKTRELMNQETR  663
             +A S  IP+V F    AA  ++F    T  + G ++PFPA+ +R +E+ +   + +    
Sbjct  119   IASSRGIPAVHFAALGAAKMTFFHRQATACSDGGDFPFPAIYIRPHEKKRMDGVFD----  174

Query  664   NFKREETLDTPAN---------QAMMLVNSSREVEGKYIDYLSELMKSKVVSIG--TTFQ  810
              F R    D   +           ++L+ + R +EGKY+DY+S     K++ +G   T  
Sbjct  175   -FMRTHVFDDDGDVFFVNYKLSSEVVLLKTGRALEGKYVDYVSTTCGRKLLPVGPLVTDV  233

Query  811   APPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISG--VNFIWVLR  984
                  +  +++  WL++K   STV++SFGSE FL +E++ EIA GLE+    VNFIWV+R
Sbjct  234   CENAEESNSDVMKWLSKKEHHSTVYISFGSECFLSEEEINEIAKGLELCDERVNFIWVVR  293

Query  985   FP-KGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESL  1161
             FP + + I++EEALP GFL+R+ +RG +V  WAPQA IL H STG FVSHCGW+S+ ES+
Sbjct  294   FPVEDKTITIEEALPLGFLDRVKDRGIVVSEWAPQANILAHPSTGAFVSHCGWSSLTESI  353

Query  1162  NLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEK  1338
               GVP+IAMPM L   ++AR++ E GA VEV R+       E++A A+R  +  E+ GE 
Sbjct  354   YYGVPVIAMPMKLAMFVDARMLEEAGACVEVSREGDEAFKGEDVANAIRNVIVEESIGEG  413

Query  1339  LKRNVKRISENLRLAGNREMDAVVAEL  1419
             L+   + +   +R+   + +D V   L
Sbjct  414   LRLRARELGGKMRIEEEQLIDDVAEHL  440



>gb|AFJ53037.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=431

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 185/447 (41%), Positives = 258/447 (58%), Gaps = 36/447 (8%)
 Frame = +1

Query  142   MFPWLAYGHITPFVGLAKNLADRG--FLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             MFPWLA+GHI+PF+ LA  L  R   F V+LCS+  NL S    I   +   + L+ELHL
Sbjct  1     MFPWLAHGHISPFLELANKLVSRSPNFHVYLCSSSINLQSATALI--KHPSHMELIELHL  58

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P  PDLPPH  TT GLP HL   L K L MA  +F+++L  L+PDLLI D    WA K A
Sbjct  59    PSLPDLPPHSHTTKGLPAHLIPTLFKALDMASSEFSQILTELSPDLLICDFFQPWAPKFA  118

Query  496   LSL-NIPSVRFFTASAAMCSYFTHMLTNPG---AEYPFPALRLRQYEQTKTRELMNQETR  663
             LSL  IP+V F T +A   +     + N G     +P  +  +  YE+ ++    ++  +
Sbjct  119   LSLLKIPTVLFMTNAAFSTAVPLTSMKNTGKFDGVFPLRSNYIFDYEEVESPSFKDRVFQ  178

Query  664   NFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET--  837
             + +R        +  ++LV S RE+E +YID +SEL    V+ IG      P  D E   
Sbjct  179   SLER--------SSPILLVKSFREIEAEYIDTVSELFGKSVLPIGPLV---PDDDDENQQ  227

Query  838   ---ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEI-----SGVNFIWVLRFPK  993
                E+ +WL  K  SS V++SFGSE +L +  +EE+A+ L I       +NF+WVLRFP+
Sbjct  228   PDEEIINWLNNKGPSSVVYISFGSESYLSRSQIEELAHALLILIEKAIPINFVWVLRFPR  287

Query  994   GEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             GEE+++ EALP+GF   +G +G M EGWAPQ +IL H S GGFVSHCGW+S+ME +  GV
Sbjct  288   GEEVAISEALPEGFFSAVGGKGYMAEGWAPQRRILRHESVGGFVSHCGWSSVMEGMKYGV  347

Query  1174  PIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNV  1353
             PI+ MP+  DQ  NA L+ E G  ++V     G++ R E+A  + E V   N  ++K  V
Sbjct  348   PIVGMPLQNDQSTNASLVEEAGVGLKV-----GEIERGELAKVIEEVVIRRN--EIKDKV  400

Query  1354  KRISENLRLAGNREMDAVVAELEKLCN  1434
             + I + L   G+ E+D  +  L  LC 
Sbjct  401   RGIRDCLLEKGDSEIDEAIDRLVHLCK  427



>gb|AEQ33588.2| putative UDP-glucose:flavonoid glucosyltransferase [Ginkgo biloba]
Length=496

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 270/469 (58%), Gaps = 37/469 (8%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ------SIR  297
             V+MFPWLA+GHI+PF+ L+  LA RG  V  CSTP N+NSIK  + QS+        SI 
Sbjct  13    VLMFPWLAHGHISPFLELSMRLAGRGITVSFCSTPSNINSIKRTL-QSHDDGETALNSIN  71

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+EL LP    L P ++TT  LP HL   LKK     E  F  LL+ L+PD +IHD +  
Sbjct  72    LVELPLPLVDGLGPSHETTASLPPHLMPLLKKAFDSLETSFGMLLQRLSPDCVIHDFLQP  131

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE----------YPFPA---LRLRQ  618
             W   VA    IPS+ F   SA + +YF   +    +E            FP+   +RL Q
Sbjct  132   WTSPVASKFGIPSLTFVPCSAVVVAYFLCAVKGKDSEQVTVEDLINPLDFPSSSTVRLHQ  191

Query  619   YEQTKTRELM--NQETRNFKREETLDTPANQ-AMMLVNSSREVEGKYIDYLSELMKSKVV  789
             +E  +T  +   N+ET      E L   AN+ + + V +  E+EGK++  L  L    VV
Sbjct  192   FEALQTLNMYKRNRET-GISDCERLQGCANKCSAIAVKTFPEIEGKFLRLLESLTGKHVV  250

Query  790   SIGTTFQAPP---PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISG  960
             ++G      P     + +++   WL R+  SS VFVSFG+EYFL K+ +EEIA GLE S 
Sbjct  251   ALGPLLTKQPSSNASEQDSKCLAWLDRQKRSSVVFVSFGTEYFLSKDQIEEIALGLEASE  310

Query  961   VNFIWVLRFPKGEEISVEE-------ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGG  1119
              +F+WVLRFP+G E +V +       +L  GF ER+  +G +V GWAPQ KIL H STGG
Sbjct  311   QSFMWVLRFPQGPEGNVNDQQRRVSASLSAGFEERMKVKGIVVSGWAPQMKILRHPSTGG  370

Query  1120  FVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMA  1296
             F++HCGW+S+ME ++ G+P+IA+PM LDQP+NARL+  ++  A+EV +   G+L R E+ 
Sbjct  371   FMTHCGWSSVMEGMSAGLPLIALPMQLDQPLNARLVAGDLKVAIEVRKGSDGRLDRNEIE  430

Query  1297  AALRETVGGENGEKLKRNVKRISENLRLAGNRE--MDAVVAELEKLCNK  1437
              ALR  +  E G +L+ N K + E +      E  +D +V E+E L  K
Sbjct  431   RALRIAMVEEEGLQLRMNAKHMGEIMMAKSEEERGLDLLVEEIETLVGK  479



>gb|EYU43902.1| hypothetical protein MIMGU_mgv1a020418mg [Erythranthe guttata]
Length=464

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 199/447 (45%), Positives = 275/447 (62%), Gaps = 15/447 (3%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLAD-RGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLEL  309
             +++MFPWLA+GHI PF+ LAK L+  R F ++LCSTP NL+SIK NI ++   SI L++L
Sbjct  10    TILMFPWLAHGHINPFLELAKRLSKTRNFNINLCSTPVNLDSIKTNI-ENDDGSITLVKL  68

Query  310   HLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEK  489
             H+P SP LPP   TT  LP  L   L    + +   F++++ ++ PDLLI+D    WA K
Sbjct  69    HMPSSPQLPPQLHTTKNLPSDLLPTLMHAFQDSSSSFSDIMDSVEPDLLIYDFFQPWAPK  128

Query  490   VALSLNIPSVRFFTASAAMCSYFTHML-TNPGAEYPFPALRLRQYEQTKTRELMN---QE  657
             +A S  IP V F T+ AA CSY+ H+  T  G+ +P+ AL +   E  K R  +    ++
Sbjct  129   LASSKGIPCVYFSTSGAAPCSYYHHIYSTGTGSTFPYKALCIPDEEIVKLRNKIAPNIKD  188

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIG---TTFQAPPPVD  828
               N K     +   +  ++LV S RE+E KYIDYLS L K K+V  G       +    D
Sbjct  189   ANNNKDFAFGNFSMSSEIVLVKSCREIEEKYIDYLSFLCKKKIVPTGPLHACNNSECNDD  248

Query  829   HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG-EEI  1005
              + E+  WL  K   ST+++SFGSE FL KE + EIA GL++  V+FIWV+R P G +E 
Sbjct  249   DDDEIMKWLGGKSRGSTIYISFGSEIFLSKEQIAEIAKGLQLCCVSFIWVVRSPVGAKET  308

Query  1006  SVEEA--LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPI  1179
             S+E+    P GFLE   ERG +V  WAPQ KIL H S GGFVSHCGW+S+MESL  GVPI
Sbjct  309   SIEDEGEWPVGFLETAKERGILVNKWAPQGKILRHPSIGGFVSHCGWSSVMESLYYGVPI  368

Query  1180  IAMPMHLDQPMNARLMVEIGAAVEVER--DEKGKLHREEMAAALRETVG-GENGEKLKRN  1350
             IAMPM  +QP+NA+L+VE G  VEV++   E G     EMA A+ + +  G+ G+ L+  
Sbjct  369   IAMPMRAEQPINAQLVVEGGVGVEVDKGGGENGDYVGIEMAKAVNKVISEGDIGDGLRER  428

Query  1351  VKRISENLRLAGNREMDAVVAELEKLC  1431
              KR+ E ++   + EM+ V  EL ++C
Sbjct  429   AKRMGEKMKEKEDEEMNVVAEELLRIC  455



>gb|EPS71672.1| hypothetical protein M569_03087 [Genlisea aurea]
Length=465

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 180/452 (40%), Positives = 270/452 (60%), Gaps = 16/452 (4%)
 Frame = +1

Query  115   TMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSI  294
              MA    ++ FPWLA+GH++PF  LAK L  + F  ++CS+P NL+SI+  +P   S ++
Sbjct  16    VMAKELKILFFPWLAHGHLSPFFELAKRLTKKNFKAYICSSPVNLSSIR--LPPD-SSAV  72

Query  295   RLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVN  474
               + LH+PESP+LP    +T  LP H    L    +  +  F  +L +L PDL+I+D+  
Sbjct  73    EFVPLHMPESPELPAELHSTRNLPNHRVIELIACFQSCDEIFAGILASLKPDLVIYDLFQ  132

Query  475   LWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFP-ALRLRQYEQTKTRELM  648
              WA ++A+ + IP+V F   +A   SY+ H+  +   E YPF  A+ L +YE+ +  +L 
Sbjct  133   PWAPRIAIGMGIPAVFFSMYNATFYSYYHHLYNHGTPETYPFSDAISLDEYERFRLGDLF  192

Query  649   NQETRNFKREETL-DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP--  819
                 ++ + E    +   +  ++LV    ++E KYI+YLS++   +++  G  F      
Sbjct  193   VH-LKDAEHEFVFGNFNLSTEVVLVKGFGKMEEKYINYLSQMNGKRILRTGPLFAGSSIG  251

Query  820   --PVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPK  993
                 +  +E+  WL+ KP SSTV++SFGSE FL  + +++I  GLEIS VNFIWV+RF  
Sbjct  252   GVHSEKSSEILKWLSGKPESSTVYISFGSESFLSAKQMQQIGVGLEISPVNFIWVIRFSH  311

Query  994   GEEIS-VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLG  1170
              E+   VEE LP+GFL+R  E+G ++  WAPQ  ILGHRS GGFVSH GW+S  ESL  G
Sbjct  312   LEKARPVEEVLPEGFLDRNKEKGLIITEWAPQQAILGHRSVGGFVSHAGWSSTTESLLCG  371

Query  1171  VPIIAMPMHLDQPMNARLMVEIGAAVEVE---RDEKGKLHREEMAAALRETVGGENGEKL  1341
             VPI+AMP+  DQP+NARL+ E G AVEVE   +D  G    E +A AL++ V  E G+ +
Sbjct  372   VPIVAMPLGSDQPINARLLAEAGVAVEVEKSVKDYSGIYMGEAIAEALKKLV-AEEGKIM  430

Query  1342  KRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
             K+    + E ++ +   ++D V  EL  +C K
Sbjct  431   KKRAAALREEMKESEEHDIDIVAHELRNICTK  462



>gb|EPS70316.1| hypothetical protein M569_04443, partial [Genlisea aurea]
Length=434

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 181/440 (41%), Positives = 265/440 (60%), Gaps = 14/440 (3%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+ FPWLA+GH++PF  LAK L+ + F  ++CSTP NL SI+   P S   ++ L+ELH+
Sbjct  1     VLFFPWLAHGHLSPFYELAKRLSKKNFKTYVCSTPINLMSIQA-APDS---AVELIELHM  56

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P S  LPP + T+   P ++  AL +  ++ + +F ++L ++ PDLLI+D++  W+ K A
Sbjct  57    PPSLKLPPEFHTSRNAPPNIGHALMQEFQLCKSNFLDILTSIKPDLLIYDLLQPWSAKQA  116

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRELMN--QETRN  666
             LS++IPSV F T+  A  SY+ H+  N  AE YPF A+ L  +E+ + R   N  ++  +
Sbjct  117   LSMSIPSVFFGTSCTANYSYYHHLDNNGFAEKYPFKAIYLHDHEKIELRGYNNFIEDVGD  176

Query  667   FKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD---HET  837
                  + +   +  ++LV S  + E KY  +LS L K K+V  G        +D      
Sbjct  177   GFLFGSFNL--STEIILVKSYGKFEAKYGCHLSALSKKKLVLTGPLIAESVDLDGTKKSN  234

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVE  1014
             E+ +WL  +   S V+VSFGSEY   K+ + EI+  LE+S V F+WV+RF  GE EIS++
Sbjct  235   EIMNWLNDQRKFSIVYVSFGSEYSPSKQQIYEISKALELSRVMFLWVIRFGIGEKEISLK  294

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             E LPKGFL+R  + G +V  W PQ +IL H S G F+SHCGW+S+ ESL  GVPII MP 
Sbjct  295   EVLPKGFLDRTKDNGIIVNEWVPQKRILAHPSIGAFISHCGWSSVTESLYFGVPIIGMPF  354

Query  1195  HLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEKLKRNVKRISEN  1371
             H DQP+NARL+VE+GAA+EVER   G      +A  + E V  E   + +K+ V  +S  
Sbjct  355   HTDQPINARLLVEVGAALEVERKPNGIYMGTAIAETITEVVFNETVYQVMKKRVVDLSNE  414

Query  1372  LRLAGNREMDAVVAELEKLC  1431
             +R      ++ V  EL K+C
Sbjct  415   IRANEEEALNGVGEELRKIC  434



>ref|XP_008363249.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Malus domestica]
Length=354

 Score =   318 bits (814),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 217/334 (65%), Gaps = 17/334 (5%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELH  312
             SVVM PWLA+GHI+PF  LAK L+DR F +  CSTP  LNS+K  +P+ YS  I  +ELH
Sbjct  11    SVVMLPWLAHGHISPFXELAKKLSDRNFHIFFCSTPVILNSVKPKLPERYSHCIEFVELH  70

Query  313   LPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAE  486
             LP    P+L PHY TTNGLP HL   LKK L+MA P F+ +LKTLNPD LI+D V  WA 
Sbjct  71    LPHDVFPELAPHYHTTNGLPPHLMPTLKKALQMASPYFSNILKTLNPDFLIYDFVVPWAL  130

Query  487   KVALSLNIPSVRFFTASAAMCSYFTH-MLTNPGAEYPFPALRLRQYEQTKTRELMNQETR  663
              + L  NIP+++FF  SA   S+  H +   P   +PFPA+ LR YE +K   +M   + 
Sbjct  131   SLGLDQNIPTIQFFIFSAVSVSFLFHRLFKGPSVRFPFPAIYLRDYEISKFNSMMPPASS  190

Query  664   NFKREETLDTPA--------NQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPP  819
             N  R++    P         +  ++L+ + RE+EGKY+DYL ELM  KVV +      P 
Sbjct  191   NDNRKDDGVPPLQFXITIGHSCDLILLKTFREIEGKYVDYLYELMDXKVVRLXPLLHXPT  250

Query  820   P----VDHETE-LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
                   D ET+ +  WL ++  SS V++SFGSEYFL KE++EEIA+GL +S V+FIWV+R
Sbjct  251   KDQEDKDEETDHVIKWLNQRETSSVVYISFGSEYFLSKEEIEEIAHGLXLSKVSFIWVVR  310

Query  985   FPKGEEIS-VEEALPKGFLERIGERGRMVEGWAP  1083
             FPK  +++  +E LPKGF+ER+GERG +VEGWAP
Sbjct  311   FPKEXKVTRAKEVLPKGFVERVGERGMIVEGWAP  344



>gb|EPS71334.1| glycosyltransferase, partial [Genlisea aurea]
Length=439

 Score =   320 bits (821),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 178/438 (41%), Positives = 259/438 (59%), Gaps = 10/438 (2%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+ FPWLA+GH++PF  LAK L+ + F  ++CST  N+ SI+   P S   ++  +ELH+
Sbjct  6     VLFFPWLAHGHVSPFFELAKRLSKKNFKTYICSTRVNMESIQAT-PDS---AVDFVELHM  61

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P SP+ PP  QTT     +L  AL K L + +  F E+L ++ PDLLI+D + LW+ K A
Sbjct  62    PPSPEFPPELQTTRNANGYLVQALMKKLHLCKSIFFEILTSIKPDLLIYDFLQLWSAKQA  121

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRELMNQETRNFK  672
             LS++IPSV F  +S A  SY+ H+ TN   E YP  A+ L  +E+   +   N       
Sbjct  122   LSMDIPSVYFAPSSTAYHSYYHHLYTNGSTEKYPLEAIYLHDHERFDLKHFKNLIEDIGD  181

Query  673   REETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD---HETEL  843
                  D   +  +MLV S  +VE KY+ +LS L K+K+V  G        ++      E+
Sbjct  182   GFTFDDFNLSTKIMLVKSYGQVEAKYVSHLSNLSKTKIVLTGPLIAESANLNGAEKSNEI  241

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVEEA  1020
              +WL  +   S V++SFGSE+ L KE + EI+ GLE+S V F+WV+RF  G+ E  +EE 
Sbjct  242   MNWLNDQQKLSIVYISFGSEHVLSKEQIYEISKGLELSRVRFLWVIRFAVGKKETFLEEI  301

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP+GFL+R  + G +V  WAPQ KIL H S   F+SHCGW+S+ E L  GVPIIAMP+H+
Sbjct  302   LPEGFLDRTKDDGIIVTEWAPQKKILAHPSIRAFISHCGWSSVTEGLYFGVPIIAMPIHV  361

Query  1201  DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGE-NGEKLKRNVKRISENLR  1377
             DQP+NARL+V++GA +EV+R          +A  + + +  E   +K+K+     S  +R
Sbjct  362   DQPINARLLVDVGAGIEVDRKPNEIFMGIAIAKTITKVICNEFVYQKMKKRTVHWSNEIR  421

Query  1378  LAGNREMDAVVAELEKLC  1431
                  E++ V  EL K+C
Sbjct  422   ENEEEELNGVAEELRKIC  439



>gb|AHK12771.1| flavanone-O-beta-L-rhamnosyltransferase-like protein 2 [Litchi 
chinensis]
Length=466

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 199/458 (43%), Positives = 278/458 (61%), Gaps = 37/458 (8%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY-----SQSIR  297
             SVVM P LA+GH++PF  LAK L+DRGF ++ CSTP  L  I+NN    +     S +I+
Sbjct  10    SVVMLPHLAHGHVSPFFELAKRLSDRGFQIYFCSTPICLEPIRNNHLDDHHNKHSSSNIQ  69

Query  298   LLELHLPES--PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             L++L LP S   DLPPHY  T  +P HL   L   L   +P F+++LK L PDL+++D+ 
Sbjct  70    LIDLQLPSSFHQDLPPHYHCTKNIPPHLMTTLLAALDATKPAFSDILKKLRPDLVVYDLF  129

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMN  651
               WA + A  LNI +V F T  A+          N   E P      ++Y +   +  +N
Sbjct  130   EPWAAEAARELNIDAVLFLTNIASQ---------NVRIETPKETEMSKEYIEYTIKNTVN  180

Query  652   --QETRNFKREETLDTPANQAMMLVNSSREVEGKYID-----YLSELMKSKVVSIGTTFQ  810
                 T+ F R  T     +  M+LV +SRE++ KY       +L+ L    +V +G   Q
Sbjct  181   GITPTQRFNRSVT----GSSHMILVKTSREIQAKYYKDGKQPHLAIL--RPLVHVGPLVQ  234

Query  811   APPPVDH---ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVL  981
              P   DH   + +L DWL++K A+S V+VS GSE FL +E++EE+A GLE+S V+FIWV+
Sbjct  235   KPQ--DHHDGDEKLMDWLSKKEAASVVYVSIGSENFLSEEEMEEMAKGLELSNVDFIWVV  292

Query  982   RFPKGEEI-SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMES  1158
             RF  G  + S+ EALP+ FLERI  RG +V+ WAPQAK+L H STGGFVSHCGWNS +ES
Sbjct  293   RFHGGSNVASIHEALPQSFLERINGRGLIVD-WAPQAKVLAHASTGGFVSHCGWNSTLES  351

Query  1159  LNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEK  1338
             +  GVPIIA+P+ LDQP+NA+L+VE+G  VEV R +K KL REE+A  +R  +  E G +
Sbjct  352   MMYGVPIIAIPIQLDQPLNAKLVVEMGVGVEVPRHDK-KLVREEVANMVRRVMIEEEGNE  410

Query  1339  LKRNVKRISENLRLAGNREMDAVVAELEKLCNKPERIA  1452
             +++  K +S  L  A + E D  V +L  L  +P  I+
Sbjct  411   VRKRAKELSVRLNEAEDEEFDEAVMKLVHLVQEPRNIS  448



>gb|EPS60299.1| hypothetical protein M569_14508, partial [Genlisea aurea]
Length=362

 Score =   314 bits (805),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 239/369 (65%), Gaps = 13/369 (4%)
 Frame = +1

Query  139   VMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLP  318
             +MFPWLA+GH+ PFV LAK L+ R F +++CS+P NL S ++ +P+S +  I L+EL +P
Sbjct  1     LMFPWLAHGHMYPFVELAKRLSRRDFRIYICSSPVNLTSFRS-LPES-NAGIELIELKIP  58

Query  319   ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVAL  498
              S +LPP   TT  LP HL   L ++ + ++  F+E+L  L PDLLI+D    WA K+A 
Sbjct  59    -SDELPPELHTTKNLPSHLVPTLMRIFQDSDSSFSEILSDLKPDLLIYDGFQPWAAKLAS  117

Query  499   SLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQ--TKTRELMNQETRNF  669
                IP+V F  A ++  +YF H+ T+  +  YPFPA+ +       TK   +   E    
Sbjct  118   EKGIPAVFFSIAGSSSITYFHHLYTHGDSTGYPFPAIFMPSSAAITTKLPPIKGAEEGFL  177

Query  670   KREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH--ETEL  843
                  + T     ++LVNS RE+E KY+DYLS L+K KVV  G    A    D   ++++
Sbjct  178   FGVYNIST----DIVLVNSYRELEAKYLDYLSVLIKKKVVPTGPLISATNVDDDNIQSDV  233

Query  844   TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVEEA  1020
              +WL +KP  ST++VSFGSEY L K+ L E+A GLE++GVNFIWVLRF   E E S EEA
Sbjct  234   MEWLQQKPQFSTLYVSFGSEYILPKDQLHELAQGLELAGVNFIWVLRFSSLEKEKSPEEA  293

Query  1021  LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHL  1200
             LP+GF+ R  +RG ++  WAPQ++IL HRS GGFVSHCGWNS+ E +  GVPIIAMPM  
Sbjct  294   LPEGFIGRTKDRGWIITDWAPQSRILAHRSVGGFVSHCGWNSLTEGVYFGVPIIAMPMSY  353

Query  1201  DQPMNARLM  1227
             +QP++A+++
Sbjct  354   EQPLSAKML  362



>ref|XP_008670653.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Zea mays]
 tpg|DAA41728.1| TPA: hypothetical protein ZEAMMB73_462265 [Zea mays]
Length=470

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 184/461 (40%), Positives = 264/461 (57%), Gaps = 35/461 (8%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-----ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             SVVMFPWLA+GHITP++ LA+ L      D    VHL STP NL++I        +  IR
Sbjct  10    SVVMFPWLAHGHITPYLELARRLTSEDGGDVDVTVHLVSTPVNLSAIARQ----QTPRIR  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
              +ELHLP + DLPP   TT  LP  L  ALK+   +A P F  LL  L PDLL+ D +  
Sbjct  66    FVELHLPAALDLPPALHTTKHLPARLMPALKRACDLAAPRFGALLDELRPDLLLFDFLYP  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHML--TNPGAEYPFPALRLRQYEQ-TKTRELM  648
             WA   A S  +P+V   T SAA  S+  H       G  +PF  + L   E+  K   L+
Sbjct  126   WAPLEAASRGVPAVHLSTCSAAATSFMVHWFGSARAGRAFPFQGVGLGGAEEEAKYTSLL  185

Query  649   NQETRNF---KREETLDTPA-NQAMMLVNSSREVEGKYIDYLSELMKSK-VVSIGTTF--  807
              +E  +    +R+  L + A +   + + +  ++E  Y+ YLSEL+  K +V IG     
Sbjct  186   LREHPDGLVPERDRLLLSLARSSGFVAIKTCADIERPYMGYLSELLGGKEMVPIGPLLVD  245

Query  808   --------QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
                      +P P      +T WL  +P +S V VSFGSEYF+ ++ L  +A GLE+SG 
Sbjct  246   GSDTGGGTTSPDP----DRVTRWLDLQPPASVVLVSFGSEYFMSEQQLARMARGLELSGE  301

Query  964   NFIWVLRFPKGEE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGW  1140
              F+WV+RFPKG+E  +   ALP+GF    G RG +VEGWAPQ ++L H + G F+SHCGW
Sbjct  302   RFVWVVRFPKGDEGDAAARALPRGFAPAPG-RGLVVEGWAPQRRVLEHPACGAFLSHCGW  360

Query  1141  NSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVG  1320
             +S++ESL  GVPI+A+P+H+DQP++A L  E+GAAV V ++  G+   E++A  +R  + 
Sbjct  361   SSVLESLAAGVPIVALPLHIDQPLDANLAAELGAAVRVPQERFGEFRAEDVARTVRRAMR  420

Query  1321  GENGEKLKRNVKRISENLRL--AGNREMDAVVAELEKLCNK  1437
             GE    L+R+   + E +    A + ++ A+V  + +LC K
Sbjct  421   GEESRALRRHAAELREVVARNDADDAQVAALVQRMARLCGK  461



>ref|XP_006367824.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Solanum tuberosum]
Length=440

 Score =   310 bits (794),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/284 (54%), Positives = 204/284 (72%), Gaps = 10/284 (4%)
 Frame = +1

Query  583   AEYPFPALRLRQYEQTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYL  762
             A +PFPA+ L + EQ K         ++F  E+ L    N  +ML+++SR +E KYID+ 
Sbjct  159   AVFPFPAINLSKIEQEKMY------AKDF--EDRL-VDGNIQIMLISTSRTIEAKYIDHC  209

Query  763   SELMKSKVVSIGTTFQAPPPVDHET-ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIA  939
             +EL+  KVV +G   Q P   D +  EL DWL  K  +STVFVSFGSEYFL KED+EE+A
Sbjct  210   TELINWKVVPVGPPVQDPITNDVDNKELMDWLETKDVNSTVFVSFGSEYFLSKEDMEEVA  269

Query  940   YGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGG  1119
             +GLE+S VNFIWV RFPKGE+ ++E+ALPKGFLERIGERGR+++ +APQ +IL H STGG
Sbjct  270   FGLELSNVNFIWVARFPKGEDQNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPSTGG  329

Query  1120  FVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAA  1299
             F+SHCGWNS+MES++ GVPIIAMP+  DQP NARL+VE+G AVE+ RD+ GK+HR E+A 
Sbjct  330   FISHCGWNSVMESVDFGVPIIAMPIQYDQPSNARLIVELGVAVEIVRDDDGKIHRGEIAE  389

Query  1300  ALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
              L++ + G+ GE L+  V+ IS+NL+     EMD     L +LC
Sbjct  390   TLKDVITGKTGENLRGKVRDISKNLKSIRGEEMDTAAEVLIQLC  433



>ref|XP_009623061.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=357

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/361 (46%), Positives = 219/361 (61%), Gaps = 26/361 (7%)
 Frame = +1

Query  118   MATRRS---VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQ  288
             M TR+    +VM PWLA+GHI PF+ LAK L+ R F+ +L +TP NL   K  +    S 
Sbjct  1     METRKKNIRIVMLPWLAHGHICPFLELAKALSKRNFITYLFTTPVNLTFFKQRLSPIDSI  60

Query  289   SIRLLELHLPESPDLPPHYQTTNGLPLHL-HDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
              I+L+E+ LP  P LPPHY TTNGLP HL  + LKK   M++PD   +L TL PDL+I+D
Sbjct  61    RIKLMEIQLPNLPQLPPHYHTTNGLPPHLIMNTLKKAFLMSKPDIFTILDTLKPDLIIYD  120

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN-PGAEYPFPALRLRQYEQTKTRE  642
              +      +  +LNIP+V F T  AA  SY  H   N P  +YPF  +  R YE  K ++
Sbjct  121   FLQPCIPTMVATLNIPAVLFLTPGAASNSYHYHRRNNNPSLDYPFREIFFRDYEHRKNKK  180

Query  643   LM-----------NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVV  789
             +            N  TR F+R        +  ++L+ + +E+EGKYIDYLS L K K V
Sbjct  181   IFDSLENDGIDEKNGVTRCFER--------SHDIVLIKTFKELEGKYIDYLSILFKKKFV  232

Query  790   SIGTTFQAPPPVDHE--TELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
              +G   +     D E   E+ +WL  K   ST+FVSFGSE FL  E++EE+A GLE+S V
Sbjct  233   LVGPLVREIDREDGEKHCEIIEWLNEKEKCSTIFVSFGSECFLSNEEVEELALGLELSMV  292

Query  964   NFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWN  1143
             NFIWV+RFP GE+ ++ E LPK + ER+  RG ++EGWAPQ +IL H S GGFVSHCGW+
Sbjct  293   NFIWVVRFPMGEKKNILEVLPKWYFERVENRGIVIEGWAPQERILEHSSIGGFVSHCGWS  352

Query  1144  S  1146
              
Sbjct  353   C  353



>dbj|BAK08326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   305 bits (782),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 174/464 (38%), Positives = 265/464 (57%), Gaps = 30/464 (6%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRG-------FLVHLCSTPDNLNSIKNNIPQSYS  285
             R  VVMFPWLA+GHI P++ LAK L            +VHL STP NL  + ++     +
Sbjct  8     RMRVVMFPWLAHGHINPYLELAKRLIASASGDHHLDVVVHLVSTPANLAPLAHH----QT  63

Query  286   QSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHD  465
               +RL+ELHLP  PDLPP   TT GLP  L   LK+   +A P F  LL  L PD+L++D
Sbjct  64    DRLRLVELHLPSLPDLPPALHTTKGLPARLMPVLKRACDLAAPRFGALLDELCPDILVYD  123

Query  466   VVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN--PGAEYPFPALRLRQY-EQTKT  636
              +  WA   A +  +P+  F T  AA  ++F H L    P + +PF ++ L    E  K 
Sbjct  124   FIQPWAPLEAEARGVPAFHFATCGAAATAFFIHCLKTDRPPSAFPFESISLGGVDEDAKY  183

Query  637   RELMN--QETRNFKREET---LDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
               L+   +++     E     L    +   + V SS ++E KY++YLS+L+  +++  G 
Sbjct  184   TALVTVREDSTALVAERDRLPLSLERSSGFVAVKSSADIERKYMEYLSQLLGKEIIPTGP  243

Query  802   TFQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
                     + + +   +  WL  +   S VFVSFGSEYF+ +  + ++A GLE+SGV F+
Sbjct  244   LLVDSGGSEEQRDGGRIMRWLDGEEPGSVVFVSFGSEYFMSEHQMAQMARGLELSGVPFL  303

Query  973   WVLRFPKGEEIS--VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNS  1146
             WV+RFP  E+ +     ++P GF     E G +VEGWAPQ +IL H S G F++HCGW+S
Sbjct  304   WVVRFPNAEDDARGAARSMPPGFEP---ELGLVVEGWAPQRRILSHPSCGAFLTHCGWSS  360

Query  1147  IMESLNLGVPIIAMPMHLDQPMNARLMVEIG-AAVEVERDEKGKLHREEMAAALRETVGG  1323
             ++ES+  GVP++A+P+H+DQP+NA L VE+G AA  V+++  G+   EE+A A+R  V G
Sbjct  361   VLESMAAGVPMVALPLHIDQPLNANLAVELGAAAARVKQERFGEFTAEEVARAVRAAVKG  420

Query  1324  ENGEKLKRNVKRISENL-RLAGNR-EMDAVVAELEKLCNKPERI  1449
             + GE  +R  + + E + R  GN  ++  ++  + +LC K + +
Sbjct  421   KEGEAARRRARELQEVVARNNGNDGQIATLLQRMARLCGKDQAV  464



>ref|XP_004958654.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Setaria italica]
Length=471

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 263/469 (56%), Gaps = 39/469 (8%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNLA--DRG---FLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             SVVMFPWLA+GHI P++ LA+ L   DR     +V+L STP NL +I +      +  IR
Sbjct  10    SVVMFPWLAHGHINPYLELARRLTSTDRDGVDVVVYLVSTPVNLAAIAHR----QTDRIR  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLP  PDLPP   TT  LP  L  ALK+   +A P F  LL  L PD L++D +  
Sbjct  66    LVELHLPSLPDLPPALHTTKHLPARLMPALKRACDLAAPRFGALLDDLRPDALLYDFLQP  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN----PGAEYPFPALRLRQY-EQTKTRE  642
             WA   A +  +P+  F T SAA  ++F H L +    P A +PF ++ L    E+ K  E
Sbjct  126   WAPLEAAARGVPAAHFSTCSAAATAFFVHCLGSADRAPRA-FPFQSVGLGTADEEAKYTE  184

Query  643   L--MNQETRNFKREET---LDTPANQAMMLVNSSREVEGKYIDYLSELMKSK-VVSIGTT  804
             L  + ++      E     L    +   + V +  ++E KY+DYLSEL+  K ++  G  
Sbjct  185   LFALREDPAALVSERDRLLLSLARSSGFVAVKTCADIERKYMDYLSELLGGKEIIPCGPL  244

Query  805   FQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIW  975
                        E   +  WL  +   S V  SFGSEYF+ +  + ++A GLE+SG  F+W
Sbjct  245   LVDSGGGGGAAESDRVMRWLDGQEPGSVVLASFGSEYFMSEHQIAQMARGLEMSGERFLW  304

Query  976   VLRFPK----GEEI--SVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCG  1137
             V+RFP+    GEE       ALP+GF      RG +VEGWAPQ +IL H + G F++HCG
Sbjct  305   VVRFPESAGGGEEDHGGAARALPRGFAP---SRGLVVEGWAPQRRILSHGACGAFLTHCG  361

Query  1138  WNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV  1317
             W+S++ESL  GVP++A+P+H+DQP+ A L  E+GAA  V ++  G+   E++A A+R  +
Sbjct  362   WSSLLESLAAGVPVVALPLHIDQPLGANLAAELGAAARVRQERFGEFRGEDVACAVRGVL  421

Query  1318  GGENGEKLKRNVKRISENLRLAGNREMDAVVAEL----EKLCNKPERIA  1452
              GE G+ L+R    + E   +A N   DA V EL     +LC K +R+A
Sbjct  422   RGEEGKALRRRAGELREV--VARNDADDAQVGELVRRMARLCGKGQRVA  468



>ref|NP_001147268.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
 gb|ACG26485.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=480

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 181/467 (39%), Positives = 257/467 (55%), Gaps = 37/467 (8%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-----ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             SVVMFPWLA+GH+TP++ LA+ L     AD    VHL STP NL++I  +     +  IR
Sbjct  10    SVVMFPWLAHGHVTPYLKLARRLTSANDADIDVTVHLVSTPVNLSAIARH----QTPRIR  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
               ELHLP +PDLPP   TT  LP  L  ALK+   +A P F  LL  + PDLL+ D +  
Sbjct  66    FAELHLPAAPDLPPELHTTKHLPARLMPALKRACDLAAPRFGALLDEIRPDLLLFDFLYP  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHML---TNPGAEYPFPALRLRQYE-------Q  627
             WA   A +  +P+    T SAA  S+  H L      G  +PF  +     E       Q
Sbjct  126   WAPLEAAARGVPAAHLSTFSAAATSFVVHCLGRGRREGCAFPFRGVGFGSAEEEAKYMAQ  185

Query  628   TKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELM--KSKVVSIGT  801
                RE +       +    L    + A + V +  +VE  Y+DYLSEL+    ++V +G 
Sbjct  186   YILREELPDALVPERNRLLLSLARSSAFVAVKTCADVERPYMDYLSELVGGNKEMVPVGP  245

Query  802   TF--------QAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGL  948
                        A      E+E   +  WL  +  +S V V FGSEYF+ ++ L  +A GL
Sbjct  246   LLVDADAAAAAAGGGTSSESESDRVMRWLDAQTPASVVLVCFGSEYFMSEQQLARMARGL  305

Query  949   EISGVNFIWVLRFPKGEEISVE--EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGF  1122
             E+SG  F+WV+RFP+  E   E   ALP+GF    G RG +VEGWAPQ +IL H + G F
Sbjct  306   ELSGERFVWVVRFPRETEEGDEAARALPRGFAPAPG-RGLVVEGWAPQRRILAHPACGAF  364

Query  1123  VSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAA  1302
             +SHCGW+S++ESL  GVPI+A+P+H+DQP++A L  E+GAAV V+++  G+   E++A A
Sbjct  365   LSHCGWSSVLESLAAGVPIVALPLHIDQPLDANLATELGAAVRVQQERFGEFRAEDVARA  424

Query  1303  LRETVGGENGEKLKRNVKRISENLRL--AGNREMDAVVAELEKLCNK  1437
             +R  + GE    L+R    + E +    A + ++ A+V  + +LC K
Sbjct  425   VRRAMRGEESHALRRRAAELREVVARNDADDAQVAALVQRMARLCGK  471



>tpg|DAA64088.1| TPA: anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=480

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 181/467 (39%), Positives = 257/467 (55%), Gaps = 37/467 (8%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL-----ADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             SVVMFPWLA+GH+TP++ LA+ L     AD    VHL STP NL++I  +     +  IR
Sbjct  10    SVVMFPWLAHGHVTPYLELARRLTSANDADIDVTVHLVSTPVNLSAIARH----QTPRIR  65

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
               ELHLP +PDLPP   TT  LP  L  ALK+   +A P F  LL  + PDLL+ D +  
Sbjct  66    FAELHLPAAPDLPPELHTTKHLPARLMPALKRACDLAAPRFGALLDEIRPDLLLFDFLYP  125

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHML---TNPGAEYPFPALRLRQYE-------Q  627
             WA   A +  +P+    T SAA  S+  H L      G  +PF  +     E       Q
Sbjct  126   WAPLEAAARGVPAAHLSTFSAAATSFVVHCLGRGRREGCAFPFRGVGFGSAEEEAKYMAQ  185

Query  628   TKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELM--KSKVVSIGT  801
                RE +       +    L    + A + V +  +VE  Y+DYLSEL+    ++V +G 
Sbjct  186   YILREELPDALVPERNRLLLSLARSSAFVAVKTCADVERPYMDYLSELVGGNKEMVPVGP  245

Query  802   TF--------QAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGL  948
                        A      E+E   +  WL  +  +S V V FGSEYF+ ++ L  +A GL
Sbjct  246   LLVDADAAAAAAGGGTSSESESDRVMRWLDAQTPASVVLVCFGSEYFMSEQQLARMARGL  305

Query  949   EISGVNFIWVLRFPKGEEISVE--EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGF  1122
             E+SG  F+WV+RFP+  E   E   ALP+GF    G RG +VEGWAPQ +IL H + G F
Sbjct  306   ELSGERFVWVVRFPRETEEGDEAARALPRGFAPAPG-RGLVVEGWAPQRRILAHPACGAF  364

Query  1123  VSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAA  1302
             +SHCGW+S++ESL  GVPI+A+P+H+DQP++A L  E+GAAV V+++  G+   E++A A
Sbjct  365   LSHCGWSSVLESLAAGVPIVALPLHIDQPLDANLATELGAAVRVQQERFGEFRAEDVARA  424

Query  1303  LRETVGGENGEKLKRNVKRISENLRL--AGNREMDAVVAELEKLCNK  1437
             +R  + GE    L+R    + E +    A + ++ A+V  + +LC K
Sbjct  425   VRRAMRGEESHALRRRAAELREVVARNDADDAQVAALVQRMARLCGK  471



>ref|XP_006424314.1| hypothetical protein CICLE_v10030045mg, partial [Citrus clementina]
 gb|ESR37554.1| hypothetical protein CICLE_v10030045mg, partial [Citrus clementina]
Length=399

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/403 (42%), Positives = 249/403 (62%), Gaps = 18/403 (4%)
 Frame = +1

Query  268   IPQSYSQSIRLLELHLPES-PDL-PPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTL  441
             I +  S SI+L++L LP + P+L  P+  TT  +P HL   L +    A+P F  +L+TL
Sbjct  2     ISRKISTSIQLIDLQLPCTFPELHDPYNHTTKNIPRHLIPTLIEAFDAAKPAFCNVLETL  61

Query  442   NPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQY  621
              P L+I+D+   WA + A   +I +V F T +AA  S+F   L N   ++PFP   L + 
Sbjct  62    KPTLVIYDLFQPWAAEAAYQHDIAAVAFVTIAAASFSFF---LQNSSLKFPFPEFDLPES  118

Query  622   E-----QTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKV  786
             E     Q K R +   E R+ +  + +D      ++LV +SRE+E K + YLS + K + 
Sbjct  119   EIQKMTQFKHRIVNGTENRD-RFLKAIDLSCK--LVLVKTSREIESKDLHYLSYITKKET  175

Query  787   VSIGTTFQAPPPVDH--ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISG  960
             + +G   Q P   D+  +T++ DWL+RK  SS V+VSFGSEYFL KE++ E+A GL +S 
Sbjct  176   IPVGPLVQEPIYTDNNNDTKIMDWLSRKEPSSVVYVSFGSEYFLSKEEMNELASGLLLSE  235

Query  961   VNFIWVLRFPKGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHC  1134
             V+FIWV+RF      ++EEALP+GF E I    +G +V+GWAPQAKILGH S GGF+SHC
Sbjct  236   VSFIWVVRFHSEGNFTIEEALPQGFAEEIQGNNKGMVVQGWAPQAKILGHGSIGGFISHC  295

Query  1135  GWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRE  1311
             GW S +E +  GVPIIA+PM LDQ  NA+++ +IG  +EV RDE   ++ +EE+A   ++
Sbjct  296   GWGSTVEGIMYGVPIIAVPMVLDQLFNAKMVADIGVGLEVPRDEINQRVRKEELARVFKQ  355

Query  1312  TVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
              V  E G+++KR  K +SE+++  G+ E   VV +L +L   P
Sbjct  356   VVEQEEGQQIKRKAKELSESIKKKGDDEEINVVEKLLQLVKVP  398



>gb|EPS71335.1| hypothetical protein M569_03424 [Genlisea aurea]
Length=449

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/450 (39%), Positives = 257/450 (57%), Gaps = 17/450 (4%)
 Frame = +1

Query  121   ATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRL  300
             A    +++FPWLA+GH++PF  LA+ L+ R F  ++CSTP NL SI+  +P     S++L
Sbjct  4     AKEYRILLFPWLAHGHVSPFFQLAERLSKRNFKTYVCSTPVNLASIR--LPAD--SSVQL  59

Query  301   LELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLW  480
             +EL +  S +LPP   TT  LP HL   L +  +   P  +E+L +L PDLL++D +  +
Sbjct  60    VELRMDSSAELPPELHTTRNLPPHLMLNLMQGFQACGPSLSEILISLKPDLLVYDFLQPF  119

Query  481   AEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQ---YEQTKTRELM  648
             A K+A ++ IPSV F    AA  SY+  + T+  A  YPF A+ L +   Y+      L+
Sbjct  120   AAKLAAAVGIPSVFFAMMGAAYFSYYHQIYTSGSAGGYPFDAMDLFEDDVYDPRMIDSLL  179

Query  649   NQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD  828
                  N    +      +  ++L+ S   +E KY+++LS+L   ++V  G          
Sbjct  180   EGVVEN--EFQCGSFKLSTEIVLIKSYGNMESKYLNHLSKLSNKRLVLTGPLMAKESHNV  237

Query  829   HETELTD----WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG  996
              + E+TD    WL RK   STV+++FGSE +L  E + EIA GLEIS  NF+WV+RF   
Sbjct  238   ADGEITDEIMNWLDRKTKFSTVYINFGSECYLSAEQIREIANGLEISKANFLWVMRFRDS  297

Query  997   EE-ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGV  1173
             +  IS  EALP+GFLER   RG ++  W PQ +IL H S   F+SHCGW+S+ ESL LGV
Sbjct  298   DGVISPAEALPEGFLERTQGRGMVLAKWVPQVRILVHESVAAFLSHCGWSSVTESLYLGV  357

Query  1174  PIIAMPMHL-DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGEN-GEKLKR  1347
             PI+AMPM L D+ +NA L+VE G  V++ER        E +A  + E +  E    KLK 
Sbjct  358   PIMAMPMQLADRAVNAALVVESGVGVKIERKAGQIYGGEAIAKCINEAICDEAVYRKLKN  417

Query  1348  NVKRISENLRLAGNREMDAVVAELEKLCNK  1437
                 +SE +R     +++ VV EL +LC K
Sbjct  418   RAAELSEEIREKEEGQINGVVEELRELCVK  447



>ref|NP_001060603.1| Os07g0672700 [Oryza sativa Japonica Group]
 dbj|BAC15998.1| putative Flavonol 3-O-glucosyltransferase(UDP-glucose flavonoid 
3-O-glucosyltransferase) [Oryza sativa Japonica Group]
 dbj|BAF22517.1| Os07g0672700 [Oryza sativa Japonica Group]
Length=474

 Score =   299 bits (765),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/466 (37%), Positives = 258/466 (55%), Gaps = 38/466 (8%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRG-----FLVHLCSTPDNLNSIKNNIPQSYSQS  291
             R  V+MFPWLA+GHI P++ LA  L          +VHL STP NL ++ +      +  
Sbjct  8     RLRVLMFPWLAHGHINPYLELATRLTTTSSSQIDVVVHLVSTPVNLAAVAHR----RTDR  63

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+ELHLPE P LPP   TT  LP  L  ALK+   +A P F  LL  L+PD++++D +
Sbjct  64    ISLVELHLPELPGLPPALHTTKHLPPRLMPALKRACDLAAPAFGALLDELSPDVVLYDFI  123

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHML-----TNPGAEYPFPALRLRQYEQTKT  636
               WA   A +  +P+V F T SAA  ++F H L           +PF A+ L   E+   
Sbjct  124   QPWAPLEAAARGVPAVHFSTCSAAATAFFLHFLDGGGGGGGRGAFPFEAISLGGAEEDAR  183

Query  637   RELM---NQETRNFKREETL--DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
               ++   +  T    + E L      +   + V +  E+E KY+DYLS+L+  +++  G 
Sbjct  184   YTMLTCRDDGTALLPKGERLPLSFARSSEFVAVKTCVEIESKYMDYLSKLVGKEIIPCGP  243

Query  802   TFQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
                    V   +E   +  WL  +   S V VSFGSEYF+ ++ L E+A GLE+SG  F+
Sbjct  244   LLVDSGDVSAGSEADGVMRWLDGQEPGSVVLVSFGSEYFMTEKQLAEMARGLELSGAAFV  303

Query  973   WVLRFPK----GEE----ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVS  1128
             WV+RFP+    G+E     +   A+P GF      RG +VEGWAPQ ++L HRS G F++
Sbjct  304   WVVRFPQQSPDGDEDDHGAAAARAMPPGFAP---ARGLVVEGWAPQRRVLSHRSCGAFLT  360

Query  1129  HCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALR  1308
             HCGW+S+MES++ GVP++A+P+H+DQP+ A L  E+G A  V ++  G+   EE+A A+R
Sbjct  361   HCGWSSVMESMSAGVPMVALPLHIDQPVGANLAAELGVAARVRQERFGEFEAEEVARAVR  420

Query  1309  ETVGGENGEKLKRNVKRISENLR---LAGNREMDAVVAELEKLCNK  1437
               + G  GE L+R    + E +       + ++ A++  + +LC K
Sbjct  421   AVMRG--GEALRRRATELREVVARRDAECDEQIGALLHRMARLCGK  464



>gb|EAZ05102.1| hypothetical protein OsI_27293 [Oryza sativa Indica Group]
Length=474

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 172/466 (37%), Positives = 257/466 (55%), Gaps = 38/466 (8%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRG-----FLVHLCSTPDNLNSIKNNIPQSYSQS  291
             R  V+MFPWLA+GHI P++ LA  L          +VHL STP NL ++ +      +  
Sbjct  8     RLRVLMFPWLAHGHINPYLELATRLTTTSSSQIDVVVHLVSTPVNLAAVAHR----RTDR  63

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             I L+ELHLPE P LPP   TT  LP  L  ALK+   +A P F  LL  L+PD++++D +
Sbjct  64    ISLVELHLPELPGLPPALHTTKHLPPRLMPALKRACDLAAPAFGALLDELSPDVVLYDFI  123

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHML-----TNPGAEYPFPALRLRQYEQTKT  636
               WA   A +  +P+V F T SAA  ++F H L           +PF A+ L   E+   
Sbjct  124   QPWAPLEAAARGVPAVHFSTCSAAATAFFLHFLDGGGGGGGRGAFPFEAISLGGAEEDAR  183

Query  637   RELM---NQETRNFKREETL--DTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGT  801
               ++   +  T      E L      +   + V +  E+E KY+DYLS+L+  +++  G 
Sbjct  184   YTMLTCRDDGTALLPEGERLPLSFARSSEFVAVKTCVEIESKYMDYLSKLVGKEIIPCGP  243

Query  802   TFQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFI  972
                    V   +E   +  WL  +   S V VSFGSEYF+ ++ L E+A GLE+SG  F+
Sbjct  244   LLVDSGEVSAGSEADGVMRWLDGQEPGSVVLVSFGSEYFMTEKQLAEMARGLELSGAAFV  303

Query  973   WVLRFPK----GEE----ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVS  1128
             WV+RFP+    G+E     +   A+P GF      RG +VEGWAPQ ++L HRS G F++
Sbjct  304   WVVRFPQQSPDGDEDDHGAAAARAMPPGFAP---ARGLVVEGWAPQRRVLSHRSCGAFLT  360

Query  1129  HCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALR  1308
             HCGW+S+MES++ GVP++A+P+H+DQP+ A L  E+G A  V ++  G+   EE+A A+R
Sbjct  361   HCGWSSVMESMSAGVPMVALPLHIDQPVGANLAAELGVAARVRQERFGEFEAEEVARAVR  420

Query  1309  ETVGGENGEKLKRNVKRISENLR---LAGNREMDAVVAELEKLCNK  1437
               + G  GE L+R    + E +       + ++ A++  + +LC K
Sbjct  421   AVMRG--GEALRRRATELREVVARRDAECDEQIGALLHRMARLCGK  464



>gb|EPS70317.1| hypothetical protein M569_04444, partial [Genlisea aurea]
Length=361

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 231/367 (63%), Gaps = 13/367 (4%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             V+ FPWLA+GH++PF  LAK L+++ F  ++CSTP NL SI+ + P S   +I L+ELH+
Sbjct  1     VLFFPWLAHGHLSPFYELAKRLSEKNFKTYVCSTPINLMSIQAS-PDS---AIELVELHM  56

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P SP+LPP + T+   P +L   L    ++ + +F ++LK++ PDLLI+D +  W+ K A
Sbjct  57    PPSPELPPEFHTSRNAPPNLGQTLMHEFQLCKSNFLDILKSIKPDLLIYDFLQPWSAKQA  116

Query  496   LSLNIPSVRFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRELMN--QETRN  666
              S+ IPSV F T+S A  SY+ H+ +N  A+ YPF  L +  +E+   R   N  ++  +
Sbjct  117   SSMGIPSVFFATSSTACYSYYHHLYSNGFAKKYPFEDLYVHHHEKIVVRGYGNIIEDVGD  176

Query  667   FKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVD---HET  837
                  + +   +  ++LV +  + E KY+ +LS L   K+V  G        +D      
Sbjct  177   GFLFGSFNL--STEIVLVKTYGKFEAKYVSHLSALSNKKLVVTGPLIAESVDLDGIEKSN  234

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGE-EISVE  1014
             E+ +WL  +   S V++SFGSEYF  KE + EI+  LE+S V F+WV+RF  G+ E S++
Sbjct  235   EIMNWLNDQRKFSVVYISFGSEYFPSKEQIYEISKALELSRVKFLWVIRFDAGKKETSLK  294

Query  1015  EALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPM  1194
             + LPKGF++R  + G +V  WAPQ KIL H S G F+SHCGW+S+MESL  GVPIIAMP+
Sbjct  295   DVLPKGFMDRSKDDGMIVTEWAPQKKILSHPSIGAFISHCGWSSVMESLYFGVPIIAMPI  354

Query  1195  HLDQPMN  1215
             H+DQP+N
Sbjct  355   HIDQPIN  361



>emb|CDP19775.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/357 (44%), Positives = 221/357 (62%), Gaps = 14/357 (4%)
 Frame = +1

Query  403   MAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHM----L  570
             MA+ +F  +L TL PDLL++D    WA ++A   +IPSV F        S   H     +
Sbjct  1     MAKTNFQNILNTLKPDLLVYDGFQPWASELAALNHIPSVLFLVVGTVNLSSVYHSRRCRV  60

Query  571   TNPGAEYPFPALRLRQYE----QTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREV  738
             +     YPFPA+  R YE      K +E   +E   F   ++++  ++  ++LV S RE+
Sbjct  61    SGANETYPFPAIFYRDYEIKKILAKLQESKAKEGDEFDVFKSIELSSD--IVLVKSWREM  118

Query  739   EGKYIDYLSELMKSKVVSIG---TTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYF  909
             EGKYID+LS     K++++G            D  + + ++L  K  +S V+VSFGSEYF
Sbjct  119   EGKYIDHLSSSCGKKLIAVGPFSNHEDDSKEADSYSHIIEFLNSKDEASLVYVSFGSEYF  178

Query  910   LRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQA  1089
             L KE+ EEIA GLE+S  NFIWV+RFP G  I +EEALP+ FLER+  RG +V GWAPQA
Sbjct  179   LSKEEREEIAIGLELSNANFIWVVRFPVGHAIGLEEALPERFLERVKGRGTVVNGWAPQA  238

Query  1090  KILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK  1269
             KILGHRSTGGFVSHCGW S++ES+  GVP++A+PMHLDQP++ARL VEIG  +E+ +D  
Sbjct  239   KILGHRSTGGFVSHCGWGSVIESIYYGVPLLALPMHLDQPLHARLAVEIGVGIEIFKDAD  298

Query  1270  GKLHREEMAAALRETVGGENGEKLKRN-VKRISENLRLAGNREMDAVVAELEKLCNK  1437
             G++ RE+ A  + E V  +   +L+R     +S+ LR  G  E+   + +L  LC+K
Sbjct  299   GQIKREDFARVINEVVVKKKEGQLQRQKAMELSKKLREEGEEELHEAIEKLRSLCSK  355



>ref|XP_008344517.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Malus domestica]
Length=311

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 204/308 (66%), Gaps = 5/308 (2%)
 Frame = +1

Query  523   FFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREETLDTPAN  702
              +  +A + S F +   N   ++PFP + LR YE    +  +   +   K  + +   ++
Sbjct  3     LYINAATIISIFANHFKNSSLKFPFPGIHLRDYEIRMFKNQVEFSSNGLKDGDRIQQCSS  62

Query  703   QA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP--PPVDHETELTDWLARKPA  870
              +  ++L  +SRE+E KYIDYLS+L+  K+V +G   Q P     D E+ +  WL ++  
Sbjct  63    SSCNIILAKTSREIEAKYIDYLSDLVGKKIVPVGPLVQDPLDQKTDEESPIIQWLNKREK  122

Query  871   SSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VEEALPKGFLERI  1047
             SS V+VSFGSEYFL KE++EEIA+GLE+S V+FIWV+RFPK ++ + VEE LPKGF+ER 
Sbjct  123   SSVVYVSFGSEYFLSKEEIEEIAHGLELSKVSFIWVIRFPKEDKTTKVEEVLPKGFVERX  182

Query  1048  GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLM  1227
             GERG +VEGWAPQAKIL H S GGFVSHCGW+S++ES+  GVPIIA+PM LDQP+NA+L+
Sbjct  183   GERGMIVEGWAPQAKILQHPSVGGFVSHCGWSSVLESIKFGVPIIALPMQLDQPVNAKLV  242

Query  1228  VEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAV  1407
              E+G  VE  R E G L RE +A A+ + V  + GE ++     + +N++   + E++ V
Sbjct  243   EEVGVGVEARRAEGGGLQREAIAEAIGDVVVKKIGEGVRMKALEVRDNMKXIEDEEINDV  302

Query  1408  VAELEKLC  1431
             + +L +LC
Sbjct  303   LEQLVQLC  310



>ref|XP_009767153.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
sylvestris]
Length=354

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/360 (41%), Positives = 231/360 (64%), Gaps = 16/360 (4%)
 Frame = +1

Query  403   MAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPG  582
             MA P F+ ++  LNP+L+I+D+   WA K+A +L+IP+V +    AA  S+F H+    G
Sbjct  1     MAGPSFSNIVTNLNPNLIIYDIFQNWAPKIASALHIPAVSYIIIGAATASFFYHLYAFDG  60

Query  583   A-EYPFPALRLRQYEQTKTRELMNQETRNFKREETLD-------TPANQAMMLVNSSREV  738
             A ++PFP + L +YE  K        ++N    + +D          +Q ++L+N+ +  
Sbjct  61    ARDFPFPEIFLPRYELEKLY------SKNASMTKFIDDIYASSGVAMSQDIILINNWKCS  114

Query  739   EGKYIDYLSELMKSKVVSIGTTF-QAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLR  915
             E KY++Y S L K  V+S+G    +    V+   E+  WL ++  SST++ +FGSE  + 
Sbjct  115   ETKYMEYFSILTKKNVISVGPLIGKTESRVEDSEEIIQWLDQRDPSSTLYAAFGSECVVN  174

Query  916   KEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VEEALPKGFLERIGERGRMVEGWAPQAK  1092
             KE++EEIA GLE+S VNFIWV+ F   ++IS ++  LP+G++ER+ ERG +V  WAPQAK
Sbjct  175   KEEIEEIARGLELSNVNFIWVVNFSFDDKISGIDGILPEGYIERVKERGMIVAKWAPQAK  234

Query  1093  ILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKG  1272
             IL H + GGF++HCG NSI+ESL+ GVP+IAMP+ +DQ + AR MVE+G  +EV+R+E G
Sbjct  235   ILRHSNIGGFLNHCGSNSILESLHFGVPLIAMPVLVDQFIAARYMVELGVGLEVKREENG  294

Query  1273  KLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKPERIA  1452
             K+  EE A A++  +  + GE+L+   + +SE ++   ++E+D  V EL+KLC K + ++
Sbjct  295   KVKAEETAKAIKNLMVEKKGEELREKSRELSEKIKREEDKEIDEAVVELQKLCLKNKNLS  354



>gb|EMT05942.1| hypothetical protein F775_52247 [Aegilops tauschii]
Length=458

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/427 (38%), Positives = 238/427 (56%), Gaps = 40/427 (9%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG-------FLVHLCSTPDNLNSIKNNIPQSYSQSI  294
             VVMFPWLA+GHI P++ LAK L            +VHL STP NL  + ++     +  I
Sbjct  11    VVMFPWLAHGHINPYLELAKRLVAASPDDHHLDVVVHLVSTPANLAPLAHH----QTDRI  66

Query  295   RLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVN  474
             +L+ELHLP  P LPP   TT GLP HL  ALK+   +A P F  LL  L PD++++D + 
Sbjct  67    KLVELHLPALPGLPPALHTTKGLPAHLMPALKRACDLAAPRFGALLDQLCPDIVVYDFLQ  126

Query  475   LWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTN---PGAEYPFPALRLRQYEQTK--TR  639
              WA   A +  +P+V F T SAA  ++  H L N   P A +PF ++ L   E+    T 
Sbjct  127   PWAPLEAAARGVPAVHFNTFSAAAKAFVVHCLKNERTPSA-FPFESISLGGAEEDAKYTA  185

Query  640   ELMNQETRNFKREETLDTP----ANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF  807
              L++++       E    P     +   + + +  ++E KY+DYLS+L+  +VV  G   
Sbjct  186   RLISRDDGTAMIPERDRLPLSLERSSGFVAIKTCADIERKYVDYLSQLVGKEVVPTGPLL  245

Query  808   QAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWV  978
                   + + +   +T WL  K   S VFVSFGSEYF+    + ++A GLE+S V ++W 
Sbjct  246   VDSGGSEAKRDGGRITRWLDGKEPGSVVFVSFGSEYFMSDRQMAQMARGLELSRVPYLWA  305

Query  979   LRFPKGEEIS--VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIM  1152
             +R PK E+ +     ++P+GF      RG +VEGWAPQ +IL HRS G F++HCGW+S++
Sbjct  306   VRVPKAEDDARGAARSMPRGFKP---ARGLVVEGWAPQWRILSHRSCGAFLTHCGWSSVL  362

Query  1153  ESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENG  1332
             ES+  GVP++A+P+H+DQP+NA L VE+GAA    + E+             E  GG  G
Sbjct  363   ESMAAGVPMVALPLHIDQPLNANLAVELGAAAARVKQER-----------FGEFKGGSGG  411

Query  1333  EKLKRNV  1353
                +R  
Sbjct  412   SAARRQA  418



>ref|XP_006471419.1| PREDICTED: flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase-like 
[Citrus sinensis]
Length=401

 Score =   282 bits (722),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 157/393 (40%), Positives = 239/393 (61%), Gaps = 20/393 (5%)
 Frame = +1

Query  301   LELHLP---ESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             L  HLP    + D   ++ TT  +P  L   L      A+P F  +L+TL P L+I+D+ 
Sbjct  15    LASHLPVEIANADFSSNH-TTKNIPRRLIPTLIAAFDAAKPSFCNVLETLKPTLVIYDLF  73

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYE-----QTKT  636
               WA + A   +I +V F T +AA  S+F   L N   ++PFP   L + E     Q K 
Sbjct  74    QPWAAEAAYQHDIAAVAFLTTAAASFSFF---LLNSSLKFPFPEFDLPESEIQKMTQFKH  130

Query  637   RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
             R +   E ++ +  E +D      ++L+ +SR++E KY+DY S + K + + +G   Q P
Sbjct  131   RIVNGTENKD-RFLEAVDLSCK--LVLIKTSRDIESKYLDYFSYITKKETIPVGPLVQEP  187

Query  817   PPVDH--ETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP  990
                D+  +T++ DWL+RK  SS V+VSFGSEYFL +E++ EIA GL +S V+FIWV+RF 
Sbjct  188   VYTDNNDDTKIMDWLSRKEPSSVVYVSFGSEYFLSQEEMNEIASGLLLSEVSFIWVVRFH  247

Query  991   KGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLN  1164
                + ++EEALP+ F + I    +G +V+GWAPQAKILGH S GGFVSHCGW S +E + 
Sbjct  248   SEGKFTIEEALPQSFSKEIQGNNKGMVVQGWAPQAKILGHGSIGGFVSHCGWGSTVEGIM  307

Query  1165  LGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAALRETVGGENGEKL  1341
              GVPIIA+PM LDQ  NA+++ +IG  +EV R+E   ++ ++++A  +++ V  E G+++
Sbjct  308   YGVPIIAVPMVLDQLFNAKMVADIGVGLEVPREEINQRVRKKDLARVIKQVVEQEEGQQI  367

Query  1342  KRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
             KR  K +SE+++  G+ E   VV +L +L   P
Sbjct  368   KRKAKELSESIKKKGDDEEINVVEKLLQLVKAP  400



>ref|XP_009627944.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=354

 Score =   279 bits (713),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/355 (40%), Positives = 215/355 (61%), Gaps = 12/355 (3%)
 Frame = +1

Query  325   PDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSL  504
             PDLP HYQ+T GLP HL+ +L K  +MA   F+ ++  LNPDL+I D    WA  +ALS 
Sbjct  2     PDLPSHYQSTKGLPNHLYPSLFKAFQMAGESFSNIVNNLNPDLIIEDFFQAWAPDIALSK  61

Query  505   NIPSVRFFTASAAMCSYFTHMLTNPGA--EYPFPALRL--RQYEQTKTRELMNQETRNFK  672
             NIP V F  + AA  S+  H+  + G+  +YPFP + L   + E     +        F 
Sbjct  62    NIPIVNFTVSGAASYSFMYHLYLHDGSTDDYPFPEMCLSNNEIEIGLISKPTGSSITTFL  121

Query  673   REETLDTPANQA--MMLVNSSREVEGKYIDYLSELMKSKVVSIGTTF---QAPPPVDHET  837
              +  + +   ++  ++L+N+ +E E KY+ YLS +   K++S+G            D ++
Sbjct  122   EKILVYSARKKSNDIILINNWKETEAKYMQYLSTITNKKILSVGPLIGQTDESTQYDQDS  181

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEE  1017
             ++ +WL ++   STV+  FGSE    KE+++EIA+G+E+S VNF+WVLRFP  E   VE+
Sbjct  182   DIIEWLDKRDPFSTVYAVFGSENVWSKENIQEIAHGIELSDVNFLWVLRFPGSE---VEQ  238

Query  1018  ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMH  1197
              LP+GFL R+ ERG +V  W P AKI+ H S GGF++HCGWNS +E ++ GVP+IAMP +
Sbjct  239   VLPEGFLNRVKERGMVVSRWVPHAKIMSHTSIGGFLNHCGWNSTVECIHFGVPLIAMPFN  298

Query  1198  LDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRI  1362
             +DQ + A   VE G A++V+RDEKG L R +  +  +   G E+G + +  +K I
Sbjct  299   MDQFITANYAVEQGMALKVQRDEKGGLKRGDRKSYKKCYNGEEDGRRTEGEIKGI  353



>ref|XP_004233933.2| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=293

 Score =   269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 197/307 (64%), Gaps = 32/307 (10%)
 Frame = +1

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WA  VA SLNIPS++F   S AMC YF H L     E+PF AL L+ +E+  TR      
Sbjct  4     WAAGVAFSLNIPSIKFCVTSIAMCCYFGHFLLKTEVEFPFSALYLKDHERDITRP-----  58

Query  658   TRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET  837
                +  E   +   N+A+MLVNSSR ++GKYI+YLSE+ K++++  G   Q     D E 
Sbjct  59    ---YDVEVKEELGENRAIMLVNSSRAIDGKYIEYLSEIGKTEILPTGVVVQDIAINDEEM  115

Query  838   ELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEE-ISVE  1014
             E+  WL  K  +STV+VSFGSE FL KE++EE+AYGLE+S V+F+WV+RFPK E+ +++E
Sbjct  116   EIVKWLGNKKENSTVYVSFGSENFLTKEEMEEVAYGLEVSNVHFVWVVRFPKEEQVVNLE  175

Query  1015  EALPKGFLER-IGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMP  1191
             + LP+GFL+R IGE+GR++E WAPQ  IL H                     GVPIIA+P
Sbjct  176   DVLPQGFLQRNIGEKGRIIERWAPQTIILKHPK------------------FGVPIIALP  217

Query  1192  MHL--DQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETV-GGEN-GEKLKRNVKR  1359
             M+   DQP+NARL+VE G  VE+ RD  GK+HR  +A  +++ + GG N GE L+R VK 
Sbjct  218   MNFYSDQPLNARLIVENGVGVEMARDGYGKIHRGNVAETIKDVIFGGRNIGEDLRRKVKD  277

Query  1360  ISENLRL  1380
             + EN++L
Sbjct  278   LRENIKL  284



>gb|EPS70318.1| hypothetical protein M569_04442, partial [Genlisea aurea]
Length=354

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 157/362 (43%), Positives = 222/362 (61%), Gaps = 13/362 (4%)
 Frame = +1

Query  163   GHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS-IRLLELHLPESPDLPP  339
             GH++PF  LAK L+ + F  ++CSTP NL SI     Q+ S S + L+EL +P SP+LPP
Sbjct  1     GHLSPFYELAKRLSKKNFKTYICSTPINLVSI-----QAASDSDVELIELRMPPSPELPP  55

Query  340   HYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSV  519
                TT   P  L   L K L + +  F E+L ++ PD+LI+D +  W+ K A S+ IPSV
Sbjct  56    ELHTTRNAPADLTRPLMKKLHLFKSIFFEILTSIKPDILIYDFLQPWSTKQASSMGIPSV  115

Query  520   RFFTASAAMCSYFTHMLTNPGAE-YPFPALRLRQYEQTKTRELMNQETRNFKREETLDTP  696
              F T S A  SY+ H+ TN   E YPF A+ L  +E   T ++ N   ++     T+D  
Sbjct  116   YFATTSTAFHSYYHHLYTNGSTEKYPFKAIYLHDHESCDTEDI-NNFIQDIGDGLTIDDF  174

Query  697   AN--QAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLARKPA  870
              N    +ML+ S  +VE KY+ +LS L+K+K+V  G         +   E+ +WL  +  
Sbjct  175   FNLPTEIMLLKSYGQVETKYVSHLSALIKTKMVLTGPLIAES--TEKSNEIINWLNDQQQ  232

Query  871   SSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEIS-VEEALPKGFLERI  1047
              S +++SFGSEYF  +E++ EI+  LE+S V FIWV+RFP  E  + +++ LP+GF++R 
Sbjct  233   FSVIYISFGSEYFASEEEIYEISKALELSRVKFIWVIRFPITENKTFLKDVLPEGFIDRS  292

Query  1048  GERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLM  1227
              + G +V  WAPQ KIL H S G F+SHCGW+S+ ESL  GVPIIAMPM  DQ +NARL+
Sbjct  293   KDNGIVVNEWAPQIKILSHPSVGAFISHCGWSSVTESLYFGVPIIAMPMRGDQLINARLL  352

Query  1228  VE  1233
             VE
Sbjct  353   VE  354



>gb|AGO03778.1| truncated non-smoky glycosyltransferase 1 [Solanum lycopersicum]
Length=348

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/350 (39%), Positives = 219/350 (63%), Gaps = 12/350 (3%)
 Frame = +1

Query  403   MAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPG  582
             MA   F  +++TL P+L+I+D    W   +A S +I ++ F+ +S +  +Y  H   +  
Sbjct  1     MASSKFPSIIETLKPNLIIYDGFQPWVATMASSYSIHAIMFYVSSTSGLAYIYHQFLHGS  60

Query  583   AE---YPFPALRLRQYEQTK--TRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGK  747
             +    +PF ++ L  +E  K   + +  ++ + F          +  ++L+N+ RE EGK
Sbjct  61    SSLTSFPFSSIYLHDHEIKKLGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCRETEGK  120

Query  748   YIDYLSELMKSKVVSIGTTFQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRK  918
             YIDY+S + K +++ IG   +    +D E +   +  WL +K   S V+VSFGSE FL K
Sbjct  121   YIDYVSTIGKKELIPIGPLIREAM-IDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFLSK  179

Query  919   EDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKIL  1098
             +++EEIA GLE+S VNFIW ++FPKG   ++EE +P+GFLE    +G ++EGWAPQ+ IL
Sbjct  180   QEIEEIAKGLELSKVNFIWTIKFPKGVNKTIEEMVPQGFLESTKGKGMVIEGWAPQSLIL  239

Query  1099  GHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKL  1278
              H S GGF++HCGWNSI+ES++ G+PIIAMPM+ DQP+N+RL+ E+G  VE+ R E GK+
Sbjct  240   NHSSIGGFITHCGWNSILESMSFGIPIIAMPMNHDQPLNSRLVEELGIGVEILRGENGKI  299

Query  1279  HREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKL  1428
              +EE+A  +R+ +  +  +++     ++SE ++L   + +D  V +L KL
Sbjct  300   MKEEVAKGIRKVIEEKPRKQIHLKAMQLSEKIKL---KAIDEGVKKLLKL  346



>gb|ABR16160.1| unknown [Picea sitchensis]
Length=476

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/466 (34%), Positives = 239/466 (51%), Gaps = 24/466 (5%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIP-QS  279
             M + T   +   ++FPWLA GHI PF+ L+K LA  G  V   STP N++ I+ ++  Q 
Sbjct  2     MDSHTGKKKVHFLLFPWLAQGHINPFLELSKALAIHGHKVSFLSTPVNISRIRPSLQLQD  61

Query  280   YSQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLI  459
             +   I L+EL LP +  L P  + T  +P  +   LK  L   E  F  LL+ L+PD L+
Sbjct  62    WPGQIDLMELPLPPTEGLTPGAECTADIPTEMAFPLKVALDGIEKPFRSLLRQLSPDYLV  121

Query  460   HDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTH------------MLTNPGAEYPFPA  603
             HD V  W +  A  + +P++ F     A  +Y  H             L  P   +P   
Sbjct  122   HDFVQYWTQSAAAEMQVPAIYFSIFPPASFAYALHPSKLRNQDITAEELAAPPFGFPSSV  181

Query  604   LRLRQYEQTKTRELMNQETRNFKREETLDTPANQAM-MLVNSSREVEGKYIDYLSELMKS  780
             +R R +E      +      +              M +++ S  E E KY+ Y  + +  
Sbjct  182   IRFRLHEARDLLVMYRGIPGHIAPISRFAKCLEGCMAVILKSCFEYEEKYMSYFEDALGV  241

Query  781   KVVSIGTTFQAPPP------VDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAY  942
              V+S+G    A  P       DH ++L +WL R+  +S VFVSFGSE FL ++ + E+A 
Sbjct  242   PVLSVGPLTPAVLPGASGNGSDH-SDLLEWLDRQREASVVFVSFGSEAFLSEDQIHELAL  300

Query  943   GLEISGVNFIWVLRFPKGEEISVEE--ALPKGFLERIGERGRMVEGWAPQAKILGHRSTG  1116
             GLE SG+ F+W +RFP+  +   +     P+GF  R  +RG +VEGW PQ +IL HRS G
Sbjct  301   GLEASGLPFLWSIRFPRYSDGGHDPLGVFPEGFQIRTQDRGLVVEGWVPQVQILSHRSIG  360

Query  1117  GFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNAR-LMVEIGAAVEVERDEKGKLHREEM  1293
             GF+SH GW+S MESL+ G+P+I +P+ LDQ +NAR +  E+ A +E+ER E G   RE +
Sbjct  361   GFLSHGGWSSAMESLSFGIPLIVLPIQLDQGLNARQIAAELKAGIEIERGEDGSFLRENI  420

Query  1294  AAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
                L   + GE GEKL+       + +       +   + +LE+L 
Sbjct  421   CTTLTMAMAGEEGEKLRSKAAEARDIIAANKQSHIHDFIQKLEQLA  466



>ref|XP_010326752.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Solanum 
lycopersicum]
Length=347

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 218/350 (62%), Gaps = 13/350 (4%)
 Frame = +1

Query  403   MAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPG  582
             MA   F  +++TL P+L+I+D    W   +A S +I ++ F+ +S +  +Y  H   +  
Sbjct  1     MASSKFPSIIETLKPNLIIYDGFQPWVATMASSYSIHAIMFYVSSTSGLAYIYHQFLHGS  60

Query  583   AE---YPFPALRLRQYEQTK--TRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGK  747
             +    +PF ++ L  +E  K   + +  ++ + F          +  ++L+N+ RE EGK
Sbjct  61    SSLTSFPFSSIYLHDHEIKKLGIQPIKPRDEKAFAYIILESFEQSHNIVLLNTCRETEGK  120

Query  748   YIDYLSELMKSKVVSIGTTFQAPPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRK  918
             YIDY+S + K +++ IG   +    +D E +   +  WL +K   S V+VSFGSE FL K
Sbjct  121   YIDYVSTIGKKELIPIGPLIREAM-IDEEEDWGTIQSWLDKKDQLSCVYVSFGSESFLSK  179

Query  919   EDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKIL  1098
             +++EEIA GLE+S VNFIW ++FPKG   ++EE +P+GFLE    +G ++EGWAPQ+ IL
Sbjct  180   QEIEEIAKGLELSKVNFIWTIKFPKGVNKTIEEMVPQGFLESTKGKGMVIEGWAPQSLIL  239

Query  1099  GHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKL  1278
              H S GGF++HCGWNSI+ES++ G+PIIAMPM+ DQP+N+RL+ E+G  VE+ R E GK+
Sbjct  240   NHSSIGGFITHCGWNSILESMSFGIPIIAMPMNHDQPLNSRLVEELGIGVEILRGENGKI  299

Query  1279  HREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKL  1428
              +EE+A  +R+ +  E   K  +   ++SE ++L   + +D  V +L KL
Sbjct  300   MKEEVAKGIRKVI-EEKPRKQIQKAMQLSEKIKL---KAIDEGVKKLLKL  345



>gb|ABR18376.1| unknown [Picea sitchensis]
Length=476

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/458 (35%), Positives = 241/458 (53%), Gaps = 32/458 (7%)
 Frame = +1

Query  139   VMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIP-QSYSQSIRLLELHL  315
             ++FPWLA GHI PF+ L+K LA  G  V   STP N++ I+ ++  Q +   I L+EL L
Sbjct  14    LLFPWLAQGHINPFLELSKALAIHGHKVSFLSTPVNISRIRPSLQLQDWPGRIDLMELPL  73

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P +  L P  + T  +P  +   LK  L   E  F  LL+ L+PD L+HD V  W +  A
Sbjct  74    PPTEGLTPGAECTADIPTEMAFPLKVALDGIEKPFRSLLRQLSPDYLVHDFVQYWTQSAA  133

Query  496   LSLNIPSVRFFTASAAMCSYFTH------------MLTNPGAEYPFPALRLRQYEQTKTR  639
               + +P++ F     A  +Y  H             L  P   +P   +R R +E    R
Sbjct  134   AEMQVPAIYFCVFPPASFAYAFHPSKFRNHDITAEELAAPPFGFPSSVMRFRLHE---AR  190

Query  640   ELMNQETRNFKREETLDTPANQAM-----MLVNSSREVEGKYIDYLSELMKSKVVSIGTT  804
             +L+    R       L +   + +     ++V S  E E KY+ Y  + +   V+S+G  
Sbjct  191   DLLVM-YRGIPGHIALMSRFAKCLEGCMAVIVKSCFEYEEKYMSYFEDAIGVPVLSVGPL  249

Query  805   FQAPPP------VDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVN  966
              +A  P       DH + L +WL R+  +S VFVSFGSE FL ++ + E+A GLE SG+ 
Sbjct  250   TRAVRPGASGNGSDH-SGLLEWLDRQREASVVFVSFGSEAFLSEDQIHELALGLEASGLP  308

Query  967   FIWVLRFPKGEEISVEE--ALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGW  1140
             F+W +RFP+  +   +     P+GF  R  +RG +++GW PQ +IL H S GGF+SH GW
Sbjct  309   FLWSIRFPRYSDGGHDPLGVFPEGFQIRTQDRGLVIKGWVPQVRILSHPSIGGFLSHGGW  368

Query  1141  NSIMESLNLGVPIIAMPMHLDQPMNAR-LMVEIGAAVEVERDEKGKLHREEMAAALRETV  1317
             NS MESL+ G+P+I +P+ LDQ +NAR +  E+ A +E+ER E G   RE +   L   +
Sbjct  369   NSAMESLSFGIPLIVLPIQLDQGLNARQIASELKAGIEIERGEDGSFLRENICTTLTMAM  428

Query  1318  GGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
              GE GEKL+    +  + +       +   + +LE+L 
Sbjct  429   AGEEGEKLRSKAAKARDIIAANKQSHIHDFIQKLEQLA  466



>gb|KDO54370.1| hypothetical protein CISIN_1g044441mg, partial [Citrus sinensis]
Length=333

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/334 (41%), Positives = 203/334 (61%), Gaps = 15/334 (4%)
 Frame = +1

Query  406   AEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA  585
             A+P F  +L+TL P L+++D+   WA + A   +I +V F T SA   SY  H + NP  
Sbjct  4     AKPAFCNILETLKPTLVMYDLFQPWAAEAAYQYHIAAVLFLTISAVAGSYLLHNIINPSL  63

Query  586   EYPFPALRLRQYEQTKTRELMN-------QETRNFKREETLDTPANQAMMLVNSSREVEG  744
             +YPF        E  K    M+        + RN K  E      +   + + +SRE+E 
Sbjct  64    KYPFFESDFLDRENKKINRFMHPTANGTLNKDRNLKAFEL-----SCKFVFIKTSREIES  118

Query  745   KYIDYLSELMKSKVVSIGTTFQAPPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKED  924
             KY+DY   LM++++V +G   Q     + +T++ DWL++K   S VFVSFGSEYFL K++
Sbjct  119   KYLDYFPSLMENEIVPVGPLVQESIFKEDDTKIMDWLSQKEPWSVVFVSFGSEYFLSKDE  178

Query  925   LEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKIL  1098
             + EIA GL +S V+FI VLR    E+I++EEALP+GF E I    +G +V+GW PQAKIL
Sbjct  179   MHEIASGLLLSEVSFIRVLRLHPDEKITIEEALPQGFAEEIERNNKGMLVQGWVPQAKIL  238

Query  1099  GHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGK  1275
              H   GGF+SHCGW S +E +  GVPIIAMPM  +Q  NA+++V+IG  ++V RD+   +
Sbjct  239   RHGRIGGFLSHCGWGSAVEGMVFGVPIIAMPMVYEQSRNAKVVVDIGMGMDVPRDKINQR  298

Query  1276  LHREEMAAALRETVGGENGEKLKRNVKRISENLR  1377
             L REE+A  ++  +  E G++++R  K +SE +R
Sbjct  299   LRREEVARVIKHVLLQEEGKQIRRKAKEMSERMR  332



>emb|CDP14985.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/240 (53%), Positives = 170/240 (71%), Gaps = 7/240 (3%)
 Frame = +1

Query  733   EVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHE-----TELTDWLARKPASSTVFVSFG  897
             +++GKY+DYLS++MK K++ +GT F  P PVD +     T+L  WL+ K   STVF++FG
Sbjct  88    KIDGKYMDYLSDIMKLKIMPVGTLF--PEPVDDDQQDKNTKLIQWLSTKTKHSTVFIAFG  145

Query  898   SEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGW  1077
             SEYF  KE+LEE+A+ LE+S VNFIW +RFP G+ I  EE LP+GFLER  + GR+VE W
Sbjct  146   SEYFWTKEELEEMAFALELSSVNFIWDVRFPLGQRIRPEEGLPQGFLERTRDGGRIVEEW  205

Query  1078  APQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVE  1257
             APQAKILGH S GGF++H GWNSI+ES+ LGVPII MPMH DQP +AR MV+IGA VE  
Sbjct  206   APQAKILGHPSIGGFITHSGWNSILESIELGVPIINMPMHFDQPFDARSMVDIGAGVEAV  265

Query  1258  RDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNK  1437
             R++ GK  R+  A  ++  V  + GE L+  +K +SE ++L  N+  D +V  L +L  +
Sbjct  266   RNDNGKFDRKVTAEVIKNVVVEKMGENLRGKMKEVSEKIKLKENQVFDELVDLLTQLVKE  325


 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +1

Query  142  MFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHLPE  321
            MFPWLAYG I+  + LAK L  RGF V++CSTP NL  I+  I  +YS SI+L+ELH P+
Sbjct  1    MFPWLAYGCISLNLELAKKLTGRGFSVYICSTPINLGFIQKKITPNYSASIQLVELHRPD  60

Query  322  SPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTL  441
            +P+LP +Y TT+GLP HL   L++ L   +  + + L  +
Sbjct  61   TPELPSYYHTTSGLPPHLLSTLQRALNKIDGKYMDYLSDI  100



>ref|XP_003559812.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Brachypodium 
distachyon]
Length=479

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 167/479 (35%), Positives = 253/479 (53%), Gaps = 43/479 (9%)
 Frame = +1

Query  127   RRSVVMFPWLAYGHITPFVGLAKNLADRGF-----LVHLCSTPDNLNSIKNNIPQSYSQS  291
             R SV+MFPWLA+GH+TP++ LA+ L    F     +VHL STP NL  I      S   +
Sbjct  8     RLSVLMFPWLAHGHVTPYLELARRLVATSFPNLDVVVHLVSTPANLAHIAT---PSLPSN  64

Query  292   IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVV  471
             + L+E+ LP   +LP    TT  LP  L  ALK    +A P F  L+  L PDL+++D +
Sbjct  65    LHLVEIRLPAE-ELPASLHTTKRLPPRLMPALKHACDLAAPRFGALIDELRPDLVLYDFL  123

Query  472   NLWAEKVALSLNIPSVRFFTASAAMCSYFTHML---TNPGAEYPFPALRLRQYEQTKTRE  642
               WA   A S  +P+  F T SAA  ++F H L    +P A +PF A+ L    Q     
Sbjct  124   QPWAPLEAASRGVPAAHFSTCSAAATAFFLHCLRTDQSPSA-FPFDAISLGGAAQDARYT  182

Query  643   LMNQETRNFKREET------------LDTPANQAMMLVNSSREVEGKYIDYLSELMKSKV  786
              +       K +++            L    +   + V +  ++E KY+DYLS+L   ++
Sbjct  183   ALLASAGRGKDDDSPPPLVPERDRLPLSLDRSTVFVAVKTCADIERKYMDYLSQLTGKEI  242

Query  787   VSIGTTFQAPPPVD------HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGL  948
             V +G       P +       E  +  WL  +   S V VSFGSEYFL +  + ++A GL
Sbjct  243   VPVGPLLVHDDPRNPGGESSEEDAIMAWLDGEDPGSVVLVSFGSEYFLSERQMAQMARGL  302

Query  949   EISGVNFIWVLRFPKGEEISVEEA--LPKGFLERIGERGRMVEGWAPQAKILGHRSTGGF  1122
             E+SG  F+WV+RFP  +  S   A  LP+ +      RG++V+GWAPQ  +L H + G F
Sbjct  303   ELSGAPFLWVVRFPDDDNDSSGAARSLPRDYAP---ARGKVVQGWAPQRLVLAHGACGAF  359

Query  1123  VSHCGWNSIMESLNLGVPIIAMPMHLDQPMN-ARLMVEIGAAVEVERDEK-GKLHREEMA  1296
             ++HCGW+S++E++ +GVP++A+P+H+DQP+N    +    AA  VE+ E+ G+   E++A
Sbjct  360   LTHCGWSSVLEAMAVGVPMVALPLHIDQPLNANLALELGAAAARVEQPERFGEFRAEDVA  419

Query  1297  AALRETVGGENGEKLKRNVKR----ISENLRLAGNREMDAVVAE-LEKLCNKPERIAFA  1458
              A+R  V GE G+  +R        ++ N    G R    V+ E + +LC K +  A A
Sbjct  420   RAVRAAVNGEEGKAARRRAAELREVVARNNDGDGARRQVGVLLEKMARLCGKGQGQAVA  478



>gb|ABR18123.1| unknown [Picea sitchensis]
Length=491

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 158/443 (36%), Positives = 239/443 (54%), Gaps = 31/443 (7%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQS  291
             E  + +  V+MFPWLA GH++ +  LA  LADRG  V   +TP N+  ++     +   S
Sbjct  14    ERSSKKLHVLMFPWLARGHLSTYAQLANRLADRGINVSFLTTPLNVPKMEPLFIMANRNS  73

Query  292   ---IRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
                ++++EL LP     PP  + T   P HL   L + + + E  F  LL+ L PD+++ 
Sbjct  74    PGKVQVVELPLPAVEGFPPGIECTADTPAHLWPLLLRAVHLLEEPFESLLRRLAPDVVVF  133

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEY----------------P  594
             D+V  W  +VA  L IP+V F    AA  SY    L+ P AEY                P
Sbjct  134   DLVQYWTPRVATKLGIPTVFFLIFGAAYSSY---QLSPPNAEYGEEITAEDLMVPPPGYP  190

Query  595   FPALRLRQYEQTKTRELMN--QETRNFKREETLDTPANQA-MMLVNSSREVEGKYIDYLS  765
                +  R +E   T ++ +   +T   +  + L    +    + + S  E EGK+I+Y  
Sbjct  191   SSTISWRPFEAQFTFKIFHTRDDTDGMRGIDRLVKCIDGCEAIAIKSCYEFEGKFIEYFQ  250

Query  766   ELMKSKVVSIGTTFQA-PPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAY  942
             ++    V+ +G   Q+   P+D  +E   WL R+ ASS V+  FG+E FL  E++ E+A 
Sbjct  251   QVTGKPVIPVGPLLQSNAGPLD--SECLKWLGRQAASSVVYACFGTECFLSNEEIREVAL  308

Query  943   GLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGF  1122
             GLE SG  FI VLRF    + S   +LP+ F  RI +RG ++  WAPQ +IL H STG F
Sbjct  309   GLEASGHPFILVLRFAGHRDSST--SLPEAFEGRIRDRGLVLTDWAPQKEILSHPSTGAF  366

Query  1123  VSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMAA  1299
             ++HCGW+S+ E +++G+P+IA+PM  DQ +NARL+V E+   VEV R   G   RE++  
Sbjct  367   LTHCGWSSLTEGMSVGLPLIALPMQWDQGLNARLIVNELKVGVEVARRGDGAASREDICR  426

Query  1300  ALRETVGGENGEKLKRNVKRISE  1368
             A+R  +  E+GE+ K   +R S+
Sbjct  427   AVRAVMAPEDGEEGKDVRQRASQ  449



>ref|XP_009609569.1| PREDICTED: crocetin glucoside glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=199

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  850   WLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPK  1029
             WL +K  SSTVFVSFGSEYFL  E++  +A GLE+S VNFIWV+RFP+GE IS+ +A+P+
Sbjct  3     WLDKKEKSSTVFVSFGSEYFLSNEEILAVAQGLELSKVNFIWVIRFPQGERISIADAVPE  62

Query  1030  GFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQP  1209
              FLER+G+RG+++E WAPQA IL H STGGFVSHCGW+S MES+  GVPIIAMPMH+DQP
Sbjct  63    VFLERVGDRGKILEEWAPQANILQHPSTGGFVSHCGWSSFMESMKFGVPIIAMPMHIDQP  122

Query  1210  MNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGN  1389
             MNARL+  IG  VE  RDE GKL  EE+A A+R+ V  E+GE +++  + +SE +   G+
Sbjct  123   MNARLVEYIGLGVEAVRDENGKLQSEEIAKAIRKVVMEESGEPVRKKARELSEKMNEKGD  182

Query  1390  REMDAVVAELEKLCN  1434
              E+D VV EL  LC 
Sbjct  183   EEIDGVVEELVSLCG  197



>gb|AFJ53041.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
 gb|AGD95006.1| UDP-glucosyltransferase [Linum usitatissimum]
Length=379

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 156/383 (41%), Positives = 222/383 (58%), Gaps = 44/383 (11%)
 Frame = +1

Query  382   ALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVR---FFTASAAMCS  552
             ALK+    + P+F ++LK L PDLL++DV+  WA + A   N+  ++   F    AA  S
Sbjct  3     ALKEAFDDSRPEFCKILKRLKPDLLVYDVLQPWAAEAAAESNVVGIKCVLFVPGGAACYS  62

Query  553   YFTHMLTNP-GAEYPFPALRLRQYEQTKTRE--LMNQETR-NFKREETLDTPAN-----Q  705
             +  H    P GA+YP       Q     +RE  L  + T  N  R+E LDT  +      
Sbjct  63    FLAHYSIKPAGAQYPL------QDWGIASREGFLKKRATYPNGLRDEDLDTYTDCMKRSS  116

Query  706   AMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHET--------ELTDWLAR  861
              ++L+ +SR +E KYIDYLSEL+  +VV +G      P  DH T        ++  WL  
Sbjct  117   DIILIKTSRNIEAKYIDYLSELLGKEVVPVGPLVNDKPE-DHRTGAEGDDDNKILKWLNS  175

Query  862   KPASS-TVFVSFGSEYFLRKEDLEEIAYGLEISG--VNFIWVLRFP--------KGEEIS  1008
               + S  V+VSFGSEYF  KE++ EIA GLE++   + FIWV+RFP          + + 
Sbjct  176   IDSDSPVVYVSFGSEYFPSKEEMGEIARGLEMNQALIRFIWVVRFPPDDHHREKNNKTLL  235

Query  1009  VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAM  1188
             ++EALP+GFLER+  RG +VEGWAPQA+IL +   GGFVSHCGW+S++E++  GVPI+AM
Sbjct  236   LQEALPEGFLERVEGRGLLVEGWAPQAEILRNERVGGFVSHCGWSSVIEAVVYGVPIVAM  295

Query  1189  PMHLDQPMNARLMVEIGAAVEVERDEKGKLHR---EEMAAALRETVGGENGEKLKRNVKR  1359
             PM LDQP NA L+ EIG  VEV+ ++ G + R   +EM   + E +G     +++  V+ 
Sbjct  296   PMQLDQPWNANLVEEIGVGVEVKGNKDGMIKRIDGDEMGRVIGEVLG---DMEMRNRVRE  352

Query  1360  ISENLRLAGNREMDAVVAELEKL  1428
             +SE L+   + EMD VV  L  L
Sbjct  353   LSEKLKGDADAEMDCVVDRLRSL  375



>ref|XP_004166802.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like 
[Cucumis sativus]
Length=336

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 206/321 (64%), Gaps = 26/321 (8%)
 Frame = +1

Query  544   MCSYFTHMLTNPGAEY--PFPALRLRQYEQTKTRELMNQETRNFKREETLDTPANQA--M  711
             M +  T+ML  P +++   FP + L ++E  + + L      + K ++ ++    ++  +
Sbjct  1     MAAMVTNMLKFPNSDFLLTFPEIHLSEFEIKQLKNLFKSSVNDAKDKQRIEECYKRSCGI  60

Query  712   MLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE--------LTDWLARKP  867
             +L+ S RE+E KYID++S  ++ K + +G      P V+ + E           WL +K 
Sbjct  61    LLLKSLREIEAKYIDFVSTSLQIKAIPVG------PLVEEQEEDIVVLAESFEKWLNKKE  114

Query  868   ASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRFP----KGEEIS---VEEALP  1026
               S + VSFGSE++L K D+EEIA+GLE+S VNFIWV+RFP    +GE      VEE LP
Sbjct  115   KRSCILVSFGSEFYLSKGDMEEIAHGLELSHVNFIWVVRFPGSGEQGERKKKNVVEEELP  174

Query  1027  KGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQ  1206
             KGFLER+GERG +VE W PQ +IL HRSTGGF+SHCGW+S++ES+  GVPIIA PM LDQ
Sbjct  175   KGFLERVGERGMVVEEWVPQVQILKHRSTGGFLSHCGWSSVLESIKSGVPIIAAPMQLDQ  234

Query  1207  PMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAG  1386
             P+NARL+  +G  V VER + G+L R E+A A+RE V  E+G++++  VK +++ ++  G
Sbjct  235   PLNARLVEHLGVGVVVERSDGGRLCRREVARAVREVVAEESGKRVREKVKEVAKIMKEKG  294

Query  1387  NR-EMDAVVAELEKLCNKPER  1446
             +  E++ VV E+ KLC +  +
Sbjct  295   DEGEVEVVVEEITKLCRRKRK  315



>ref|XP_002463370.1| hypothetical protein SORBIDRAFT_02g042580 [Sorghum bicolor]
 gb|EER99891.1| hypothetical protein SORBIDRAFT_02g042580 [Sorghum bicolor]
Length=479

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 260/472 (55%), Gaps = 48/472 (10%)
 Frame = +1

Query  133   SVVMFPWLAYGHITPFVGLAKNL--ADR--------GFLVHLCSTPDNLNSIKNNIPQSY  282
             SVVMFPWLA+GHITP++ LA+ L  ADR           VHL STP NL++I  +     
Sbjct  10    SVVMFPWLAHGHITPYLELARRLTSADRRRAAGDNIDVTVHLVSTPVNLSAIARH----Q  65

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             +  IR +ELHLP  PDLPP   TT  LP  L   LK+   +A P F  LL  L PDLL+ 
Sbjct  66    TPRIRFVELHLPAPPDLPPDLHTTKHLPSRLMPTLKRACDLAAPRFGALLDDLRPDLLLF  125

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQ-TKTR  639
             D +  WA   A +  + +V   T SAA  S+F H L   G  +PF  + L   E+  K  
Sbjct  126   DFLYPWAPLEAAARGVAAVHLSTCSAAATSFFVHCLGT-GRAFPFQGVGLGTAEEEAKYT  184

Query  640   ELM----NQETRNFKREETLDTPA-NQAMMLVNSSREVEGKYIDYLSELMKSK-VVSIGT  801
              L     + +    +R+  L + A +   + + +  ++E  Y+ YLSEL+  K +V +G 
Sbjct  185   SLFAVREHPDALVPERDRLLLSLARSSGFVAIKTCADIERPYMGYLSELLGGKEIVPVG-  243

Query  802   TFQAPPPVD----------HETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLE  951
                 P  VD              +T WL  +P +S V VS GSEYF+ +E L  +A GLE
Sbjct  244   ----PLLVDDSDGGGGNSSESDRVTRWLDAQPPASVVLVSVGSEYFMTEEQLARMARGLE  299

Query  952   ISGVNFIWVLRFPKGEE--------ISVEEALPKGFLERIGERGRMVEGWAPQAKILGHR  1107
             +SG  F+WV+RFPK  E         +   ALP+GF    G RG +VEGWAPQ ++L H 
Sbjct  300   LSGERFLWVVRFPKSPEEDDDAAPAPAPARALPRGFAPAPG-RGLVVEGWAPQRRVLAHP  358

Query  1108  STGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHRE  1287
             + G F+SHCGW+S++ESL  GVPI+A+P+H+DQP+ A L  E+GAAV V ++  G+   E
Sbjct  359   ACGTFLSHCGWSSVLESLAAGVPIVALPLHIDQPLGANLAAELGAAVRVPQERFGEFRDE  418

Query  1288  EMAAALRETVGGENGEKLKRNVKRISENLRL--AGNREMDAVVAELEKLCNK  1437
             ++A A+R  + GE    L+R    + E +    A    +DA+V  + +LC K
Sbjct  419   DVARAVRGAMRGEESRALRRRAAELREVVARNDADGALVDALVQRMARLCGK  470



>ref|XP_003593142.1| Glucosyltransferase [Medicago truncatula]
 gb|ACT34899.1| GT4 [Medicago truncatula]
 gb|AES63393.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=473

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 154/457 (34%), Positives = 245/457 (54%), Gaps = 35/457 (8%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             +VM PWLA GHI P+  +AK LA +G  V   ++P N++ +    P++    I+L+ L L
Sbjct  16    IVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKT-PKTIEPFIKLVRLPL  74

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P    LPP  + T  +P++++  L+   +  + D TE+LKT  PD + +D   +W   +A
Sbjct  75    PHIEQLPPGAENTMDIPINMNKYLELAYQGLQDDVTEILKTSKPDWVFYDYGTVWLAPIA  134

Query  496   LSLNIPSVRFFTASAAMCSYF------------THMLTNPGAEYPF-PALRLRQYEQTKT  636
              SLNI SV +    A    +F               +  P    PF   + L+ YE  + 
Sbjct  135   KSLNIASVHYSITPAWNICFFDRPKDQIKTNFEIQDICGPHKWLPFQTTIHLKPYELIRA  194

Query  637   RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
                +  E+ N       +  ++  ++L+ +SRE+EG+++DY+SE     VV +G     P
Sbjct  195   FTALRDESGNMPDSGLNNAYSSCDLLLLRTSRELEGEWLDYISEQYNVPVVPVGLI---P  251

Query  817   PPV----DHETE-------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
             P +    D E E       +  WL  + +SS V++ FGSE  L +EDL E+AYG+E+SG+
Sbjct  252   PSMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQEDLTELAYGIELSGL  311

Query  964   NFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWN  1143
             +F W L+  K  E ++E  LP+GF ER  ERG + + WAPQ KIL H + GG +SHCG  
Sbjct  312   SFFWTLKNLK--EGTLE--LPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCGSG  367

Query  1144  SIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVER-DEKGKLHREEMAAALRETVG  1320
             S++E ++ G  ++ +P  LDQ + +R +VE   AVEV R +E G   R+ +A +LR  + 
Sbjct  368   SVIEKVHFGHVLVTLPYLLDQCLFSRALVEKEVAVEVPRSEEDGSFTRDSVAHSLRLAIV  427

Query  1321  GENGEKLKRNVKRISE--NLRLAGNREMDAVVAELEK  1425
              E G   + N K + +  + +   N+ +D  +A L K
Sbjct  428   DEEGSSFRNNAKELGKVFSSKDIHNQYIDDFIAALYK  464



>gb|EMS55799.1| Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase [Triticum 
urartu]
Length=436

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 204/366 (56%), Gaps = 26/366 (7%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRG------FLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             VVMFPWLA+GHI P++ LAK L           +VHL STP NL  + ++     +  IR
Sbjct  11    VVMFPWLAHGHINPYLELAKRLVAASPDDHLDVVVHLVSTPANLAPLAHH----QTDRIR  66

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
             L+ELHLP  P LPP   TT GLP HL  ALK+   +A P F  LL  L PD++++D +  
Sbjct  67    LVELHLPALPGLPPALHTTKGLPAHLMPALKRACDLAAPRFGALLDQLCPDIVVYDFLQP  126

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGA--EYPFPALRLRQYEQTK--TREL  645
             WA   A +  +P+V F T SAA  ++  H L    A   +PF  + L   ++    T  L
Sbjct  127   WAPLEAAARGVPAVHFNTFSAAAKAFVVHCLKTERAPSAFPFETISLGGADEDAKYTARL  186

Query  646   MNQETRNFKREETLDTP----ANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQA  813
             ++++       E    P     +   + + +  ++E KY+DYLS+L+  +VV  G     
Sbjct  187   ISRDDGTAMIPERDRLPLSLERSSGFVAIKTCADIERKYVDYLSQLVGKEVVPTGPLLVD  246

Query  814   PPPVDHETE---LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLR  984
                 + + +   +  WL  K   S V VSFGSEYF+    + ++A GLE+S V ++WV+R
Sbjct  247   SGGSEAKRDGGRIMRWLDGKEPGSVVLVSFGSEYFMSDRQMAQMARGLELSRVPYLWVVR  306

Query  985   FPKGEEIS--VEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMES  1158
             FP  E+ +     ++P+GF      RG +VEGWAPQ +IL HRS G F++HCGW+S++ES
Sbjct  307   FPNAEDDARGAARSMPRGFKP---ARGLVVEGWAPQWRILSHRSCGAFLTHCGWSSVLES  363

Query  1159  LNLGVP  1176
             +  GVP
Sbjct  364   MASGVP  369



>gb|ABR16053.1| unknown [Picea sitchensis]
Length=491

 Score =   246 bits (627),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 154/444 (35%), Positives = 234/444 (53%), Gaps = 33/444 (7%)
 Frame = +1

Query  112   ETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIK---NNIPQSY  282
             E  + +  V+MFPWLA GH + +  L   LADRG  V   +TP N+  ++   N   ++ 
Sbjct  14    ERSSKKLHVLMFPWLARGHFSIYAELTNRLADRGINVSFLTTPLNVPKMEPLFNLANRNL  73

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
                ++++EL  P    LPP  + T   P HL   L + + + E  F  +L+ L PD+++ 
Sbjct  74    PGKVQVVELPFPAVEGLPPGIECTADTPAHLWPLLLRAVFLLEEPFESVLRRLAPDVVVF  133

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEY----------------P  594
             D++  W  +VA  L IP+V FFT SAA   Y ++ L+ P AEY                P
Sbjct  134   DLMQYWTPRVATKLGIPTVLFFTFSAA---YLSYHLSPPNAEYGEEITAEDLMVPPPGYP  190

Query  595   FPALRLRQYEQTKTRELMN--QETRNFKR-EETLDTPANQAMMLVNSSREVEGKYIDYLS  765
                +  R +E   T ++ +   +T   +  +  L        + + S  E E K I Y  
Sbjct  191   SSTISWRPFEAQFTLKMFHTRDDTEGMRVIDRQLTCIDGCETIAIKSCYEFEEKLIKYFE  250

Query  766   ELMKSKVVSIGTTFQ--APPPVDHETELTDWLARKPASSTVFVSFGSEYFLRKEDLEEIA  939
              +    V+ +G   Q  A P    ++E   WL R+ ASS V+  FG+E FL  E++ E+A
Sbjct  251   RVTGKPVIPVGPLLQSNAGP---QDSECLKWLGRQAASSVVYACFGTECFLSNEEIREVA  307

Query  940   YGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGG  1119
              GLE SG  FI VLRF    + S   +LP+ F  RI +RG ++  WAPQ +IL H ST  
Sbjct  308   LGLEASGHPFILVLRFAGHCDGST--SLPEAFEGRIRDRGLVLTDWAPQKEILSHPSTVA  365

Query  1120  FVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMV-EIGAAVEVERDEKGKLHREEMA  1296
             F++HCGW+S+ E +++G+P+IA+ M  DQ +NARL+V E+   VEV R   G   RE++ 
Sbjct  366   FLTHCGWSSLTEGMSVGLPLIALLMQWDQGLNARLIVNELKVGVEVARRGDGAASREDIC  425

Query  1297  AALRETVGGENGEKLKRNVKRISE  1368
              A+R  +  E+GE+ K   +R S+
Sbjct  426   RAVRAVMAPEDGEEGKDVRQRASQ  449



>ref|XP_011071660.1| PREDICTED: beta-D-glucosyl crocetin beta-1,6-glucosyltransferase-like 
[Sesamum indicum]
Length=340

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 209/362 (58%), Gaps = 41/362 (11%)
 Frame = +1

Query  385   LKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVALSLNIPSVRFFTASAAMCSYFTH  564
             L    +++   F++++  L PDLLI+D    W+ K+A S  IP+V F    +   S+F H
Sbjct  4     LMHAFQLSASTFSDIITRLKPDLLIYDGFQPWSAKLASSQGIPAVYFALTGSTAISFFHH  63

Query  565   MLTNPGAE-YPFPALRLRQYEQTKTRELMNQETRNFKREETLDTPA-------NQAMMLV  720
             +  +  ++ +P+PA+ L +YE+   R+L+ Q     K ++  +  A          +++ 
Sbjct  64    LYVHKTSDTFPYPAIYLNEYEK---RDLIAQGA-TIKVQDVDEGFAFGVLKLSCDIVLIK  119

Query  721   NSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDHETE--LTDWLARKPASSTVFVSF  894
             +    +E KYIDYLS L K ++V +G   Q     DHET+  + +WL++K  SST+++SF
Sbjct  120   SCCTGIERKYIDYLSTLCKRRIVPVGPLVQ-ENAADHETDSWILNWLSKKSKSSTLYISF  178

Query  895   GSEYFLRKEDLEEIAYGLEISGVNFIWVLRFPKG-EEISVEEALPKGFLERIGERGRMVE  1071
             GSE +  K+ + EIA GLE++ VNFIWV+R P G ++I+VEEALP+GF++R+ ERG +V+
Sbjct  179   GSENYFSKDQIREIAKGLELTKVNFIWVVRSPVGSDQINVEEALPEGFIDRVKERGVLVQ  238

Query  1072  GWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVE  1251
              WAPQA IL   +  GF+SHCGW+SI ES   G                         VE
Sbjct  239   EWAPQAAILASPAVAGFMSHCGWSSITESAGFG-------------------------VE  273

Query  1252  VERDEKGKLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLC  1431
             V RDEKG    E +  A+ E + GE+GE+L++ V+ +SE ++L  +     VV EL ++C
Sbjct  274   VVRDEKGMFDGEGVGTAVDEVMLGESGERLRKRVRELSEKIKLQEDERCSGVVEELSRIC  333

Query  1432  NK  1437
              K
Sbjct  334   VK  335



>ref|XP_011043118.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=465

 Score =   243 bits (620),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 154/447 (34%), Positives = 234/447 (52%), Gaps = 43/447 (10%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MA++  V MFPWLA+GHI P++  +K LA +G  +   STP N+    + IPQ  S   +
Sbjct  1     MASKSHVFMFPWLAFGHILPYLEFSKQLAAKGIHISFISTPINIKRFPS-IPQDISGRFK  59

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
              +E+ LP    LP + + T  L       LK+     +  F  L++   P +++ D    
Sbjct  60    FIEIQLPIVDGLPENCEATIDLSPEQIQYLKQAYDALKVPFESLVQKEAPQMILFDFAAC  119

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFT--------HMLTNP-----GAEY-PFPALRLR  615
             W   +A    I SV F   SAA  +Y           + T P       E+ PFP+L   
Sbjct  120   WIPAIAARYGITSVFFSPLSAASSAYLGPPDELRSFRLRTRPEDYARAPEWIPFPSLVAY  179

Query  616   QYEQTKTRELMNQETRNF-------KREETLDTPANQAMMLVNSSREVEGKYIDYLSELM  774
             + +Q  TR + +    +        +R +TL   A   ++ V S RE E  Y++ L E+ 
Sbjct  180   RPDQG-TRFMQHVYIPDVSGISTGQRRAKTL---AECDLVAVRSCREFEDSYLNVLEEIY  235

Query  775   KSKVVSIGTTFQAPPP--VDHETELTD---------WLARKPASSTVFVSFGSEYFLRKE  921
             +  V+ IG      PP  V+++T   +         WL ++   S VFV FGSEY +  E
Sbjct  236   QKPVLPIGLL----PPNFVENKTSYPESSNFYGAFKWLDKQEQKSVVFVGFGSEYKMPVE  291

Query  922   DLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILG  1101
              + E+AYG+E+SG+ F+W+L+ P+G  I  ++ LP GF+ RI +RG +  GWAPQ +IL 
Sbjct  292   TIHELAYGIELSGLPFMWILKKPEG--IDSQDLLPTGFVSRISDRGIVSFGWAPQQEILA  349

Query  1102  HRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLH  1281
             H S GG + H GW SI+ESL  G P+I MPM  DQ +NA+L+VE  A  EV R++ G  +
Sbjct  350   HPSIGGCLFHSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRNKDGSFN  409

Query  1282  REEMAAALRETVGGENGEKLKRNVKRI  1362
             R+ +A ++R  +  E GE ++R    +
Sbjct  410   RDMVAKSMRLVMVAEEGETIRRKTSEL  436



>gb|AFK37289.1| unknown [Medicago truncatula]
Length=472

 Score =   241 bits (614),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 153/460 (33%), Positives = 245/460 (53%), Gaps = 35/460 (8%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             +VM PWLA GHI P+  +AK LA +G  V   ++P N++ +    P++    I+L+ L L
Sbjct  15    IVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKT-PKTIEPFIKLVRLPL  73

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P    LPP  + T  +  +++  LK+  +  + D TE+LKT  PD + +D  + W   +A
Sbjct  74    PHIEQLPPGAENTMDIQPNMNRFLKQAYEGLQDDVTEILKTSKPDWVFYDFASGWLAPIA  133

Query  496   LSLNIPSVRFFTASAAMCSYFT------------HMLTNPGAEYPF-PALRLRQYEQTKT  636
              SLNI +  +    A    +F               +  P    PF   + L+ YE  + 
Sbjct  134   KSLNIAAAHYNITPAWNKCFFDPPKDQVKTNFKLEDMCGPPKWVPFQTTIHLKPYEIIRA  193

Query  637   RELMNQETRNFKREETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAP  816
                +  E+R     +     ++  + L+ +SRE+EG+++DY+SE  K  VV +G     P
Sbjct  194   FTALRNESRGIAGFDLDKAYSSCDLFLLRTSRELEGEWLDYISEQYKVPVVPVGLL---P  250

Query  817   PPV----DHETE-------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGV  963
             P +    D E E       +  WL  + +SS V++ FGSE  L + DL E+A+G+E+SG+
Sbjct  251   PSMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQNDLTELAHGIELSGL  310

Query  964   NFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWN  1143
             +F W L+  K  E ++E  LP+GF ER  ERG + + WAPQ KIL H + GG +SHCG  
Sbjct  311   SFFWALKNLK--EGTLE--LPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCGSG  366

Query  1144  SIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVER-DEKGKLHREEMAAALRETVG  1320
             S++E ++ G  ++ +P  LDQ + +R +VE G AVEV R +E G   R+ +A +LR  + 
Sbjct  367   SVIEKVHFGHVLVTLPYLLDQCLFSRALVEKGVAVEVPRSEEDGSFTRDSVAHSLRLAIV  426

Query  1321  GENGEKLKRNVKRISE--NLRLAGNREMDAVVAELEKLCN  1434
              E G   + N K + +  + +   N+ +D ++A L K  N
Sbjct  427   DEEGSSFRNNAKELGKVFSSKDIHNQYIDDLIAALYKYRN  466



>gb|KDO51357.1| hypothetical protein CISIN_1g042362mg, partial [Citrus sinensis]
Length=294

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 191/296 (65%), Gaps = 8/296 (3%)
 Frame = +1

Query  568   LTNPGAEYPFPALRLRQYEQTKTRELMNQETRNFKREETLDTPANQAMMLVNSSREVEGK  747
             L  P  E+  P   +++  Q K R +   E ++ +  + +D      ++L+ +SR++E K
Sbjct  1     LKFPFPEFDLPESEIQKMTQFKHRIVNGTENKD-RFLKAIDLSCK--LVLIKTSRDIESK  57

Query  748   YIDYLSELMKSKVVSIGTTFQAPPPVDH--ETELTDWLARKPASSTVFVSFGSEYFLRKE  921
             Y+DY S + K + + +G   Q P   D+  +T++ DWL+RK  SS V+VSFGSEYFL +E
Sbjct  58    YLDYFSYITKKETIPVGPLVQEPVYTDNNDDTKIMDWLSRKEPSSVVYVSFGSEYFLSQE  117

Query  922   DLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERI--GERGRMVEGWAPQAKI  1095
             ++ EIA GL +S V+FIWV+RF    + ++EEALP+ F + I    +G +V+GWAPQAKI
Sbjct  118   EMNEIASGLLLSEVSFIWVVRFHSEGKFTIEEALPQSFSKEIQGNNKGMVVQGWAPQAKI  177

Query  1096  LGHRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KG  1272
             LGH S GGFVSHCGW S +E +  GVPIIA+PM LDQ  NA+++ +IG  +EV R+E   
Sbjct  178   LGHGSIGGFVSHCGWGSTVEGIMYGVPIIAVPMVLDQLFNAKMVADIGVGLEVPREEINQ  237

Query  1273  KLHREEMAAALRETVGGENGEKLKRNVKRISENLRLAGNREMDAVVAELEKLCNKP  1440
             ++ ++++A  +++ V  E G+++KR  K +SE+++  G+ E   VV +L +L   P
Sbjct  238   RVRKKDLARVIKQVVEQEEGQQIKRKAKELSESIKKKGDDEEINVVEKLLQLVKAP  293



>ref|XP_004162019.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 201/326 (62%), Gaps = 11/326 (3%)
 Frame = +1

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFTHMLTNPGAEYPFPALRLRQYEQTKTRELMNQE  657
             WA ++A SLNIP++ F T+  +M SY  H + +P +++PF    L    ++K     ++ 
Sbjct  2     WAPRLASSLNIPAINFSTSGTSMISYGFHSIHHPSSKFPFSDFVLHNPWRSKYNSTPSEH  61

Query  658   TRNFKRE--ETLDTPANQAMMLVNSSREVEGKYIDYLSELMKSKVVSIGTTFQAPPPVDH  831
              R+ +    E L+T  ++ ++L+NS +EVEG+Y+DYLS L+K KV+ +G     P   D 
Sbjct  62    ARSVREAFFECLNT--SRDVILINSFKEVEGEYMDYLSLLLKKKVIPVGPLVYEPNEKDE  119

Query  832   ETE----LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLEISGVNFIWVLRF-PKG  996
             E E    + +WL +K A STV VS GSE +  +E+ EEI  GL  S  NFIWV R   KG
Sbjct  120   EDEDYSRIKNWLDKKEALSTVLVSLGSESYASEEEKEEIVQGLVESEANFIWVERINKKG  179

Query  997   EEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSHCGWNSIMESLNLGVP  1176
             +E   ++   +  LE+ GER  +V+GWAPQ KIL H S GGFVSHCGWNS++ES+  GVP
Sbjct  180   DE--EQQIKRRELLEKSGERAMVVKGWAPQGKILKHGSIGGFVSHCGWNSVLESIVSGVP  237

Query  1177  IIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLHREEMAAALRETVGGENGEKLKRNVK  1356
             II +P+  DQP NA ++   G  VE +RD  GK+ R+E+A  ++E V  +  E+L+  V+
Sbjct  238   IIGVPVFGDQPFNAGVVEFAGIGVEAKRDPDGKIQRKEVAKLIKEVVIEKRREELRMKVR  297

Query  1357  RISENLRLAGNREMDAVVAELEKLCN  1434
              +SE ++  G+  ++ ++A++    N
Sbjct  298   EMSEIVKRRGDVLIEEMLAQISHFSN  323



>ref|XP_007208586.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
 gb|EMJ09785.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
Length=470

 Score =   240 bits (612),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 158/470 (34%), Positives = 229/470 (49%), Gaps = 38/470 (8%)
 Frame = +1

Query  103   MGTETMATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSY  282
             M + T   +  + +FPWLA+GHI PF  +AK++A RG  V   STP N+  +   IPQ  
Sbjct  1     MSSTTEPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPK-IPQHL  59

Query  283   SQSIRLLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIH  462
             +  I L+++ LP   +LP + + T  +P H+   LK      E   +  L+T  PD +IH
Sbjct  60    TPLINLVQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIH  119

Query  463   DVVNLWAEKVALSLNIPSVRFFTASAAMCSY----------------FTHMLTNPGAEYP  594
             D    W   +A SL I    F   +A+   +                     T P    P
Sbjct  120   DFAPHWLPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIP  179

Query  595   FPA-LRLRQYEQTKTRELMNQETRN----FKREETLDTPANQAMMLVNSSREVEGKYIDY  759
             FP+ L  R +E  K  +   Q        F+ + T+       + L+ S RE+EG+++D 
Sbjct  180   FPSNLVFRSFEAKKLFDATKQNASGVSDLFRVQSTVQ---GCQVYLIRSCREIEGEWLDL  236

Query  760   LSELMKSKVVSIGTTFQAPPPVDHETELTDW------LARKPASSTVFVSFGSEYFLRKE  921
             L EL +  VV IG     PP V    +  DW      L ++   + V+++ GSE  L +E
Sbjct  237   LQELQQFPVVPIGLL---PPLVQTREDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQE  293

Query  922   DLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILG  1101
             D  E+A GLE+SG+ F WVLR P     S    LP GF ER   RG +   WAPQ KIL 
Sbjct  294   DFTELALGLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILA  353

Query  1102  HRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK-GKL  1278
             H S GGF++HCGW+S++E+L  G P+I +P   DQ + AR   +    +EV R+E+ G  
Sbjct  354   HDSIGGFLTHCGWSSLIEALQYGRPLIMLPFLYDQGLIARFW-DKKIGIEVPRNEEDGSF  412

Query  1279  HREEMAAALRETVGGENGEKLKRNVKRISENLRLAG--NREMDAVVAELE  1422
              R+ +A +L   V  E G+  +   K   E  +     +R MD  V  LE
Sbjct  413   TRKSLAESLNLVVVDEEGKAYRDGAKEHGEVFKDKDLHDRYMDKCVEYLE  462



>ref|XP_002323718.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
 gb|EEF03851.1| hypothetical protein POPTR_0017s07030g [Populus trichocarpa]
Length=465

 Score =   239 bits (611),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 152/441 (34%), Positives = 234/441 (53%), Gaps = 43/441 (10%)
 Frame = +1

Query  118   MATRRSVVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIR  297
             MA++  V MFPW A+GHI P++  +K LA +G  +   STP N+  + + IPQ+ S   +
Sbjct  1     MASKSHVFMFPWFAFGHILPYLEFSKQLAAKGIHISFISTPRNIKRLPS-IPQNISGKFK  59

Query  298   LLELHLPESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNL  477
              +E+ LP    LP + + T  L       LK+     +  F  L++   P++++ D    
Sbjct  60    FIEIQLPIVDGLPENCEATIDLSPEQIQYLKQAYDALKVPFESLVQKEAPEMILFDFAAC  119

Query  478   WAEKVALSLNIPSVRFFTASAAMCSYFT--------HMLTNP-----GAEY-PFPALRLR  615
             W   +A    I SV F   SAA  +Y           + T P       E+ PFP+L   
Sbjct  120   WIPAIAARYGITSVFFSPLSAASSAYLGPPDELHSFRLRTRPEDYARAPEWIPFPSLVAY  179

Query  616   QYEQTKTRELMNQETRNF-------KREETLDTPANQAMMLVNSSREVEGKYIDYLSELM  774
             + +Q  TR + +    +        +R +TL   A   M+ V S RE E  Y++ L E+ 
Sbjct  180   RPDQG-TRYMQHVYIPDVSGISTGQRRAKTL---AECDMVAVRSCREFEDSYLNVLEEIY  235

Query  775   KSKVVSIGTTFQAPPP--VDHETELTD---------WLARKPASSTVFVSFGSEYFLRKE  921
             +  V+ IG      PP  V+++T   +         WL ++   S VFV FGSEY +  E
Sbjct  236   QKPVLPIGLL----PPNFVENKTSHPESSNFSSTFKWLDKQEQKSVVFVGFGSEYKMPVE  291

Query  922   DLEEIAYGLEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILG  1101
              + E+AYG+E+SG+ F+W+L+ P+G  I  ++ LP GF+ RI +RG +  GWAPQ +IL 
Sbjct  292   TIHELAYGIELSGLPFMWILKKPEG--IDSQDLLPTGFVSRISDRGIVSFGWAPQLEILA  349

Query  1102  HRSTGGFVSHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEKGKLH  1281
             H S GG + H GW SI+ESL  G P+I MPM  DQ +NA+L+VE  A  EV R++ G  +
Sbjct  350   HPSIGGCLFHSGWGSIIESLGFGHPLILMPMVNDQTLNAKLLVEKSAGFEVPRNKDGSFN  409

Query  1282  REEMAAALRETVGGENGEKLK  1344
             R+ +A ++R  +  + GE ++
Sbjct  410   RDMVAKSMRLVMVDKEGEPIR  430



>ref|XP_007148434.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
 gb|ESW20428.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
Length=478

 Score =   239 bits (610),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 165/464 (36%), Positives = 239/464 (52%), Gaps = 49/464 (11%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             + M PWLA GHI P+  +AK LA +G  V   ++P N++ I    P++    I L+ L L
Sbjct  23    IAMLPWLAMGHIYPYFEVAKILAQKGHHVTFINSPKNIDRIPK-APKTLRPFITLVRLPL  81

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             P    LP   ++T  +P   +  LKK  +  +    ELLKT  PD + +D    W   +A
Sbjct  82    PHVQHLPEGAESTMDIPSTKNCFLKKAYEGLQDPVAELLKTSKPDWVFYDFAAAWVTPIA  141

Query  496   LSLNIPSVRFFTASA-----------AMCSYFTHMLTNPGAEYPFPA-LRLRQYEQTKTR  639
              SLNIP   +    A            M  Y    +  P    PFP  LRLR YE  +  
Sbjct  142   KSLNIPCAHYNITPAYNKVFFDPPKDKMKDYSIETICGPPTWLPFPTTLRLRPYEFLRAL  201

Query  640   ELMNQETRNFKREETLDTPANQA-----MMLVNSSREVEGKYIDYLSELMKSKVVSIGTT  804
                 Q  R+ +  E  D   N+A     + L+ +SRE+EG+++DYL+   K  VV +G  
Sbjct  202   ----QRNRDQETGEKADFDLNKAYSSCDLFLLRTSRELEGEWLDYLAGNYKVPVVPVGLL  257

Query  805   FQAPPPV---DHETE--------LTDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYGLE  951
                PP +   D E E        + +WL  K +SS V++ FGSE  L +EDL E+A G+E
Sbjct  258   ---PPSMQIRDAEEEDENPDWVTIKEWLDAKESSSVVYIGFGSELKLSQEDLTELANGIE  314

Query  952   ISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFVSH  1131
             +SG+ F W L+  K  E  +E  LP+GF ER  +RG + + WAPQ KIL H + GG +SH
Sbjct  315   LSGLPFFWALKNLK--EGVLE--LPEGFEERTKDRGVVWKSWAPQLKILAHGAIGGCMSH  370

Query  1132  CGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDEK-GKLHREEMAAALR  1308
             CG  S++E L+ G  ++ +P  LDQ + +R++ E   A+EV R EK G   R+ +A  LR
Sbjct  371   CGSGSVIEKLHFGHALVTLPYLLDQALFSRVLEEKKVAIEVPRSEKDGSFTRDSVAKTLR  430

Query  1309  ETVGGENGEKLKRNVKRI-----SENLRLAGNREMDAVVAELEK  1425
               +  E G  L++N K +     SE L    N  +D ++A L K
Sbjct  431   FAIVDEEGSSLRKNAKEMGKLFSSEELH---NHYIDDLIAALHK  471



>ref|XP_007018258.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY15483.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=466

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 236/463 (51%), Gaps = 41/463 (9%)
 Frame = +1

Query  136   VVMFPWLAYGHITPFVGLAKNLADRGFLVHLCSTPDNLNSIKNNIPQSYSQSIRLLELHL  315
             +VMFPWLA GH  PF  L+K LA RG  +   STP NL+ +   IP + S  I L+   L
Sbjct  9     IVMFPWLAMGHFIPFFRLSKLLAQRGHRISFVSTPRNLSKLPK-IPSNLSSQITLVSFPL  67

Query  316   PESPDLPPHYQTTNGLPLHLHDALKKVLKMAEPDFTELLKTLNPDLLIHDVVNLWAEKVA  495
             PE P+LP   +++  +  +    LK    + +P  T  L++  PD +I+D  + W   VA
Sbjct  68    PEVPNLPSLAESSMDITHNQQQPLKHAFDLLQPLLTSFLESSKPDWIIYDYASHWLPSVA  127

Query  496   LSLNIPSVRFFTASAAMCSYFT---HMLTNPG--------------AEYPFPA-LRLRQY  621
               L + S  FF    A C  F      L N G                 PF + L  R +
Sbjct  128   AQLGV-SRAFFAVFTAACLSFLGPPSALINGGDGARSTADDFTKVPKWVPFESNLAYRLH  186

Query  622   EQTKTRELMNQETRNFKREETLD---TPANQAMMLVNSSREVEGKYIDYLSELMKSKVVS  792
             E TK  E  +++T  F   +T+    T     ++++ SS E E  + + L +L +  V  
Sbjct  187   EITKYVERTDEDT--FGPPDTVRFGVTIQESDVVVIRSSDEFEPDWFNLLRQLFEKPVTP  244

Query  793   IGTTFQAPPPVDHETEL---------TDWLARKPASSTVFVSFGSEYFLRKEDLEEIAYG  945
             +G      PP+  E E+          +WL ++  +S V+V+ G+E  L KE+L ++A G
Sbjct  245   VGFL----PPILEEDEIQKDEKWVVVKEWLDKQRVNSVVYVALGTEVHLSKEELSDLAMG  300

Query  946   LEISGVNFIWVLRFPKGEEISVEEALPKGFLERIGERGRMVEGWAPQAKILGHRSTGGFV  1125
             LE SG+ F WVL+   G   S  + LP G  ER+  RG +  GW PQ KIL H S GGF+
Sbjct  301   LEKSGLPFFWVLKKSPGSSQSELDMLPDGLEERVKGRGFVHLGWVPQVKILSHESIGGFL  360

Query  1126  SHCGWNSIMESLNLGVPIIAMPMHLDQPMNARLMVEIGAAVEVERDE-KGKLHREEMAAA  1302
             +HCGWNS++E+L LG  +I  P+  DQ +NARL+ E    VE+ R+E  G    +E+A +
Sbjct  361   THCGWNSVIEALGLGRVLIMFPVLNDQGLNARLLHERKVGVEIPRNEIDGSFTSDEVAES  420

Query  1303  LRETVGGENGEKLKRNVKRISENLRLAGNRE--MDAVVAELEK  1425
             +R  V  E+G+ L+  V+ I       G  +  +D  V +LE+
Sbjct  421   VRLAVVEESGQSLRETVQAIKSYFGDKGRNDGYVDKFVRQLEE  463



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4318295211160