BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20536_g1_i1 len=1185 path=[1162:0-154 @1317@!:155-1024
2442:1025-1025 2187:1026-1184]

Length=1185
                                                                      Score     E

ref|XP_006342681.1|  PREDICTED: uncharacterized protein LOC102596842    177   3e-46   
ref|XP_004253020.1|  PREDICTED: uncharacterized protein LOC101244358    176   7e-46   
emb|CDO99320.1|  unnamed protein product                                174   2e-45   
ref|XP_009804994.1|  PREDICTED: uncharacterized protein DDB_G0292...    172   2e-44   
ref|XP_009621969.1|  PREDICTED: uncharacterized protein LOC104113496    169   2e-43   
ref|XP_011091348.1|  PREDICTED: uncharacterized protein LOC105171810    169   2e-43   
ref|XP_009604695.1|  PREDICTED: uncharacterized protein LOC104099416    166   4e-42   
ref|XP_009767920.1|  PREDICTED: uncharacterized protein LOC104218993    160   3e-40   
ref|XP_009795412.1|  PREDICTED: uncharacterized protein LOC104242110    156   6e-39   
ref|XP_009590587.1|  PREDICTED: ankyrin repeat-containing protein...    147   7e-36   
ref|XP_004247791.2|  PREDICTED: uncharacterized protein LOC101245204    141   8e-34   
gb|EYU32591.1|  hypothetical protein MIMGU_mgv1a006056mg                140   1e-33   
ref|XP_011073723.1|  PREDICTED: uncharacterized protein LOC105158612    139   4e-33   
gb|EYU43768.1|  hypothetical protein MIMGU_mgv1a006114mg                136   3e-32   
ref|XP_004234051.1|  PREDICTED: uncharacterized protein LOC101265801    133   4e-31   
ref|XP_006356117.1|  PREDICTED: uncharacterized protein LOC102592369    123   1e-27   
emb|CAN83108.1|  hypothetical protein VITISV_026570                     112   6e-24   Vitis vinifera
ref|XP_002282144.1|  PREDICTED: uncharacterized protein LOC100256206    110   3e-23   Vitis vinifera
ref|XP_010105208.1|  hypothetical protein L484_011265                   110   5e-23   
emb|CBI23723.3|  unnamed protein product                                107   3e-22   
ref|XP_002311697.2|  C2 domain-containing family protein                106   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_003590735.1|  RNA-binding protein 12B                            105   4e-21   
ref|XP_011029742.1|  PREDICTED: uncharacterized protein LOC105129399    101   5e-20   
ref|XP_003556915.1|  PREDICTED: uncharacterized protein LOC100779058  99.0    2e-19   
ref|XP_007035276.1|  Calcium-dependent lipid-binding family prote...  97.8    6e-19   
ref|XP_009357966.1|  PREDICTED: uncharacterized protein LOC103948651  97.8    7e-19   
ref|XP_008340669.1|  PREDICTED: uncharacterized protein LOC103403599  95.5    4e-18   
ref|XP_004495257.1|  PREDICTED: proteoglycan 4-like                   92.8    5e-17   
ref|XP_004297932.1|  PREDICTED: uncharacterized protein LOC101311957  92.0    8e-17   
ref|XP_011041447.1|  PREDICTED: uncharacterized protein LOC105137420  90.1    3e-16   
ref|XP_007226487.1|  hypothetical protein PRUPE_ppa026634mg           89.4    5e-16   
ref|XP_006489752.1|  PREDICTED: uncharacterized protein DDB_G0271...  88.6    1e-15   
ref|XP_002314508.1|  C2 domain-containing family protein              87.8    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006303752.1|  hypothetical protein CARUB_v10011922mg           88.2    1e-15   
ref|XP_003555498.1|  PREDICTED: uncharacterized protein LOC100812185  87.8    2e-15   
ref|XP_002889512.1|  hypothetical protein ARALYDRAFT_470434           87.4    2e-15   
ref|NP_180890.1|  calcium-dependent lipid-binding domain-containi...  87.4    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO41882.1|  hypothetical protein CISIN_1g041258mg                 87.0    3e-15   
ref|XP_006420366.1|  hypothetical protein CICLE_v10006849mg           87.0    3e-15   
ref|XP_010457504.1|  PREDICTED: uncharacterized protein LOC104738975  87.0    4e-15   
ref|XP_010483923.1|  PREDICTED: uncharacterized protein LOC104762347  86.7    4e-15   
ref|XP_004147189.1|  PREDICTED: uncharacterized protein LOC101215059  86.7    5e-15   
ref|XP_008460692.1|  PREDICTED: uncharacterized protein LOC103499460  86.7    5e-15   
ref|XP_004173200.1|  PREDICTED: uncharacterized LOC101215059          86.7    5e-15   
ref|XP_010522448.1|  PREDICTED: uncharacterized protein LOC104801063  86.3    6e-15   
ref|NP_171948.1|  calcium-dependent lipid-binding domain-containi...  85.9    8e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475114.1|  PREDICTED: uncharacterized protein LOC104754591  84.7    2e-14   
ref|XP_010025827.1|  PREDICTED: uncharacterized protein LOC104416087  84.3    2e-14   
emb|CDX89815.1|  BnaA10g02670D                                        84.3    2e-14   
gb|KCW57324.1|  hypothetical protein EUGRSUZ_H00123                   84.3    2e-14   
emb|CDY18242.1|  BnaC05g02650D                                        83.6    3e-14   
ref|XP_010026783.1|  PREDICTED: protein bunched, class 2/F/G isof...  83.6    4e-14   
ref|XP_002881275.1|  C2 domain-containing protein                     83.6    5e-14   
ref|XP_010469493.1|  PREDICTED: uncharacterized protein LOC104749540  83.6    5e-14   
ref|XP_010667096.1|  PREDICTED: uncharacterized protein LOC104884184  82.8    7e-14   
ref|XP_010509905.1|  PREDICTED: serine/arginine repetitive matrix...  82.8    8e-14   
ref|XP_006293875.1|  hypothetical protein CARUB_v10022860mg           82.8    8e-14   
emb|CDY37732.1|  BnaA04g19360D                                        82.8    9e-14   
ref|XP_006410470.1|  hypothetical protein EUTSA_v10016412mg           82.4    1e-13   
ref|XP_009141305.1|  PREDICTED: uncharacterized protein LOC103865261  82.4    1e-13   
gb|KFK42792.1|  hypothetical protein AALP_AA1G039700                  82.0    1e-13   
ref|XP_010413889.1|  PREDICTED: uncharacterized protein LOC104700118  82.0    2e-13   
ref|XP_009119477.1|  PREDICTED: uncharacterized protein LOC103844449  81.6    2e-13   
emb|CDY23753.1|  BnaC04g43690D                                        81.6    2e-13   
ref|XP_010556931.1|  PREDICTED: uncharacterized protein LOC104826097  80.9    4e-13   
ref|XP_002528347.1|  hypothetical protein RCOM_1217340                80.1    5e-13   Ricinus communis
gb|AAB80639.1|  Contains similarity to Glycine SRC2 (gb|AB000130)     80.5    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003535258.1|  PREDICTED: uncharacterized protein LOC100787698  79.3    1e-12   
ref|XP_003590193.1|  hypothetical protein MTR_1g045780                78.6    2e-12   
gb|KDP33324.1|  hypothetical protein JCGZ_12873                       78.2    2e-12   
ref|XP_006418119.1|  hypothetical protein EUTSA_v10007144mg           76.3    1e-11   
ref|XP_004497792.1|  PREDICTED: uncharacterized protein LOC101505544  74.3    5e-11   
emb|CDY59181.1|  BnaC08g50140D                                        74.3    5e-11   
emb|CDY53195.1|  BnaAnng12200D                                        74.3    5e-11   
ref|XP_009118638.1|  PREDICTED: uncharacterized protein LOC103843645  74.3    5e-11   
ref|XP_004152866.1|  PREDICTED: uncharacterized protein LOC101218582  73.2    6e-11   
ref|XP_004155136.1|  PREDICTED: uncharacterized protein LOC101227028  73.2    7e-11   
ref|XP_007144140.1|  hypothetical protein PHAVU_007G132000g           73.2    1e-10   
ref|XP_006577748.1|  PREDICTED: uncharacterized protein LOC102667983  72.4    1e-10   
gb|KCW60206.1|  hypothetical protein EUGRSUZ_H02915                   72.4    2e-10   
emb|CDY17161.1|  BnaA05g10270D                                        69.3    5e-10   
ref|XP_008441789.1|  PREDICTED: uncharacterized protein LOC103485843  70.5    6e-10   
ref|XP_007205372.1|  hypothetical protein PRUPE_ppa007276mg           69.3    1e-09   
emb|CDY19481.1|  BnaC04g11180D                                        68.6    3e-09   
ref|XP_010102203.1|  hypothetical protein L484_024484                 67.0    8e-09   
ref|XP_009143873.1|  PREDICTED: uncharacterized protein LOC103867544  67.0    1e-08   
ref|XP_004304780.1|  PREDICTED: uncharacterized protein LOC101296310  66.2    2e-08   
ref|XP_008370760.1|  PREDICTED: uncharacterized protein LOC103434221  65.5    3e-08   
ref|XP_002521996.1|  conserved hypothetical protein                   65.1    3e-08   Ricinus communis
ref|XP_002325345.1|  hypothetical protein POPTR_0019s03780g           65.1    3e-08   Populus trichocarpa [western balsam poplar]
gb|KDP23730.1|  hypothetical protein JCGZ_23563                       65.1    3e-08   
ref|XP_008218351.1|  PREDICTED: uncharacterized protein LOC103318712  65.1    4e-08   
ref|XP_011036375.1|  PREDICTED: uncharacterized protein LOC105133911  64.7    4e-08   
emb|CDP04278.1|  unnamed protein product                              64.7    4e-08   
ref|XP_009379739.1|  PREDICTED: uncharacterized protein LOC103968123  64.3    6e-08   
ref|XP_008366882.1|  PREDICTED: uncharacterized protein LOC103430513  64.3    6e-08   
ref|XP_008388740.1|  PREDICTED: uncharacterized protein LOC103451084  64.3    6e-08   
ref|XP_009343786.1|  PREDICTED: uncharacterized protein LOC103935702  64.3    7e-08   
gb|EYU39519.1|  hypothetical protein MIMGU_mgv1a012935mg              61.6    1e-07   
ref|XP_011077059.1|  PREDICTED: uncharacterized protein LOC105161156  60.1    1e-06   
ref|XP_007147205.1|  hypothetical protein PHAVU_006G104400g           59.7    2e-06   
ref|XP_004494967.1|  PREDICTED: uncharacterized protein LOC101508328  57.8    6e-06   
ref|XP_010043310.1|  PREDICTED: uncharacterized protein LOC104432551  57.8    6e-06   
gb|KCW85316.1|  hypothetical protein EUGRSUZ_B02156                   57.8    7e-06   
gb|KEH24577.1|  calcium-dependent lipid-binding (CaLB domain) fam...  56.2    3e-05   
ref|XP_010557577.1|  PREDICTED: uncharacterized protein LOC104826528  53.5    2e-04   
ref|XP_010264865.1|  PREDICTED: uncharacterized protein LOC104602763  52.4    4e-04   
ref|XP_011038591.1|  PREDICTED: uncharacterized protein LOC105135426  51.6    7e-04   
ref|XP_008224037.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.6    8e-04   
ref|XP_007145354.1|  hypothetical protein PHAVU_007G232100g           51.2    0.001   



>ref|XP_006342681.1| PREDICTED: uncharacterized protein LOC102596842 [Solanum tuberosum]
Length=528

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 130/285 (46%), Positives = 160/285 (56%), Gaps = 59/285 (21%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNK---SYQKGKAISVVSDSITIKD  837
             +K SSILS S ++P P    + KGKASSVI+ A+++ K   + +KGK+ SV+SDSI  K+
Sbjct  238   EKESSILSIS-FEP-PKHMMKKKGKASSVISGAELREKLKTNNKKGKSGSVLSDSIVSKE  295

Query  836   SS-------------PSGKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVD--------  720
             SS                    + E   K K + E K G    DSPT K VD        
Sbjct  296   SSCYIHRPKPKPKDEKPKLKLIELEFGDKEKPINEKKGGT---DSPTTKVVDEKSITIKP  352

Query  719   ------------------GKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEV  594
                               GKP +    G+DYG  K   G    + GGP KA+S+ SDSEV
Sbjct  353   NKGLGLDVSPKERQTTVIGKPMLRNNGGFDYGGPKGQNGK--FVFGGPLKAHSVWSDSEV  410

Query  593   GPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYA  423
             GPSPSEVAAA+AE+ +YPLE+   SVLDGWS DESVEGLRS+LERWRTE+PPLYD+ G A
Sbjct  411   GPSPSEVAAAIAEK-KYPLEEEKSSVLDGWSIDESVEGLRSKLERWRTELPPLYDR-GMA  468

Query  422   PTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
              +S             R    GG G  SCFGN +GYECQCVCG+P
Sbjct  469   SSSYHSTGR-----HTRRHTDGGSGLFSCFGNFYGYECQCVCGKP  508



>ref|XP_004253020.1| PREDICTED: uncharacterized protein LOC101244358 [Solanum lycopersicum]
Length=534

 Score =   176 bits (446),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 170/291 (58%), Gaps = 66/291 (23%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNK---SYQKGKAISVVSDSITIKD  837
             +K SSILS S ++P P    + KGKASSVI+ A+++ K   + +KGK+ SV+SDSI  K+
Sbjct  239   EKESSILSIS-FEP-PKHMMKKKGKASSVISGAELREKPKTNNKKGKSGSVLSDSIVSKE  296

Query  836   SS-------------------PSGKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVD--  720
             SS                   P  K+  + E   K K + E K G    DSPT K VD  
Sbjct  297   SSSYLHRPKPKDYRPKPKDEKPKLKL-IELEFGDKEKPINEKKAG---TDSPTTKVVDEK  352

Query  719   ------------------------GKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSI  612
                                     GKP +    G+DYG  K G   + V GG P KA+S+
Sbjct  353   SITIKPNKNLGHDVSPKERQTPVIGKPMLRNNGGFDYGGPK-GQNGKFVFGG-PLKAHSV  410

Query  611   MSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLY  441
              SDSEVGPSPSEVAAA+AE+ +YPLE+   SVLDGWS DESVEGLRS+LERWRTE+PPLY
Sbjct  411   WSDSEVGPSPSEVAAAIAEK-KYPLEEEKSSVLDGWSIDESVEGLRSKLERWRTELPPLY  469

Query  440   DQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             D+ G A +  S+ S+ ++T   R    GG G  SCFGN +GYECQCVCG+P
Sbjct  470   DR-GMASS--SYHSTGRHT---RRHTDGGSGLFSCFGNFYGYECQCVCGKP  514



>emb|CDO99320.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/253 (49%), Positives = 153/253 (60%), Gaps = 46/253 (18%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGK----AISVVSDSITIKDSSPSGKIGNKNEAQAKN-KEV  777
            KGKASSVI+ A+++ K   +GK    + SV+SDS+  K+SS       +  A+A + K  
Sbjct  256  KGKASSVISGAELREKPKSRGKRGGKSGSVLSDSVVSKESSYVRPKDRQPVAKATDLKPA  315

Query  776  VENKNG---PRFD---DSPTNKTVD---------------------GKPNIPKIPGYDYG  678
            V+ K     P  D   + PTNK VD                     GKP +PK+ GY+YG
Sbjct  316  VKTKGANPKPGSDLGSEPPTNKAVDDKYVTISKAIPPLKEPPKMAIGKP-VPKLNGYEYG  374

Query  677  SAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSC  507
               P    + V G  P KANS+ SDSEVGPSPSEVAAAMAE+ +YPL++   SVLDGWS 
Sbjct  375  G--PKANGKYVFGA-PMKANSLWSDSEVGPSPSEVAAAMAEK-KYPLDEERSSVLDGWSL  430

Query  506  DESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGN  327
            DESVEGLRS+LERWRTE+PPLYD+ GYA +S            KR    GG G  SCFGN
Sbjct  431  DESVEGLRSKLERWRTELPPLYDR-GYASSSFQSTGH-----HKRRHTDGGTGMFSCFGN  484

Query  326  IFGYECQCVCGQP  288
            I+GYECQC+CG+P
Sbjct  485  IYGYECQCICGKP  497



>ref|XP_009804994.1| PREDICTED: uncharacterized protein DDB_G0292186-like [Nicotiana 
sylvestris]
Length=526

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 157/271 (58%), Gaps = 44/271 (16%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTE--ETKGKASSVINAADVKNK---SYQKGKAISVVSDSITI  843
             +K SSILS S+     PPT   + KGKASS I+ A+++ K     +KGK+ SV+SDSI  
Sbjct  249   EKESSILSISF----EPPTHMMKKKGKASSFISGAELREKPKSEGKKGKSGSVLSDSIVS  304

Query  842   KDSSPSG------------------KIGNKNEAQAK--NKEVVENKNGPRFDDSPTNKTV  723
             K+SS                     ++GNKNE   K  +++ +    G    D P   T+
Sbjct  305   KESSSYNWANNEKPKPKPKLKLIELEMGNKNEPTTKVIDEQSITKSKGLGVSDKPKETTI  364

Query  722   --DGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERP  549
                GKP I K  G +YG  K    +   + GGP KANS+ S+SE+GPS SEVAAA+ E+ 
Sbjct  365   PQIGKP-IMKYSGNEYGGPKGPIQNGKFVYGGPLKANSLFSESEIGPSASEVAAALVEK-  422

Query  548   RYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAK  378
             RYPL+D   SVLDGWS DESVEGLRS+LERWRTE+PP+YD+           SS   T +
Sbjct  423   RYPLDDKKSSVLDGWSLDESVEGLRSKLERWRTELPPIYDR-------GMDSSSYHSTGR  475

Query  377   K-RgsgsgggGPLSCFGNIFGYECQCVCGQP  288
               R    GG    SCFGNI G+ECQC+CG+P
Sbjct  476   HPRRHSDGGSSLFSCFGNICGFECQCICGKP  506



>ref|XP_009621969.1| PREDICTED: uncharacterized protein LOC104113496 [Nicotiana tomentosiformis]
Length=523

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 157/269 (58%), Gaps = 42/269 (16%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTE--ETKGKASSVINAADVKNK---SYQKGKAISVVSDSITI  843
             DK SSILS S+     PPT   + KGKASSVI+ A+++ K     +KGK+ SV+SDSI  
Sbjct  248   DKESSILSISF----EPPTHMIKKKGKASSVISGAELREKPKSESKKGKSGSVLSDSIVS  303

Query  842   KDSSPSG----------------KIGNKNEAQAK--NKEVVENKNGPRFDDSPTNKTV--  723
             K+SS                   ++GNKNE   K  + + V    G    + P    +  
Sbjct  304   KESSSYNWPNNKKPKPKLKLIELEMGNKNEPTTKVIDDQSVTKSKGLGVGEKPKETPIPQ  363

Query  722   DGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRY  543
              GKP I K  G +YG  K    +   + GGP KANS+ S+SE+GPS SEVAAA+ E+ RY
Sbjct  364   IGKP-IVKYSGNEYGGPKGPMQNGKFVYGGPLKANSLWSESEIGPSASEVAAALVEK-RY  421

Query  542   PLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKK-  375
             PL+D   SVLDGWS DES EGLRS+LERWRTE+PP+YD+ G A +      S   T +  
Sbjct  422   PLDDKKSSVLDGWSLDESTEGLRSKLERWRTELPPIYDR-GMASS------SYHSTGRHP  474

Query  374   RgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             R    GG    SCFGNI G+ECQC+CG+P
Sbjct  475   RRHSDGGSSLFSCFGNICGFECQCICGKP  503



>ref|XP_011091348.1| PREDICTED: uncharacterized protein LOC105171810 [Sesamum indicum]
Length=545

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 148/256 (58%), Gaps = 52/256 (20%)
 Frame = -2

Query  938  GKASSVINAADVKNKSYQKGK----AISVVSDSITIKDSSPSGKIGNKNEAQAKNKE-VV  774
            GKASSVI+ A+++ K  QKGK    A SV+SDSI  K+SS       K E   K K+  +
Sbjct  280  GKASSVISGAELREKPKQKGKKSGKAGSVLSDSILSKESSV-----RKVETSLKTKDDAI  334

Query  773  ENKNG--PRFD---DSPTNKTVD-------------------------GKPNIPKIPGYD  684
            E K+   P  D   D  TNK VD                         GKP + K  G D
Sbjct  335  EEKDNENPGTDESGDKATNKVVDEKSGTKAKVVNNGDSPKEKLPVATIGKP-VGKYNGND  393

Query  683  YGSAK-PGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDG  516
            YG++K P    + VIG    K NS+ SDSEVGPSPSEVAA MAE+ +YPLED   SVLDG
Sbjct  394  YGASKGPLPQGKCVIGAPVKKGNSLWSDSEVGPSPSEVAAVMAEK-KYPLEDNQSSVLDG  452

Query  515  WSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSC  336
            WS DESVEGLRS+LERWR E+PPLYD+ G++ +S             R     G G LSC
Sbjct  453  WSLDESVEGLRSKLERWRMELPPLYDR-GFSTSSYKSSG-----PHPRRRTDKGSGLLSC  506

Query  335  FGNIFGYECQCVCGQP  288
            FGNIFGYECQC+CG+P
Sbjct  507  FGNIFGYECQCICGKP  522



>ref|XP_009604695.1| PREDICTED: uncharacterized protein LOC104099416 [Nicotiana tomentosiformis]
Length=545

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 168/294 (57%), Gaps = 67/294 (23%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQKGKAI---SVVSDSITIKD  837
             +K SSILS S ++P P    + KGKASSVI+ A+++ K   K K     SV+SDSI  K+
Sbjct  245   EKESSILSIS-FEP-PKHMMKKKGKASSVISGAELREKPKTKDKKGKSGSVLSDSIVSKE  302

Query  836   SS----------PSGKIGNK------------NEAQAKNKEVVENKNGPRFDDSPTNKTV  723
             SS          P  K  N+             E   K+K + E K G    DSPT K V
Sbjct  303   SSSLINRPKDDKPKPKENNRPKDEKPKLKLIELELGDKDKPINEKKTG---TDSPTTKAV  359

Query  722   D------------------------GKPNIPKIPGYDYGSAKPGTGSR--LVIGGGPYKA  621
             D                        GKP +P+  GYDYG  K     +    + GGPYKA
Sbjct  360   DEKSVTKSKGLGVGEMPKEKQTTVIGKP-MPRNGGYDYGGPKGLGPGKNGKFVFGGPYKA  418

Query  620   NSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVP  450
             +S+ SDSEVGPSPSEVAA MAE+ +YPLE+   SVLDGWS DESVEGLRS+LERWRTE+P
Sbjct  419   HSMWSDSEVGPSPSEVAAIMAEK-KYPLEEEKSSVLDGWSLDESVEGLRSKLERWRTELP  477

Query  449   PLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             PLYD+ G A +  S+ S+ ++T   R    GG G  SCFGN +GYECQC+CG+P
Sbjct  478   PLYDR-GMASS--SYHSTGRHT---RRHTDGGSGLFSCFGNFYGYECQCICGKP  525



>ref|XP_009767920.1| PREDICTED: uncharacterized protein LOC104218993 [Nicotiana sylvestris]
Length=520

 Score =   160 bits (404),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 160/277 (58%), Gaps = 53/277 (19%)
 Frame = -2

Query  1010  YDKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQKGKAISVVSDSITIKDSS  831
             YDK SSILS S  +P P    + KGKASSVI+ A++K KS  KGKA SV+SDSI  K+SS
Sbjct  242   YDKESSILSIS-LEPPPQMLVKKKGKASSVISGAELKEKSKPKGKAGSVLSDSIMSKESS  300

Query  830   PSGKIGNK-NEAQAKNKEV---VENKNGPRFDDSPTNK----------------------  729
                 I N   E + K K +   +ENK  P  +  PTN                       
Sbjct  301   ----IYNGPKEEKPKLKLITLELENKGKPINEKKPTNDSSTTKVVDEKSITKPKGLDASG  356

Query  728   ------TVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIM-SDSEVGPSPSEVA  570
                   TV GKP IPK  GY++G  K    +   + GGP K N+   +DSE+GPS SEVA
Sbjct  357   KQDEPITVIGKP-IPKYNGYEFGGPKGSGHNGKYVFGGPIKGNTHHWTDSEIGPSASEVA  415

Query  569   AAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrs  399
             AA+A + +YPLED   SVLDGWS DES EGLRS+LERWR E+PP+YD+ G+A +S     
Sbjct  416   AAVAGK-KYPLEDQKSSVLDGWSLDESTEGLRSKLERWRMELPPVYDR-GHASSS-----  468

Query  398   sSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
                Y +  R +    G   SCFGNI GYECQC+CG+P
Sbjct  469   ---YRSTGRHTHGSSGL-FSCFGNIMGYECQCICGKP  501



>ref|XP_009795412.1| PREDICTED: uncharacterized protein LOC104242110 [Nicotiana sylvestris]
Length=545

 Score =   156 bits (395),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 159/297 (54%), Gaps = 67/297 (23%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQKGKAI---SVVSDSITIKD  837
             +K SSILS S ++P      + KGKASSVI+ A+++ K   K K     SV+SDSI  K+
Sbjct  239   EKESSILSIS-FEPPKHMMMKKKGKASSVISGAELREKPKTKDKKGKSGSVLSDSIVSKE  297

Query  836   SS-----------PSGKIGNK------------NEAQAKNKEVVENKNGPRFDDSPTNKT  726
             SS           P  K  N+             E   K+K + E K G    DSPT K 
Sbjct  298   SSSLINRPKDDHKPKPKDNNRPKDEKPKLKLIELELGDKDKPINEKKTGTG-TDSPTTKA  356

Query  725   VD------------------------GKPNIPKIPGYDYGSAKPGTGSRL----VIGGGP  630
             VD                        GKP +P   GYDYG  K            + GGP
Sbjct  357   VDEKSVTKSKGLGVGDMPKEKQTTVIGKP-MPSNGGYDYGGPKGLGPGPGQNGKFVFGGP  415

Query  629   YKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRT  459
             YKA+S+ SDSEVGPSPSEVAA MAE+ +YPLE+   SVLDGWS DESVEGLRS+LERWRT
Sbjct  416   YKAHSMWSDSEVGPSPSEVAAIMAEK-KYPLEEEKSSVLDGWSLDESVEGLRSKLERWRT  474

Query  458   EVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             E+PPLYD+ G A +S             R    GG G  SCFGN +GYECQC+CG+P
Sbjct  475   ELPPLYDR-GMASSSYHSTGR-----HTRRHTDGGSGLFSCFGNFYGYECQCICGKP  525



>ref|XP_009590587.1| PREDICTED: ankyrin repeat-containing protein kinase A-like [Nicotiana 
tomentosiformis]
Length=535

 Score =   147 bits (372),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 164/282 (58%), Gaps = 53/282 (19%)
 Frame = -2

Query  1010  YDKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQKGKAI---SVVSDSITIK  840
             YDK SSILS S  +P P    + KGKASSVI+ A++K KS  KGK     SV+SDSI  K
Sbjct  247   YDKESSILSIS-LEPPPQMMVKKKGKASSVISGAELKEKSKPKGKKGKAGSVLSDSIMSK  305

Query  839   DSSPSGKIGNKNE--------AQAKNKEVVENKNGPRFDDSPTNKTVD------------  720
             +SS     G+K E         + +NKE   N+  P  +DS T K VD            
Sbjct  306   ESSIYN--GSKEEKPKLKLIALELENKEKPTNEKKPT-NDSSTTKVVDEKSITKPKGLDA  362

Query  719   --------------GKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIM-SDSEVGPS  585
                           GKP IPK  GY++G  K    +   + GGP K N+   +DSE+GPS
Sbjct  363   SGKQDEPKEPITVIGKP-IPKYSGYEFGGPKGSGHNGKFVFGGPIKGNTHHWTDSEIGPS  421

Query  584   PSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTs  414
              SEVAAA+AE+ +YPLED   SVLDGWS DES EGLRS+LERWR E+PP+YD+     TS
Sbjct  422   ASEVAAAVAEK-KYPLEDQKSSVLDGWSLDESTEGLRSKLERWRMELPPVYDR---GHTS  477

Query  413   ssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             SS+ S+ ++T   R    G  G  SCFGNI GYECQC+CG+P
Sbjct  478   SSYHSTGRHT---RRHTHGSSGLFSCFGNIMGYECQCICGKP  516



>ref|XP_004247791.2| PREDICTED: uncharacterized protein LOC101245204 [Solanum lycopersicum]
Length=521

 Score =   141 bits (356),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 159/279 (57%), Gaps = 38/279 (14%)
 Frame = -2

Query  1037  SIKKFNKFNYDKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQKGKAISVVS  858
             S KK    NYDK SSILS S  +P P    + KGKASS+++    +    +KGK  SV+S
Sbjct  233   SKKKNKAHNYDKESSILSIS-LEPPPQMLVKKKGKASSMVSGPKEEKPKDKKGKTGSVLS  291

Query  857   DSITIKDSSP---------------SGKIGNK----NEAQAKNKEV----VENKN--GPR  753
             DSI  K+SS                + ++ NK    NE +   K +    VE K+   P+
Sbjct  292   DSIVSKESSLYNIGPKEDKPKLKLIALELENKEKPTNEKKVDEKSLTKPKVEEKSLTKPK  351

Query  752   FDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIM-SDSEVGPSPSE  576
              D+     TV GKP I    GY++G  K    +   + GGP K N+   +DSE+GPS SE
Sbjct  352   VDEPKEPITVIGKP-IQNYNGYEFGGPKGVGHNGKFVFGGPIKGNAHHWTDSEIGPSASE  410

Query  575   VAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssf  405
             VAAA+AE+ +YPL+D   S+LDGWS DESVEGLRS+LERWRTEVPP+YD+ G A +S   
Sbjct  411   VAAAVAEK-KYPLDDQKSSMLDGWSLDESVEGLRSKLERWRTEVPPVYDR-GQASSSYRS  468

Query  404   rssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
                       R    G  G  SCFGNI G+ECQC+CG+P
Sbjct  469   TGR-----HARRHARGSSGLFSCFGNIMGFECQCICGKP  502



>gb|EYU32591.1| hypothetical protein MIMGU_mgv1a006056mg [Erythranthe guttata]
Length=459

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 130/225 (58%), Gaps = 29/225 (13%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGKAISVVSDSITI---KDSSPSGKIGNKNEAQAKNKEVVE  771
            KGKASSVI+ A++++K  +  K     S        K SS   KIG K     +  ++ +
Sbjct  234  KGKASSVISGAELRDKKPKHKKGGKPSSVVSDSVYSKGSSSFFKIGQK-----ETTKISD  288

Query  770  NKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGP-YKANSIMSDSEV  594
              NG      PTNK        P IP      AK  T      G  P YKA+SI SDSEV
Sbjct  289  ESNG-----VPTNK--------PPIPTIGKPIAKGPTKYGGGGGHHPQYKASSIWSDSEV  335

Query  593  GPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYA  423
            GPSPSEVAAAM    RYPL+D   SVLDGWS DESVEGLRS+LERWR E+PPLYD  G++
Sbjct  336  GPSPSEVAAAMMAERRYPLDDNQSSVLDGWSMDESVEGLRSKLERWRMELPPLYDN-GFS  394

Query  422  PTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             +S           ++R  GSGG G  SCFGNI GYECQCVCG+P
Sbjct  395  SSSYKSSGR---QVRRRNEGSGGSGLFSCFGNICGYECQCVCGKP  436



>ref|XP_011073723.1| PREDICTED: uncharacterized protein LOC105158612 [Sesamum indicum]
Length=505

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 121/188 (64%), Gaps = 16/188 (9%)
 Frame = -2

Query  842  KDSSPSGKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPG  663
            KD+    K+G+  +A+  +++ V  K G +   SP +K V     IP I   +     P 
Sbjct  309  KDNRGDKKLGSPEKAKVVDEKSVGIK-GVQNSGSPKHKAV-----IPTILKPNGAQKGPL  362

Query  662  TGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSCDESVE  492
               + VIG  P+K NSI+SDSEVGPSPSEVAAA+A+R RY  +D   SVLDGWS DESVE
Sbjct  363  PIGKPVIGA-PFKGNSIVSDSEVGPSPSEVAAALAQR-RYLQDDNQSSVLDGWSLDESVE  420

Query  491  GLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYE  312
            GLRS+LERWRTE+PPLYD  G++ TSS   S  Q+    R    GG G  SCFGNI GYE
Sbjct  421  GLRSKLERWRTELPPLYDN-GFS-TSSYKSSGGQHG---RRHSDGGSGLFSCFGNICGYE  475

Query  311  CQCVCGQP  288
            CQC+CG+P
Sbjct  476  CQCICGKP  483



>gb|EYU43768.1| hypothetical protein MIMGU_mgv1a006114mg [Erythranthe guttata]
Length=456

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 125/222 (56%), Gaps = 37/222 (17%)
 Frame = -2

Query  938  GKASSVINAADVKNKSYQ---KGKAISVVSDSITIKDSSPSGKIGNKNEAQAKNKEVVEN  768
            GKASSVIN A+++ K  Q   KGKA SVVSDSI  K+S+       KNE     K++ E 
Sbjct  242  GKASSVINGAELREKPRQRGKKGKAGSVVSDSIVSKESTSF----RKNETPVLIKKIEEG  297

Query  767  K--NGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEV  594
               N P+     +   V   P +  I        KP   S+ VIG    K  SI SDSEV
Sbjct  298  NTVNFPK----ESKAAVTTPPPVATI-------GKPI--SKYVIGAPAKKGGSIWSDSEV  344

Query  593  GPSPSEVAAAMAERPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTs  414
            GPSPSEVAAAMA++ R             DESVEGLRS+L+RWR E+PPLYD  G   +S
Sbjct  345  GPSPSEVAAAMADQRR------------VDESVEGLRSKLDRWRMELPPLYDDRGGCSSS  392

Query  413  ssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
            S   S+ ++    R     G G  SCFGNIFGYECQCVCG+P
Sbjct  393  SYKSSTVRHA---RRHTDNGSGLFSCFGNIFGYECQCVCGKP  431



>ref|XP_004234051.1| PREDICTED: uncharacterized protein LOC101265801 [Solanum lycopersicum]
Length=485

 Score =   133 bits (335),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 151/262 (58%), Gaps = 52/262 (20%)
 Frame = -2

Query  1013  NYDKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKN-KSYQKGKAI---SVVSDSIT  846
             +++K SSILS S ++P P    + KGKASSVIN A++ N KS  + K I   SV+SDSI 
Sbjct  235   DHEKESSILSIS-FEP-PIHMMKKKGKASSVINGAELINEKSKLENKKIKTSSVLSDSIV  292

Query  845   IKDSSPSGKIGNKNEAQAKNKEVVENKNGPRFD---------DSPTNKTVDGKP---NIP  702
              K SS    I +K   + K K ++E + GP+++         D PT K +D +    +  
Sbjct  293   SKGSS----IYDKPNPKPKLK-LIELEMGPKYEPINEKGPCYDPPTTKEIDEQSITKSSM  347

Query  701   KIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---  531
             KI G ++G  K           GP      +++SE+GPS S VAAA+ ER  Y L+D   
Sbjct  348   KIYGNEFGGPK-----------GP------LTESEIGPSASIVAAALVERG-YLLDDKRS  389

Query  530   SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKK-Rgsgsgg  354
             SVLDGWS DES EGLRS+LERWR E+PP+ ++        +  SS + T +  R   SGG
Sbjct  390   SVLDGWSIDESTEGLRSKLERWRNEIPPVQNR-------GTGSSSYRSTGRHPRRRSSGG  442

Query  353   gGPLSCFGNIFGYECQCVCGQP  288
                 SCFGNI GYECQC+CG+P
Sbjct  443   SSLFSCFGNICGYECQCMCGKP  464



>ref|XP_006356117.1| PREDICTED: uncharacterized protein LOC102592369 [Solanum tuberosum]
Length=482

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 151/257 (59%), Gaps = 44/257 (17%)
 Frame = -2

Query  1013  NYDKGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNK----SYQKGKAISVVSDSIT  846
             +++K SSILS S ++P P    + KGKASSVIN A++ N+      +K KA SV+SDSI 
Sbjct  234   DHEKESSILSIS-FEP-PIHMMKKKGKASSVINGAELINEKSKLENKKIKASSVLSDSIV  291

Query  845   IKDS----SPSGKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVD----GKPNIPKIPG  690
              K S     P  KI    E +   K+   N  GP   D PT K +D     KP I KI G
Sbjct  292   SKGSYIYEKPKSKI-KLIELEIGPKDEPINGKGPG-SDPPTTKAIDEQSVTKP-IMKIYG  348

Query  689   YDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLD  519
              ++G  K           GP      +++SE+GPS S VAAA+AER  YPL+D   SVL+
Sbjct  349   NEFGGPK-----------GP------LTESEIGPSASVVAAALAERG-YPLDDKRSSVLE  390

Query  518   GWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLS  339
             GWS DES EGL+S+LERWR E+PP+ ++      SSS+ S+ ++T   R   SGG    S
Sbjct  391   GWSIDESTEGLKSKLERWRNEIPPIQNR---GTGSSSYHSTGRHT---RRHSSGGSSLFS  444

Query  338   CFGNIFGYECQCVCGQP  288
             CFGNI GYECQC+CG+P
Sbjct  445   CFGNICGYECQCMCGKP  461



>emb|CAN83108.1| hypothetical protein VITISV_026570 [Vitis vinifera]
Length=494

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 129/270 (48%), Gaps = 51/270 (19%)
 Frame = -2

Query  962  PPPTEETKGKASSVINAADVKNKSYQK---GKAISVVS-----DSITIKDSSPSGKIGNK  807
            P    +T GKASS+I+ +    +S  K   GKA SV+S     D +  K  + +  + N 
Sbjct  220  PRKRNKTSGKASSMISGSSAGGRSKGKVKSGKASSVISGSEFVDLLKKKSGAKASSMLNG  279

Query  806  NEAQ---AKNKEVVENKNGPRFDDSPTNKTVDGKPNI----------------PKIPGYD  684
            +E      KNK  + +       + P  K  +GK +                  K  G+D
Sbjct  280  SEVSYPVIKNKGSILSAGSTDLGE-PLMKKTNGKADSLINSSEGGEFTKGKVGSKFIGFD  338

Query  683  YGSAK-----------PGTGS----RLVIGGGP--YKANSIMSDSEVGPSPSEVAAAMAE  555
            +GS             PG G     +L   GGP      S++S+SEVGPSPSEVAAA+A 
Sbjct  339  FGSKATPKTSGLEFWGPGKGGLRSFKLNDYGGPKNITTGSMLSESEVGPSPSEVAAAIAH  398

Query  554  RPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYT  384
                  ED   S LDGWS + S EGLRS+L+RWRTE+PPLYD+  Y    +      ++T
Sbjct  399  DRCRQAEDGNNSALDGWSLNSSEEGLRSKLQRWRTELPPLYDRGAYGIYRTPGGHVRRHT  458

Query  383  AKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
                  GSG     SCFGNI GYEC  VCG
Sbjct  459  EGDEPDGSGL---FSCFGNICGYECSIVCG  485



>ref|XP_002282144.1| PREDICTED: uncharacterized protein LOC100256206 [Vitis vinifera]
Length=494

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 129/270 (48%), Gaps = 51/270 (19%)
 Frame = -2

Query  962  PPPTEETKGKASSVINAADVKNKSYQK---GKAISVVS-----DSITIKDSSPSGKIGNK  807
            P    +T GKASS+I+ +    +S  K   GKA SV+S     D +  K  + +  + N 
Sbjct  220  PRKRNKTSGKASSMISGSSAGGRSKGKMKSGKASSVISGSEFVDLLKKKSGAKASSMLNG  279

Query  806  NEAQ---AKNKEVVENKNGPRFDDSPTNKTVDGKPNI----------------PKIPGYD  684
            +E      K+K  + +       + P  K  +GK +                  K  G+D
Sbjct  280  SEVSYPVIKSKGSILSAGSTDLGE-PLMKKTNGKADSLINSSEGGEFTKGKVGTKFIGFD  338

Query  683  YGSAK-----------PGTGS----RLVIGGGP--YKANSIMSDSEVGPSPSEVAAAMAE  555
            +GS             PG G     +L   GGP      S++S+SEVGPSPSEVAAA+A 
Sbjct  339  FGSKATPKTSGLEFWGPGKGGLRSFKLNDYGGPKNITTGSMLSESEVGPSPSEVAAAIAH  398

Query  554  RPRYPLED---SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYT  384
                  ED   S LDGWS + S EGLRS+L+RWRTE+PPLYD+  Y    +      ++T
Sbjct  399  DRCRQAEDGNNSALDGWSLNSSEEGLRSKLQRWRTELPPLYDRGAYGIYRTPGGHVRRHT  458

Query  383  AKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
                  GSG     SCFGNI GYEC  VCG
Sbjct  459  EGDEPDGSGL---FSCFGNICGYECSIVCG  485



>ref|XP_010105208.1| hypothetical protein L484_011265 [Morus notabilis]
 gb|EXC04073.1| hypothetical protein L484_011265 [Morus notabilis]
Length=589

 Score =   110 bits (275),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 13/132 (10%)
 Frame = -2

Query  689  YDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWS  510
            Y+YG+ +  T    ++GGG       +++SE+GPSPSEVAAA+A++P    E S++ GWS
Sbjct  444  YEYGTPRKST----LMGGG---GMVFLTESELGPSPSEVAAALAKQPADEAESSIVGGWS  496

Query  509  CDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFG  330
             DESVEGLRS+LERWRTE+PP+YD+  ++   S+       +   R    GG G  SCF 
Sbjct  497  VDESVEGLRSKLERWRTELPPVYDRGEFSSYPSTE------SHHNRRHTDGGSGLFSCFS  550

Query  329  NIFGYECQCVCG  294
            NI G EC  VCG
Sbjct  551  NICGVECSIVCG  562



>emb|CBI23723.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 127/250 (51%), Gaps = 30/250 (12%)
 Frame = -2

Query  998  SSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSY----QKGKAISV----VSDSITI  843
            SS+ S   Y+      +++  KASS++N ++V   SY     KG  +S     + + +  
Sbjct  142  SSMRSMPLYKFVDLLKKKSGAKASSMLNGSEV---SYPVIKSKGSILSAGSTDLGEPLMK  198

Query  842  KDSSPSGKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDY-GSAKP  666
            K +  +  + N +E      E  + K G +F          G    PK  G ++ G  K 
Sbjct  199  KTNGKADSLINSSEG----GEFTKGKVGTKFIGFDF-----GSKATPKTSGLEFWGPGKG  249

Query  665  GTGS-RLVIGGGP--YKANSIMSDSEVGPSPSEVAAAMAERPRYPLED---SVLDGWSCD  504
            G  S +L   GGP      S++S+SEVGPSPSEVAAA+A       ED   S LDGWS +
Sbjct  250  GLRSFKLNDYGGPKNITTGSMLSESEVGPSPSEVAAAIAHDRCRQAEDGNNSALDGWSLN  309

Query  503  ESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNI  324
             S EGLRS+L+RWRTE+PPLYD+  Y    +      ++T      GSG     SCFGNI
Sbjct  310  SSEEGLRSKLQRWRTELPPLYDRGAYGIYRTPGGHVRRHTEGDEPDGSGL---FSCFGNI  366

Query  323  FGYECQCVCG  294
             GYEC  VCG
Sbjct  367  CGYECSIVCG  376



>ref|XP_002311697.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE89064.2| C2 domain-containing family protein [Populus trichocarpa]
Length=492

 Score =   106 bits (264),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 117/231 (51%), Gaps = 19/231 (8%)
 Frame = -2

Query  941  KGKASSVINAADV--KNKSYQKGKAISVVSDSITIKDSSPSGKIGNK--NEAQAKNKEVV  774
            + KASS+++ +++  KNK+++K  +  +    I  KD + +  + +   N A AK     
Sbjct  246  RTKASSMVSGSELEKKNKNWRKEASYMISGSEIVKKDQNNNLVLSDSELNGAFAKASLSS  305

Query  773  ENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSI----MS  606
            E     R DD  T      KP +PK PG D GS  P    R      P KAN I    ++
Sbjct  306  EALTNERSDDKSTELDNIVKP-LPKFPGLDLGS--PYNNFR---HATPKKANLISRPAIT  359

Query  605  DSEVGPSPSEVAAAMAE---RPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEVPPLYD-  438
            DSE+GPSPSEVAA M     R    +E  ++   S D S+EGL+S+LERWR E+PP+YD 
Sbjct  360  DSELGPSPSEVAAVMTRKKNRRFVEIESEIMGVMSLDGSMEGLQSKLERWRAELPPVYDA  419

Query  437  -QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
              +   P SS+ + S       R   +   G  +CFG   G EC  VCG P
Sbjct  420  SDISSFPASSTSKESKIVKQHSRRHSADDDGTFTCFGRFCGLECSIVCGGP  470



>ref|XP_003590735.1| RNA-binding protein 12B [Medicago truncatula]
 gb|AES60986.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=682

 Score =   105 bits (261),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/214 (36%), Positives = 108/214 (50%), Gaps = 34/214 (16%)
 Frame = -2

Query  836  SSPSGKIGNKNEAQAKNKEVVENKNGP----------RFDDSPTNKTVDGKPNIPKI---  696
            +SP  ++ N    Q +N  + E KN P          +F +SP  +  +    +P+    
Sbjct  441  NSPMHQVRNSPMPQFRNSPMPEYKNSPMHQVRNSPMPQFRNSPMPQFRNSPAVLPQFRNS  500

Query  695  -------PGYDYGSAKPGTGSRLV--IGGG-----PYKAN------SIMSDSEVGPSPSE  576
                   P   +G +  GT       + G      P ++N       IM++SE+GPSPSE
Sbjct  501  PAVSKFNPAVGFGGSHRGTPMHPFGKMNGAMEYATPMRSNLANMRPVIMTESELGPSPSE  560

Query  575  VAAAMAERPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrss  396
            VAAAMA +P    E+S + GWS DESVEGL+S+LERWRTE+PP+ D  G   +  +  S 
Sbjct  561  VAAAMARKPIIDEENSTVGGWSLDESVEGLQSKLERWRTELPPVIDH-GELSSFPTTSSK  619

Query  395  SQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            +   +++   G  G G  SCF NI G EC  VCG
Sbjct  620  TSRHSRRHTEGGSGNGLFSCFSNICGVECSVVCG  653



>ref|XP_011029742.1| PREDICTED: uncharacterized protein LOC105129399 [Populus euphratica]
Length=492

 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 115/231 (50%), Gaps = 19/231 (8%)
 Frame = -2

Query  941  KGKASSVINAADV--KNKSYQKGKAISVVSDSITIKDSSPSGKIGNK--NEAQAKNKEVV  774
            + KASS+++ +++  KNK++++  +  +    I  KD + +  + +   N A AK     
Sbjct  246  RTKASSMVSGSELEKKNKNWRQEASYMISGSEIVKKDQNNNLVLSDSELNGAFAKASLSS  305

Query  773  ENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSI----MS  606
            E     R DD  T      K  +PK PG D GS  P    R      P KAN I    ++
Sbjct  306  EALTNERSDDKSTELDNIVK-TVPKFPGLDLGS--PYNNFR---HATPKKANLISRPAIT  359

Query  605  DSEVGPSPSEVAAAMAE---RPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEVPPLYD-  438
            DSE+GPSPSEVAA M     R     E  ++   S D S+EGL+S+LERWR E+PP+YD 
Sbjct  360  DSELGPSPSEVAAVMTRKKNRRVVETESEIMGVMSLDGSMEGLQSKLERWRAELPPVYDS  419

Query  437  -QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
              +   P SS+ + S       R   +   G  +CFG   G EC  VCG P
Sbjct  420  SDISSFPASSTSKESKIVKRHSRRHSADDDGTFTCFGRFCGLECSIVCGGP  470



>ref|XP_003556915.1| PREDICTED: uncharacterized protein LOC100779058 [Glycine max]
Length=449

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 120/236 (51%), Gaps = 32/236 (14%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGKAISVVSDSITIKDSSPSGKIGNK----------NEAQA  792
            KGKASS I  ++V  KS  K K  S +SDS  +K +   GK+G K          N   A
Sbjct  204  KGKASSQITPSEVSTKS--KNKTSSTLSDS-NVKATPKRGKLGRKKTKITSHDSQNNLNA  260

Query  791  KNKEVVENKNGPR--FDDSPTNKTVDG----KPNIPKIPGYDYGSAKPGTGSRLVIGGGP  630
            +     + K+ P+  F ++P+    +     K N+   P + +           +  G P
Sbjct  261  RLYVDYQVKSTPKREFQNTPSRTYNNNNNNYKGNLRATPLHAFAVTNAA-----LEYGTP  315

Query  629  YKANS----IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDESVEGLRSRLERWR  462
            Y++N      M+DSE+GPS SEVAA +A  P    E+S + GWS D+SVEGL+ ++ERW+
Sbjct  316  YRSNLGRRPFMTDSELGPSASEVAAVVARLPIEEGENSTVGGWSLDDSVEGLQPKVERWQ  375

Query  461  TEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            TE+PP+YD        S+  +SS+     R    GG G  SCF  I G EC  VCG
Sbjct  376  TELPPVYD----GSERSNMTTSSKKGKHSRRQTDGGNGLFSCFSVICGVECSIVCG  427



>ref|XP_007035276.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
 gb|EOY06202.1| Calcium-dependent lipid-binding family protein, putative [Theobroma 
cacao]
Length=480

 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 89/163 (55%), Gaps = 21/163 (13%)
 Frame = -2

Query  767  KNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGP  588
            KNGP+   +    +    P   K  G DYG+ +        +GGG +      +DSE+GP
Sbjct  308  KNGPK---AVVKSSAAKSPGGFKYNGLDYGAPRK-------MGGGTF-----CTDSELGP  352

Query  587  SPSEVAAAMAERPRYP-----LEDSVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYA  423
            SPSEVAAAMA R  YP      E S++D WS D S+EGLRS+L+RWRTE+PP+YD+  ++
Sbjct  353  SPSEVAAAMA-RNMYPNRMDETESSLVDEWSLDGSIEGLRSKLDRWRTELPPVYDRGEFS  411

Query  422  PTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
               SS   ++    +     +   G  SCFGN+ G E    CG
Sbjct  412  SYLSSGIPTTTKKTRHVRRHTVNEGLFSCFGNVCGCEISISCG  454



>ref|XP_009357966.1| PREDICTED: uncharacterized protein LOC103948651 [Pyrus x bretschneideri]
Length=533

 Score = 97.8 bits (242),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 88/251 (35%), Positives = 126/251 (50%), Gaps = 44/251 (18%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGKAISVVSDS---------------ITIKDSSPSGKIGNK  807
            KGKASS+++A+DV   SY+KGKA S++S S                ++  +S  G     
Sbjct  261  KGKASSIVSASDV---SYRKGKASSMLSASDVGPPKSWKDKKGKPSSVLSASDVGARDPP  317

Query  806  NEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIG----  639
                +K ++ + +  G    + P+ K        PK    D   A P   S L +G    
Sbjct  318  KNGSSKIEKPISSILGANEAEEPSRKMRGSHKPSPKFHLVDNYGATPTRKSTLPVGKSPL  377

Query  638  ---GGPYKANS-----------IMSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDG-WSC  507
                 PY+A +            +++SE+GPSPSEVAAA+A ER     E SV+ G W+ 
Sbjct  378  QRLQSPYEAYATPRKSNLMPVPFITESELGPSPSEVAAAIAKERVDQDNESSVVVGAWNE  437

Query  506  DESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGN  327
            D+SVEGL+S+LERW TE+PP+Y++  ++   S   S  ++T   R    G  G  SCF N
Sbjct  438  DDSVEGLQSKLERWLTELPPVYERGEFS---SFKSSEMRHT---RRHSEGSNGLFSCFSN  491

Query  326  IFGYECQCVCG  294
            I G EC  VCG
Sbjct  492  ICGIECSVVCG  502



>ref|XP_008340669.1| PREDICTED: uncharacterized protein LOC103403599 [Malus domestica]
Length=533

 Score = 95.5 bits (236),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 125/252 (50%), Gaps = 46/252 (18%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGKAISVVSD----------------SITIKDSSPSGKIGN  810
            KGKASS+++A+DV   SY+KGKA S++S                 S  +  S  S +   
Sbjct  261  KGKASSIVSASDV---SYRKGKASSMLSATNVGPPKSWKDKKGKPSSILSASDVSAQDPP  317

Query  809  KNEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIG---  639
            KN++ + N++ V +         PT K        PK    D   A P   S L  G   
Sbjct  318  KNDS-SNNEKPVSSILSANEAKEPTRKMRGSHKPSPKFHLVDNYGATPARKSALPAGKSS  376

Query  638  -----------GGPYKANSI----MSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDG-WS  510
                         P K+N +    +++SE+GPSPSEVAAA+A ER     E SV+ G W+
Sbjct  377  LQRLQSPYDTYATPRKSNLMPVPFITESELGPSPSEVAAAIAKERVDQDNESSVVVGAWN  436

Query  509  CDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFG  330
             D+SVEGL+S+LERW TE+PP+Y++  +    S   S  ++T   R    G  G  SCF 
Sbjct  437  EDDSVEGLQSKLERWLTELPPVYERGEF---FSFKSSEMRHT---RRHSEGSNGLFSCFS  490

Query  329  NIFGYECQCVCG  294
            NI G EC  VCG
Sbjct  491  NICGIECSVVCG  502



>ref|XP_004495257.1| PREDICTED: proteoglycan 4-like [Cicer arietinum]
Length=713

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLED-SVLDGWSCDESVEGLRSRLERWRTEVPPLYD  438
            +M++SE+GPSPSEVAAAMA +P     D S +  WS DESVEGL S+L+RWRTE+PP+ D
Sbjct  581  MMTESELGPSPSEVAAAMARKPMVDEGDNSTMTRWSLDESVEGLGSKLDRWRTELPPVID  640

Query  437  QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            + G   +  +  + +   +++   G GG G  SCF NI G EC  VCG
Sbjct  641  R-GELSSLPTNSTKTSRHSRRHTDGGGGNGLFSCFSNICGVECSIVCG  687



>ref|XP_004297932.1| PREDICTED: uncharacterized protein LOC101311957 [Fragaria vesca 
subsp. vesca]
Length=519

 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 81/121 (67%), Gaps = 15/121 (12%)
 Frame = -2

Query  632  PYKANSI----MSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDG-WSCDESVEGLRSRLE  471
            P K+N +    +++SE+GPSPSEVAAA+A ER     E SV+ G W+ DESVEGL+S+LE
Sbjct  372  PRKSNLMAVPYLTESELGPSPSEVAAAIARERVDQDNESSVVVGAWNEDESVEGLQSKLE  431

Query  470  RWRTEVPPLYDQVGYA--PTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVC  297
            RWRTE+PP+YD+  Y+  P+SS  R + ++T        GG G  SCF NI G EC  VC
Sbjct  432  RWRTELPPVYDRGDYSSLPSSSEGRHTRRHT-------DGGNGLFSCFSNICGVECSIVC  484

Query  296  G  294
            G
Sbjct  485  G  485



>ref|XP_011041447.1| PREDICTED: uncharacterized protein LOC105137420 [Populus euphratica]
Length=459

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/259 (31%), Positives = 121/259 (47%), Gaps = 21/259 (8%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTE--ETKGKASSVINAADV-KNKSYQKGKAISVVSDSITIKD  837
             DK S I S S+  P  P  E   TK  +SS+  +  + K K   KGK  S++S S  +++
Sbjct  181   DKSSGIHSNSFLLPWLPKPELRRTKSDSSSMFGSIVMAKRKMIMKGKGSSMISGS-EVEE  239

Query  836   SSPSGKIGNKNEAQAKNKEVV-ENKNGPRFDDSPTNKTVDG------------KPNIPKI  696
              +   K  +K  +     E V E++NG     S T++++              KP+ PK 
Sbjct  240   RNMLNKGRSKASSLTSGSEFVKEDENGAFGKASLTSESLTKTDTKSTELDHILKPS-PKF  298

Query  695   PGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDS---V  525
              G D GS               + +  ++++S++GPS SEVAA +A      LE++   +
Sbjct  299   TGLDLGSPCSNNFRYATPKKANFVSKPVITESQLGPSASEVAAVIARNKHRRLEETESEI  358

Query  524   LDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGP  345
             +   S D S+E L+S+LERWRTE+PP +D    +   +S         +     +   G 
Sbjct  359   IGEMSLDGSMEALQSKLERWRTELPPAFDASNISSFPTSGTCKGGLVKRHNHRHTDDDGT  418

Query  344   LSCFGNIFGYECQCVCGQP  288
              SCFG   G EC  VCG P
Sbjct  419   FSCFGRFCGLECSIVCGDP  437



>ref|XP_007226487.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
 gb|EMJ27686.1| hypothetical protein PRUPE_ppa026634mg [Prunus persica]
Length=492

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 88/255 (35%), Positives = 125/255 (49%), Gaps = 54/255 (21%)
 Frame = -2

Query  938  GKASSVINAADVKNKSYQKG-------------------KAISVVSDS-ITIKDSSPSGK  819
            GKA S++N ++V  K  +KG                   K  SV+S S ++++D    G 
Sbjct  220  GKAGSMVNGSEVSIKKNKKGRLSKASSIIGGSEIIIRKRKPSSVLSASEVSVQDPPKKG-  278

Query  818  IGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIG  639
                N +  K    + + + P  +D P  K    KP+       +YGS  PG  S    G
Sbjct  279  ----NSSNGKPASSMPSASEP--EDRPRRKPASHKPSPKFNLAENYGST-PGRKSAPRAG  331

Query  638  GGPY-------------KANSIM-----SDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDG  516
              P+             + ++IM     ++SE+GPSPSEVAAA+A ER     E SV+ G
Sbjct  332  KSPFYKLQSPYEQYATPRKSNIMPVPFITESELGPSPSEVAAAIAKERLDQDAESSVVVG  391

Query  515  -WSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLS  339
             W+ ++SVEGL+S+LERWRTE+PP+YD+  ++   SS          +R    GG G  S
Sbjct  392  AWNEEDSVEGLQSKLERWRTELPPVYDRGEFSSFPSSDER------HERRHSDGGSGLFS  445

Query  338  CFGNIFGYECQCVCG  294
            CF NI G EC  VCG
Sbjct  446  CFSNICGIECSIVCG  460



>ref|XP_006489752.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
Length=510

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 85/249 (34%), Positives = 122/249 (49%), Gaps = 28/249 (11%)
 Frame = -2

Query  1004  KGSSILSTSWYQPQPPPTEETKGKASSVINAADVKNKSYQK---GKAISVVSDSITIKD-  837
             KGSS+ S S    +P    +    A S  + +D++     K   GK  S+V+   T+   
Sbjct  247   KGSSVFSGSDIFKKP--NNKVANSALSAFSGSDLRKDQPGKEGAGKVRSLVNGIETVNQV  304

Query  836   SSPS-GKIGNKNEAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGT  660
              SP+ GKIGN     + +    +  + PR  D P+ K +  +    +  GY++    P  
Sbjct  305   GSPTKGKIGNTGSMNSGS----DGSDPPRKVD-PSPKAISPRKPFARDQGYEF--VHP--  355

Query  659   GSRLVIGGGPYK-ANSIMSDSEVGPSPSEVAAAMAERPRYPL----EDSVLDGWSCDESV  495
              ++L +    YK    ++++SE+GPSPSEVAAA A+          E SV+  W  D SV
Sbjct  356   -NKLKL----YKNVQPVITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSV  410

Query  494   EGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGP--LSCFGNIF  321
             EGL+S+LERWR E+PPLYD    + ++             R    GG GP   SCF NI 
Sbjct  411   EGLQSKLERWRAELPPLYDSSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNIC  470

Query  320   GYECQCVCG  294
             G EC  VCG
Sbjct  471   GCECSIVCG  479



>ref|XP_002314508.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF00679.1| C2 domain-containing family protein [Populus trichocarpa]
Length=460

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 123/261 (47%), Gaps = 24/261 (9%)
 Frame = -2

Query  1007  DKGSSILSTSWYQPQPPPTE--ETKGKASSVINAADV-KNKSYQKGKAISVVSDSITIKD  837
             DK S I S S+  P  P  E   TK  +SS+  +  + K K   KGK  S++S S  +++
Sbjct  181   DKSSGIHSNSFLLPWLPKPELRRTKSDSSSMFGSIVMAKRKMIMKGKGSSMISGS-EVEE  239

Query  836   SSPSGKIGNKNEAQAKNKEVV-ENKNGPRFDDSPTNKTVDG------------KPNIPKI  696
                  K  +K  +     E+V E++NG     S T++++              KP+ PK 
Sbjct  240   RKMLNKGRSKASSLTGGSEIVKEDENGAFGKASLTSESLTKTDTKSTELDHILKPS-PKF  298

Query  695   PGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDS---V  525
              G D GS               + +  ++++S++GPS SEVAA +A      +E++   +
Sbjct  299   TGLDLGSPCNNNFRYATPKKANFVSKPVITESQLGPSASEVAAVIARNKHRRVEETESEI  358

Query  524   LDGWSCDESVEGLRSRLERWRTEVPPLYD--QVGYAPTsssfrssSQYTAKKRgsgsggg  351
             +   S D S+E L+S+LERWRTE+PP YD   +   PT S      +   +     +   
Sbjct  359   IGEMSLDGSMEALQSKLERWRTELPPAYDASNISSFPT-SGTSKGGKVVKRHNHKHTDDD  417

Query  350   GPLSCFGNIFGYECQCVCGQP  288
             G  SCFG   G EC  VCG P
Sbjct  418   GTFSCFGRFCGLECSIVCGGP  438



>ref|XP_006303752.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
 gb|EOA36650.1| hypothetical protein CARUB_v10011922mg [Capsella rubella]
Length=600

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 69/125 (55%), Gaps = 18/125 (14%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I+++SE+GPSPSEVA  +A+   +  E S+L  WS DES +EGLRS+LERWRTE+PPLYD
Sbjct  445  ILTESELGPSPSEVAEKLAKDKSHETESSILSEWSIDESSIEGLRSKLERWRTELPPLYD  504

Query  437  ----------------QVGYAPTsssfrssSQYTAKK-RgsgsgggGPLSCFGNIFGYEC  309
                             V  A    S R  +  T K  R    GG G  SCF  I G EC
Sbjct  505  IGSSHISSSNYDGASVHVATAGGGMSSRRKTPATKKHNRRHTDGGNGLFSCFSKICGVEC  564

Query  308  QCVCG  294
              VCG
Sbjct  565  SFVCG  569



>ref|XP_003555498.1| PREDICTED: uncharacterized protein LOC100812185 [Glycine max]
Length=642

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPL-EDSVLDGWSCD-ESVEGLRSRLERWRTEVPPLY  441
            ++++SE+GPSPSEVAAA+A +P     E+S + GWS D ESVEGL+S+LERWRT++PP+ 
Sbjct  508  VITESELGPSPSEVAAAIARKPVIDEGENSTVGGWSLDAESVEGLQSKLERWRTDLPPVV  567

Query  440  D--QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            D  +V   PT +S   +S+++ +    GS G G  SCF NI G EC   CG
Sbjct  568  DRGEVSSYPT-TSTTKTSRHSRRHTDGGSTGSGLFSCFSNICGVECYVGCG  617



>ref|XP_002889512.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65771.1| hypothetical protein ARALYDRAFT_470434 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 73/126 (58%), Gaps = 20/126 (16%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I+++SE+GPSPSEVA  +A+   +  E S+L  WS DES +EGLRS+LERWRTE+PPLYD
Sbjct  421  ILTESELGPSPSEVADKLAKDRSHETESSILSEWSIDESSIEGLRSKLERWRTELPPLYD  480

Query  437  QVGYAPTsssfrssSQY----------------TAKK--RgsgsgggGPLSCFGNIFGYE  312
             +G +  SSS    +                  TAKK  R    GG G  SCF  I G E
Sbjct  481  -IGSSHISSSNYDGASVPAATAGGGMSSRRKTPTAKKHNRRHTDGGNGLFSCFSKICGVE  539

Query  311  CQCVCG  294
            C  VCG
Sbjct  540  CSFVCG  545



>ref|NP_180890.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAB80650.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08815.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=602

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 79/146 (54%), Gaps = 27/146 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPR-YPLEDSVLDGWSCDE--S  498
            GT  R  + G P     ++++SE+GPSPSEVA  MA ER + Y  E S+L  WS D+  +
Sbjct  433  GTPMRSNLAGRP-----VLTESELGPSPSEVAQKMAKERSQAYETESSILSEWSLDDDSN  487

Query  497  VEGLRSRLERWRTEVPPLYD------------------QVGYAPTsssfrssSQYTAKKR  372
            +EGLRS+LERWRTE+PPLYD                   VG   +S     + +    +R
Sbjct  488  IEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAMVVANVGGGKSSRKKTPAVKKKHNRR  547

Query  371  gsgsgggGPLSCFGNIFGYECQCVCG  294
             +  GG G  SCF N+ G EC  VCG
Sbjct  548  HTEGGGNGLFSCFSNLCGVECTFVCG  573



>gb|KDO41882.1| hypothetical protein CISIN_1g041258mg [Citrus sinensis]
Length=510

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPL----EDSVLDGWSCDESVEGLRSRLERWRTEVPP  447
            ++++SE+GPSPSEVAAA A+          E SV+  W  D SVEGL+S+LERWR E+PP
Sbjct  367  VITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPP  426

Query  446  LYDQVGYAPTsssfrssSQYTAKKRgsgsgggGP--LSCFGNIFGYECQCVCG  294
            LYD    + ++             R    GG GP   SCF NI G EC  VCG
Sbjct  427  LYDSSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNICGCECSIVCG  479



>ref|XP_006420366.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
 gb|ESR33606.1| hypothetical protein CICLE_v10006849mg [Citrus clementina]
Length=497

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPL----EDSVLDGWSCDESVEGLRSRLERWRTEVPP  447
            ++++SE+GPSPSEVAAA A+          E SV+  W  D SVEGL+S+LERWR E+PP
Sbjct  354  VITESELGPSPSEVAAAKAKEKLLKQTNDEESSVMMAWDMDSSVEGLQSKLERWRAELPP  413

Query  446  LYDQVGYAPTsssfrssSQYTAKKRgsgsgggGP--LSCFGNIFGYECQCVCG  294
            LYD    + ++             R    GG GP   SCF NI G EC  VCG
Sbjct  414  LYDSSFPSSSAGGGGGGGTTARHSRRHTDGGSGPGLFSCFSNICGCECSIVCG  466



>ref|XP_010457504.1| PREDICTED: uncharacterized protein LOC104738975 [Camelina sativa]
Length=600

 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 18/130 (14%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDE-SVEGLRSRLERWRTEV  453
            +    I+++SE+GPSPSEVA  +A    +  E S+L  WS DE S+EGLRS+L+RWR E+
Sbjct  440  FAGRRILTESELGPSPSEVAEKLANNRSHETESSILSEWSIDESSIEGLRSKLDRWRMEL  499

Query  452  PPLYD----QVGY---------APTsssfrssSQYT----AKKRgsgsgggGPLSCFGNI  324
            PPLYD    Q+           A T+    SS + T       R    GG GP SCF  I
Sbjct  500  PPLYDIGSSQISSSDYDGASVPAATAGGGMSSRRKTPAVKKHNRRHTDGGNGPFSCFSKI  559

Query  323  FGYECQCVCG  294
             G EC  VCG
Sbjct  560  CGVECSFVCG  569



>ref|XP_010483923.1| PREDICTED: uncharacterized protein LOC104762347 [Camelina sativa]
Length=601

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 18/130 (14%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDE-SVEGLRSRLERWRTEV  453
            +    I+++SE+GPSPSEVA  +A    +  E S+L  WS DE S+EGLRS+L+RWR E+
Sbjct  441  FARRRILTESELGPSPSEVAEKLANNRSHETESSILSEWSIDESSIEGLRSKLDRWRMEL  500

Query  452  PPLYD----QVGY---------APTsssfrssSQYT----AKKRgsgsgggGPLSCFGNI  324
            PPLYD    Q+           A T+    SS + T       R    GG GP SCF  I
Sbjct  501  PPLYDIGSSQISSSDYDGASVPAATAGGGMSSRRKTPAVKKHNRRHTDGGNGPFSCFSKI  560

Query  323  FGYECQCVCG  294
             G EC  VCG
Sbjct  561  CGVECSFVCG  570



>ref|XP_004147189.1| PREDICTED: uncharacterized protein LOC101215059 [Cucumis sativus]
 gb|KGN61560.1| hypothetical protein Csa_2G171820 [Cucumis sativus]
Length=561

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 11/115 (10%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEV  453
            +   + +++SE+GPSPSEVAA MA ++     E S++ G S ++SVEGL+S+LERWRTE+
Sbjct  429  FLGGAFLTESELGPSPSEVAAQMARQKTEDGNESSIVGGLSLNDSVEGLQSKLERWRTEL  488

Query  452  PPLYD--QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            PP+YD  ++   P+S +   + +++         GGG  SCF NI G EC  VCG
Sbjct  489  PPVYDRGELSSFPSSETREHNRRHS--------DGGGLFSCFSNICGCECSIVCG  535



>ref|XP_008460692.1| PREDICTED: uncharacterized protein LOC103499460 [Cucumis melo]
Length=561

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 76/115 (66%), Gaps = 11/115 (10%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEV  453
            +   +++++SE+GPSPSEVAA MA ++     E S++ G S ++SVEGL+S+LERWRTE+
Sbjct  429  FLGGAVLTESELGPSPSEVAAQMAKQKIDDGNESSIVGGLSLNDSVEGLQSKLERWRTEL  488

Query  452  PPLYD--QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            PP+YD  ++   P+S + + + +++         GGG  SCF NI G EC  VCG
Sbjct  489  PPVYDRGELSSFPSSETRQHNRRHS--------DGGGLFSCFSNICGCECSIVCG  535



>ref|XP_004173200.1| PREDICTED: uncharacterized LOC101215059 [Cucumis sativus]
Length=533

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 11/115 (10%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDGWSCDESVEGLRSRLERWRTEV  453
            +   + +++SE+GPSPSEVAA MA ++     E S++ G S ++SVEGL+S+LERWRTE+
Sbjct  401  FLGGAFLTESELGPSPSEVAAQMARQKTEDGNESSIVGGLSLNDSVEGLQSKLERWRTEL  460

Query  452  PPLYD--QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            PP+YD  ++   P+S +   + +++         GGG  SCF NI G EC  VCG
Sbjct  461  PPVYDRGELSSFPSSETREHNRRHS--------DGGGLFSCFSNICGCECSIVCG  507



>ref|XP_010522448.1| PREDICTED: uncharacterized protein LOC104801063 [Tarenaya hassleriana]
Length=580

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 75/140 (54%), Gaps = 22/140 (16%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSC-DESV  495
            GT  R  + G P     I+++SE+GPSPSEVA  MA+    P   E S+L  WS  D S+
Sbjct  422  GTPMRSNLAGRP-----ILTESELGPSPSEVAEKMAKERSSPNDTESSILSEWSIEDNSI  476

Query  494  EGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAK-------------KRgsgsgg  354
            EGLRS+LERWRTE+PPLYD +G +  SS     +    K              R    GG
Sbjct  477  EGLRSKLERWRTELPPLYD-LGSSHLSSEMDEDAAAGGKSSRTRKTPATKTHSRRHTDGG  535

Query  353  gGPLSCFGNIFGYECQCVCG  294
             G  SCF NI G EC  VCG
Sbjct  536  NGLFSCFSNICGVECTFVCG  555



>ref|NP_171948.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE27711.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=601

 Score = 85.9 bits (211),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 20/126 (16%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I+++SE+GPSPSEVA  +A+   +  E S+L  WS DES +EGLRS+LERWRTE+PPLYD
Sbjct  445  ILTESELGPSPSEVADKLAKDRSHETESSILSEWSIDESSIEGLRSKLERWRTELPPLYD  504

Query  437  QVGYAPTsssfrssSQY----------------TAKK--RgsgsgggGPLSCFGNIFGYE  312
             +G +  SS+    +                  T KK  R    GG G  SCF  I G E
Sbjct  505  -IGSSHISSTDYDGASVPAATAGGGMSSRRKTPTTKKHNRRHTDGGNGLFSCFSKICGVE  563

Query  311  CQCVCG  294
            C  VCG
Sbjct  564  CSFVCG  569



>ref|XP_010475114.1| PREDICTED: uncharacterized protein LOC104754591 [Camelina sativa]
Length=600

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 71/131 (54%), Gaps = 20/131 (15%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDE-SVEGLRSRLERWRTEV  453
            +    I+++SE+GPSPSEVA  +A+   +  E  +L  WS DE S+EGLRS+L+RWR E+
Sbjct  440  FAGRRILTESELGPSPSEVADKLAKNGSHETESLILSEWSIDESSIEGLRSKLDRWRMEL  499

Query  452  PPLYDQVGYAPTsssfrssSQYTA------------------KKRgsgsgggGPLSCFGN  327
            PPLYD +G +  SSS   S+   A                    R    GG GP SCF  
Sbjct  500  PPLYD-IGSSQISSSDYDSASVPAATAGGGMSSRRKTPAIKKHNRRHTDGGNGPFSCFSK  558

Query  326  IFGYECQCVCG  294
            I G EC  VCG
Sbjct  559  ICGVECSFVCG  569



>ref|XP_010025827.1| PREDICTED: uncharacterized protein LOC104416087 [Eucalyptus grandis]
Length=481

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 14/129 (11%)
 Frame = -2

Query  638  GGPYKANSI-MSDSEVGPSPSEVAAAMAERPRYPL----EDSVLDGWSCDESVEGLRSRL  474
            G P K   + +++SE+GPSPSE+AA  A+   Y +    E+S + GWS +ESVEGL+S+L
Sbjct  327  GDPRKPGELYITESELGPSPSELAAVAAKERMYKVVDDTENSGVGGWSLNESVEGLQSKL  386

Query  473  ERWRTEVPPLYDQ---VGYAPTsssfrssSQYT------AKKRgsgsgggGPLSCFGNIF  321
            ERWR E+P +YD+     Y P++                A++   G  G G  SCF NI 
Sbjct  387  ERWRMELPTIYDRSDFASYGPSTKGSGGGGGGGGGGSRHARRHTEGESGKGLFSCFSNIC  446

Query  320  GYECQCVCG  294
            G +C  VCG
Sbjct  447  GCQCSIVCG  455



>emb|CDX89815.1| BnaA10g02670D [Brassica napus]
Length=498

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 66/124 (53%), Gaps = 17/124 (14%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSCDE-SVEGLRSRLERWRTEVPPL  444
            I++DSE+GPSPSE+A  +A+   +    E S+L  WS DE SVEGLRS+LERWRTE+PPL
Sbjct  343  ILTDSELGPSPSEIAEQLAKNRSHANDTESSILSDWSIDETSVEGLRSKLERWRTELPPL  402

Query  443  YD----QVG--------YAPTsssfrssSQYTAKK--RgsgsgggGPLSCFGNIFGYECQ  306
            YD    QV           P             KK  R    GG G  SCF  I G EC 
Sbjct  403  YDIGSSQVSSTEYDGSTIVPAGGRSSRRKTPAVKKHSRRHTEGGNGLFSCFSKICGVECS  462

Query  305  CVCG  294
              CG
Sbjct  463  FACG  466



>gb|KCW57324.1| hypothetical protein EUGRSUZ_H00123 [Eucalyptus grandis]
Length=462

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 14/129 (11%)
 Frame = -2

Query  638  GGPYKANSI-MSDSEVGPSPSEVAAAMAERPRYPL----EDSVLDGWSCDESVEGLRSRL  474
            G P K   + +++SE+GPSPSE+AA  A+   Y +    E+S + GWS +ESVEGL+S+L
Sbjct  308  GDPRKPGELYITESELGPSPSELAAVAAKERMYKVVDDTENSGVGGWSLNESVEGLQSKL  367

Query  473  ERWRTEVPPLYDQ---VGYAPTsssfrssSQYT------AKKRgsgsgggGPLSCFGNIF  321
            ERWR E+P +YD+     Y P++                A++   G  G G  SCF NI 
Sbjct  368  ERWRMELPTIYDRSDFASYGPSTKGSGGGGGGGGGGSRHARRHTEGESGKGLFSCFSNIC  427

Query  320  GYECQCVCG  294
            G +C  VCG
Sbjct  428  GCQCSIVCG  436



>emb|CDY18242.1| BnaC05g02650D [Brassica napus]
Length=410

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 69/125 (55%), Gaps = 18/125 (14%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSCDE-SVEGLRSRLERWRTEVPPL  444
            I++DSE+GPSPSE+A  +A+   +    E S+L  WS DE SVEGLRS+LERWRTE+PPL
Sbjct  257  ILTDSELGPSPSEIAEQLAKNRSHANDTESSILSEWSIDETSVEGLRSKLERWRTELPPL  316

Query  443  YD----QV--------GYAPTsssfrssSQYTAKK---RgsgsgggGPLSCFGNIFGYEC  309
            YD    QV           P +    S  +  A K   R    GG G  SCF  I G EC
Sbjct  317  YDIGSSQVSSTEYDGSAIVPANGGRSSRRKTPAVKKHSRRHTEGGNGLFSCFSKICGVEC  376

Query  308  QCVCG  294
               CG
Sbjct  377  SFACG  381



>ref|XP_010026783.1| PREDICTED: protein bunched, class 2/F/G isoform-like [Eucalyptus 
grandis]
Length=456

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 13/120 (11%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRY---PLEDSVLDGWSCDESVEGLRSRLERWRTEVPPL  444
            I+++SE+GPSPSEVAAA+A + RY    +E  V+ GWS +ESVEGL+S+LERWR E+P L
Sbjct  332  IITESELGPSPSEVAAAVAAKERYKEKEVESPVVGGWSLNESVEGLQSKLERWRMELPTL  391

Query  443  YDQVGYAPTsssfrssSQYTAKKRgsgsggg----------GPLSCFGNIFGYECQCVCG  294
            YD+  Y+   SS   ++    K + SG                 SC GNI G EC  VCG
Sbjct  392  YDRGDYSSLPSSGSGNNNNIVKSKSSGRRHVRRHTDGGGGGSLFSCVGNICGLECTIVCG  451



>ref|XP_002881275.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57534.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=595

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 77/145 (53%), Gaps = 26/145 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--S  498
            GT  R  + G P     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  +
Sbjct  427  GTPMRSNLAGRP-----ILTESELGPSPSEVAQKMAKERSQANETESSILSEWSLDDDSN  481

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK---------Rg  369
            +EGLRS+LERWRTE+PPLYD         VG      +     + + KK         R 
Sbjct  482  IEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAIVVANVGGGKSSRKKTPVVKKKHNRR  541

Query  368  sgsgggGPLSCFGNIFGYECQCVCG  294
               GG G  SCF N+ G EC  VCG
Sbjct  542  HTEGGNGLFSCFSNLCGVECTFVCG  566



>ref|XP_010469493.1| PREDICTED: uncharacterized protein LOC104749540 [Camelina sativa]
Length=596

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 78/145 (54%), Gaps = 26/145 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--S  498
            GT  R  + G P     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  +
Sbjct  428  GTPMRSNLAGRP-----ILTESELGPSPSEVAQKMAKERSQANDTESSILSEWSLDDDSN  482

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK---------Rg  369
            +EGLRS+LERWRTE+PPLYD        +VG      +     + + K+         R 
Sbjct  483  IEGLRSKLERWRTELPPLYDLGSSHQSSEVGSGAIVVANTGGGKSSRKRTPTVKKKHNRR  542

Query  368  sgsgggGPLSCFGNIFGYECQCVCG  294
               GG G  SCF N+ G EC  VCG
Sbjct  543  HTEGGNGLFSCFSNLCGVECTFVCG  567



>ref|XP_010667096.1| PREDICTED: uncharacterized protein LOC104884184 [Beta vulgaris 
subsp. vulgaris]
Length=464

 Score = 82.8 bits (203),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 74/121 (61%), Gaps = 9/121 (7%)
 Frame = -2

Query  629  YKANSIMSDSEVGPSPSEVAAAMAERPRY---PLEDS--VLDGWSCDESVEGLRSRLERW  465
            + A SI S+SEVGPSPSEVAAA+AE  +Y   P   S  ++D  S  E+ EG+R++LERW
Sbjct  318  FAAGSIWSESEVGPSPSEVAAAIAEDNKYRHFPGRGSSIIMDDNSMVEN-EGVRTKLERW  376

Query  464  RTEVPPLYDQVGYAPTsssfrssSQY---TAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            R+++P  YD  G      S  SS+ +      +R +  G  G  SCFGNI GYEC  VCG
Sbjct  377  RSDMPNTYDYGGSYVGGGSSSSSTIFPRSKHTRRHTTEGANGKFSCFGNICGYECSIVCG  436

Query  293  Q  291
            +
Sbjct  437  R  437



>ref|XP_010509905.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=596

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 77/145 (53%), Gaps = 26/145 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--S  498
            GT  R  + G P     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  +
Sbjct  428  GTPMRSNLAGRP-----ILTESELGPSPSEVAQKMAKERSQANDTESSILSEWSLDDDSN  482

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK---------Rg  369
            +EGLRS+LERWRTE+PPLYD         VG      +     + + K+         R 
Sbjct  483  IEGLRSKLERWRTELPPLYDFGSSHQSSDVGSGAIVVANTGGGKSSRKRTPAVKKKHNRR  542

Query  368  sgsgggGPLSCFGNIFGYECQCVCG  294
               GG G  SCF N+ G EC  VCG
Sbjct  543  HTEGGNGLFSCFSNLCGVECTFVCG  567



>ref|XP_006293875.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
 gb|EOA26773.1| hypothetical protein CARUB_v10022860mg [Capsella rubella]
Length=597

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 75/145 (52%), Gaps = 26/145 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSCDE--S  498
            GT  R  + G P     I+++SE+GPSPSEVA  MA+        E S+L  WS D+  +
Sbjct  429  GTPMRSNLAGRP-----ILTESELGPSPSEVAQKMAKERSLANETESSILSEWSLDDDSN  483

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK---------Rg  369
            +EGLRS+LERWRTE+PPLYD         VG      +     + + KK         R 
Sbjct  484  MEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAIVVANAGGGKSSRKKTPAVKKKHNRR  543

Query  368  sgsgggGPLSCFGNIFGYECQCVCG  294
               GG G  SCF N+ G EC  VCG
Sbjct  544  HTEGGNGLFSCFSNLCGVECTFVCG  568



>emb|CDY37732.1| BnaA04g19360D [Brassica napus]
Length=611

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 79/143 (55%), Gaps = 28/143 (20%)
 Frame = -2

Query  638  GGPYKANS----IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--SVEGLR  483
            G P ++N     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  ++EGLR
Sbjct  440  GTPMRSNLAGRLILTESELGPSPSEVANKMAKERSQANDTESSILSEWSLDDDSNIEGLR  499

Query  482  SRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK------------Rgsg  363
            S+LERWRTE+PPLYD         VG A   +S  +    ++++            R   
Sbjct  500  SKLERWRTELPPLYDLGSSHQSSDVGSAIVPASASAGGGKSSRRKTPTVKKKKKHQRRHT  559

Query  362  sgggGPLSCFGNIFGYECQCVCG  294
             GG G  SCF NI G EC  VCG
Sbjct  560  EGGNGLFSCFSNICGAECTFVCG  582



>ref|XP_006410470.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
 gb|ESQ51923.1| hypothetical protein EUTSA_v10016412mg [Eutrema salsugineum]
Length=597

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 77/146 (53%), Gaps = 27/146 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--S  498
            GT  R  + G P     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  +
Sbjct  428  GTPMRSNLAGRP-----ILTESELGPSPSEVANKMAKERSQANDTESSILSEWSLDDDSN  482

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK----------R  372
            +EGLRS+LERWRTE+PPLYD         VG      +     + + +K          R
Sbjct  483  IEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAIVPANGGGGKSSRRKTPVTGKKKHNR  542

Query  371  gsgsgggGPLSCFGNIFGYECQCVCG  294
                GG G  SCF NI G EC  VCG
Sbjct  543  RHTEGGNGLFSCFSNICGVECTFVCG  568



>ref|XP_009141305.1| PREDICTED: uncharacterized protein LOC103865261 [Brassica rapa]
Length=611

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 78/143 (55%), Gaps = 28/143 (20%)
 Frame = -2

Query  638  GGPYKANS----IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--SVEGLR  483
            G P ++N     I+++SE+GPSPSEVA  MA ER +    E S+L  WS D+  ++EGLR
Sbjct  440  GTPMRSNLAGRLILTESELGPSPSEVANKMAKERSQANDTESSILSEWSLDDDSNIEGLR  499

Query  482  SRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK------------Rgsg  363
            S+LERWRTE+PPLYD         VG A   +S  +     +++            R   
Sbjct  500  SKLERWRTELPPLYDLGSSHQSSDVGSAIVPASASAGGGKISRRKTPTVKKKKKHQRRHT  559

Query  362  sgggGPLSCFGNIFGYECQCVCG  294
             GG G  SCF NI G EC  VCG
Sbjct  560  EGGNGLFSCFSNICGAECSFVCG  582



>gb|KFK42792.1| hypothetical protein AALP_AA1G039700 [Arabis alpina]
Length=572

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 72/135 (53%), Gaps = 21/135 (16%)
 Frame = -2

Query  638  GGPYKAN----SIMSDSEVGPSPSEVAAAMAE--RPRYPLEDSVLDGWSCDE-SVEGLRS  480
            G P +AN     I+++SE+GPSPSEVA  +A+     +  E S+L  WS DE S+EGLRS
Sbjct  400  GTPMRANLAGRRILTESELGPSPSEVAEKIAKDRSNTHDTESSILSEWSIDETSIEGLRS  459

Query  479  RLERWRTEVPPLYD-----------QVGYAPTsssfrssSQYTAKK---RgsgsgggGPL  342
            +LERW+TE+PPLYD                PT     S  +  A K   R    GG G  
Sbjct  460  KLERWKTELPPLYDIGSSHVSSSDYDGAIVPTGGGMSSRRKTPAMKKHNRRHTDGGNGLF  519

Query  341  SCFGNIFGYECQCVC  297
            SCF  I G EC  VC
Sbjct  520  SCFSKICGVECSFVC  534



>ref|XP_010413889.1| PREDICTED: uncharacterized protein LOC104700118 [Camelina sativa]
Length=596

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 77/145 (53%), Gaps = 26/145 (18%)
 Frame = -2

Query  665  GTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--S  498
            GT  R  + G P     ++++SE+GPSPSEVA  MA ER +    E S+L  WS D+  +
Sbjct  428  GTPMRSNLAGRP-----VLTESELGPSPSEVAQKMAKERSQANDTESSILSEWSLDDDSN  482

Query  497  VEGLRSRLERWRTEVPPLYD--------QVGYAPTsssfrssSQYTAKK---------Rg  369
            +EGLRS+LERWRTE+PPLYD         VG      +     + + K+         R 
Sbjct  483  IEGLRSKLERWRTELPPLYDLGSSHQSSDVGSGAIVVANTGGGKSSRKRTPAVKKKHNRR  542

Query  368  sgsgggGPLSCFGNIFGYECQCVCG  294
               GG G  SCF N+ G EC  VCG
Sbjct  543  HTEGGNGLFSCFSNLCGVECTFVCG  567



>ref|XP_009119477.1| PREDICTED: uncharacterized protein LOC103844449 [Brassica rapa]
Length=561

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 65/123 (53%), Gaps = 17/123 (14%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSCDE-SVEGLRSRLERWRTEVPPL  444
            I++DSE+GPSPSE+A  +A+   +    E S+L  WS DE SVEGLRS+LERWRTE+PPL
Sbjct  406  ILTDSELGPSPSEIAEQLAKNRSHANDTESSILSEWSIDETSVEGLRSKLERWRTELPPL  465

Query  443  YD----QVG--------YAPTsssfrssSQYTAKK--RgsgsgggGPLSCFGNIFGYECQ  306
            YD    QV           P             KK  R    GG G  SCF  I G EC 
Sbjct  466  YDIGSSQVSSTEYDGSTIVPAGGRSSRRKTPAVKKHSRRHTEGGNGLFSCFSKICGVECS  525

Query  305  CVC  297
              C
Sbjct  526  FAC  528



>emb|CDY23753.1| BnaC04g43690D [Brassica napus]
Length=610

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 76/144 (53%), Gaps = 29/144 (20%)
 Frame = -2

Query  638  GGPYKANS----IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--SVEGLR  483
            G P ++N     I+++SE+GPSPSEVA  MA ER +   +E S+L  WS D+  ++EGLR
Sbjct  438  GTPMRSNLAGRLILTESELGPSPSEVANKMAKERSQANDIESSILSEWSLDDDSNIEGLR  497

Query  482  SRLERWRTEVPPLYDQVGYAPTsssfrssSQYTA---------------------KKRgs  366
            S+LERWRTE+PPLYD      +S    +    +A                      +R  
Sbjct  498  SKLERWRTELPPLYDLGSSHQSSDVDSAIVPASASAGGGKSSRRKTPTVKKKNKKHQRRH  557

Query  365  gsgggGPLSCFGNIFGYECQCVCG  294
              GG G  SCF NI G EC  VCG
Sbjct  558  TEGGNGLFSCFSNICGAECTFVCG  581



>ref|XP_010556931.1| PREDICTED: uncharacterized protein LOC104826097 [Tarenaya hassleriana]
Length=585

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 16/131 (12%)
 Frame = -2

Query  638  GGPYKANS----IMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGWSC-DESVEGLRS  480
            G P + N     I+++SE+GPSPSEV   M +    P   E S+L  WS  D S+EGLRS
Sbjct  426  GTPMRPNMARRPILTESELGPSPSEVMEKMEKERSNPNDTESSILSEWSIEDGSIEGLRS  485

Query  479  RLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKK---------RgsgsgggGPLSCFGN  327
            +LERWRTE+PPLYD      +S    ++   ++++         R    GG G  SCF N
Sbjct  486  KLERWRTELPPLYDLGSSHLSSEMDEAAGGKSSRRKTPAMKTHSRRHTDGGNGLFSCFSN  545

Query  326  IFGYECQCVCG  294
            I G EC   CG
Sbjct  546  ICGVECTFACG  556



>ref|XP_002528347.1| hypothetical protein RCOM_1217340 [Ricinus communis]
 gb|EEF34019.1| hypothetical protein RCOM_1217340 [Ricinus communis]
Length=472

 Score = 80.1 bits (196),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (63%), Gaps = 10/112 (9%)
 Frame = -2

Query  611  MSDSEVGPSPSEVAAAMAE-RPRYPLEDS---VLDGWSCDESVEGLRSRLERWRTEVPPL  444
            +++SE+GPS SEVAA M   + +Y +E++   ++  WS + S+EGL+S+LERWR E+PP+
Sbjct  341  ITESELGPSASEVAAIMVNNKNQYKVEEAESEIMGSWSLESSMEGLQSKLERWRAELPPV  400

Query  443  YD--QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            YD  ++   P SS     +++  ++    S G G  SCFG   G EC  VCG
Sbjct  401  YDRSELSSYPISSVAAGGNRHNRRR----SDGDGAFSCFGTFCGMECSIVCG  448



>gb|AAB80639.1| Contains similarity to Glycine SRC2 (gb|AB000130) [Arabidopsis 
thaliana]
Length=578

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I+++SE+GPSPSEVA  +A+   +  E S+L  WS DES +EGLRS+LERWRTE+PPLYD
Sbjct  442  ILTESELGPSPSEVADKLAKDRSHETESSILSEWSIDESSIEGLRSKLERWRTELPPLYD  501



>ref|XP_003535258.1| PREDICTED: uncharacterized protein LOC100787698 [Glycine max]
Length=657

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRY-PLEDSVLDGWSCD-ESVEGLRSRLERWRTEVPPLY  441
            ++++SE+GPS SEVAA +A++P     E+S + GWS D ES+EGL S+LERW+T++PP+ 
Sbjct  518  VITESELGPSASEVAAVIAQKPVIDEAENSTVGGWSLDAESMEGLESKLERWQTKLPPVI  577

Query  440  D--QVGYAPTsssfrssSQ---YTAKKRgsgsgggGPLSCFGNIFGYECQCVCG  294
            D  ++   PT+S+ ++S     +T         G G  SCF NI G EC   CG
Sbjct  578  DHGELSSYPTTSTTKTSRHSRRHTDGGSIGSGSGSGLFSCFSNICGVECYVGCG  631



>ref|XP_003590193.1| hypothetical protein MTR_1g045780 [Medicago truncatula]
 gb|AES60444.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=459

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 122/239 (51%), Gaps = 29/239 (12%)
 Frame = -2

Query  941  KGKASSVINAADVKNKSYQKGKAISVVSDSITIKDSSPSGKI----GNKNEAQAKNKEVV  774
            +GKASS +  ++V   +Y K K+ S++S S  +K +  S K+     NKN     N   +
Sbjct  206  RGKASSQVTLSEVS--TYSKKKSPSMLSGS-DVKATPTSKKVKSRKTNKNYPNDFNPTAI  262

Query  773  ENKN-------GPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANS  615
             + +        P+F +SP    V         P + +        + +     PY+ N 
Sbjct  263  VSYDYEVKPSPKPQFLNSPATGRVYNNGGARATPLHAFAINNAVANANMEYNS-PYRTNK  321

Query  614  -----IMSDSEVGPSPSEVAAAMAERPRYPL-EDSVLDGWSCDESVEGLRSRLERWRTEV  453
                 I++DSE+GPS SEVA A+A +P     E S++ GWS +ESVE L+ ++ERW+T++
Sbjct  322  GHHRPIITDSELGPSASEVAEAVARQPVMDEGESSIVTGWSLNESVEDLQPKIERWQTDL  381

Query  452  PPLYD--QVGYAPTsssfrssSQYTAKKRgsgsgggGP----LSCFGNIFGYECQCVCG  294
             P++D  ++   PT+SS +      +++R +G GG G      SCF  I G EC  VCG
Sbjct  382  APVHDGREMSSKPTTSSKKKDKH--SRRRTNGGGGDGGDNGLFSCFSVICGLECSIVCG  438



>gb|KDP33324.1| hypothetical protein JCGZ_12873 [Jatropha curcas]
Length=446

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 73/138 (53%), Gaps = 14/138 (10%)
 Frame = -2

Query  677  SAKPG----TGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRY--PLEDSVLDG  516
            + KPG    T S    GG P    SI+++SE+GPSPSEV AAM +       +E  ++  
Sbjct  291  NGKPGSNNDTSSSKFNGGAP----SILTESELGPSPSEVVAAMIKNKLRIEEMESEIIGS  346

Query  515  WSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQ---YTAKKRgsgsgggGP  345
            WS + S+EGL S+LERW+ E   +YD    +    S   S     Y   +R S   GG  
Sbjct  347  WSLESSMEGLHSKLERWQIEASSVYDHSDISSLIRSSVVSGGSGPYMHHRRHSEGDGGV-  405

Query  344  LSCFGNIFGYECQCVCGQ  291
             SCFG++ G +C  VCG+
Sbjct  406  FSCFGSVCGVQCSIVCGR  423



>ref|XP_006418119.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
 gb|ESQ36472.1| hypothetical protein EUTSA_v10007144mg [Eutrema salsugineum]
Length=595

 Score = 76.3 bits (186),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 72/150 (48%), Gaps = 33/150 (22%)
 Frame = -2

Query  647  VIGGGPYKAN-------------SIMSDSEVGPSPSEVAAAMAERPRYP--LEDSVLDGW  513
            +IG  P ++N              I ++SE+GPSPSEVA  +A+        E S+L  W
Sbjct  412  IIGSTPMRSNYMATPMRSNLVGRKIFTESELGPSPSEVAEKIAKDRSNANETESSILSEW  471

Query  512  SCDES-VEGLRSRLERWRTEVPPLYD----QV-----------GYAPTsssfrssSQYTA  381
            S DES +EGLRS+L+RWRTE+PPLYD    QV               T           A
Sbjct  472  SIDESSIEGLRSKLDRWRTELPPLYDIGSSQVSNSEFDGSIVPAAVATGGRSSRRKTPAA  531

Query  380  KK--RgsgsgggGPLSCFGNIFGYECQCVC  297
            KK  R    GG G  SCF  I G EC  VC
Sbjct  532  KKHHRRHTDGGNGLFSCFSKICGVECSFVC  561



>ref|XP_004497792.1| PREDICTED: uncharacterized protein LOC101505544 [Cicer arietinum]
Length=451

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 11/124 (9%)
 Frame = -2

Query  632  PYKANS-----IMSDSEVGPSPSEVAAAMAERPRYPLED-SVLDGWSCDESVEGLRSRLE  471
            PY+++      I++DSE+GPS SEVAA +A +P     D S +  WS DESVE L+ ++E
Sbjct  307  PYRSHMGRHRPIITDSELGPSASEVAAVVARQPVMDEGDNSTIGRWSLDESVEELQPKIE  366

Query  470  RWRTEVPPLYD--QVGYAPTsss---frssSQYTAKKRgsgsgggGPLSCFGNIFGYECQ  306
            RW+T++ P+YD  ++   PTSS      S  +  +   G G GG G  SCF  I G EC 
Sbjct  367  RWQTDLAPVYDGGEMSSVPTSSKKKGKHSRRRTESSSGGGGGGGNGLFSCFSVICGLECS  426

Query  305  CVCG  294
             VCG
Sbjct  427  IVCG  430



>emb|CDY59181.1| BnaC08g50140D [Brassica napus]
Length=593

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 61/122 (50%), Gaps = 20/122 (16%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I++DSE+GPS SEVA   +    +  E S+L  WS D+S +EG RS+LE WRTE+PPLYD
Sbjct  444  ILTDSELGPSSSEVAKNKS----HETESSILSDWSVDDSSIEGARSKLEMWRTELPPLYD  499

Query  437  -------------QVGYAPTsssfrssSQYTAK--KRgsgsgggGPLSCFGNIFGYECQC  303
                          V YA             AK   R   S G G  SCF  I G EC  
Sbjct  500  IGSSQVSSTDYDGSVVYAANGGRSSRRKTPAAKNANRRHSSEGNGLFSCFSKICGVECSF  559

Query  302  VC  297
            VC
Sbjct  560  VC  561



>emb|CDY53195.1| BnaAnng12200D [Brassica napus]
Length=593

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 61/122 (50%), Gaps = 20/122 (16%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I++DSE+GPS SEVA   +    +  E S+L  WS D+S +EG RS+LE WRTE+PPLYD
Sbjct  444  ILTDSELGPSSSEVAKNKS----HETESSILSDWSVDDSSIEGARSKLEMWRTELPPLYD  499

Query  437  -------------QVGYAPTsssfrssSQYTAK--KRgsgsgggGPLSCFGNIFGYECQC  303
                          V YA             AK   R   S G G  SCF  I G EC  
Sbjct  500  IGSSQVSSTDYDGSVVYAANGGRSSRRKTPAAKNANRRHSSEGNGLFSCFSKICGVECSF  559

Query  302  VC  297
            VC
Sbjct  560  VC  561



>ref|XP_009118638.1| PREDICTED: uncharacterized protein LOC103843645 [Brassica rapa]
Length=593

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 61/122 (50%), Gaps = 20/122 (16%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDES-VEGLRSRLERWRTEVPPLYD  438
            I++DSE+GPS SEVA   +    +  E S+L  WS D+S +EG RS+LE WRTE+PPLYD
Sbjct  444  ILTDSELGPSSSEVAKNKS----HETESSILSDWSVDDSSIEGARSKLEMWRTELPPLYD  499

Query  437  -------------QVGYAPTsssfrssSQYTAK--KRgsgsgggGPLSCFGNIFGYECQC  303
                          V YA             AK   R   S G G  SCF  I G EC  
Sbjct  500  IGSSQVSSTDYDGSVVYAANGGRSSRRKTPAAKNANRRHSSEGNGLFSCFSKICGVECSF  559

Query  302  VC  297
            VC
Sbjct  560  VC  561



>ref|XP_004152866.1| PREDICTED: uncharacterized protein LOC101218582 [Cucumis sativus]
 gb|KGN61292.1| hypothetical protein Csa_2G076000 [Cucumis sativus]
Length=360

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPLED----SVLDGWSCDESVEGLRSRLERWRTEVPPLYD-  438
            S+VGPSPS VAAA+A +  YP  D    S+L+ W+  +S+EGL++++ERWRTE+ P+Y+ 
Sbjct  232  SDVGPSPSVVAAAIA-KGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYES  290

Query  437  QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
            ++   P+ S  + S +   +K+GSG       SCFG  +G E    CG P
Sbjct  291  EIKKLPSRSYRKKSVKKQRRKKGSGL-----FSCFGTAYGCEFSITCGGP  335



>ref|XP_004155136.1| PREDICTED: uncharacterized protein LOC101227028 [Cucumis sativus]
Length=360

 Score = 73.2 bits (178),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPLED----SVLDGWSCDESVEGLRSRLERWRTEVPPLYD-  438
            S+VGPSPS VAAA+A +  YP  D    S+L+ W+  +S+EGL++++ERWRTE+ P+Y+ 
Sbjct  232  SDVGPSPSVVAAAIA-KGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPMYES  290

Query  437  QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
            ++   P+ S  + S +   +K+GSG       SCFG  +G E    CG P
Sbjct  291  EIKKLPSRSYRKKSVKKQRRKKGSGL-----FSCFGTAYGCEFSITCGGP  335



>ref|XP_007144140.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
 gb|ESW16134.1| hypothetical protein PHAVU_007G132000g [Phaseolus vulgaris]
Length=736

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 17/124 (14%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRYPL-EDSVLDGWSCDESVEGLRSRLERWRTEVPPLYD  438
            +M++SE+GPSPSEVAAA+A  P     E+  ++GW  D S+EGL+S+LERWR+++PP+ D
Sbjct  589  MMTESELGPSPSEVAAAIARNPVIDEGENMTVEGWDLDGSMEGLQSKLERWRSDLPPVID  648

Query  437  --QVGYAPTsssfrssS--QYT------------AKKRgsgsgggGPLSCFGNIFGYECQ  306
              ++   PTSS+  S    ++T                G   GGGG  SCF  I G EC 
Sbjct  649  RGELSSHPTSSTKTSLHSRRHTDGGSTPSGGGGGGGSGGGRKGGGGLFSCFSKICGLECY  708

Query  305  CVCG  294
              CG
Sbjct  709  IGCG  712



>ref|XP_006577748.1| PREDICTED: uncharacterized protein LOC102667983 [Glycine max]
Length=373

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 71/139 (51%), Gaps = 16/139 (12%)
 Frame = -2

Query  689  YDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPL--------E  534
            Y Y       G R    G  +   S++SD  VGPSPS VAAA+A +  YP+        E
Sbjct  213  YGYDGQDSDVGMR---KGAVFNEGSLISD--VGPSPSVVAAAIA-KGLYPMPPPAPRTVE  266

Query  533  DSVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgg  354
             S +DGWS +   EG+++++ERWR E+ P Y+   Y       R +S+   +       G
Sbjct  267  SSTMDGWSENSGTEGMKTKIERWRNELTPAYED--YVDERKVLRQTSKRVGRTPRRRGQG  324

Query  353  gGPLSCFGNIFGYECQCVC  297
            GGP SCFG++FG E    C
Sbjct  325  GGPCSCFGSVFGVEISITC  343



>gb|KCW60206.1| hypothetical protein EUGRSUZ_H02915 [Eucalyptus grandis]
Length=452

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMAERPRY---PLEDSVLDGWSCDESVEGLRSRLERWRTEVPPL  444
            I+++SE+GPSPSEVAAA+A + RY    +E  V+ GWS +ESVEGL+S+LERWR E+P L
Sbjct  322  IITESELGPSPSEVAAAVAAKERYKEKEVESPVVGGWSLNESVEGLQSKLERWRMELPTL  381

Query  443  YDQVGYA  423
            YD+  Y+
Sbjct  382  YDRGDYS  388



>emb|CDY17161.1| BnaA05g10270D [Brassica napus]
Length=278

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 68/131 (52%), Gaps = 24/131 (18%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--SVEGLRSRLERWRTEVPP  447
            I+++SE+GPS S VA  +A ER +    E S+L  WS D+  ++EGL S+LERWRTE+PP
Sbjct  118  ILTESELGPSSSGVANKIAKERSQANDTESSILSEWSLDDDSNIEGLLSKLERWRTELPP  177

Query  446  LYD--------QVGYAPTsssfrssSQYTAKK------------RgsgsgggGPLSCFGN  327
            LYD         VG      S       ++++            R    GG G  SCF N
Sbjct  178  LYDLGSSHQSSDVGREIVPVSANGGGGKSSRRKTPSAKKKKKHNRRHTEGGNGLFSCFSN  237

Query  326  IFGYECQCVCG  294
            + G EC  VCG
Sbjct  238  LCGVECTFVCG  248



>ref|XP_008441789.1| PREDICTED: uncharacterized protein LOC103485843 [Cucumis melo]
Length=361

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 12/111 (11%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPLED----SVLDGWSCDESVEGLRSRLERWRTEVPP-LYD  438
            S+VGPSPS VAAA+A +  YP  D    S+L+ W+  +S+EGL++++ERWRTE+ P +YD
Sbjct  232  SDVGPSPSVVAAAIA-KGLYPAPDDVGSSILEDWTEKDSIEGLKTKIERWRTELHPIMYD  290

Query  437  -QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQP  288
             ++   P+ S  + S +   +K+GSG       SCFG  +G E    CG P
Sbjct  291  NEIKKLPSRSYRKKSVKKQRRKKGSGL-----FSCFGTAYGCEFSITCGGP  336



>ref|XP_007205372.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
 gb|EMJ06571.1| hypothetical protein PRUPE_ppa007276mg [Prunus persica]
Length=375

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 59/101 (58%), Gaps = 21/101 (21%)
 Frame = -2

Query  692  GYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPL--------  537
            G DYGS   G+       GG  K  SI SD  VGPSPS VAAA+A +  YPL        
Sbjct  190  GSDYGSIVNGSELSSAQKGG--KGGSICSD--VGPSPSVVAAAIA-KGIYPLGHVGGNVV  244

Query  536  --------EDSVLDGWSCDESVEGLRSRLERWRTEVPPLYD  438
                     +S+LD W+  +SVEGL++++ERWRTE+PP+YD
Sbjct  245  RHAAQGDARNSLLDEWTDQDSVEGLKTKIERWRTELPPVYD  285



>emb|CDY19481.1| BnaC04g11180D [Brassica napus]
Length=423

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 67/131 (51%), Gaps = 24/131 (18%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSC--DESVEGLRSRLERWRTEVPP  447
            I+++SE+ PS SEVA   A ER +    E S+L  WS   D ++EGLRS+LERWRTE+PP
Sbjct  270  ILTESELVPSSSEVANKKAKERSQANDTESSILSEWSLEDDRNIEGLRSKLERWRTELPP  329

Query  446  LYD--------QVGYAPTsssfrssSQYTAKK------------RgsgsgggGPLSCFGN  327
            LYD         VG      S       ++++            R    GG G  SCF N
Sbjct  330  LYDLGSSHQSSDVGREIVPVSANGGGGKSSRRKAPTVKKKKKHNRRHTEGGNGLFSCFSN  389

Query  326  IFGYECQCVCG  294
            + G EC  VCG
Sbjct  390  LCGVECTFVCG  400



>ref|XP_010102203.1| hypothetical protein L484_024484 [Morus notabilis]
 gb|EXB93146.1| hypothetical protein L484_024484 [Morus notabilis]
Length=377

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 65/122 (53%), Gaps = 20/122 (16%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPL-------------EDSVLDGWSC-DESVEGLRSRLERW  465
            S+VGPSPS VAAA+A   RYP              E S+L+ W+  D+S EGL++++ERW
Sbjct  224  SDVGPSPSVVAAAIA-MGRYPAKAKDSGGAANEMAESSILEEWTEEDDSAEGLKTKIERW  282

Query  464  RTEVPPLYD-----QVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCV  300
            R+E+ PLY       + Y   + +  +  +    K+    GG G  SCFGN +G E    
Sbjct  283  RSEIHPLYQSQYKKNMSYHRENYNRSTHRRNEPAKKELRRGGSGLFSCFGNAYGCEFSIT  342

Query  299  CG  294
            CG
Sbjct  343  CG  344



>ref|XP_009143873.1| PREDICTED: uncharacterized protein LOC103867544 [Brassica rapa]
Length=561

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 67/131 (51%), Gaps = 24/131 (18%)
 Frame = -2

Query  614  IMSDSEVGPSPSEVAAAMA-ERPRY-PLEDSVLDGWSCDE--SVEGLRSRLERWRTEVPP  447
            I+++SE+GPS S V    + ER +    E S+L  WS D+  ++EGLRS+LERWRTE+PP
Sbjct  401  ILTESELGPSSSGVTNQKSKERSQANDTESSILSEWSLDDDSNIEGLRSKLERWRTELPP  460

Query  446  LYD--------QVGYAPTsssfrssSQYTAKK------------RgsgsgggGPLSCFGN  327
            LYD         VG      S       ++++            R    GG G  SCF N
Sbjct  461  LYDLGSSHQSSDVGREIVPVSANGGGGKSSRRKTPTAKKKKKHNRRHTEGGNGLFSCFSN  520

Query  326  IFGYECQCVCG  294
            + G EC  VCG
Sbjct  521  LCGVECTFVCG  531



>ref|XP_004304780.1| PREDICTED: uncharacterized protein LOC101296310 [Fragaria vesca 
subsp. vesca]
Length=457

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 13/87 (15%)
 Frame = -2

Query  668  PGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAMAERPRYPLED----------SVLD  519
            P  G+  ++ G      S+ SD  VGPSPS VAAA+A +  YPL            S++D
Sbjct  297  PPNGNGSMVNGSSIVNGSLCSD--VGPSPSVVAAAIA-KGIYPLPHGASNTDQSGSSLMD  353

Query  518  GWSCDESVEGLRSRLERWRTEVPPLYD  438
             W+ ++SVEGL++++ERWRTE+PP+YD
Sbjct  354  EWADEDSVEGLKTKIERWRTELPPVYD  380



>ref|XP_008370760.1| PREDICTED: uncharacterized protein LOC103434221 [Malus domestica]
 ref|XP_008370902.1| PREDICTED: uncharacterized protein LOC103434347 [Malus domestica]
Length=402

 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 62/114 (54%), Gaps = 16/114 (14%)
 Frame = -2

Query  740  PTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSEVAAAM  561
            P+N T +     PK     + ++    GS L  G      N  +  S+VGPSPS VAAA+
Sbjct  212  PSNSTCNAAAYKPKTQA-SFCNSSIVNGSELSTGQKKGNVNGSLC-SDVGPSPSVVAAAI  269

Query  560  AERPRYPL-------------EDSVLDGWSCDESVEGLRSRLERWRTEVPPLYD  438
            A +  YPL               S+LD W+  +SVEGL++++ERWRTE+PP+YD
Sbjct  270  A-KGIYPLPYTGARAPSPDDAGSSLLDEWADQDSVEGLKTKIERWRTELPPVYD  322



>ref|XP_002521996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40400.1| conserved hypothetical protein [Ricinus communis]
Length=380

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 6/79 (8%)
 Frame = -2

Query  530  SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsggg  351
            S++D W+ ++SVEGLR++LERWRTE+PP+YD    A    S     Q+  ++  +     
Sbjct  284  SIIDDWTENDSVEGLRTKLERWRTELPPIYDS--NAKKMKSKSRRKQHHRRRSDNPGL--  339

Query  350  GPLSCFGNIFGYECQCVCG  294
               +CFGN FG E    CG
Sbjct  340  --FTCFGNAFGCEISITCG  356



>ref|XP_002325345.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
 gb|EEE99726.1| hypothetical protein POPTR_0019s03780g [Populus trichocarpa]
Length=364

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = -2

Query  530  SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsggg  351
            S+L+ W+ ++S EGLR++LERWRTE+PP+YD           +  S+   KK    S GG
Sbjct  268  SILEDWTENDSAEGLRTKLERWRTELPPVYDN-------DLRKMQSRSRNKKHRRRSEGG  320

Query  350  GPLSCFGNIFGYECQCVCG  294
               SCFGN FG E    CG
Sbjct  321  RLFSCFGNAFGCEISITCG  339



>gb|KDP23730.1| hypothetical protein JCGZ_23563 [Jatropha curcas]
Length=375

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 46/79 (58%), Gaps = 6/79 (8%)
 Frame = -2

Query  530  SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsggg  351
            S+L+ W+ ++SVEGLR++LERWRTE+PP+YD             S     +++   S   
Sbjct  278  SILEDWTDNDSVEGLRTKLERWRTELPPIYDN------DKQKMMSKSRRKQQQRRRSEHP  331

Query  350  GPLSCFGNIFGYECQCVCG  294
            G  +CFGNIFG E    CG
Sbjct  332  GLFTCFGNIFGCEISITCG  350



>ref|XP_008218351.1| PREDICTED: uncharacterized protein LOC103318712 [Prunus mume]
Length=417

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 19/79 (24%)
 Frame = -2

Query  626  KANSIMSDSEVGPSPSEVAAAMAERPRYPL----------------EDSVLDGWSCDESV  495
            K  SI SD  VGPSPS VAAA+A +  YPL                 +S+LD W+  +SV
Sbjct  254  KGGSICSD--VGPSPSVVAAAIA-KGIYPLGHGGGNVVRHAAQGDARNSLLDEWTDQDSV  310

Query  494  EGLRSRLERWRTEVPPLYD  438
            EGL++++ERWRTE+PP+YD
Sbjct  311  EGLKTKIERWRTELPPVYD  329



>ref|XP_011036375.1| PREDICTED: uncharacterized protein LOC105133911 [Populus euphratica]
Length=382

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = -2

Query  530  SVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsggg  351
            S+L+ W+ ++S EGLR++LERWRTE+PP+YD           +  S+   KK    S GG
Sbjct  286  SILEDWTENDSAEGLRTKLERWRTELPPVYDN-------DLRKMQSRSRNKKHRRRSEGG  338

Query  350  GPLSCFGNIFGYECQCVCG  294
               SCFGN FG E    CG
Sbjct  339  RLFSCFGNAFGCEISITCG  357



>emb|CDP04278.1| unnamed protein product [Coffea canephora]
Length=377

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 84/181 (46%), Gaps = 28/181 (15%)
 Frame = -2

Query  803  EAQAKNKEVVENKNGPRFDDSPTNKTVDGKPNI--PKIPGYDYGSAKPGTGSRLVIGGGP  630
            E + K  +   N  G  ++ S  N    G  ++  P + G + G AK G+          
Sbjct  179  EVKEKGNKWKGNGEGSVYNSSVVNGPTRGGSSLNGPNLNGSEIGVAKNGS----------  228

Query  629  YKANSIMSDSEVGPSPSEVAAAMAERPRYPL--------EDSVLDGWSCDE-SVEGLRSR  477
                  M +S+VGPSPS VAAA+A R  YP           S+L  W+ D+ SVEGL+S+
Sbjct  229  ------MCNSDVGPSPSVVAAAVA-RGLYPTPLPKPHDPGSSILGDWTADDASVEGLKSK  281

Query  476  LERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVC  297
            ++RW+ E+P   D+   +          +   ++R S + G G  SCFG   G E   VC
Sbjct  282  IDRWKMELPGKCDKTPNSYQKIPKEKERKQHWRRRKSANEGSGRFSCFGAACGCEFTIVC  341

Query  296  G  294
            G
Sbjct  342  G  342



>ref|XP_009379739.1| PREDICTED: uncharacterized protein LOC103968123 [Pyrus x bretschneideri]
Length=395

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 14/68 (21%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPLE-------------DSVLDGWSCDESVEGLRSRLERWR  462
            S+VGPSPS VAAA+A +  YPL               S+LD W+  +SVEGL++++ERWR
Sbjct  257  SDVGPSPSVVAAAIA-KGIYPLPYTGARAPPANDAGSSLLDEWTDQDSVEGLKTKIERWR  315

Query  461  TEVPPLYD  438
            TE+PP+YD
Sbjct  316  TELPPVYD  323



>ref|XP_008366882.1| PREDICTED: uncharacterized protein LOC103430513 [Malus domestica]
Length=395

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 14/68 (21%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPL-------------EDSVLDGWSCDESVEGLRSRLERWR  462
            S+VGPSPS VAAA+A +  YPL               S+LD W+  +SVEGL++++ERWR
Sbjct  257  SDVGPSPSVVAAAIA-KGIYPLPYTGPRAQPANDAGSSLLDEWTDQDSVEGLKTKIERWR  315

Query  461  TEVPPLYD  438
            TE+PP+YD
Sbjct  316  TELPPVYD  323



>ref|XP_008388740.1| PREDICTED: uncharacterized protein LOC103451084 [Malus domestica]
Length=395

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 14/68 (21%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPLE-------------DSVLDGWSCDESVEGLRSRLERWR  462
            S+VGPSPS VAAA+A +  YPL               S+LD W+  +SVEGL++++ERWR
Sbjct  257  SDVGPSPSVVAAAIA-KGIYPLPYTGPRAQPANDAGSSLLDEWTDQDSVEGLKTKIERWR  315

Query  461  TEVPPLYD  438
            TE+PP+YD
Sbjct  316  TELPPVYD  323



>ref|XP_009343786.1| PREDICTED: uncharacterized protein LOC103935702 [Pyrus x bretschneideri]
Length=402

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (71%), Gaps = 14/68 (21%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYPL----------ED---SVLDGWSCDESVEGLRSRLERWR  462
            S+VGPSPS VAAA+A +  YPL          +D   S+LD W+  +SVEGL++++ERWR
Sbjct  256  SDVGPSPSVVAAAIA-KGIYPLPYTGARAPSPDDAGSSLLDEWADQDSVEGLKTKIERWR  314

Query  461  TEVPPLYD  438
            TE+PP+YD
Sbjct  315  TELPPVYD  322



>gb|EYU39519.1| hypothetical protein MIMGU_mgv1a012935mg [Erythranthe guttata]
Length=235

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 63/122 (52%), Gaps = 21/122 (17%)
 Frame = -2

Query  605  DSEVGPSPSEVAAAMAERPRYPLED--------SVLDGWSCDE-SVEGLRSRLERWRTEV  453
            +S+VGPSPS VAAA+A    YP +         SVL+ W+ +E S+EGL+S++ERWR E+
Sbjct  86   NSDVGPSPSVVAAAVAW-GLYPTQHGPAPKPGSSVLEDWTVEETSMEGLKSKIERWRMEL  144

Query  452  PPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGP----------LSCFGNIFGYECQC  303
            P  YDQ  Y    ++ R        +R   +   G            +CFGN +G E   
Sbjct  145  PQKYDQ-KYRRLENNKRREKNKKNHRRSKTAVDDGGGGDGDDDDGLFTCFGNAYGCEFTI  203

Query  302  VC  297
            VC
Sbjct  204  VC  205



>ref|XP_011077059.1| PREDICTED: uncharacterized protein LOC105161156 [Sesamum indicum]
Length=397

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 12/121 (10%)
 Frame = -2

Query  623  ANSIMSDSEVGPSPSEVAAAMAERPRYPLE--------DSVLDGWSCDE-SVEGLRSRLE  471
             N    +S++GPSPS VAAA+A    YP +         SVL+ W+ +E S+EGL+S++E
Sbjct  255  VNGSQCNSDLGPSPSVVAAAVAC-GLYPTQLGPPPKPGSSVLEDWTVEEASMEGLKSKIE  313

Query  470  RWRTEVP--PLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVC  297
            RWR E+P    Y ++  +      +   +      G+     G  SCFGN +G E   VC
Sbjct  314  RWRMELPQNQRYQRLEASNKRREKKPGHRRRKTANGADDDEAGRFSCFGNAYGCEFTIVC  373

Query  296  G  294
            G
Sbjct  374  G  374



>ref|XP_007147205.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
 gb|ESW19199.1| hypothetical protein PHAVU_006G104400g [Phaseolus vulgaris]
Length=371

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 73/162 (45%), Gaps = 13/162 (8%)
 Frame = -2

Query  755  RFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPYKANSIMSDSEVGPSPSE  576
            R+     + T+D          Y Y       G R    GG +  +S++SD  VGPSPS 
Sbjct  188  RYQSEKNDSTIDDYAYHGNAKRYFYDEQDSEVGVR---KGGVFNGDSLISD--VGPSPSM  242

Query  575  VAAAMAERPRYPL------EDSVLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTs  414
            VA+A++ +  YP+      + S +DGWS +   E ++ ++E+WR E+ P Y+        
Sbjct  243  VASAIS-KGLYPMPPPRTADSSTIDGWSENSGTEVMKKKMEKWRMELSPAYEDYDDERRK  301

Query  413  ssfrssSQ-YTAKKRgsgsgggGPLSCFGNIFGYECQCVCGQ  291
                S  +  T +         G  SCFG++FG E    C +
Sbjct  302  LKQTSPREGQTPRGGSRRGSRRGGPSCFGSVFGCEITITCAK  343



>ref|XP_004494967.1| PREDICTED: uncharacterized protein LOC101508328 [Cicer arietinum]
Length=373

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 56/117 (48%), Gaps = 27/117 (23%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAERPRYP-------LEDSVLDGWSCDESVEGLRSRLERWRTEVPPL  444
            S++GPSPS VAAA+A +  YP       +E S +D WS     EG+ ++++RWR E+ P 
Sbjct  241  SDIGPSPSVVAAAIA-KGLYPIPAPPRTMESSTVDDWSESNCSEGMNTKIQRWRHELTPA  299

Query  443  YDQVGYAPTsssfrssSQYTAKKRgsgsgggGP-------LSCFGNIFGYECQCVCG  294
            Y++  Y               +KR  G   G P        SCFG  FG E    CG
Sbjct  300  YNKEEYDEI------------EKRVGGKTPGRPVSRKGKLFSCFGTAFGCEFSISCG  344



>ref|XP_010043310.1| PREDICTED: uncharacterized protein LOC104432551 [Eucalyptus grandis]
Length=355

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -2

Query  527  VLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggG  348
            +LD W+ ++S EGLR+++ERWRTE+PP++++ G    ++   ++      +R S  GG  
Sbjct  265  LLDNWTENDSSEGLRTKIERWRTELPPIHNRGGNGKKNAKTGANQGRDRPRRHSDGGGL-  323

Query  347  PLSCFGNIFGYECQCVCG  294
              SCFGN +G E    CG
Sbjct  324  -FSCFGNAYGCEFSISCG  340



>gb|KCW85316.1| hypothetical protein EUGRSUZ_B02156 [Eucalyptus grandis]
Length=352

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -2

Query  527  VLDGWSCDESVEGLRSRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggG  348
            +LD W+ ++S EGLR+++ERWRTE+PP++++ G    ++   ++      +R S  GG  
Sbjct  265  LLDNWTENDSSEGLRTKIERWRTELPPIHNRGGNGKKNAKTGANQGRDRPRRHSDGGGL-  323

Query  347  PLSCFGNIFGYECQCVCG  294
              SCFGN +G E    CG
Sbjct  324  -FSCFGNAYGCEFSISCG  340



>gb|KEH24577.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=389

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 13/116 (11%)
 Frame = -2

Query  602  SEVGPSPSEVAAAMAER------PRYPLEDSVLDGWSCDESVEGLRSRLERWRTEVPPLY  441
            S+VGPSPS VAAA+A+       P   ++ S + GWS     EG+ +++ERWR E+ P Y
Sbjct  245  SDVGPSPSVVAAAIAKGLYLMPPPSRKVKSSAVGGWSESNYTEGMDTKIERWRNELTPAY  304

Query  440  DQVGYAPTsssfrssSQYTAKKRgsgsgggGPL-------SCFGNIFGYECQCVCG  294
            D+          +         + SG   G P+       SCFG +FG E    CG
Sbjct  305  DEEFEELDEEIKKRMVVAKKTPKRSGKTPGRPMSKKGKLCSCFGTMFGCEFSITCG  360



>ref|XP_010557577.1| PREDICTED: uncharacterized protein LOC104826528 [Tarenaya hassleriana]
Length=446

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 76/273 (28%), Positives = 113/273 (41%), Gaps = 75/273 (27%)
 Frame = -2

Query  947  ETKGKASSVINAADVKNKSYQKGKAISVVSDSITIKDSSPSGKIGNKNEAQAKNKEVV--  774
            ET     S ++   ++  S++  +    V+ S    +S       +KNE  + ++ V   
Sbjct  176  ETSSMVESGVSTMIIRRNSFKDLERKDDVTGSNQTTNSDFEISSSDKNEFSSDSQMVAYH  235

Query  773  ------ENKNGPRFDDSPT--NKTVDGKPNIPKIPGY-------DYGSAKPGTGSRLVIG  639
                  +  + PRF+  PT     V   P  P+  GY       +YG+  P    R+VI 
Sbjct  236  PPNKTPKTTSNPRFEAKPTLARHDVYATPMRPRNMGYVPKKNNVEYGT--PMRARRIVI-  292

Query  638  GGPYKANSIMSDSEVGPSPSEVAA------AMAERPRYPLEDSVLDGWSCDE-SVEGLRS  480
                      ++SE+GPS S VAA      AMA R    +E +V+   S DE SVEGL+S
Sbjct  293  ----------TESELGPSASVVAAQVARERAMAGRE---VESTVI---SVDERSVEGLQS  336

Query  479  RLERWRTEVPPLYDQVGYAPTsssfrssSQY-----------------------------  387
            +LERW+  + P+ D      TSS +++SS Y                             
Sbjct  337  KLERWQANLQPILDAGSSYQTSSDYKASSNYKPTSNYKRNDAIGGGGGGRSVKHQVAVVP  396

Query  386  ---TAKKRgsgsgggGPLSCFGNIFGYECQCVC  297
                +++   G G  G  SCF NI G EC  VC
Sbjct  397  MKKHSRRHTEGGGDSGLFSCFSNICGIECSIVC  429



>ref|XP_010264865.1| PREDICTED: uncharacterized protein LOC104602763 [Nelumbo nucifera]
Length=418

 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = -2

Query  617  SIMSDSEVGPSPSEVAAAMAERPRYP---LEDSVLDGWSCDES-VEGLRSRLERWRTEVP  450
            S+ S+S+V P+PS   A++A    +P    E+   + W+ D+S VEGL S+LERWR E+P
Sbjct  229  SVYSESDVCPTPSVREASIAAADYFPAPETENYAPEHWNDDDSSVEGLSSKLERWRAELP  288

Query  449  PLYDQVGY  426
            P + + GY
Sbjct  289  PTFHRGGY  296



>ref|XP_011038591.1| PREDICTED: uncharacterized protein LOC105135426 [Populus euphratica]
Length=367

 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -2

Query  530  SVLDGWSCDESVEGLRSRLERWRTEVPPLYD  438
            SV++ W+ ++S+EGLR++LERWRTE+PP++D
Sbjct  273  SVVEDWTENDSIEGLRTKLERWRTELPPIHD  303



>ref|XP_008224037.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103323799 
[Prunus mume]
Length=516

 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 103/243 (42%), Gaps = 63/243 (26%)
 Frame = -2

Query  941  KGKASSVINAADV-------KNKSYQKGKAISVVSDS-ITIKDSSPSGKIGNKNEAQAKN  786
            KGK SS++ A+DV       K    +KGK  SV+S S  T++D+   G   N   A +  
Sbjct  278  KGKPSSILAASDVNSSVAPPKYGKDKKGKPSSVLSASEATVRDAQKKGDSSNGKPASS--  335

Query  785  KEVVENKNGPRFDDSPTNKTVDGKPNIPKIPGYDYGSAKPGTGSRLVIGGGPY-------  627
               + + + P  +D P  K    KP+       +YGS  PG  S    G  P+       
Sbjct  336  ---MPSASEP--EDPPRRKPASHKPSPKFNLAENYGST-PGRKSAPRAGKSPFYKLQSPY  389

Query  626  ------KANSIM-----SDSEVGPSPSEVAAAMA-ERPRYPLEDSVLDGWSCDESVEGLR  483
                  + ++IM     ++SE+GPSPSEVAAA+A ER     E SV+ G   +E      
Sbjct  390  EQYATPRKSNIMPVPFITESELGPSPSEVAAAIAKERLDQDTESSVVGGARNEE------  443

Query  482  SRLERWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQC  303
                          D+    P+S            +R    GG G  SCF NI G EC  
Sbjct  444  --------------DEFASFPSSDER--------HERRHSDGGSGLFSCFSNICGIECSI  481

Query  302  VCG  294
            VCG
Sbjct  482  VCG  484



>ref|XP_007145354.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
 gb|ESW17348.1| hypothetical protein PHAVU_007G232100g [Phaseolus vulgaris]
Length=438

 Score = 51.2 bits (121),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 59/118 (50%), Gaps = 18/118 (15%)
 Frame = -2

Query  638  GGPYKANS----IMSDSEVGPSPSEVAAAMAERPRYPLEDSVLDGWSCDESVEGLRSRLE  471
            G PY++N      M+DSE+GPS SEVAAA+A  P      S + GWS D+  EG++ ++E
Sbjct  310  GTPYRSNLGHRPFMTDSELGPSASEVAAAVARLPMEEEGHSTVGGWSLDDDEEGMQPKVE  369

Query  470  RWRTEVPPLYDQVGYAPTsssfrssSQYTAKKRgsgsgggGPLSCFGNIFGYECQCVC  297
            RW+TE              S+   S +     R    G  G  SCF  I G EC  VC
Sbjct  370  RWQTE--------------SNATGSGRKGKHPRRQTDGSNGLFSCFSVICGVECSIVC  413



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2929097739896