BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20535_g1_i5 len=2287 path=[281:0-51 @333@!:52-785 5573:786-865
@1546@!:866-1572 280:1573-2286]

Length=2287
                                                                      Score     E

gb|AAS79609.1|  putative neutral invertase                              744   0.0      Ipomoea trifida
dbj|BAF37799.1|  hypothetical protein                                   730   0.0      Ipomoea trifida
gb|AHA82517.1|  neutral/alkaline invertase                              653   0.0      
ref|XP_011005355.1|  PREDICTED: alkaline/neutral invertase CINV1-...    639   0.0      
gb|EYU36087.1|  hypothetical protein MIMGU_mgv1a002839mg                639   0.0      
ref|XP_002532011.1|  beta-fructofuranosidase, putative                  642   0.0      Ricinus communis
ref|XP_006384642.1|  hypothetical protein POPTR_0004s19760g             632   0.0      
ref|XP_010242620.1|  PREDICTED: alkaline/neutral invertase CINV1-...    637   0.0      
ref|XP_010031480.1|  PREDICTED: alkaline/neutral invertase CINV1-...    647   0.0      
ref|XP_010031479.1|  PREDICTED: alkaline/neutral invertase CINV1-...    639   0.0      
ref|XP_011102049.1|  PREDICTED: alkaline/neutral invertase CINV1-...    641   0.0      
ref|XP_011102136.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    640   0.0      
gb|AFV94466.1|  alkaline/neutral invertase protein                      619   0.0      
ref|XP_009606001.1|  PREDICTED: alkaline/neutral invertase CINV2-...    696   0.0      
ref|XP_006349102.1|  PREDICTED: alkaline/neutral invertase CINV2-...    692   0.0      
ref|XP_009606000.1|  PREDICTED: alkaline/neutral invertase CINV2-...    697   0.0      
ref|XP_009605998.1|  PREDICTED: alkaline/neutral invertase CINV2-...    697   0.0      
ref|XP_006349099.1|  PREDICTED: alkaline/neutral invertase CINV2-...    694   0.0      
ref|XP_009790874.1|  PREDICTED: alkaline/neutral invertase CINV2-...    694   0.0      
ref|XP_006349098.1|  PREDICTED: alkaline/neutral invertase CINV2-...    694   0.0      
ref|XP_004251032.1|  PREDICTED: alkaline/neutral invertase CINV1        694   0.0      
ref|XP_006349097.1|  PREDICTED: alkaline/neutral invertase CINV2-...    694   0.0      
emb|CBI17063.3|  unnamed protein product                                656   0.0      
gb|AGU19630.1|  neutral/alkaline invertase 3                            658   0.0      
ref|XP_003632264.1|  PREDICTED: alkaline/neutral invertase CINV1-...    657   0.0      
gb|AFP23358.1|  neutral invertase                                       657   0.0      
ref|XP_010535668.1|  PREDICTED: alkaline/neutral invertase CINV1        656   0.0      
ref|XP_007221417.1|  hypothetical protein PRUPE_ppa002625mg             657   0.0      
emb|CDP06959.1|  unnamed protein product                                656   0.0      
ref|XP_011090015.1|  PREDICTED: alkaline/neutral invertase CINV1        654   0.0      
gb|KDP45002.1|  hypothetical protein JCGZ_01502                         655   0.0      
gb|KDO46928.1|  hypothetical protein CISIN_1g006329mg                   644   0.0      
ref|XP_010658734.1|  PREDICTED: alkaline/neutral invertase CINV1-...    653   0.0      
ref|XP_010088753.1|  hypothetical protein L484_018310                   650   0.0      
ref|XP_009356115.1|  PREDICTED: alkaline/neutral invertase CINV1-...    652   0.0      
ref|XP_002529075.1|  beta-fructofuranosidase, putative                  651   0.0      Ricinus communis
gb|KDP34707.1|  hypothetical protein JCGZ_10912                         651   0.0      
gb|KHG04215.1|  hypothetical protein F383_30053                         650   0.0      
ref|XP_010244028.1|  PREDICTED: alkaline/neutral invertase CINV1-...    651   0.0      
gb|AFH77954.1|  neutral/alkaline invertase                              651   0.0      
ref|XP_008345689.1|  PREDICTED: alkaline/neutral invertase CINV1-...    650   0.0      
ref|XP_006492196.1|  PREDICTED: alkaline/neutral invertase CINV2-...    650   0.0      
gb|KDO46923.1|  hypothetical protein CISIN_1g006329mg                   649   0.0      
ref|XP_007015893.1|  Alkaline/neutral invertase isoform 1               647   0.0      
ref|XP_010686069.1|  PREDICTED: alkaline/neutral invertase CINV1        647   0.0      
emb|CAD19320.1|  neutral invertase                                      645   0.0      Beta vulgaris [beet]
ref|XP_004249987.1|  PREDICTED: alkaline/neutral invertase CINV1-...    646   0.0      
ref|XP_006361445.1|  PREDICTED: alkaline/neutral invertase CINV1-...    645   0.0      
ref|XP_009787814.1|  PREDICTED: alkaline/neutral invertase CINV1-...    645   0.0      
ref|XP_009618314.1|  PREDICTED: alkaline/neutral invertase CINV1-...    644   0.0      
ref|XP_007015894.1|  Alkaline/neutral invertase isoform 2               643   0.0      
ref|XP_002311958.2|  hypothetical protein POPTR_0008s02460g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007010262.1|  Alkaline/neutral invertase isoform 1               642   0.0      
emb|CDX92345.1|  BnaA10g13840D                                          639   0.0      
emb|CDY26937.1|  BnaC09g36460D                                          639   0.0      
ref|XP_009120650.1|  PREDICTED: alkaline/neutral invertase CINV1        639   0.0      
emb|CDO99885.1|  unnamed protein product                                640   0.0      
ref|XP_010067152.1|  PREDICTED: alkaline/neutral invertase CINV1-...    640   0.0      
ref|XP_006400758.1|  hypothetical protein EUTSA_v10012973mg             637   0.0      
ref|XP_002874073.1|  hypothetical protein ARALYDRAFT_489110             637   0.0      
ref|NP_197643.1|  alkaline/neutral invertase                            637   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150486.1|  PREDICTED: uncharacterized protein LOC101217778    636   0.0      
ref|XP_008446771.1|  PREDICTED: alkaline/neutral invertase CINV1        636   0.0      
ref|XP_011032827.1|  PREDICTED: alkaline/neutral invertase CINV1-...    637   0.0      
ref|XP_006287277.1|  hypothetical protein CARUB_v10000472mg             635   0.0      
ref|XP_004504002.1|  PREDICTED: uncharacterized protein LOC101511142    635   0.0      
ref|XP_010093212.1|  hypothetical protein L484_008994                   634   0.0      
ref|XP_003531388.1|  PREDICTED: alkaline/neutral invertase CINV2-...    634   0.0      
ref|XP_002316508.2|  hypothetical protein POPTR_0010s24250g             634   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011024247.1|  PREDICTED: alkaline/neutral invertase CINV2-...    634   0.0      
ref|XP_008363531.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    623   0.0      
ref|XP_010493339.1|  PREDICTED: alkaline/neutral invertase CINV1-...    631   0.0      
ref|XP_010421041.1|  PREDICTED: alkaline/neutral invertase CINV1-...    631   0.0      
ref|XP_010454516.1|  PREDICTED: alkaline/neutral invertase CINV1-...    630   0.0      
ref|XP_006471382.1|  PREDICTED: alkaline/neutral invertase CINV1-...    631   0.0      
ref|XP_006424304.1|  hypothetical protein CICLE_v10028002mg             630   0.0      
ref|XP_004291628.1|  PREDICTED: uncharacterized protein LOC101292085    630   0.0      
ref|XP_003630134.1|  Alkaline/neutral invertase                         630   0.0      
ref|XP_009404816.1|  PREDICTED: alkaline/neutral invertase CINV1-...    628   0.0      
ref|XP_009364876.1|  PREDICTED: alkaline/neutral invertase CINV2-...    628   0.0      
gb|EMT12815.1|  hypothetical protein F775_30387                         627   0.0      
gb|EMS48943.1|  hypothetical protein TRIUR3_16260                       629   0.0      
ref|XP_001754878.1|  predicted protein                                  550   0.0      
ref|XP_007159781.1|  hypothetical protein PHAVU_002G266600g             628   0.0      
ref|XP_008355223.1|  PREDICTED: alkaline/neutral invertase CINV2-...    628   0.0      
ref|XP_008788363.1|  PREDICTED: alkaline/neutral invertase CINV1        627   0.0      
dbj|BAJ89009.1|  predicted protein                                      625   0.0      
ref|XP_007208045.1|  hypothetical protein PRUPE_ppa002614mg             628   0.0      
ref|XP_007035889.1|  Neutral invertase isoform 1                        557   0.0      
ref|XP_006580314.1|  PREDICTED: alkaline/neutral invertase CINV2-...    627   0.0      
ref|XP_009364274.1|  PREDICTED: alkaline/neutral invertase CINV2-...    626   0.0      
ref|XP_008227420.1|  PREDICTED: alkaline/neutral invertase CINV2        627   0.0      
ref|XP_010940279.1|  PREDICTED: alkaline/neutral invertase CINV1 ...    625   0.0      
ref|XP_004952630.1|  PREDICTED: alkaline/neutral invertase CINV2-...    624   0.0      
ref|XP_009393828.1|  PREDICTED: alkaline/neutral invertase CINV1-...    624   0.0      
ref|XP_010940271.1|  PREDICTED: alkaline/neutral invertase CINV1 ...    625   0.0      
ref|XP_002452195.1|  hypothetical protein SORBIDRAFT_04g021550          620   0.0      Sorghum bicolor [broomcorn]
ref|XP_001780432.1|  predicted protein                                  537   0.0      
ref|NP_001047012.1|  Os02g0529400                                       617   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647331.1|  PREDICTED: alkaline/neutral invertase CINV2-...    617   0.0      
ref|XP_008661659.1|  PREDICTED: uncharacterized protein LOC100274...    616   0.0      
gb|EAY86114.1|  hypothetical protein OsI_07486                          617   0.0      Oryza sativa Indica Group [Indian rice]
emb|CAM32308.1|  neutral/alkaline invertase                             615   0.0      Lolium perenne [perennial ryegrass]
emb|CAA05869.1|  alkaline/neutral invertase                             613   0.0      Lolium temulentum
ref|XP_003579686.1|  PREDICTED: alkaline/neutral invertase CINV1-...    614   0.0      
ref|XP_008385536.1|  PREDICTED: alkaline/neutral invertase CINV2-...    611   0.0      
ref|NP_001142296.1|  alkaline/neutral invertase isoform 1               613   0.0      Zea mays [maize]
ref|XP_008349784.1|  PREDICTED: alkaline/neutral invertase CINV1-...    614   0.0      
gb|EAY94016.1|  hypothetical protein OsI_15793                          610   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006653369.1|  PREDICTED: alkaline/neutral invertase CINV2-...    609   0.0      
ref|XP_003575059.1|  PREDICTED: alkaline/neutral invertase CINV1        610   0.0      
emb|CAE04902.1|  OSJNBa0042I15.24                                       606   0.0      Oryza sativa [red rice]
ref|XP_004975545.1|  PREDICTED: alkaline/neutral invertase CINV2-...    603   0.0      
ref|XP_006407938.1|  hypothetical protein EUTSA_v10020219mg             537   0.0      
gb|KHG09699.1|  Enolase-like protein ENO4                               605   0.0      
ref|XP_006851551.1|  hypothetical protein AMTR_s00040p00181990          603   0.0      
ref|XP_010031481.1|  PREDICTED: alkaline/neutral invertase CINV1-...    499   0.0      
emb|CDY05271.1|  BnaC05g45320D                                          538   0.0      
ref|XP_002975181.1|  hypothetical protein SELMODRAFT_267827             591   0.0      
ref|XP_001781871.1|  predicted protein                                  524   0.0      
emb|CDY24687.1|  BnaA05g30860D                                          541   0.0      
ref|XP_009147157.1|  PREDICTED: alkaline/neutral invertase CINV2        538   0.0      
gb|EEE60952.1|  hypothetical protein OsJ_14709                          578   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA45080.1|  TPA: hypothetical protein ZEAMMB73_402946              564   0.0      
ref|XP_010553709.1|  PREDICTED: alkaline/neutral invertase CINV2        573   0.0      
ref|NP_176049.1|  alkaline/neutral invertase A                          570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891983.1|  hypothetical protein ARALYDRAFT_474815             569   0.0      
ref|XP_006302021.1|  hypothetical protein CARUB_v10020003mg             568   0.0      
gb|KFK22543.1|  hypothetical protein AALP_AAs68488U000500               567   0.0      
ref|XP_008655058.1|  PREDICTED: alkaline/neutral invertase CINV2-...    567   0.0      
gb|EMT27375.1|  hypothetical protein F775_29966                         558   0.0      
ref|XP_010511297.1|  PREDICTED: alkaline/neutral invertase CINV2-...    565   0.0      
ref|XP_002978791.1|  hypothetical protein SELMODRAFT_443960             565   0.0      
ref|XP_010480269.1|  PREDICTED: alkaline/neutral invertase CINV2-...    565   0.0      
ref|XP_006392417.1|  hypothetical protein EUTSA_v10023341mg             566   0.0      
ref|XP_002465359.1|  hypothetical protein SORBIDRAFT_01g037120          565   0.0      Sorghum bicolor [broomcorn]
ref|XP_010270854.1|  PREDICTED: alkaline/neutral invertase CINV2        566   0.0      
ref|XP_006841615.1|  hypothetical protein AMTR_s00003p00222410          565   0.0      
ref|XP_010415004.1|  PREDICTED: alkaline/neutral invertase CINV2-...    563   0.0      
ref|XP_004984582.1|  PREDICTED: alkaline/neutral invertase CINV2-...    563   0.0      
gb|KDP27968.1|  hypothetical protein JCGZ_19048                         562   0.0      
emb|CDY04446.1|  BnaA03g59380D                                          563   0.0      
ref|NP_001049936.1|  Os03g0314800                                       563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009124460.1|  PREDICTED: alkaline/neutral invertase CINV2        563   0.0      
emb|CDY04374.1|  BnaC04g18190D                                          563   0.0      
ref|XP_003558048.1|  PREDICTED: alkaline/neutral invertase CINV1-...    562   0.0      
gb|EEC75120.1|  hypothetical protein OsI_11302                          564   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010415005.1|  PREDICTED: alkaline/neutral invertase CINV2-...    561   0.0      
gb|EMS48780.1|  hypothetical protein TRIUR3_08899                       560   0.0      
dbj|BAJ94475.1|  predicted protein                                      561   0.0      
ref|XP_009381188.1|  PREDICTED: alkaline/neutral invertase CINV2-...    561   0.0      
emb|CAL64380.1|  putative neutral invertase                             553   0.0      Prunus persica
ref|XP_004144808.1|  PREDICTED: uncharacterized protein LOC101218389    559   0.0      
ref|XP_002277312.2|  PREDICTED: alkaline/neutral invertase CINV2        562   0.0      Vitis vinifera
emb|CBI39621.3|  unnamed protein product                                561   0.0      
ref|XP_007225679.1|  hypothetical protein PRUPE_ppa002847mg             560   0.0      
ref|XP_004495636.1|  PREDICTED: uncharacterized protein LOC101503498    561   0.0      
ref|XP_008453273.1|  PREDICTED: alkaline/neutral invertase CINV1-...    561   0.0      
ref|XP_006649984.1|  PREDICTED: alkaline/neutral invertase CINV2-...    559   0.0      
ref|XP_008223426.1|  PREDICTED: alkaline/neutral invertase CINV2        560   0.0      
emb|CAN63178.1|  hypothetical protein VITISV_029106                     560   0.0      Vitis vinifera
gb|KHN16041.1|  hypothetical protein glysoja_012017                     559   0.0      
ref|XP_003555178.1|  PREDICTED: alkaline/neutral invertase CINV2-...    559   0.0      
gb|KGN61014.1|  hypothetical protein Csa_2G034660                       560   0.0      
ref|XP_004302290.1|  PREDICTED: uncharacterized protein LOC101304591    559   0.0      
ref|XP_010102907.1|  hypothetical protein L484_005970                   560   0.0      
gb|AFS17279.1|  neutral/alkaline invertase                              555   0.0      
emb|CBI22843.3|  unnamed protein product                                559   0.0      
gb|ADF27783.1|  neutral/alkaline invertase 2                            558   0.0      
ref|XP_008793361.1|  PREDICTED: alkaline/neutral invertase CINV2        558   0.0      
ref|XP_010024149.1|  PREDICTED: alkaline/neutral invertase CINV1        558   0.0      
ref|XP_010938195.1|  PREDICTED: alkaline/neutral invertase CINV1-...    558   0.0      
ref|XP_004158710.1|  PREDICTED: uncharacterized LOC101218389            555   0.0      
gb|KHG04460.1|  hypothetical protein F383_29023                         558   0.0      
gb|AHD25653.1|  neutral invertase 2                                     558   0.0      
emb|CAP59645.1|  putative neutral invertase                             557   0.0      Vitis vinifera
ref|XP_006645848.1|  PREDICTED: alkaline/neutral invertase CINV2-...    553   0.0      
emb|CDP15231.1|  unnamed protein product                                557   0.0      
ref|XP_003535315.1|  PREDICTED: alkaline/neutral invertase CINV2-...    556   0.0      
ref|XP_010045364.1|  PREDICTED: alkaline/neutral invertase CINV2        557   0.0      
ref|XP_003591226.1|  Neutral invertase                                  554   0.0      
ref|XP_010667189.1|  PREDICTED: alkaline/neutral invertase CINV2-...    557   0.0      
gb|AGG41122.1|  putative neutral/alkaline invertase                     555   0.0      
gb|AGG41113.1|  putative neutral/alkaline invertase                     555   0.0      
gb|AHF27220.1|  invertase                                               556   0.0      
ref|XP_009337633.1|  PREDICTED: alkaline/neutral invertase CINV2        556   0.0      
ref|XP_009414162.1|  PREDICTED: alkaline/neutral invertase CINV2-...    555   0.0      
ref|XP_010914649.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    554   0.0      
gb|EPS61872.1|  neutral/alkaline invertase 2                            548   0.0      
ref|NP_001169586.1|  hypothetical protein                               554   0.0      Zea mays [maize]
ref|XP_007031201.1|  Neutral invertase isoform 1                        555   0.0      
ref|XP_004295043.1|  PREDICTED: uncharacterized protein LOC101296189    555   0.0      
emb|CAP59646.1|  putative neutral invertase                             555   0.0      Vitis vinifera
ref|XP_008370364.1|  PREDICTED: alkaline/neutral invertase CINV2-...    555   0.0      
gb|AGX27472.1|  plant neutral invertase                                 550   0.0      
gb|ABF50704.1|  neutral invertase                                       540   0.0      Populus sp. UG-2006
ref|NP_001267976.1|  neutral invertase                                  554   0.0      
ref|XP_002519277.1|  beta-fructofuranosidase, putative                  555   0.0      Ricinus communis
ref|XP_009412138.1|  PREDICTED: alkaline/neutral invertase CINV1-...    553   0.0      
gb|ABF50705.1|  neutral invertase 2                                     540   0.0      Populus sp. UG-2006
ref|XP_009587952.1|  PREDICTED: alkaline/neutral invertase CINV2        553   0.0      
ref|XP_009373311.1|  PREDICTED: alkaline/neutral invertase CINV2-...    554   0.0      
ref|XP_010551013.1|  PREDICTED: alkaline/neutral invertase CINV2        552   0.0      
ref|XP_009335501.1|  PREDICTED: alkaline/neutral invertase CINV2-...    553   0.0      
gb|EYU38407.1|  hypothetical protein MIMGU_mgv1a002478mg                553   0.0      
ref|XP_008794511.1|  PREDICTED: alkaline/neutral invertase CINV2-...    551   0.0      
gb|EMT27716.1|  hypothetical protein F775_26108                         547   0.0      
gb|KHN28199.1|  hypothetical protein glysoja_024017                     551   0.0      
emb|CAA76145.1|  neutral invertase                                      553   0.0      Daucus carota [Queen Anne's lace]
ref|XP_010092957.1|  hypothetical protein L484_018894                   551   0.0      
ref|NP_001281053.1|  alkaline/neutral invertase CINV2                   553   0.0      
ref|XP_009777348.1|  PREDICTED: alkaline/neutral invertase CINV2        552   0.0      
ref|XP_008674013.1|  PREDICTED: alkaline/neutral invertase CINV1-...    551   0.0      
ref|XP_002455584.1|  hypothetical protein SORBIDRAFT_03g013420          551   0.0      Sorghum bicolor [broomcorn]
gb|EMS59378.1|  hypothetical protein TRIUR3_23445                       547   0.0      
gb|KDP23366.1|  hypothetical protein JCGZ_23199                         553   0.0      
ref|XP_011071359.1|  PREDICTED: alkaline/neutral invertase CINV2        553   0.0      
ref|XP_006488793.1|  PREDICTED: alkaline/neutral invertase CINV2-...    552   0.0      
ref|XP_007208331.1|  hypothetical protein PRUPE_ppa002385mg             552   0.0      
ref|XP_006419305.1|  hypothetical protein CICLE_v10004474mg             552   0.0      
ref|XP_009372083.1|  PREDICTED: alkaline/neutral invertase CINV2        552   0.0      
ref|XP_002984705.1|  hypothetical protein SELMODRAFT_181158             550   0.0      
ref|XP_004968681.1|  PREDICTED: alkaline/neutral invertase CINV2-...    550   0.0      
gb|ACX33985.1|  neutral invertase                                       539   0.0      Ananas comosus
ref|XP_003529503.1|  PREDICTED: alkaline/neutral invertase CINV2-...    551   0.0      
ref|XP_002311370.2|  hypothetical protein POPTR_0008s10090g             551   0.0      Populus trichocarpa [western balsam poplar]
gb|EAY73839.1|  hypothetical protein OsI_01715                          549   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002512536.1|  beta-fructofuranosidase, putative                  551   0.0      Ricinus communis
ref|NP_001042931.1|  Os01g0332100                                       550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008246215.1|  PREDICTED: alkaline/neutral invertase CINV2        551   0.0      
ref|XP_003550817.1|  PREDICTED: alkaline/neutral invertase CINV2-...    551   0.0      
ref|XP_011019331.1|  PREDICTED: alkaline/neutral invertase CINV2        551   0.0      
gb|AEP31948.1|  neutral/alkaline invertase                              551   0.0      
gb|AAO25633.1|  invertase                                               548   0.0      Oryza sativa Indica Group [Indian rice]
gb|AFA46813.1|  neutral/alkaline invertase                              550   0.0      
ref|XP_010674559.1|  PREDICTED: alkaline/neutral invertase CINV2        550   0.0      
ref|XP_008390412.1|  PREDICTED: alkaline/neutral invertase CINV2-...    550   0.0      
emb|CAP59643.1|  putative neutral invertase                             549   0.0      Vitis vinifera
ref|XP_008388459.1|  PREDICTED: alkaline/neutral invertase CINV2        549   0.0      
ref|XP_007145019.1|  hypothetical protein PHAVU_007G203100g             548   0.0      
gb|EYU45478.1|  hypothetical protein MIMGU_mgv1a002360mg                549   0.0      
ref|XP_003567650.1|  PREDICTED: alkaline/neutral invertase CINV1-...    547   0.0      
gb|KDO81628.1|  hypothetical protein CISIN_1g005783mg                   540   0.0      
emb|CAP59644.1|  putative neutral invertase                             548   0.0      Vitis vinifera
ref|XP_002318940.2|  hypothetical protein POPTR_0013s00800g             548   0.0      Populus trichocarpa [western balsam poplar]
gb|KHG16119.1|  hypothetical protein F383_01238                         548   0.0      
ref|XP_006344790.1|  PREDICTED: alkaline/neutral invertase CINV2-...    547   0.0      
gb|AHA82519.1|  neutral/alkaline invertase                              548   0.0      
gb|KFK38110.1|  hypothetical protein AALP_AA3G070900                    546   0.0      
gb|KHN02814.1|  Cell cycle checkpoint protein RAD1                      557   0.0      
gb|AAG51337.1|AC020580_17  neutral invertase, putative; 73674-70896     542   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KCW60577.1|  hypothetical protein EUGRSUZ_H03308                     547   0.0      
ref|XP_011038960.1|  PREDICTED: alkaline/neutral invertase CINV2-...    546   0.0      
ref|XP_011087506.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    547   0.0      
ref|XP_010941514.1|  PREDICTED: alkaline/neutral invertase CINV2-...    545   0.0      
gb|KEH32364.1|  alkaline/neutral invertase                              546   0.0      
ref|XP_006433565.1|  hypothetical protein CICLE_v10000500mg             546   0.0      
ref|XP_010441142.1|  PREDICTED: alkaline/neutral invertase CINV2-...    545   0.0      
ref|XP_004230329.1|  PREDICTED: alkaline/neutral invertase CINV1        545   0.0      
ref|XP_010486160.1|  PREDICTED: alkaline/neutral invertase CINV2-...    545   1e-180   
ref|XP_011023805.1|  PREDICTED: alkaline/neutral invertase CINV1-...    545   2e-180   
gb|KDO81624.1|  hypothetical protein CISIN_1g005783mg                   545   2e-180   
ref|XP_006472236.1|  PREDICTED: alkaline/neutral invertase CINV2-...    545   2e-180   
ref|XP_002882475.1|  hypothetical protein ARALYDRAFT_896781             543   3e-180   
ref|NP_187302.2|  protein alkaline/neutral invertase C                  543   3e-180   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98459.1|  putative neutral invertase                             543   3e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154423.1|  hypothetical protein PHAVU_003G118400g             543   6e-180   
emb|CDP20748.1|  unnamed protein product                                543   9e-180   
gb|AAP40464.1|  putative neutral invertase                              542   9e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007035890.1|  Neutral invertase isoform 2                        447   1e-179   
ref|XP_010546951.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    541   2e-179   
ref|XP_006408025.1|  hypothetical protein EUTSA_v10020291mg             540   2e-179   
ref|XP_008438972.1|  PREDICTED: alkaline/neutral invertase CINV2        541   2e-179   
ref|XP_004508109.1|  PREDICTED: uncharacterized protein LOC101491074    541   3e-179   
ref|XP_004165515.1|  PREDICTED: uncharacterized protein LOC101231486    540   6e-179   
gb|KHN03923.1|  hypothetical protein glysoja_022609                     537   7e-179   
ref|XP_010319230.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    540   9e-179   
gb|KGN57182.1|  hypothetical protein Csa_3G168930                       539   1e-178   
ref|XP_004494531.1|  PREDICTED: uncharacterized protein LOC101506288    539   1e-178   
ref|XP_010432487.1|  PREDICTED: alkaline/neutral invertase CINV1-...    538   2e-178   
gb|AAF26084.1|AC012393_10  putative alkaline/neutral invertase          537   2e-178   
ref|XP_006297136.1|  hypothetical protein CARUB_v10013138mg             539   2e-178   
sp|Q84JL5.1|INVH_ARATH  RecName: Full=Probable alkaline/neutral i...    537   3e-178   
ref|XP_003520789.1|  PREDICTED: alkaline/neutral invertase CINV2-...    538   4e-178   
ref|XP_006299298.1|  hypothetical protein CARUB_v10015452mg             538   4e-178   
gb|KEH24469.1|  alkaline/neutral invertase                              536   5e-178   
ref|XP_002884536.1|  hypothetical protein ARALYDRAFT_896678             536   5e-178   
ref|NP_187233.5|  alkaline/neutral invertase H                          537   6e-178   
ref|XP_007163312.1|  hypothetical protein PHAVU_001G224200g             537   1e-177   
ref|XP_010464135.1|  PREDICTED: alkaline/neutral invertase CINV1-...    535   3e-177   
gb|KHN43356.1|  hypothetical protein glysoja_001939                     535   3e-177   
ref|XP_006605260.1|  PREDICTED: alkaline/neutral invertase CINV2-...    535   4e-177   
ref|XP_010486057.1|  PREDICTED: alkaline/neutral invertase CINV1-...    534   6e-177   
emb|CDY18825.1|  BnaAnng02900D                                          533   1e-176   
ref|XP_006337994.1|  PREDICTED: alkaline/neutral invertase CINV2-...    535   1e-176   
ref|XP_009124963.1|  PREDICTED: alkaline/neutral invertase CINV1        533   1e-176   
ref|XP_008232043.1|  PREDICTED: alkaline/neutral invertase CINV2-...    520   2e-176   
gb|KFK37997.1|  hypothetical protein AALP_AA3G056600                    523   1e-173   
ref|XP_010276558.1|  PREDICTED: alkaline/neutral invertase CINV1-...    525   7e-173   
emb|CBI40245.3|  unnamed protein product                                506   5e-171   
ref|XP_007035891.1|  Neutral invertase isoform 3                        411   4e-169   
ref|XP_006287300.1|  hypothetical protein CARUB_v10000493mg             450   4e-166   
ref|XP_010438391.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    452   1e-165   
ref|XP_010438400.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    451   2e-165   
ref|XP_010455341.1|  PREDICTED: alkaline/neutral invertase CINV2-...    451   3e-165   
ref|XP_010496150.1|  PREDICTED: alkaline/neutral invertase CINV2-...    451   3e-165   
gb|EPS61890.1|  hypothetical protein M569_12899                         448   9e-165   
ref|NP_567347.1|  cytosolic invertase 2                                 450   1e-164   
gb|KDO46929.1|  hypothetical protein CISIN_1g006329mg                   499   2e-164   
ref|XP_006397461.1|  hypothetical protein EUTSA_v10001814mg             454   4e-164   
ref|XP_002874570.1|  hypothetical protein ARALYDRAFT_489803             448   5e-164   
ref|XP_003575117.1|  PREDICTED: alkaline/neutral invertase CINV2-...    451   2e-163   
ref|XP_006436654.1|  hypothetical protein CICLE_v100309251mg            496   2e-163   
ref|XP_010268259.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    452   2e-163   
ref|XP_002979690.1|  hypothetical protein SELMODRAFT_111393             443   2e-163   
ref|XP_010268239.1|  PREDICTED: alkaline/neutral invertase CINV2 ...    452   3e-163   
ref|NP_001130493.1|  uncharacterized protein LOC100191591               452   4e-163   
ref|XP_007041939.1|  Plant neutral invertase family protein isofo...    444   4e-163   
ref|XP_002453965.1|  hypothetical protein SORBIDRAFT_04g022350          452   4e-163   
ref|XP_002276670.1|  PREDICTED: alkaline/neutral invertase CINV2        450   6e-163   
ref|XP_010690448.1|  PREDICTED: alkaline/neutral invertase CINV2        447   6e-163   
ref|XP_006397189.1|  hypothetical protein EUTSA_v10028553mg             445   6e-163   
ref|XP_002893885.1|  hypothetical protein ARALYDRAFT_891210             445   7e-163   
ref|XP_004952843.1|  PREDICTED: alkaline/neutral invertase CINV2-...    451   8e-163   
dbj|BAJ85099.1|  predicted protein                                      451   9e-163   
emb|CDY41869.1|  BnaA08g06300D                                          450   2e-162   
ref|NP_001047095.1|  Os02g0550600                                       450   2e-162   
ref|XP_009145124.1|  PREDICTED: alkaline/neutral invertase CINV1-...    452   2e-162   
emb|CAB78074.1|  neutral invertase like protein                         443   2e-162   
gb|KDP27592.1|  hypothetical protein JCGZ_19597                         447   2e-162   
ref|XP_011009346.1|  PREDICTED: alkaline/neutral invertase CINV2-...    445   2e-162   
gb|AFH77953.1|  neutral/alkaline invertase                              449   2e-162   
ref|XP_008236189.1|  PREDICTED: alkaline/neutral invertase CINV2-...    446   2e-162   
ref|NP_174791.2|  alkaline/neutral invertase CINV1                      443   2e-162   
ref|NP_001168719.1|  uncharacterized protein LOC100382511               452   2e-162   
ref|XP_007201719.1|  hypothetical protein PRUPE_ppa003483mg             446   3e-162   
ref|XP_010679425.1|  PREDICTED: alkaline/neutral invertase CINV2        441   3e-162   
ref|XP_003556210.1|  PREDICTED: alkaline/neutral invertase CINV2-...    441   3e-162   
ref|XP_007222917.1|  hypothetical protein PRUPE_ppa003670mg             448   3e-162   
ref|XP_008218919.1|  PREDICTED: alkaline/neutral invertase CINV2        448   3e-162   
gb|EAY86242.1|  hypothetical protein OsI_07611                          449   4e-162   
ref|XP_006423584.1|  hypothetical protein CICLE_v10030393mg             444   5e-162   
ref|XP_006353610.1|  PREDICTED: alkaline/neutral invertase CINV2-...    440   5e-162   
ref|XP_010500040.1|  PREDICTED: alkaline/neutral invertase CINV1        443   6e-162   
ref|XP_007017803.1|  Plant neutral invertase family protein             450   7e-162   
ref|XP_007211552.1|  hypothetical protein PRUPE_ppa004112mg             444   7e-162   
gb|KHN17098.1|  hypothetical protein glysoja_011572                     440   7e-162   
ref|XP_011037256.1|  PREDICTED: alkaline/neutral invertase CINV2        448   8e-162   
ref|XP_006647359.1|  PREDICTED: alkaline/neutral invertase CINV2-...    446   8e-162   
gb|AEY78489.1|  neutral invertase 2                                     441   9e-162   
ref|XP_003536372.1|  PREDICTED: alkaline/neutral invertase CINV2-...    440   9e-162   
ref|XP_006304719.1|  hypothetical protein CARUB_v10012014mg             442   9e-162   
ref|XP_010415921.1|  PREDICTED: alkaline/neutral invertase CINV1-...    445   1e-161   
emb|CAP59642.1|  putative neutral invertase                             451   1e-161   
ref|XP_002275648.1|  PREDICTED: alkaline/neutral invertase CINV2        448   1e-161   
emb|CAP59641.1|  putative neutral invertase                             451   1e-161   
gb|KHG01868.1|  Collagen and calcium-binding EGF domain-containing 1    444   2e-161   
ref|XP_008372873.1|  PREDICTED: alkaline/neutral invertase CINV2        445   2e-161   
ref|XP_006487399.1|  PREDICTED: alkaline/neutral invertase CINV2-...    444   2e-161   
ref|XP_004289834.1|  PREDICTED: uncharacterized protein LOC101301732    443   2e-161   
ref|XP_009401124.1|  PREDICTED: alkaline/neutral invertase CINV2-...    435   2e-161   
emb|CDX69092.1|  BnaC01g03610D                                          439   2e-161   
ref|XP_006376270.1|  putative beta-fructofuranosidase family protein    440   2e-161   
ref|XP_008231940.1|  PREDICTED: alkaline/neutral invertase CINV2-...    442   2e-161   
ref|XP_009775050.1|  PREDICTED: alkaline/neutral invertase CINV2        437   2e-161   
ref|XP_004241837.1|  PREDICTED: alkaline/neutral invertase CINV2        439   2e-161   
gb|KCW65220.1|  hypothetical protein EUGRSUZ_G02704                     491   2e-161   
ref|XP_009107914.1|  PREDICTED: alkaline/neutral invertase CINV1        446   3e-161   
ref|XP_006471384.1|  PREDICTED: alkaline/neutral invertase CINV1-...    490   3e-161   
emb|CDX75467.1|  BnaA01g02350D                                          439   3e-161   
ref|XP_009766405.1|  PREDICTED: alkaline/neutral invertase CINV2-...    455   3e-161   
ref|XP_006412178.1|  hypothetical protein EUTSA_v10024783mg             439   3e-161   
ref|XP_002306166.1|  beta-fructofuranosidase family protein             447   4e-161   
ref|XP_009108292.1|  PREDICTED: alkaline/neutral invertase CINV2        438   4e-161   
emb|CAG30577.1|  putative neutral/alkaline invertase                    439   4e-161   
ref|XP_009596246.1|  PREDICTED: alkaline/neutral invertase CINV2        436   4e-161   
ref|XP_011046819.1|  PREDICTED: alkaline/neutral invertase CINV2-...    447   5e-161   
gb|ABF50709.1|  neutral invertase 6                                     480   5e-161   
ref|XP_004978830.1|  PREDICTED: alkaline/neutral invertase CINV2-...    447   5e-161   
ref|XP_004238357.1|  PREDICTED: alkaline/neutral invertase CINV2        452   5e-161   
ref|XP_002450402.1|  hypothetical protein SORBIDRAFT_05g004770          451   6e-161   
emb|CDY34812.1|  BnaA09g41790D                                          439   6e-161   
ref|XP_006342050.1|  PREDICTED: alkaline/neutral invertase CINV2-...    452   6e-161   
ref|XP_009618880.1|  PREDICTED: alkaline/neutral invertase CINV2-...    454   6e-161   
gb|AGG41114.1|  putative neutral/alkaline invertase                     451   6e-161   
ref|XP_006301300.1|  hypothetical protein CARUB_v10021707mg             450   6e-161   
ref|XP_007143667.1|  hypothetical protein PHAVU_007G091300g             438   7e-161   
ref|XP_008447991.1|  PREDICTED: alkaline/neutral invertase CINV2        446   8e-161   
gb|AGG41120.1|  putative neutral/alkaline invertase                     451   8e-161   
ref|XP_006662773.1|  PREDICTED: alkaline/neutral invertase CINV2-...    447   1e-160   
ref|XP_009803417.1|  PREDICTED: alkaline/neutral invertase CINV2-...    434   1e-160   
gb|KDP28466.1|  hypothetical protein JCGZ_14237                         453   1e-160   
ref|XP_009375457.1|  PREDICTED: alkaline/neutral invertase CINV2-...    453   1e-160   
ref|XP_009624723.1|  PREDICTED: alkaline/neutral invertase CINV2-...    436   2e-160   
tpg|DAA39011.1|  TPA: hypothetical protein ZEAMMB73_928957              449   2e-160   
ref|XP_004144831.1|  PREDICTED: uncharacterized protein LOC101204549    444   2e-160   
ref|XP_009393808.1|  PREDICTED: alkaline/neutral invertase CINV2-...    444   2e-160   
emb|CDY58813.1|  BnaAnng15360D                                          439   2e-160   
gb|KHG29973.1|  Protein degV                                            441   2e-160   
gb|EMS50471.1|  hypothetical protein TRIUR3_29983                       444   2e-160   
gb|EMT25280.1|  hypothetical protein F775_32214                         443   3e-160   
ref|XP_004292948.1|  PREDICTED: uncharacterized protein LOC101309221    446   3e-160   
ref|XP_009383978.1|  PREDICTED: alkaline/neutral invertase CINV2-...    445   3e-160   
ref|XP_006283418.1|  hypothetical protein CARUB_v10004468mg             437   3e-160   
emb|CDX90723.1|  BnaA03g24030D                                          436   3e-160   
emb|CDY05058.1|  BnaC03g28560D                                          436   3e-160   
ref|XP_009108698.1|  PREDICTED: alkaline/neutral invertase CINV2-...    439   3e-160   
ref|XP_009134146.1|  PREDICTED: LOW QUALITY PROTEIN: alkaline/neu...    436   3e-160   
ref|XP_003523504.1|  PREDICTED: alkaline/neutral invertase CINV2-...    436   4e-160   
ref|XP_006581104.1|  PREDICTED: alkaline/neutral invertase CINV2-...    434   4e-160   
gb|AEY78488.1|  neutral invertase 1                                     433   4e-160   
ref|XP_002867101.1|  hypothetical protein ARALYDRAFT_491170             437   5e-160   
ref|NP_195212.1|  beta-fructofuranosidase-like protein                  436   5e-160   
ref|XP_002312983.1|  beta-fructofuranosidase family protein             444   6e-160   
ref|XP_009105864.1|  PREDICTED: alkaline/neutral invertase CINV2        449   6e-160   
ref|XP_006390718.1|  hypothetical protein EUTSA_v10019647mg             446   7e-160   
dbj|BAH20183.1|  AT4G34860                                              436   9e-160   
ref|XP_011074955.1|  PREDICTED: alkaline/neutral invertase CINV2-...    439   1e-159   
ref|XP_010066240.1|  PREDICTED: alkaline/neutral invertase CINV2-...    441   1e-159   
ref|XP_004496345.1|  PREDICTED: uncharacterized protein LOC101512400    438   1e-159   
ref|XP_008356627.1|  PREDICTED: alkaline/neutral invertase CINV2-...    451   1e-159   
ref|XP_010447027.1|  PREDICTED: alkaline/neutral invertase CINV2        436   1e-159   
ref|XP_010428053.1|  PREDICTED: alkaline/neutral invertase CINV2-...    448   1e-159   
ref|NP_001146670.1|  hypothetical protein                               446   1e-159   
ref|XP_002526803.1|  beta-fructofuranosidase, putative                  439   1e-159   
gb|AGG41118.1|  putative neutral/alkaline invertase                     440   1e-159   
ref|XP_010691858.1|  PREDICTED: alkaline/neutral invertase CINV2-...    437   1e-159   
ref|XP_010471222.1|  PREDICTED: alkaline/neutral invertase CINV2-...    440   1e-159   
ref|XP_009801178.1|  PREDICTED: alkaline/neutral invertase CINV2-...    438   1e-159   
gb|KHN20009.1|  hypothetical protein glysoja_014587                     433   1e-159   
ref|XP_006444810.1|  hypothetical protein CICLE_v10023282mg             461   1e-159   
ref|XP_004500744.1|  PREDICTED: uncharacterized protein LOC101500758    437   2e-159   
ref|XP_010266598.1|  PREDICTED: alkaline/neutral invertase CINV2-...    444   2e-159   
ref|XP_001777804.1|  predicted protein                                  442   2e-159   
ref|XP_010930813.1|  PREDICTED: alkaline/neutral invertase CINV2-...    437   2e-159   
ref|XP_002976121.1|  hypothetical protein SELMODRAFT_104721             439   2e-159   
gb|AII99811.1|  beta-fructofuranosidase, transcript variant 2           449   2e-159   
ref|XP_002968256.1|  hypothetical protein SELMODRAFT_89558              439   3e-159   
ref|XP_006350338.1|  PREDICTED: alkaline/neutral invertase CINV2-...    432   3e-159   
ref|XP_008221404.1|  PREDICTED: alkaline/neutral invertase CINV2-...    447   3e-159   
gb|EYU40403.1|  hypothetical protein MIMGU_mgv1a003765mg                437   4e-159   
ref|XP_007226952.1|  hypothetical protein PRUPE_ppa025225mg             445   4e-159   
ref|XP_006416176.1|  hypothetical protein EUTSA_v10007305mg             437   4e-159   
ref|XP_009407007.1|  PREDICTED: alkaline/neutral invertase CINV2-...    440   5e-159   
ref|NP_001065878.1|  Os11g0175400                                       443   5e-159   
ref|XP_002976468.1|  hypothetical protein SELMODRAFT_151264             437   5e-159   
emb|CDY17491.1|  BnaC03g65720D                                          439   6e-159   
gb|EPS64471.1|  neutral/alkaline invertase 1                            443   6e-159   
ref|XP_008233173.1|  PREDICTED: alkaline/neutral invertase CINV2-...    452   6e-159   
ref|XP_007220618.1|  hypothetical protein PRUPE_ppa002149mg             452   6e-159   
ref|NP_564177.1|  putative neutral invertase                            436   6e-159   
ref|XP_002994046.1|  hypothetical protein SELMODRAFT_163303             437   7e-159   
ref|XP_010530788.1|  PREDICTED: alkaline/neutral invertase CINV2        440   7e-159   
ref|XP_003591999.1|  Neutral invertase-like protein                     437   7e-159   
gb|AHD25652.1|  neutral invertase 1                                     436   8e-159   
ref|XP_009621341.1|  PREDICTED: alkaline/neutral invertase CINV1        437   8e-159   
ref|XP_009801620.1|  PREDICTED: alkaline/neutral invertase CINV1-...    436   1e-158   
ref|XP_004250416.1|  PREDICTED: alkaline/neutral invertase CINV2-...    430   1e-158   
ref|XP_010088674.1|  hypothetical protein L484_003226                   439   1e-158   
gb|AFH77952.1|  neutral/alkaline invertase                              445   1e-158   
gb|AAM65926.1|  putative invertase                                      436   1e-158   
ref|XP_009602730.1|  PREDICTED: alkaline/neutral invertase CINV2-...    436   1e-158   
ref|XP_001758344.1|  predicted protein                                  441   1e-158   
ref|XP_010437560.1|  PREDICTED: alkaline/neutral invertase CINV2-...    432   1e-158   
ref|XP_001782510.1|  predicted protein                                  437   1e-158   
ref|XP_009115616.1|  PREDICTED: alkaline/neutral invertase CINV2        438   1e-158   
ref|XP_009402636.1|  PREDICTED: alkaline/neutral invertase CINV2-...    435   2e-158   
ref|XP_011045089.1|  PREDICTED: alkaline/neutral invertase CINV2-...    449   2e-158   
ref|XP_010432372.1|  PREDICTED: alkaline/neutral invertase CINV2-...    432   2e-158   
ref|XP_011092865.1|  PREDICTED: alkaline/neutral invertase CINV1-...    436   2e-158   
gb|KHN05471.1|  hypothetical protein glysoja_020436                     437   3e-158   
ref|XP_003604026.1|  Neutral invertase-like protein                     434   3e-158   
gb|AFO84094.1|  neutral invertase                                       439   3e-158   
ref|XP_011088508.1|  PREDICTED: alkaline/neutral invertase CINV2-...    434   3e-158   
ref|XP_008377226.1|  PREDICTED: alkaline/neutral invertase CINV2-...    442   3e-158   
ref|XP_008350490.1|  PREDICTED: alkaline/neutral invertase CINV2-...    446   4e-158   
ref|XP_010477524.1|  PREDICTED: alkaline/neutral invertase CINV2        434   4e-158   
ref|NP_001147920.1|  neutral/alkaline invertase                         436   5e-158   
ref|XP_010061067.1|  PREDICTED: alkaline/neutral invertase CINV2-...    447   6e-158   
ref|XP_003540627.1|  PREDICTED: alkaline/neutral invertase CINV2-...    437   6e-158   
gb|ABQ28669.1|  beta-fructofuranosidase                                 442   6e-158   
ref|XP_006852072.1|  hypothetical protein AMTR_s00041p00232150          437   6e-158   
ref|XP_002893242.1|  hypothetical protein ARALYDRAFT_472504             434   7e-158   
ref|XP_006287276.1|  hypothetical protein CARUB_v10000472mg             481   7e-158   
ref|XP_002307726.1|  hypothetical protein POPTR_0005s26090g             447   7e-158   
ref|XP_010498746.1|  PREDICTED: alkaline/neutral invertase CINV2-...    434   8e-158   
ref|XP_004975646.1|  PREDICTED: alkaline/neutral invertase CINV2-...    437   9e-158   
ref|XP_006359646.1|  PREDICTED: alkaline/neutral invertase CINV2-...    436   1e-157   
ref|XP_001779600.1|  predicted protein                                  438   1e-157   
ref|XP_010526906.1|  PREDICTED: alkaline/neutral invertase CINV2-...    437   2e-157   
ref|XP_002887406.1|  hypothetical protein ARALYDRAFT_316170             444   2e-157   
ref|XP_003579771.1|  PREDICTED: alkaline/neutral invertase CINV2-...    439   3e-157   
ref|XP_003577807.1|  PREDICTED: alkaline/neutral invertase CINV2-...    440   3e-157   
ref|XP_004230910.1|  PREDICTED: alkaline/neutral invertase CINV2        434   4e-157   
gb|ADP88917.1|  neutral invertase                                       432   5e-157   
ref|XP_010460025.1|  PREDICTED: alkaline/neutral invertase CINV2-...    435   5e-157   
gb|AGG41119.1|  putative neutral/alkaline invertase                     437   6e-157   
ref|XP_007135885.1|  hypothetical protein PHAVU_009G000400g             429   9e-157   
emb|CAL26914.1|  alkaline invertase                                     440   1e-156   
ref|XP_009795841.1|  PREDICTED: alkaline/neutral invertase CINV2-...    434   2e-156   



>gb|AAS79609.1| putative neutral invertase [Ipomoea trifida]
Length=634

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/380 (95%), Positives = 367/380 (97%), Gaps = 4/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG
Sbjct  255   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  314

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALN+R
Sbjct  315   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNNR  374

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  375   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVEWMPSKGGYL  434

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIE KWEDLVANMPLKICYPALE
Sbjct  435   IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIETKWEDLVANMPLKICYPALE  494

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVA VKMKRPEIAENAIKVAERRIAGDK
Sbjct  495   GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVACVKMKRPEIAENAIKVAERRIAGDK  554

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL
Sbjct  555   WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  614

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKGAVKQSYIV
Sbjct  615   SSNPRRKRSRKGAVKQSYIV  634


 Score =   404 bits (1037),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 207/235 (88%), Gaps = 22/235 (9%)
 Frame = +1

Query  157  DHFK--GKSFRVKCSKDLGKITSSSKLCAVRDFYGLEKPKLLRCYCRPAERGNERIFEDE  330
            DH K  GK+ RVKC KDLG ITSSSKLCAVRDFYGLEKP LLRCYC+PAERGNERIFEDE
Sbjct  42   DHLKVKGKNSRVKCFKDLGTITSSSKLCAVRDFYGLEKPNLLRCYCQPAERGNERIFEDE  101

Query  331  QGRSVHSIAPNGQTS----------------ATVNNALP----NSIEEEAWDLLRASMVY  450
            QGRSVHSIAPNGQTS                 TVNNALP    NSIEEEAW+LLRASMVY
Sbjct  102  QGRSVHSIAPNGQTSDAAQQFKNDNGTVPSSKTVNNALPKSSTNSIEEEAWNLLRASMVY  161

Query  451  YCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE  630
            YCGNPIGTIAANDP+DSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE
Sbjct  162  YCGNPIGTIAANDPSDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE  221

Query  631  KTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KTMDCYSPGQGLMPASFKVRTVPL+NDENATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  222  KTMDCYSPGQGLMPASFKVRTVPLDNDENATEDVLDPDFGEAAIGRVAPVDSGLW  276



>dbj|BAF37799.1| hypothetical protein [Ipomoea trifida]
Length=668

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/408 (88%), Positives = 367/408 (90%), Gaps = 32/408 (8%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG
Sbjct  261   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  320

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALN+R
Sbjct  321   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNNR  380

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  381   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVEWMPSKGGYL  440

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIE KWEDLVANMPLKICYPALE
Sbjct  441   IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIETKWEDLVANMPLKICYPALE  500

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQ----------------------------L  1625
             GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQ                            L
Sbjct  501   GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQGSPFSMLIVKVSLVEQKIEDSASKFDAIL  560

Query  1626  AVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAK  1805
             AVA VKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAK
Sbjct  561   AVACVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAK  620

Query  1806  LLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSYIV  1949
             LLVANPEAAKMLITIEDTELLSAFSSILS+NPRRKRSRKGAVKQSYIV
Sbjct  621   LLVANPEAAKMLITIEDTELLSAFSSILSSNPRRKRSRKGAVKQSYIV  668


 Score =   446 bits (1148),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 229/282 (81%), Positives = 236/282 (84%), Gaps = 39/282 (14%)
 Frame = +1

Query  67   MGVPALQVLPGELSCRFIRRCSS----NSLLLLKDHFK--GKSFRVKCSKDLGKITSSSK  228
            MGVPALQVLPGELSCRF RRCSS    NSLLLLKDH K  GK+ RVKC KDLG ITSSSK
Sbjct  1    MGVPALQVLPGELSCRFFRRCSSTVASNSLLLLKDHLKVKGKNSRVKCFKDLGTITSSSK  60

Query  229  LCAVRDFYGLEKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAPNGQTS-----------  375
            LCAVRDFYGLEKP LLRCYC+PAERGNERIFEDEQGRSVHSIAPNGQTS           
Sbjct  61   LCAVRDFYGLEKPNLLRCYCQPAERGNERIFEDEQGRSVHSIAPNGQTSDAAQQFKNDNG  120

Query  376  -----ATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVF  528
                  TVNNALP    NSIEEEAW+LLRASMVYYCGNPIGTIAANDP+DSSILNYDQVF
Sbjct  121  TVPSSKTVNNALPKSSTNSIEEEAWNLLRASMVYYCGNPIGTIAANDPSDSSILNYDQVF  180

Query  529  IRDFIPSGIAFLLKGEYDIVRNFLLHTLQL-------------QSWEKTMDCYSPGQGLM  669
            IRDFIPSGIAFLLKGEYDIVRNFLLHTLQL             QSWEKTMDCYSPGQGLM
Sbjct  181  IRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQPVLLCINTLPSKQSWEKTMDCYSPGQGLM  240

Query  670  PASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PASFKVRTVPL+NDENATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  241  PASFKVRTVPLDNDENATEDVLDPDFGEAAIGRVAPVDSGLW  282



>gb|AHA82517.1| neutral/alkaline invertase [Manihot esculenta]
Length=624

 Score =   653 bits (1684),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 305/362 (84%), Positives = 332/362 (92%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  264   SGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDR  323

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+RL+ALSFHIREYYWID++K
Sbjct  324   RMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDMRK  383

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRYKTEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYLIGNLQPAHMDFRFFSLGN
Sbjct  384   INEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYLIGNLQPAHMDFRFFSLGN  443

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW DLVA MP KICYPALEGQEWRIITG DPKNTPWS
Sbjct  444   LWSIVSSLATVDQSHAILDLIEAKWADLVAEMPFKICYPALEGQEWRIITGSDPKNTPWS  503

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIAE A+K+AERRI+ DKWPEYYDTK+  FIGKQAR
Sbjct  504   YHNGGSWPTLLWQLTVACIKMNRPEIAEKAVKLAERRISKDKWPEYYDTKKARFIGKQAR  563

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSIAGYLVAKLL+ NP AAK+L+  EDTEL + FS I++ANPRRKR R G  KQ +
Sbjct  564   LFQTWSIAGYLVAKLLLDNPSAAKILVNEEDTELQNTFSCIINANPRRKRGRSG-YKQPF  622

Query  1944  IV  1949
             IV
Sbjct  623   IV  624


 Score =   248 bits (634),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 161/226 (71%), Gaps = 18/226 (8%)
 Frame = +1

Query  169  GKSFRVKCSKDLGKITSSSKLCAVRD---FYGLEKPKLL---RCYCRPAER-----GNER  315
            G S   K S+ L K T ++  C  ++   +   E+ K L   RC C+ A+       NE 
Sbjct  43   GGSLHQKSSRMLWKYTRANS-CQGKNIACYVETERAKRLESIRCECQRADSVSRITANEN  101

Query  316  IFEDEQGRSVHSIAPNGQTSA------TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            I       +   +  NG   +      T +     S+ EEAWDLLR S+VYYCGNPIGTI
Sbjct  102  IPSISLPVNAGDVKVNGNVDSAKTVRDTSHKTNECSVVEEAWDLLRESVVYYCGNPIGTI  161

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AANDP+D+SILNYDQVFIRDFIPSGIAFLLKGE+DIVRNF+L+TLQLQSWEKTMDC+SPG
Sbjct  162  AANDPSDTSILNYDQVFIRDFIPSGIAFLLKGEFDIVRNFILYTLQLQSWEKTMDCHSPG  221

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPL+ D++ATED+LD DFGEAAIGRVAPVDSG++
Sbjct  222  QGLMPASFKVRTVPLDGDDSATEDILDADFGEAAIGRVAPVDSGLW  267



>ref|XP_011005355.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
Length=618

 Score =   639 bits (1649),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/362 (83%), Positives = 332/362 (92%), Gaps = 4/362 (1%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTGMKMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  261   SGLWWIILLRAYGKCSGDLSVQERVDVQTGMKMILRLCLADGFDMFPTLLVTDGSCMIDR  320

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEI+ALFYSALLCAREMLAPE+ S DLI ALN+RL+ALSFHIREYYWID+KK
Sbjct  321   RMGIHGHPLEIEALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDLKK  380

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWLV++MPSKGGYLIGNLQPAHMDFRFF+LGN
Sbjct  381   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLVEFMPSKGGYLIGNLQPAHMDFRFFTLGN  440

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW +LVA MP+KIC+PALEGQEWRIITG DPKNT WS
Sbjct  441   LWSIVSSLATLDQSHAILDLIEAKWAELVAEMPIKICFPALEGQEWRIITGSDPKNTAWS  500

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIAE A+++ ERRI+ DKWPEYYDTKR  FIGKQAR
Sbjct  501   YHNGGSWPTLLWQLTVACIKMNRPEIAEKAVRLVERRISRDKWPEYYDTKRARFIGKQAR  560

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSI+GYLVAKLL+ANP AAK+ +  ED EL++A   ++SANPRRKR+RKG  KQ +
Sbjct  561   LFQTWSISGYLVAKLLLANPNAAKIFVNEEDPELVNA---LISANPRRKRARKG-FKQPF  616

Query  1944  IV  1949
             I+
Sbjct  617   II  618


 Score =   258 bits (659),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 175/258 (68%), Gaps = 19/258 (7%)
 Frame = +1

Query  79   ALQVLPGELSC--RF-IRRCSSNSLLLLKDHFKGKSFRVKCSKDL-------GKITSSS-  225
             LQVL G L C  RF +    SNS+L +    K K  R    K L       GK TS   
Sbjct  7    VLQVLSGGLPCPHRFDLSFGGSNSVLSICSDVKRKKNRGLVYKKLNNGMRLLGKCTSRGV  66

Query  226  -KLCAVRDFYGLEKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAPNGQTS-------AT  381
              + + R    +++ + +RC C+ AE             S+     +G T+       A 
Sbjct  67   GAVTSRRKVKCIDRWESMRCKCQKAESFGGATANQWSPVSLPLNGVHGATNIFERGSLAL  126

Query  382  VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAF  561
              N    SIEEEAWDLLRAS+V YCGNPIGTIAANDPN +SILNYDQVFIRDFIPSGIAF
Sbjct  127  KGNEETQSIEEEAWDLLRASVVCYCGNPIGTIAANDPNGTSILNYDQVFIRDFIPSGIAF  186

Query  562  LLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDP  741
            LLKGEYDIVRNF+L+TLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL+++++ATE+VLD 
Sbjct  187  LLKGEYDIVRNFILYTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDSEDSATEEVLDA  246

Query  742  DFGEAAIGRVAPVDSGMF  795
            DFGEAAIGRVAPVDSG++
Sbjct  247  DFGEAAIGRVAPVDSGLW  264



>gb|EYU36087.1| hypothetical protein MIMGU_mgv1a002839mg [Erythranthe guttata]
Length=632

 Score =   639 bits (1648),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 298/362 (82%), Positives = 330/362 (91%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKC+GD S+ ERIDVQTG+KMILKLCL+DGFDMFPTLLVTDGSCMIDR
Sbjct  272   SGLWWIILLRAYGKCTGDRSVQERIDVQTGIKMILKLCLSDGFDMFPTLLVTDGSCMIDR  331

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQ+LFYSALLCAREMLAPE+A  DLITALN+RL+ALS HIREYYW+D+KK
Sbjct  332   RMGIHGHPLEIQSLFYSALLCAREMLAPEDAPSDLITALNNRLVALSIHIREYYWVDMKK  391

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYS++A+NKFNIYPDQIPPWLV+WMP+KGG+LIGNLQPAHMDFRFF+LGN
Sbjct  392   LNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEWMPNKGGFLIGNLQPAHMDFRFFALGN  451

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW+I+ SLATT+QSHAILDLIEAKW DL+A MP+KICYPALEGQEWRIITG DPKNTPWS
Sbjct  452   LWAIICSLATTEQSHAILDLIEAKWSDLIAGMPMKICYPALEGQEWRIITGCDPKNTPWS  511

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIAE A+KVAE+R+  DKWPEYYDTK   FIGKQA 
Sbjct  512   YHNGGSWPTLLWQLTVACIKMNRPEIAEKALKVAEKRLGRDKWPEYYDTKGARFIGKQAH  571

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSIAGYLVAKLLV NP AA ML+ IED +LL+ FS  LSANPR KR RKG  K+S+
Sbjct  572   LFQTWSIAGYLVAKLLVENPNAANMLVNIEDADLLNTFSWTLSANPRGKRPRKGP-KKSF  630

Query  1944  IV  1949
             I+
Sbjct  631   II  632


 Score =   253 bits (645),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 148/201 (74%), Gaps = 23/201 (11%)
 Frame = +1

Query  262  KPKLLRCYCRPAERGNERIFEDEQGRSVHSIA---------PNGQTSATVNNAL------  396
            + K L C C  AE   E   ED   R+V  +           + +    +NN L      
Sbjct  75   RSKSLLCNCSGAESVQEAFREDGSKRTVKGVTEDLDAAQYLKHDKDGLLLNNELTLDTAI  134

Query  397  --------PNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSG  552
                     N +E+EAW+LLRASMVYYCGNP+GTIAANDP+DS++LNYDQVFIRDFIPSG
Sbjct  135  GNTFGGSGANDLEDEAWNLLRASMVYYCGNPVGTIAANDPSDSNMLNYDQVFIRDFIPSG  194

Query  553  IAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDV  732
            IAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPL+ D+ ATE++
Sbjct  195  IAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLDGDDTATEEI  254

Query  733  LDPDFGEAAIGRVAPVDSGMF  795
            LDPDFGEAAIGRVAPVDSG++
Sbjct  255  LDPDFGEAAIGRVAPVDSGLW  275



>ref|XP_002532011.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF30366.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=663

 Score =   642 bits (1657),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 301/362 (83%), Positives = 331/362 (91%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  303   SGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDR  362

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALL AREMLAPE+ S DL+ ALN+RL+ALSFHIREYYWID++K
Sbjct  363   RMGIHGHPLEIQALFYSALLSAREMLAPEDGSADLVRALNNRLVALSFHIREYYWIDLRK  422

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP++GGYLIGNLQPAHMDFRFFSLGN
Sbjct  423   LNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNQGGYLIGNLQPAHMDFRFFSLGN  482

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWS+VS LAT DQSHAILDLIEAKW DLVA MP KICYPALEGQEW+IITG DPKNTPWS
Sbjct  483   LWSVVSGLATKDQSHAILDLIEAKWTDLVAEMPFKICYPALEGQEWQIITGSDPKNTPWS  542

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIA  A++VAER I+ DKWPEYYDTKRG FIGKQA 
Sbjct  543   YHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEVAERNISRDKWPEYYDTKRGRFIGKQAH  602

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSIAGYLVAK+L+A+P AAK+L T ED EL++AFS ++SANPRRKR RK  +KQ+Y
Sbjct  603   LFQTWSIAGYLVAKILLADPSAAKILTTEEDPELVNAFSCMISANPRRKRGRKD-LKQTY  661

Query  1944  IV  1949
             IV
Sbjct  662   IV  663


 Score =   247 bits (631),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  379  TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIA  558
            T +    +SIE+EAWDLLR+S+V+YCG+PIGTIAANDP  S++LNYDQVFIRDFIPSGIA
Sbjct  168  TSHKVTIDSIEDEAWDLLRSSVVHYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIA  227

Query  559  FLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLD  738
            FLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ TE++LD
Sbjct  228  FLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSTTEEILD  287

Query  739  PDFGEAAIGRVAPVDSGMF  795
            PDFGEAAIGRVAPVDSG++
Sbjct  288  PDFGEAAIGRVAPVDSGLW  306



>ref|XP_006384642.1| hypothetical protein POPTR_0004s19760g [Populus trichocarpa]
 gb|ERP62439.1| hypothetical protein POPTR_0004s19760g [Populus trichocarpa]
Length=564

 Score =   632 bits (1630),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 297/362 (82%), Positives = 329/362 (91%), Gaps = 4/362 (1%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTGMKMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  207   SGLWWIILLRAYGKCSGDLSVQERVDVQTGMKMILRLCLADGFDMFPTLLVTDGSCMIDR  266

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEI+ALFYSALLCAREMLAPE+ S DLI ALN+RL+ALSFHIREYYWID+KK
Sbjct  267   RMGIHGHPLEIEALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDLKK  326

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWLV++MP+KGGYLIGNLQPAHMDFRFF+LGN
Sbjct  327   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLVEFMPNKGGYLIGNLQPAHMDFRFFTLGN  386

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW +LVA MP+KICYPALEGQEWRI+TG DPKNT WS
Sbjct  387   LWSIVSSLATLDQSHAILDLIEAKWAELVAEMPIKICYPALEGQEWRIVTGSDPKNTAWS  446

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIAE A+++ ERRI+ DKWPEYYDTKR  FIGKQA 
Sbjct  447   YHNGGSWPTLLWQLTVACIKMNRPEIAERAVQLVERRISRDKWPEYYDTKRARFIGKQAH  506

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSI+GYLVAKL +ANP AAK+ +  ED EL++A   ++SANPRRKR+RK   KQ +
Sbjct  507   LFQTWSISGYLVAKLFLANPSAAKIFVNEEDPELVNA---LISANPRRKRARK-IFKQPF  562

Query  1944  IV  1949
             IV
Sbjct  563   IV  564


 Score =   255 bits (652),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 159/211 (75%), Gaps = 14/211 (7%)
 Frame = +1

Query  187  KC-SKDLGKITSSSKLCAVRDFYGLEKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAPN  363
            KC S+ +G +TS  K+  +      ++ + +RC C+ AE        +    S+     +
Sbjct  6    KCRSRGVGAVTSRGKVKCI------DRWESMRCKCQKAESFGGATANEWSPVSLPVNGVH  59

Query  364  GQTS-------ATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQ  522
            G T+       A   N    SIEEEAWDLLRAS+V YCGNPIGTIAANDPN +SILNYDQ
Sbjct  60   GATNIFERGSFALKGNEETQSIEEEAWDLLRASVVCYCGNPIGTIAANDPNSTSILNYDQ  119

Query  523  VFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  702
            VFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL
Sbjct  120  VFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  179

Query  703  ENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +++++ATE+VLD DFGEAAIGRVAPVDSG++
Sbjct  180  DSEDSATEEVLDADFGEAAIGRVAPVDSGLW  210



>ref|XP_010242620.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
Length=666

 Score =   637 bits (1642),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/362 (83%), Positives = 325/362 (90%), Gaps = 2/362 (1%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADGFDMFPTLLVTDGSCM+DR
Sbjct  299   SGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMVDR  358

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYS LLCAREMLAPE+ S DLI ALN+RL+ LSFHIREYYW+D++K
Sbjct  359   RMGIHGHPLEIQALFYSTLLCAREMLAPEDGSADLIRALNNRLVTLSFHIREYYWVDMRK  418

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYSY+AINKFNIYPDQIPPWLVDWMP+KGGYLIGNLQPAHMDFRFF+LGN
Sbjct  419   LNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVDWMPNKGGYLIGNLQPAHMDFRFFALGN  478

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW DLV NMP KICYPALE QEWRIITG DPKNTPWS
Sbjct  479   LWSIVSSLATVDQSHAILDLIEAKWTDLVGNMPFKICYPALEDQEWRIITGCDPKNTPWS  538

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHNAGSWPTLLWQL  A +KM R EIA  A++VAE+RI+ D WPEYYDTK   FIGKQA 
Sbjct  539   YHNAGSWPTLLWQLTAACIKMNRSEIAVKAVEVAEKRISRDMWPEYYDTKSARFIGKQAH  598

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             L QTWSIAGYLVAKLL+ANP AA  LI  ED +L +AF S ++ANPRRKR R+GA KQSY
Sbjct  599   LLQTWSIAGYLVAKLLLANPSAASALINEEDKDLANAF-SCMNANPRRKRGRQGA-KQSY  656

Query  1944  IV  1949
             IV
Sbjct  657   IV  658


 Score =   250 bits (638),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            E   +   E E   S   +A   +   +++    +S+E+EAW+LLR S+VYYCG+PIGTI
Sbjct  137  EEVQQSKHESESSGSNGKLASVEKVKDSLHKVGIDSLEDEAWNLLRESVVYYCGSPIGTI  196

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AA DP DS++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPG
Sbjct  197  AAKDPTDSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPG  256

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPLE D++ATED+LDPDFGEAAIGRVAPVDSG++
Sbjct  257  QGLMPASFKVRTVPLEGDDSATEDILDPDFGEAAIGRVAPVDSGLW  302



>ref|XP_010031480.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW50790.1| hypothetical protein EUGRSUZ_J00457 [Eucalyptus grandis]
 gb|KCW50791.1| hypothetical protein EUGRSUZ_J00457 [Eucalyptus grandis]
 gb|KCW50792.1| hypothetical protein EUGRSUZ_J00457 [Eucalyptus grandis]
Length=648

 Score =   647 bits (1670),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/362 (83%), Positives = 332/362 (92%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  288   SGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDR  347

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQ+LFYSALLCAREML PE+AS DLI ALN+RL+ALSFHIREYYWID++K
Sbjct  348   RMGIHGHPLEIQSLFYSALLCAREMLTPEDASADLIQALNNRLIALSFHIREYYWIDMRK  407

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWL  WMP+KGGYLIGNLQPAHMDFRFFSLGN
Sbjct  408   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLAGWMPNKGGYLIGNLQPAHMDFRFFSLGN  467

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW DLVA+MP KICYPALEGQEWRI+TG DPKNTPWS
Sbjct  468   LWSIVSSLATVDQSHAILDLIEAKWADLVADMPFKICYPALEGQEWRIVTGSDPKNTPWS  527

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPEIAENAI++AERRI+ DKWPEYYDTKR  FIGKQA 
Sbjct  528   YHNGGSWPTLLWQLTVACIKMNRPEIAENAIRMAERRISQDKWPEYYDTKRARFIGKQAH  587

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             LFQTWSIAGYLV+KLL++NP A ++L   ED +L++AFS ++S+NPRRKR R  AV++ +
Sbjct  588   LFQTWSIAGYLVSKLLLSNPSAVRILANEEDADLVNAFSCMISSNPRRKRGRP-AVEKRF  646

Query  1944  IV  1949
             IV
Sbjct  647   IV  648


 Score =   239 bits (610),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 3/147 (2%)
 Frame = +1

Query  364  GQTSAT---VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            GQ  AT   V      S+E+EAW+L+R S+ YYC NPIGTIAANDP+  SILNYDQVFIR
Sbjct  145  GQPEATREKVQKISSKSMEDEAWELMRDSIAYYCNNPIGTIAANDPSCPSILNYDQVFIR  204

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMD YSPGQGLMPASFKVRTVPL  D 
Sbjct  205  DFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDSYSPGQGLMPASFKVRTVPLNGDN  264

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATE++LDPDFGEAAIGRVAPVDSG++
Sbjct  265  SATEEILDPDFGEAAIGRVAPVDSGLW  291



>ref|XP_010031479.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Eucalyptus 
grandis]
Length=660

 Score =   639 bits (1649),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/374 (80%), Positives = 332/374 (89%), Gaps = 13/374 (3%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  288   SGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDR  347

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQ+LFYSALLCAREML PE+AS DLI ALN+RL+ALSFHIREYYWID++K
Sbjct  348   RMGIHGHPLEIQSLFYSALLCAREMLTPEDASADLIQALNNRLIALSFHIREYYWIDMRK  407

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWL  WMP+KGGYLIGNLQPAHMDFRFFSLGN
Sbjct  408   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLAGWMPNKGGYLIGNLQPAHMDFRFFSLGN  467

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW DLVA+MP KICYPALEGQEWRI+TG DPKNTPWS
Sbjct  468   LWSIVSSLATVDQSHAILDLIEAKWADLVADMPFKICYPALEGQEWRIVTGSDPKNTPWS  527

Query  1584  YHNAGSWPTLLWQ------------LAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYD  1727
             YHN GSWPTLLWQ            L VA +KM RPEIAENAI++AERRI+ DKWPEYYD
Sbjct  528   YHNGGSWPTLLWQVSSLSMSLDDCLLTVACIKMNRPEIAENAIRMAERRISQDKWPEYYD  587

Query  1728  TKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRR  1907
             TKR  FIGKQA LFQTWSIAGYLV+KLL++NP A ++L   ED +L++AFS ++S+NPRR
Sbjct  588   TKRARFIGKQAHLFQTWSIAGYLVSKLLLSNPSAVRILANEEDADLVNAFSCMISSNPRR  647

Query  1908  KRSRKGAVKQSYIV  1949
             KR R  AV++ +IV
Sbjct  648   KRGRP-AVEKRFIV  660


 Score =   239 bits (610),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 3/147 (2%)
 Frame = +1

Query  364  GQTSAT---VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            GQ  AT   V      S+E+EAW+L+R S+ YYC NPIGTIAANDP+  SILNYDQVFIR
Sbjct  145  GQPEATREKVQKISSKSMEDEAWELMRDSIAYYCNNPIGTIAANDPSCPSILNYDQVFIR  204

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMD YSPGQGLMPASFKVRTVPL  D 
Sbjct  205  DFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDSYSPGQGLMPASFKVRTVPLNGDN  264

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATE++LDPDFGEAAIGRVAPVDSG++
Sbjct  265  SATEEILDPDFGEAAIGRVAPVDSGLW  291



>ref|XP_011102049.1| PREDICTED: alkaline/neutral invertase CINV1-like [Sesamum indicum]
 ref|XP_011102050.1| PREDICTED: alkaline/neutral invertase CINV1-like [Sesamum indicum]
Length=646

 Score =   641 bits (1653),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 297/362 (82%), Positives = 331/362 (91%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  286   SGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDR  345

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALLCAREMLAPE+ S DL  ALN+RL+ALSFHIREYYWID++K
Sbjct  346   RMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLSRALNNRLVALSFHIREYYWIDMRK  405

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYS++A+NKFNIYPDQI PWL +WMP+KGGYLIGNLQPAHMDFRFFSLGN
Sbjct  406   LNEIYRYKTEEYSFDAVNKFNIYPDQISPWLAEWMPNKGGYLIGNLQPAHMDFRFFSLGN  465

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWS+VSSLAT DQSHAILDLIEAKW DLVA+MP KICYPALEG+EW+IITG DPKNTPWS
Sbjct  466   LWSVVSSLATVDQSHAILDLIEAKWSDLVADMPFKICYPALEGKEWQIITGCDPKNTPWS  525

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN G+WPTLLWQL VA +KM RPEIAE  +K+AE+RI+ DKWPEYYDTKR  FIGKQAR
Sbjct  526   YHNGGAWPTLLWQLTVACIKMNRPEIAERVVKIAEKRISKDKWPEYYDTKRARFIGKQAR  585

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             L+QTWSIAGYLVAKLL+ NP AAK+LI  ED+EL++AFS  +S++PRRKR  K + K +Y
Sbjct  586   LYQTWSIAGYLVAKLLLDNPSAAKILINEEDSELINAFSCAISSSPRRKRGPKSSQK-TY  644

Query  1944  IV  1949
             IV
Sbjct  645   IV  646


 Score =   230 bits (586),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            E   E   E E   S      NG T  T+   +  SIE+EAW+LL+ S+VYYCG+PIGTI
Sbjct  127  ETIKESSLEREAFSSNSKTPQNGTTRDTLQKDIAGSIEDEAWELLKESIVYYCGSPIGTI  186

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AA DP  S++LNYDQVFIRDFIPSGIAFLL   +   RNF+LHTLQLQSWEKTMDC+SPG
Sbjct  187  AAKDPTTSNVLNYDQVFIRDFIPSGIAFLLXXXF---RNFILHTLQLQSWEKTMDCHSPG  243

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPL+ D+ A E++LDPDFGEAAIGRVAPVDSG++
Sbjct  244  QGLMPASFKVRTVPLDGDDTAMEEILDPDFGEAAIGRVAPVDSGLW  289



>ref|XP_011102136.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV1-like 
[Sesamum indicum]
Length=648

 Score =   640 bits (1652),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 297/362 (82%), Positives = 331/362 (91%), Gaps = 1/362 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  288   SGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDR  347

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALLCAREMLAPE+ S DL  ALN+RL+ALSFHIREYYWID++K
Sbjct  348   RMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLSRALNNRLVALSFHIREYYWIDMRK  407

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYS++A+NKFNIYPDQI PWL +WMP+KGGYLIGNLQPAHMDFRFFSLGN
Sbjct  408   LNEIYRYKTEEYSFDAVNKFNIYPDQISPWLAEWMPNKGGYLIGNLQPAHMDFRFFSLGN  467

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWS+VSSLAT DQSHAILDLIEAKW DLVA+MP KICYPALEG+EW+IITG DPKNTPWS
Sbjct  468   LWSVVSSLATVDQSHAILDLIEAKWSDLVADMPFKICYPALEGKEWQIITGCDPKNTPWS  527

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN G+WPTLLWQL VA +KM RPEIAE  +K+AE+RI+ DKWPEYYDTKR  FIGKQAR
Sbjct  528   YHNGGAWPTLLWQLTVACIKMNRPEIAERVVKIAEKRISKDKWPEYYDTKRARFIGKQAR  587

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             L+QTWSIAGYLVAKLL+ NP AAK+LI  ED+EL++AFS  +S++PRRKR  K + K +Y
Sbjct  588   LYQTWSIAGYLVAKLLLDNPSAAKILINEEDSELINAFSCAISSSPRRKRGPKSSQK-TY  646

Query  1944  IV  1949
             IV
Sbjct  647   IV  648


 Score =   228 bits (582),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            E   E   E E   S      NG T  T+   +  SIE+EAW+LL+ S+VYYCG+PIGTI
Sbjct  127  ETIKESSLEREAFSSNSKTPQNGTTRDTLQKDIAGSIEDEAWELLKESIVYYCGSPIGTI  186

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AA DP  S++LNYDQVFIRDFIPSGIAFLL       RNF+LHTLQLQSWEKTMDC+SPG
Sbjct  187  AAKDPTTSNVLNYDQVFIRDFIPSGIAFLLXXXXXF-RNFILHTLQLQSWEKTMDCHSPG  245

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPL+ D+ A E++LDPDFGEAAIGRVAPVDSG++
Sbjct  246  QGLMPASFKVRTVPLDGDDTAMEEILDPDFGEAAIGRVAPVDSGLW  291



>gb|AFV94466.1| alkaline/neutral invertase protein [Saccharum hybrid cultivar 
GT28]
Length=603

 Score =   619 bits (1595),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 292/362 (81%), Positives = 323/362 (89%), Gaps = 7/362 (2%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGD+S+ ERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  249   SGLWWIILLRAYGKCSGDMSVQERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  308

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+RL+ALSFHIREYYW+D++K
Sbjct  309   RMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNRLIALSFHIREYYWLDMQK  368

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY IGNLQPAHMDFRFFSLGN
Sbjct  369   LNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGN  428

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE QEW+IITG DPKNTPWS
Sbjct  429   LWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPALENQEWKIITGSDPKNTPWS  488

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQL VA +KM RPE+A  AI+VAERRIA DKWPEYYDTK+  FIGKQAR
Sbjct  489   YHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDKWPEYYDTKKARFIGKQAR  548

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGAVKQSY  1943
             L+QTWSIAG+LVAKLL+  P+AA++L   ED E+L+A S+       RKR +K  +K++Y
Sbjct  549   LYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNALST------NRKRGKK-VLKKTY  601

Query  1944  IV  1949
             IV
Sbjct  602   IV  603


 Score =   246 bits (627),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAW+LL+ SMVYYCG+P+GTIAANDPNDS  +NYDQVFIRDFIPSGIAFLLKGEY
Sbjct  121  SSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPVNYDQVFIRDFIPSGIAFLLKGEY  180

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT+PL+ DE+ATE+VLDPDFGEAA
Sbjct  181  EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDEDATEEVLDPDFGEAA  240

Query  760  IGRVAPVDSGMF  795
            +GRVAPVDSG++
Sbjct  241  MGRVAPVDSGLW  252



>ref|XP_009606001.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606003.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606004.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009606005.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Nicotiana 
tomentosiformis]
Length=642

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/380 (87%), Positives = 355/380 (93%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMILKLCLADG
Sbjct  264   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLCLADG  323

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALLCAREMLAPEE S DL+ ALN+R
Sbjct  324   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRALNNR  383

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  384   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSKGGYL  443

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  444   IGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICYPALE  503

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEI+E AI +AERR+A D+
Sbjct  504   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRLARDR  563

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAK L+ANPEAAK+LI +EDTELLSAFSSIL
Sbjct  564   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAFSSIL  623

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  624   SSNPRRKRSRKG-VKQSFII  642


 Score =   296 bits (758),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 162/280 (58%), Positives = 194/280 (69%), Gaps = 42/280 (15%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSF---RVKCSKDLGKITSSSKLCA  237
            AL  L GE SC+F R  S    S+SLL  +   K ++F   R +  K L K    S L A
Sbjct  7    ALHFLSGEFSCQF-RTSSILAKSSSLLCYEHCLKSRNFGDMRYQQIKGLSKWKKCSSLNA  65

Query  238  VRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSIA---PNG-------  366
             R  + +        + K L C C+  ER NE I ++  GRS+H+I+   PN        
Sbjct  66   FRGIHSVFGGEKLRSRSKSLICNCQQPERFNEAIIKNGNGRSIHAISSKIPNHAQDEQMI  125

Query  367  -------------QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPN  495
                         +T+ATVN+A P    +SIE+EAW  LRA+MVYYCG P+GTIAANDP+
Sbjct  126  KQENGAQLFSKGLKTAATVNSAFPRTNTDSIEDEAWHFLRAAMVYYCGTPVGTIAANDPS  185

Query  496  DSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPA  675
            ++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPA
Sbjct  186  EATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPA  245

Query  676  SFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SFKVRTVPL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  246  SFKVRTVPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  285



>ref|XP_006349102.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X6 [Solanum 
tuberosum]
Length=534

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 356/380 (94%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMIL+LCLADG
Sbjct  156   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADG  215

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALL AREMLAPEEAS DL+ ALN+R
Sbjct  216   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNR  275

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPS+GGYL
Sbjct  276   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYL  335

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLA  DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  336   IGNLQPAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALE  395

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AERR++ D+
Sbjct  396   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDR  455

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAKLL+ANPEAAKM+I +EDTELLSAFSSIL
Sbjct  456   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSIL  515

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  516   SSNPRRKRSRKG-VKQSFII  534


 Score =   255 bits (652),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 137/146 (94%), Gaps = 3/146 (2%)
 Frame = +1

Query  367  QTSATVNN---ALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRD  537
            +T+A+VN+       SIE+EAW  LRA+MVYYCG+P+GTIAANDP+++++LNYDQVFIRD
Sbjct  32   KTAASVNSRPRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSEATMLNYDQVFIRD  91

Query  538  FIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDEN  717
            FIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRT+PL+NDE+
Sbjct  92   FIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTIPLDNDES  151

Query  718  ATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  152  ATEDVLDPDFGEAAIGRVAPVDSGLW  177



>ref|XP_009606000.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=668

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/380 (87%), Positives = 355/380 (93%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMILKLCLADG
Sbjct  290   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLCLADG  349

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALLCAREMLAPEE S DL+ ALN+R
Sbjct  350   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRALNNR  409

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  410   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSKGGYL  469

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  470   IGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICYPALE  529

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEI+E AI +AERR+A D+
Sbjct  530   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRLARDR  589

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAK L+ANPEAAK+LI +EDTELLSAFSSIL
Sbjct  590   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAFSSIL  649

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  650   SSNPRRKRSRKG-VKQSFII  668


 Score =   299 bits (766),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 166/290 (57%), Positives = 198/290 (68%), Gaps = 44/290 (15%)
 Frame = +1

Query  55   FLASMGV--PALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSF---RVKCSKDLG  207
            FL  MG    AL  L GE SC+F R  S    S+SLL  +   K ++F   R +  K L 
Sbjct  23   FLLKMGASEAALHFLSGEFSCQF-RTSSILAKSSSLLCYEHCLKSRNFGDMRYQQIKGLS  81

Query  208  KITSSSKLCAVRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSIA---  357
            K    S L A R  + +        + K L C C+  ER NE I ++  GRS+H+I+   
Sbjct  82   KWKKCSSLNAFRGIHSVFGGEKLRSRSKSLICNCQQPERFNEAIIKNGNGRSIHAISSKI  141

Query  358  PNG--------------------QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNP  465
            PN                     +T+ATVN+A P    +SIE+EAW  LRA+MVYYCG P
Sbjct  142  PNHAQDEQMIKQENGAQLFSKGLKTAATVNSAFPRTNTDSIEDEAWHFLRAAMVYYCGTP  201

Query  466  IGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDC  645
            +GTIAANDP+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC
Sbjct  202  VGTIAANDPSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDC  261

Query  646  YSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            YSPGQGLMPASFKVRTVPL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  262  YSPGQGLMPASFKVRTVPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  311



>ref|XP_009605998.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009605999.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=683

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/380 (87%), Positives = 355/380 (93%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMILKLCLADG
Sbjct  305   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLCLADG  364

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALLCAREMLAPEE S DL+ ALN+R
Sbjct  365   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEVSTDLVRALNNR  424

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  425   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSKGGYL  484

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  485   IGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICYPALE  544

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEI+E AI +AERR+A D+
Sbjct  545   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEISEKAIMIAERRLARDR  604

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAK L+ANPEAAK+LI +EDTELLSAFSSIL
Sbjct  605   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAFSSIL  664

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  665   SSNPRRKRSRKG-VKQSFII  683


 Score =   301 bits (771),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 200/294 (68%), Gaps = 44/294 (15%)
 Frame = +1

Query  43   FSIRFLASMGV--PALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSF---RVKCS  195
             + RFL  MG    AL  L GE SC+F R  S    S+SLL  +   K ++F   R +  
Sbjct  34   INFRFLLKMGASEAALHFLSGEFSCQF-RTSSILAKSSSLLCYEHCLKSRNFGDMRYQQI  92

Query  196  KDLGKITSSSKLCAVRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSI  354
            K L K    S L A R  + +        + K L C C+  ER NE I ++  GRS+H+I
Sbjct  93   KGLSKWKKCSSLNAFRGIHSVFGGEKLRSRSKSLICNCQQPERFNEAIIKNGNGRSIHAI  152

Query  355  A---PNG--------------------QTSATVNNALP----NSIEEEAWDLLRASMVYY  453
            +   PN                     +T+ATVN+A P    +SIE+EAW  LRA+MVYY
Sbjct  153  SSKIPNHAQDEQMIKQENGAQLFSKGLKTAATVNSAFPRTNTDSIEDEAWHFLRAAMVYY  212

Query  454  CGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEK  633
            CG P+GTIAANDP+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEK
Sbjct  213  CGTPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEK  272

Query  634  TMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            TMDCYSPGQGLMPASFKVRTVPL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  273  TMDCYSPGQGLMPASFKVRTVPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  326



>ref|XP_006349099.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006349100.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X4 [Solanum 
tuberosum]
 ref|XP_006349101.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X5 [Solanum 
tuberosum]
Length=641

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 356/380 (94%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMIL+LCLADG
Sbjct  263   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADG  322

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALL AREMLAPEEAS DL+ ALN+R
Sbjct  323   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNR  382

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPS+GGYL
Sbjct  383   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYL  442

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLA  DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  443   IGNLQPAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALE  502

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AERR++ D+
Sbjct  503   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDR  562

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAKLL+ANPEAAKM+I +EDTELLSAFSSIL
Sbjct  563   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSIL  622

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  623   SSNPRRKRSRKG-VKQSFII  641


 Score =   283 bits (723),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 193/279 (69%), Gaps = 41/279 (15%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKS---FRVKCSKDLGKITSSSKLCA  237
            ALQ+L G LS + +R  S    SNSLL  +  FK ++   +R K  K L K+   S L A
Sbjct  7    ALQLLSGTLSFQ-VRTSSILAKSNSLLCYERCFKARNCGDWRYKQIKGLKKLQDCSSLHA  65

Query  238  VRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAP------------  360
             R  + +        +  L  C C+  ER +E I +   G+S+H++ P            
Sbjct  66   FRGLHSVFRGEKIYNRSNLSICNCQQPERVSETIIKGGNGKSMHTVPPKIPNLTPDEQNM  125

Query  361  ---NG--------QTSATVNN---ALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
               NG        +T+A+VN+       SIE+EAW  LRA+MVYYCG+P+GTIAANDP++
Sbjct  126  KQENGARPFSEGFKTAASVNSRPRTNTESIEDEAWHFLRAAMVYYCGSPVGTIAANDPSE  185

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
            +++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPAS
Sbjct  186  ATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPAS  245

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRT+PL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  246  FKVRTIPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  284



>ref|XP_009790874.1| PREDICTED: alkaline/neutral invertase CINV2-like [Nicotiana sylvestris]
Length=642

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/380 (87%), Positives = 355/380 (93%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWI+LLRAYGKCSGDLSL  R+DVQTGMKMIL+LCLADG
Sbjct  264   VLDPDFGEAAIGRVAPVDSGLWWIVLLRAYGKCSGDLSLQGRVDVQTGMKMILRLCLADG  323

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALLCAREMLAPEEAS DL+ ALN+R
Sbjct  324   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLCAREMLAPEEASTDLVRALNNR  383

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  384   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSKGGYL  443

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  444   IGNLQPAHMDFRFFALGNLWSIVSSLATIDQSHAILDLIEAKWEDLVADMPLKICYPALE  503

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AE R+A DK
Sbjct  504   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAEIRLARDK  563

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAK L+ANPEAAK+LI +EDTELLSAFSSIL
Sbjct  564   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKQLIANPEAAKILINVEDTELLSAFSSIL  623

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  624   SSNPRRKRSRKG-VKQSFII  642


 Score =   286 bits (732),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 160/282 (57%), Positives = 193/282 (68%), Gaps = 46/282 (16%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRRCSS----NSLLLLKDHFKGKSFRV-----KCSKDLGKITSSSKL  231
            AL  L GE SC+F  R SS    +S LL  +H   KS  +     +  K L K    S+L
Sbjct  7    ALHFLSGEFSCQF--RTSSILTKSSSLLCYEHCL-KSINIGDTTYQQIKGLSKWRYCSRL  63

Query  232  CAVRDFYGLEKPKLLR-------CYCRPAERGNERIFEDEQGRSVHSIAPNG--------  366
             A R  + + + + L+       C C+  ER NE I +D  GRS+H+I+ N         
Sbjct  64   NAFRGIHSVFRGEKLQNQFNSLICNCQQPERFNETIIKDGNGRSIHTISSNIPNHDQDEQ  123

Query  367  ---------------QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAAND  489
                           +T+A VN+ALP     SIE+EAW  LRA+MVYY G+P+GTIAAND
Sbjct  124  MIKQENGAQLFSKGLKTAAMVNSALPRTNTGSIEDEAWHFLRAAMVYYYGDPVGTIAAND  183

Query  490  PNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLM  669
            P+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLM
Sbjct  184  PSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLM  243

Query  670  PASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PASFKVRTVPL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  244  PASFKVRTVPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  285



>ref|XP_006349098.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Solanum 
tuberosum]
Length=645

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 356/380 (94%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMIL+LCLADG
Sbjct  267   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADG  326

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALL AREMLAPEEAS DL+ ALN+R
Sbjct  327   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNR  386

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPS+GGYL
Sbjct  387   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYL  446

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLA  DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  447   IGNLQPAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALE  506

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AERR++ D+
Sbjct  507   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDR  566

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAKLL+ANPEAAKM+I +EDTELLSAFSSIL
Sbjct  567   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSIL  626

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  627   SSNPRRKRSRKG-VKQSFII  645


 Score =   271 bits (694),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/286 (52%), Positives = 185/286 (65%), Gaps = 56/286 (20%)
 Frame = +1

Query  43   FSIRFLASMGV--PALQVLPGELSCRFIRRCSSNSLLLLKDHFKGKSFRVKCSKDLGKIT  216
             + R+L +MG    ALQ+L         R C                +R K  K L K+ 
Sbjct  24   INFRYLLTMGASEAALQLLSA-------RNCGD--------------WRYKQIKGLKKLQ  62

Query  217  SSSKLCAVRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAP-----  360
              S L A R  + +        +  L  C C+  ER +E I +   G+S+H++ P     
Sbjct  63   DCSSLHAFRGLHSVFRGEKIYNRSNLSICNCQQPERVSETIIKGGNGKSMHTVPPKIPNL  122

Query  361  ----------NG--------QTSATVNN---ALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
                      NG        +T+A+VN+       SIE+EAW  LRA+MVYYCG+P+GTI
Sbjct  123  TPDEQNMKQENGARPFSEGFKTAASVNSRPRTNTESIEDEAWHFLRAAMVYYCGSPVGTI  182

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AANDP+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPG
Sbjct  183  AANDPSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPG  242

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRT+PL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  243  QGLMPASFKVRTIPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  288



>ref|XP_004251032.1| PREDICTED: alkaline/neutral invertase CINV1 [Solanum lycopersicum]
Length=672

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 356/380 (94%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMIL+LCLADG
Sbjct  294   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALL AREMLAPEEAS DL+ ALN+R
Sbjct  354   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNR  413

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPS+GGYL
Sbjct  414   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYL  473

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLA  DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  474   IGNLQPAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALE  533

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AERR++ D+
Sbjct  534   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDR  593

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAKLL+ANPEAAKM+I +EDTELLSAFSSIL
Sbjct  594   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSIL  653

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  654   SSNPRRKRSRKG-VKQSFII  672


 Score =   295 bits (754),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 202/293 (69%), Gaps = 43/293 (15%)
 Frame = +1

Query  43   FSIRFLASMGV--PALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSF---RVKCS  195
             + R+L +MG    ALQ+L GELSC+ +R  S    SNSLL  +  FK +++   R K  
Sbjct  24   INFRYLLTMGASEAALQLLSGELSCQ-VRTSSILAKSNSLLCYERCFKARNYGDWRYKQI  82

Query  196  KDLGKITSSSKLCAVRDFYG-------LEKPKLLRCYCRPAERGNERIFEDEQGRSVHSI  354
              + K+   S L A    +        L +  LL C C+  ER +E I +   G+S+H++
Sbjct  83   NSIKKLQDCSSLHAFHGLHSVFCGEKLLSQSNLLICNCQQPERVSETIIKGGNGKSMHTV  142

Query  355  AP---------------NG--------QTSATVNN---ALPNSIEEEAWDLLRASMVYYC  456
            +P               NG        +T+A+VN+       SIE+EAW  LRA+MVYYC
Sbjct  143  SPKIPNLAPDEQNMKQENGARPFSEGFKTAASVNSRPRTNTESIEDEAWHFLRAAMVYYC  202

Query  457  GNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKT  636
            G+P+GTIAANDP+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKT
Sbjct  203  GSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKT  262

Query  637  MDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MDCYSPGQGLMPASFKVRT+PL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  263  MDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  315



>ref|XP_006349097.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Solanum 
tuberosum]
Length=672

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 356/380 (94%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMIL+LCLADG
Sbjct  294   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILRLCLADG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL+YSALL AREMLAPEEAS DL+ ALN+R
Sbjct  354   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALYYSALLGAREMLAPEEASTDLVRALNNR  413

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWIDVKKLNEIYRYKTEEYSY+AINKFNIYPDQIPPWLV+WMPS+GGYL
Sbjct  414   LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYDAINKFNIYPDQIPPWLVEWMPSEGGYL  473

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLA  DQSHAILDLIEAKWEDLVA+MPLKICYPALE
Sbjct  474   IGNLQPAHMDFRFFSLGNVWSIVSSLANIDQSHAILDLIEAKWEDLVADMPLKICYPALE  533

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITGGDPKNTPWSYHN GSWPTLLWQL VA +KMKRPEIAE AIK+AERR++ D+
Sbjct  534   GQEWRIITGGDPKNTPWSYHNGGSWPTLLWQLTVACIKMKRPEIAEKAIKIAERRLSRDR  593

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RGGFIGKQARLFQTW+IAGYLVAKLL+ANPEAAKM+I +EDTELLSAFSSIL
Sbjct  594   WPEYYDTRRGGFIGKQARLFQTWTIAGYLVAKLLIANPEAAKMVINVEDTELLSAFSSIL  653

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKRSRKG VKQS+I+
Sbjct  654   SSNPRRKRSRKG-VKQSFII  672


 Score =   287 bits (735),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 160/293 (55%), Positives = 200/293 (68%), Gaps = 43/293 (15%)
 Frame = +1

Query  43   FSIRFLASMGV--PALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKS---FRVKCS  195
             + R+L +MG    ALQ+L G LS + +R  S    SNSLL  +  FK ++   +R K  
Sbjct  24   INFRYLLTMGASEAALQLLSGTLSFQ-VRTSSILAKSNSLLCYERCFKARNCGDWRYKQI  82

Query  196  KDLGKITSSSKLCAVRDFYGL-------EKPKLLRCYCRPAERGNERIFEDEQGRSVHSI  354
            K L K+   S L A R  + +        +  L  C C+  ER +E I +   G+S+H++
Sbjct  83   KGLKKLQDCSSLHAFRGLHSVFRGEKIYNRSNLSICNCQQPERVSETIIKGGNGKSMHTV  142

Query  355  AP---------------NG--------QTSATVNN---ALPNSIEEEAWDLLRASMVYYC  456
             P               NG        +T+A+VN+       SIE+EAW  LRA+MVYYC
Sbjct  143  PPKIPNLTPDEQNMKQENGARPFSEGFKTAASVNSRPRTNTESIEDEAWHFLRAAMVYYC  202

Query  457  GNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKT  636
            G+P+GTIAANDP+++++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKT
Sbjct  203  GSPVGTIAANDPSEATMLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKT  262

Query  637  MDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MDCYSPGQGLMPASFKVRT+PL+NDE+ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  263  MDCYSPGQGLMPASFKVRTIPLDNDESATEDVLDPDFGEAAIGRVAPVDSGLW  315



>emb|CBI17063.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/380 (82%), Positives = 344/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER DVQTG+KMILKLCLADG
Sbjct  163   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERFDVQTGIKMILKLCLADG  222

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S  LI ALN+R
Sbjct  223   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSSALIRALNNR  282

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             ++ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  283   VVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPSKGGYL  342

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHA+LDLIEAKW +LVA+MP KICYPA E
Sbjct  343   IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAMLDLIEAKWSELVADMPFKICYPAFE  402

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRI TG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIAE A+K+AE+RI+ DK
Sbjct  403   GQEWRITTGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAEKAVKIAEKRISRDK  462

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G FIGKQARLFQTWSIAGYLV+KLL+ANP+AA +L+  ED++L+SAFSS+L
Sbjct  463   WPEYYDTKQGRFIGKQARLFQTWSIAGYLVSKLLLANPDAANILVNREDSDLVSAFSSML  522

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR  KG +KQ +IV
Sbjct  523   SANPRRKRDWKG-LKQKFIV  541


 Score =   249 bits (637),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +1

Query  355  APNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            A  G  + T+  A  +SIE+EAW+LLR S+V+YCG PIGTIAANDP++SS LNYDQVFIR
Sbjct  38   AAGGTINDTLGKASIDSIEDEAWNLLRESIVFYCGYPIGTIAANDPSNSSSLNYDQVFIR  97

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVR+F+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D+
Sbjct  98   DFIPSGIAFLLKGEYDIVRSFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDD  157

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  158  SATEDVLDPDFGEAAIGRVAPVDSGLW  184



>gb|AGU19630.1| neutral/alkaline invertase 3 [Hevea brasiliensis]
Length=662

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/380 (83%), Positives = 344/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+LERIDVQTG+KMIL+LCLADG
Sbjct  284   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSILERIDVQTGIKMILRLCLADG  343

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  344   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  403

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP++GGYL
Sbjct  404   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNQGGYL  463

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VS LAT DQSHAILDLIEAKW DLVA MPLKICYPALE
Sbjct  464   IGNLQPAHMDFRFFSLGNLWSVVSGLATIDQSHAILDLIEAKWTDLVAGMPLKICYPALE  523

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A++VAER I+ DK
Sbjct  524   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVAGIKMNRPEIAARAVEVAERCISRDK  583

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARLFQTWSIAGYLVAKLL+A+P AAKMLIT ED EL++AFS ++
Sbjct  584   WPEYYDTKRARFIGKQARLFQTWSIAGYLVAKLLLADPSAAKMLITEEDPELVNAFSCMI  643

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  +KQ+YIV
Sbjct  644   SANPRRKRGRKN-LKQTYIV  662


 Score =   244 bits (623),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +SIE+EAWDLL  SMVYYCG+PIGTIAA DP  S++LNYDQVFIRDFIPSGIAFLLKGEY
Sbjct  174  DSIEDEAWDLLLNSMVYYCGSPIGTIAACDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEY  233

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAA
Sbjct  234  DIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAA  293

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  294  IGRVAPVDSGLW  305



>ref|XP_003632264.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
 ref|XP_010651714.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
Length=639

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/380 (82%), Positives = 344/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER DVQTG+KMILKLCLADG
Sbjct  261   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERFDVQTGIKMILKLCLADG  320

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S  LI ALN+R
Sbjct  321   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSSALIRALNNR  380

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             ++ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMPSKGGYL
Sbjct  381   VVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPSKGGYL  440

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHA+LDLIEAKW +LVA+MP KICYPA E
Sbjct  441   IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAMLDLIEAKWSELVADMPFKICYPAFE  500

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRI TG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIAE A+K+AE+RI+ DK
Sbjct  501   GQEWRITTGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAEKAVKIAEKRISRDK  560

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G FIGKQARLFQTWSIAGYLV+KLL+ANP+AA +L+  ED++L+SAFSS+L
Sbjct  561   WPEYYDTKQGRFIGKQARLFQTWSIAGYLVSKLLLANPDAANILVNREDSDLVSAFSSML  620

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR  KG +KQ +IV
Sbjct  621   SANPRRKRDWKG-LKQKFIV  639


 Score =   249 bits (637),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +1

Query  355  APNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            A  G  + T+  A  +SIE+EAW+LLR S+V+YCG PIGTIAANDP++SS LNYDQVFIR
Sbjct  136  AAGGTINDTLGKASIDSIEDEAWNLLRESIVFYCGYPIGTIAANDPSNSSSLNYDQVFIR  195

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVR+F+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D+
Sbjct  196  DFIPSGIAFLLKGEYDIVRSFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDD  255

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  256  SATEDVLDPDFGEAAIGRVAPVDSGLW  282



>gb|AFP23358.1| neutral invertase [Litchi chinensis]
Length=650

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/380 (82%), Positives = 347/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  272   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  331

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCM+DRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  332   FDMFPTLLVTDGSCMVDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  391

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  392   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  451

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLI+ KW DLVA+MPLKICYPALE
Sbjct  452   IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIDTKWADLVADMPLKICYPALE  511

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEI+  A++VAER+I+ DK
Sbjct  512   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEISARAVQVAERQISRDK  571

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARLFQTWSIAGYLVAKLL+A+P AAK+LIT ED+EL+++FS ++
Sbjct  572   WPEYYDTKRARFIGKQARLFQTWSIAGYLVAKLLLADPSAAKILITEEDSELVNSFSCMI  631

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK + KQ+YIV
Sbjct  632   SANPRRKRGRKDS-KQTYIV  650


 Score =   256 bits (653),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 144/164 (88%), Gaps = 2/164 (1%)
 Frame = +1

Query  304  GNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAA  483
            G ++  ++++G + + +   G+   TV+ A  NSIE+EAWDLLR SMVYYCG+PIGTIAA
Sbjct  132  GVQQFEQEKKGLTSNGVVGTGR--ETVHKASVNSIEDEAWDLLRDSMVYYCGSPIGTIAA  189

Query  484  NDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQG  663
            NDP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQG
Sbjct  190  NDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQG  249

Query  664  LMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            LMPASFKV TVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  250  LMPASFKVCTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  293



>ref|XP_010535668.1| PREDICTED: alkaline/neutral invertase CINV1 [Tarenaya hassleriana]
Length=637

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 342/380 (90%), Gaps = 4/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GD S+ ER+DVQTG+KMILKLCLADG
Sbjct  258   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDHSVQERVDVQTGIKMILKLCLADG  317

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  318   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  377

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  378   LVALSFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  437

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILDLIEAKW +LVA+MP KICYPALE
Sbjct  438   IGNLQPAHMDFRFFSLGNLWSIVSSLATNDQSHAILDLIEAKWAELVADMPFKICYPALE  497

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VA +KM+RPEIAE A+++AERRIA DK
Sbjct  498   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVACIKMERPEIAEKAVELAERRIARDK  557

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ NP AAK L   ED++L SAFSSI+
Sbjct  558   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLENPSAAKFLSNEEDSDLKSAFSSII  617

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RKGA KQS+IV
Sbjct  618   SANPRRKRGRKGANKQSFIV  637


 Score =   254 bits (648),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 134/154 (87%), Gaps = 5/154 (3%)
 Frame = +1

Query  349  SIAPNGQTSATVN-----NALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
            S A NG   +  N      A   SIEEEAWDLLR S+VYYCGNPIGTIAANDPN SS+LN
Sbjct  126  SFASNGNAQSVGNVGAAHMAYTKSIEEEAWDLLRESVVYYCGNPIGTIAANDPNSSSVLN  185

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRT
Sbjct  186  YDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRT  245

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ D++ TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  246  VPLDGDDSMTEEVLDPDFGEAAIGRVAPVDSGLW  279



>ref|XP_007221417.1| hypothetical protein PRUPE_ppa002625mg [Prunus persica]
 gb|EMJ22616.1| hypothetical protein PRUPE_ppa002625mg [Prunus persica]
Length=651

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 347/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  273   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  332

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSALLCAREMLAPE+ S+DLI ALN+R
Sbjct  333   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALLCAREMLAPEDGSVDLIRALNNR  392

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI  WLV+WMP+KGGYL
Sbjct  393   LVALSFHIREYYWVDLKKLNEIYRYKTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYL  452

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS++SS+ATTDQSHAILDLIE+KW DLVA+MP KICYPALE
Sbjct  453   IGNLQPAHMDFRFFSLGNLWSVISSIATTDQSHAILDLIESKWGDLVADMPFKICYPALE  512

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VAS+KM RPEIA  A++VAE+RI+ DK
Sbjct  513   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVASIKMNRPEIAAKAVEVAEKRISRDK  572

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQARLFQTWSIAGYLVAKLL+A+P  AK+L T ED+EL++AFS ++
Sbjct  573   WPEYYDTKRGRFIGKQARLFQTWSIAGYLVAKLLLADPSKAKILTTEEDSELVNAFSCMI  632

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  +KQ+YIV
Sbjct  633   SANPRRKRGRKD-LKQTYIV  651


 Score =   254 bits (648),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 142/165 (86%), Gaps = 7/165 (4%)
 Frame = +1

Query  319  FEDEQ--GRSVHSIAPNGQTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIA  480
            F+D Q   +    + PNG T+ TV +A      +S+E+EAWDLLR SMVYYCG+P+GTIA
Sbjct  131  FQDVQQLKQEKEGLPPNG-TNGTVRDAFHKISVDSLEDEAWDLLRESMVYYCGSPVGTIA  189

Query  481  ANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQ  660
            A DP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQ
Sbjct  190  AKDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQ  249

Query  661  GLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            GLMPASFKVRTVPL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  250  GLMPASFKVRTVPLDGDESATEEVLDPDFGEAAIGRVAPVDSGLW  294



>emb|CDP06959.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/380 (82%), Positives = 344/380 (91%), Gaps = 6/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  263   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKFSGDLSVQERVDVQTGIKMILKLCLADG  322

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PEEAS DLI ALN+R
Sbjct  323   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLVPEEASADLIRALNNR  382

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRY TEEYSY+A+NKFNIYPDQIPPWLV+WMP+ GGY 
Sbjct  383   LVALSFHIREYYWIDMRKLNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLVEWMPTTGGYF  442

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSI+SSLATTDQSHAILDLIEAKWED+VANMPLKICYPALE
Sbjct  443   IGNLQPAHMDFRFFSLGNLWSIISSLATTDQSHAILDLIEAKWEDIVANMPLKICYPALE  502

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EW+IITG DPKNTPWSYHNAG+WPTLLWQL VA +KM RPEIAENAIKVAERRIA DK
Sbjct  503   GEEWQIITGYDPKNTPWSYHNAGAWPTLLWQLTVACIKMNRPEIAENAIKVAERRIARDK  562

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK   FIGKQARLFQTWSIAGYLVAKLL++NP+AAK LI +ED+EL++A S  L
Sbjct  563   WPEYYDTKGARFIGKQARLFQTWSIAGYLVAKLLISNPKAAKKLINVEDSELVNALSYAL  622

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANP+++  RK  +KQSYI+
Sbjct  623   SANPKKRPRRK--LKQSYII  640


 Score =   264 bits (675),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 184/281 (65%), Gaps = 42/281 (15%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSFR-VKCSKDLGKITSSSKL----  231
            ++Q++ G + C +    S    S+S   +K++ KGK  + + C +  G +     L    
Sbjct  4    SIQLVFGAVPCHYTTAKSYFTRSSSYFSVKNYVKGKWDKDILCEQLKGPVDFQGCLRVQG  63

Query  232  -CAVRDFYGLEKP----KLLRCYCRPAERGNERIFEDEQGRSVHS---------------  351
              A+   Y + KP    + L C C+  E  ++ I E   G+SV+                
Sbjct  64   RGAISRLYSVGKPNRRLETLSCKCQRTESVSQAIVEVGSGKSVNGMSEPSSLQSLEGPKL  123

Query  352  -------------IAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDP  492
                         IA   + S T+     NSIE+EAW+LLRAS+VYYCGNPIGTIAANDP
Sbjct  124  LNNEKTVISSDDEIAAASEMSDTLQGFGINSIEDEAWNLLRASIVYYCGNPIGTIAANDP  183

Query  493  NDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMP  672
            + ++ILNYDQ+FIRDFIPSG+AFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMP
Sbjct  184  SAANILNYDQIFIRDFIPSGMAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMP  243

Query  673  ASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ASFKVRTVPL+ D++ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  244  ASFKVRTVPLDGDDSATEDVLDPDFGEAAIGRVAPVDSGLW  284



>ref|XP_011090015.1| PREDICTED: alkaline/neutral invertase CINV1 [Sesamum indicum]
Length=634

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/380 (82%), Positives = 340/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  256   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  315

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+AS DL+ ALN+R
Sbjct  316   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLVRALNNR  375

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALS HIREYYWID+KKLNEIYRYKTEEYS++A+NKFNIYPDQIPPWLV+WMP+KGGYL
Sbjct  376   LVALSIHIREYYWIDMKKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEWMPNKGGYL  435

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IV SLAT DQSHAILDLIEAKW DLVA+MPLKICYPALE
Sbjct  436   IGNLQPAHMDFRFFSLGNLWAIVCSLATADQSHAILDLIEAKWSDLVADMPLKICYPALE  495

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTL+WQL VA +KM RPEIAE AI+ AE+R+A DK
Sbjct  496   GQEWRIITGSDPKNTPWSYHNGGSWPTLIWQLTVACIKMNRPEIAEKAIRAAEKRLARDK  555

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYD+K   FIGKQA LFQTWSIAGYLVAKLL+ANP AA +LI +ED ELLS FS  L
Sbjct  556   WPEYYDSKGARFIGKQAHLFQTWSIAGYLVAKLLIANPSAANILINMEDAELLSVFSWAL  615

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             +ANPR KRSRKG  KQS+I+
Sbjct  616   NANPRGKRSRKGP-KQSFII  634


 Score =   265 bits (676),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 180/271 (66%), Gaps = 32/271 (12%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRRCSSNSLLLLKDHFKGKSFRVKCSKDLGKITSSSKLCAVRD--FY  252
            ALQVL G +  +      S SLL  K  FK +    + ++ + +I + S +    D  F 
Sbjct  7    ALQVLFGAVPSQTYTNLRSTSLLSCKYSFKSQKCTSQKARGIFRIYAGSHVIRKTDGTFR  66

Query  253  GLE--KPKLLRCYCRPAER--------GNERI--------------------FEDEQGRS  342
            G +  + K LRC C  AE         G++ +                    +E E   S
Sbjct  67   GGQNNQSKPLRCNCTGAESVWEASRDDGSKGVVNGVAKDLDNQSLEATQHFKYEKEDLLS  126

Query  343  VHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQ  522
               +A +     T + A  NS+E+EAW+LLRASMVYYCGNP+GTIAANDP+DS+ LNYDQ
Sbjct  127  NDKLASDTAVGKTFSGAGANSLEDEAWNLLRASMVYYCGNPVGTIAANDPSDSNTLNYDQ  186

Query  523  VFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  702
            VFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPL
Sbjct  187  VFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPL  246

Query  703  ENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  247  DGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  277



>gb|KDP45002.1| hypothetical protein JCGZ_01502 [Jatropha curcas]
Length=665

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 345/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  287   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADG  346

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  347   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  406

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++K+NEIYRYKTEEYSY+A+NKFNIYPDQIPPWLVDWMP++GGYL
Sbjct  407   LVALSFHIREYYWIDLRKVNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVDWMPTRGGYL  466

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWS+VSSLAT DQSHAILDL+EAKW DLVA+MP KICYPALE
Sbjct  467   IGNLQPAHMDFRFFTLGNLWSVVSSLATADQSHAILDLLEAKWTDLVADMPFKICYPALE  526

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A++VAERRI+ DK
Sbjct  527   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVEVAERRISRDK  586

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR   IGKQARLFQTWSIAGYLVAK+L+A+P AAKMLIT ED+EL++AFS ++
Sbjct  587   WPEYYDTKRARLIGKQARLFQTWSIAGYLVAKILLADPSAAKMLITEEDSELVNAFSCMI  646

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR +K  +K++YIV
Sbjct  647   SANPRRKRGQKN-LKKTYIV  665


 Score =   245 bits (626),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 5/154 (3%)
 Frame = +1

Query  349  SIAPNGQTSA---TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPN--DSSILN  513
            S++ NG       T N    +SIE+EAWDLLR S+VYYCG+PIGTIAANDP    S++LN
Sbjct  155  SLSTNGAAVIDRDTSNKVSIDSIEDEAWDLLRDSVVYYCGSPIGTIAANDPTCPTSNLLN  214

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT
Sbjct  215  YDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRT  274

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  275  VPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  308



>gb|KDO46928.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
Length=410

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL + ERIDVQTG+KMILKLCLADG
Sbjct  32    VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQTGIKMILKLCLADG  91

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  92    FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  151

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMP+KGGYL
Sbjct  152   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPNKGGYL  211

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIV+ LAT DQSHAILDL+EAKW DLVA+MPLKICYPALE
Sbjct  212   IGNLQPAHMDFRFFSLGNIWSIVNGLATRDQSHAILDLMEAKWADLVADMPLKICYPALE  271

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQ  VA +KM RPEIA  A++VAE+R++ DK
Sbjct  272   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAARAVQVAEKRLSRDK  331

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+LFQTWSIAGYLV+K+L+A+P AAK+L T ED+EL++AFS ++
Sbjct  332   WPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTTEEDSELVNAFSCMI  391

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  + Q+YI+
Sbjct  392   SANPRRKRGRKN-LNQTYII  410


 Score =   102 bits (253),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = +1

Query  637  MDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  1    MDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  53



>ref|XP_010658734.1| PREDICTED: alkaline/neutral invertase CINV1-like [Vitis vinifera]
Length=651

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/380 (81%), Positives = 345/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  273   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADG  332

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  333   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  392

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  393   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  452

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSI+SSLAT DQSHAILDL+EAKW DLVA+MPLKICYPALE
Sbjct  453   IGNLQPAHMDFRFFSLGNLWSIISSLATMDQSHAILDLVEAKWGDLVADMPLKICYPALE  512

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RP+IA  A+++AERRIA DK
Sbjct  513   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMDRPQIAAKAVEIAERRIARDK  572

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQA LFQTWSIAGYLVAKLL+++P AAK+LIT ED+EL++AFS ++
Sbjct  573   WPEYYDTKKARFIGKQACLFQTWSIAGYLVAKLLLSDPTAAKILITEEDSELVNAFSCMI  632

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK +  Q++IV
Sbjct  633   SANPRRKRGRKSST-QTFIV  651


 Score =   255 bits (651),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 177/287 (62%), Gaps = 49/287 (17%)
 Frame = +1

Query  79   ALQVLPGELSCRFIRR---CSSNSLLLLKDHFK-----GKSFRVKCSKDLGKITSSSKLC  234
             LQV  G + C F        S+S+   K H K     G  + +KCS  +     + +L 
Sbjct  9    VLQVFSGAVPCLFGSDPCFSKSDSMSPFKSHIKSVKKRGSRYMLKCSYMIRSHIMTHRLH  68

Query  235  AVRD-FYG---LEKPKLLRCYCRPA--------ERGNERIFEDEQGR-------------  339
             V    YG   + + +L  C C+ A        E GN   F D   +             
Sbjct  69   GVGGGLYGNTSIHRSQLQSCKCQRADSVSGIASEAGNGTWFVDNAKKRNPINGVMDTPNV  128

Query  340  ----SVHSIAPNGQTSATVNNALP-----------NSIEEEAWDLLRASMVYYCGNPIGT  474
                 V  + P  + S + N A+            +SIE+EAWDLLR SMVYYCG+PIGT
Sbjct  129  LEFQDVQELKPEMEGSIS-NGAVETARDTFVKVRVDSIEDEAWDLLRESMVYYCGSPIGT  187

Query  475  IAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSP  654
            IAA DP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SP
Sbjct  188  IAAKDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSP  247

Query  655  GQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            GQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  248  GQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  294



>ref|XP_010088753.1| hypothetical protein L484_018310 [Morus notabilis]
 gb|EXB36936.1| hypothetical protein L484_018310 [Morus notabilis]
Length=585

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/380 (82%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  207   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  266

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  267   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  326

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMPSKGGYL
Sbjct  327   LLALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPSKGGYL  386

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDLIEAKW+DLVA+MP KICYPALE
Sbjct  387   IGNLQPAHMDFRFFSLGNLWSIVSSLATMNQSHAILDLIEAKWDDLVADMPFKICYPALE  446

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G EW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A+ VAE+ I+ DK
Sbjct  447   GMEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAAKAVDVAEKHISRDK  506

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA L+QTWSIAGYLVAKLL+A+P  A+MLIT ED+EL++AFS ++
Sbjct  507   WPEYYDTKRARFIGKQAHLYQTWSIAGYLVAKLLLADPSKARMLITEEDSELVNAFSCMV  566

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK +  Q+YIV
Sbjct  567   SANPRRKRGRKTST-QTYIV  585


 Score =   244 bits (623),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 150/214 (70%), Gaps = 36/214 (17%)
 Frame = +1

Query  262  KPKLLRCYCRPAERGNERIFEDEQG----------RSVHSI--APN--------------  363
            +P L  C C P+ER +    ED  G           +++ +   PN              
Sbjct  15   RPSLQSCKCHPSERVSGITAEDVNGTWFVDNANKLNTINGVVNGPNVLEFQDVQQSKQEK  74

Query  364  -GQTSATVNNALP---------NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
             G TS   N  +          +SIE+EAW+LLR S+VYYCG+PIGTIAA DP  S++LN
Sbjct  75   DGLTSNGANGTVVRDEFRKISVDSIEDEAWNLLRDSVVYYCGSPIGTIAATDPTSSNVLN  134

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIP+GIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT
Sbjct  135  YDQVFIRDFIPAGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRT  194

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ D +ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  195  VPLDGDGSATEEVLDPDFGEAAIGRVAPVDSGLW  228



>ref|XP_009356115.1| PREDICTED: alkaline/neutral invertase CINV1-like [Pyrus x bretschneideri]
 ref|XP_009356116.1| PREDICTED: alkaline/neutral invertase CINV1-like [Pyrus x bretschneideri]
Length=652

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 345/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  274   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  334   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI  WLV+WMP+KGGYL
Sbjct  394   LVALSFHIREYYWVDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSS+ATTDQSHAILDLIEAKW DLVA+MP KICYPAL+
Sbjct  454   IGNLQPAHMDFRFFSLGNLWSVVSSVATTDQSHAILDLIEAKWGDLVADMPFKICYPALD  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A+++AE+RI+ DK
Sbjct  514   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMDRPEIAAKAVEIAEKRISRDK  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G F+GKQARLFQTWSIAGYLVAKLL+A+P  AK+LIT ED+EL++AFS ++
Sbjct  574   WPEYYDTKKGRFVGKQARLFQTWSIAGYLVAKLLLADPSKAKILITEEDSELVNAFSCMI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  +KQ+YIV
Sbjct  634   SANPRRKRDRKN-LKQTYIV  652


 Score =   251 bits (640),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 7/165 (4%)
 Frame = +1

Query  319  FED--EQGRSVHSIAPNGQTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIA  480
            F+D  E  +    + PNG T+ TV +A      +S+E+EAWDLLR SMVYYCG+P+GTIA
Sbjct  132  FQDIQELKQEKEGLPPNG-TNGTVRDAFHKTSIDSLEDEAWDLLRESMVYYCGSPVGTIA  190

Query  481  ANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQ  660
            A DP  S+ LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQ
Sbjct  191  AKDPTSSNTLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQ  250

Query  661  GLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            GLMPASFKVRTVPL+ DE+ TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  251  GLMPASFKVRTVPLDGDESTTEEVLDPDFGEAAIGRVAPVDSGLW  295



>ref|XP_002529075.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF33319.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=634

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 344/380 (91%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  256   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  315

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+AS+DLI ALN+R
Sbjct  316   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASVDLIRALNNR  375

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV++MP++GGYL
Sbjct  376   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEFMPNRGGYL  435

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILDLIEAKW++LVA MP KICYPALE
Sbjct  436   IGNLQPAHMDFRFFSLGNLWSIVSSLATVDQSHAILDLIEAKWKELVAEMPFKICYPALE  495

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA ++MKRPEIAE A+K+AERRI+ DK
Sbjct  496   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIRMKRPEIAEKAVKLAERRISRDK  555

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARLFQTWSIAGYLVAKLL+ NP AAK+L+  ED ELL+ FS ++
Sbjct  556   WPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLLLDNPSAAKILVNEEDPELLNTFSYMI  615

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             +A+PRRKR R G+ K+ +IV
Sbjct  616   NASPRRKRGRVGS-KRPFIV  634


 Score =   252 bits (643),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +1

Query  376  ATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGI  555
              V+ A   SI+EEAWDLLRAS+VYYC NPIGTIAANDP+D+SILNYDQVFIRDFIPSGI
Sbjct  138  GNVDTAARESIDEEAWDLLRASIVYYCSNPIGTIAANDPSDTSILNYDQVFIRDFIPSGI  197

Query  556  AFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVL  735
            AFLLKGE+DIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRT+PL+ D++A+EDVL
Sbjct  198  AFLLKGEFDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDDSASEDVL  257

Query  736  DPDFGEAAIGRVAPVDSGMF  795
            DPDFGEAAIGRVAPVDSG++
Sbjct  258  DPDFGEAAIGRVAPVDSGLW  277



>gb|KDP34707.1| hypothetical protein JCGZ_10912 [Jatropha curcas]
Length=646

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  268   ILDPDFGESAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  327

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  328   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  387

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV++MP++GGYL
Sbjct  388   LVALSFHIREYYWIDRRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEFMPNRGGYL  447

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSI+SSLAT DQSHAILDLIEAKW +LVA MPLKICYPALE
Sbjct  448   IGNLQPAHMDFRFFSLGNLWSIISSLATVDQSHAILDLIEAKWPELVAEMPLKICYPALE  507

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA VKM RPEIAE A+K+AERRI+ D 
Sbjct  508   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACVKMNRPEIAEKAVKIAERRISRDN  567

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARLFQTWSIAGYLVAKL++ NP AAK+++  ED+ELL+ FS ++
Sbjct  568   WPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLILENPSAAKIVVNEEDSELLTTFSYMM  627

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             +ANPRRKRSR G  KQ ++V
Sbjct  628   NANPRRKRSRPG-FKQPFVV  646


 Score =   253 bits (645),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 6/153 (4%)
 Frame = +1

Query  355  APNGQTSA------TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNY  516
             PNG   A      T+  A   SIEEEAW+ LRAS+VYYC NPIGTIAANDP+D+SILNY
Sbjct  137  TPNGNVDAAGTVRDTLQKACRESIEEEAWNQLRASIVYYCSNPIGTIAANDPSDASILNY  196

Query  517  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV  696
            DQVFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRTV
Sbjct  197  DQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTV  256

Query  697  PLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PL+ D++ATED+LDPDFGE+AIGRVAPVDSG++
Sbjct  257  PLDGDDSATEDILDPDFGESAIGRVAPVDSGLW  289



>gb|KHG04215.1| hypothetical protein F383_30053 [Gossypium arboreum]
Length=620

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/380 (81%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  242   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  301

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  302   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  361

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV++MPS+GGYL
Sbjct  362   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEFMPSRGGYL  421

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV  LAT DQSHAILDL+E KW +LVA+MPLKICYPALE
Sbjct  422   IGNLQPAHMDFRFFSLGNLWSIVGGLATVDQSHAILDLVEEKWSELVADMPLKICYPALE  481

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNT WSYHN GSWPTLLWQL VA +KM RPEIAE A+ +AERR++ DK
Sbjct  482   GQEWRIITGSDPKNTAWSYHNGGSWPTLLWQLTVACMKMNRPEIAEKAVMLAERRLSRDK  541

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+R  FIGKQ+RLFQTWSIAGYLVAKLL+ANP AAK+LIT ED+EL++AFS +L
Sbjct  542   WPEYYDTRRARFIGKQSRLFQTWSIAGYLVAKLLLANPSAAKVLITEEDSELVNAFSCML  601

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RKG  KQ +I+
Sbjct  602   SANPRRKRGRKG-FKQPFII  620


 Score =   248 bits (632),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 6/163 (4%)
 Frame = +1

Query  307  NERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAAN  486
            NE +  D +G        +G T+          IEEEAWDLL+ S+VYYCGNPIGTIAA+
Sbjct  107  NELLQSDGEG------VASGDTNGGGTVGGRKGIEEEAWDLLKESVVYYCGNPIGTIAAS  160

Query  487  DPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGL  666
            D + SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGL
Sbjct  161  DTSSSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGL  220

Query  667  MPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MPASFKVRTVPL+ D + TEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  221  MPASFKVRTVPLDGDNSVTEDVLDPDFGEAAIGRVAPVDSGLW  263



>ref|XP_010244028.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
 ref|XP_010244036.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nelumbo nucifera]
Length=659

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/380 (81%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  281   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  340

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+AS DL+ ALN+R
Sbjct  341   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNR  400

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIR YYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P+KGGYL
Sbjct  401   LLALSFHIRNYYWVDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPNKGGYL  460

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKW DLV +MP KICYPALE
Sbjct  461   IGNLQPAHMDFRFFALGNLWSIVSSLATMDQSHAILDLIEAKWTDLVGHMPFKICYPALE  520

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHNAGSWPTLLWQL VA +KM R +IA  A++VAE+RI+ D+
Sbjct  521   GQEWRIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRSDIAAKAVEVAEKRISKDR  580

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK   FIGKQARLFQTWSIAGYLVAKLL+ANP AAK+LI  ED EL++A S I+
Sbjct  581   WPEYYDTKSARFIGKQARLFQTWSIAGYLVAKLLLANPSAAKILINEEDQELVNALSCII  640

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              ANP+RKR RKG +KQSYIV
Sbjct  641   GANPKRKRGRKG-MKQSYIV  659


 Score =   246 bits (629),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAW+LL  SMVYYCG+PIGTIAA DP DS+ LNYDQVFIRDFIPSG+AFLLKGEY
Sbjct  171  DSLEDEAWNLLHDSMVYYCGSPIGTIAAKDPTDSNALNYDQVFIRDFIPSGMAFLLKGEY  230

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPLE D++ATEDVLDPDFGEAA
Sbjct  231  DIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLEGDDSATEDVLDPDFGEAA  290

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  291  IGRVAPVDSGLW  302



>gb|AFH77954.1| neutral/alkaline invertase [Manihot esculenta]
Length=663

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/380 (82%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCL+DG
Sbjct  285   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLSDG  344

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI AL +R
Sbjct  345   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALTNR  404

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV W+P++GGYL
Sbjct  405   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVKWIPNQGGYL  464

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VS LATT+QSHAILDLIEAKW DLVA+MPLKICYPALE
Sbjct  465   IGNLQPAHMDFRFFSLGNLWSVVSGLATTEQSHAILDLIEAKWIDLVADMPLKICYPALE  524

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  AI VAERRI+ DK
Sbjct  525   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAIGVAERRISWDK  584

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARLFQTWSIAGYLVAKLL+A+P AAKMLIT ED EL++AFS ++
Sbjct  585   WPEYYDTKRARFIGKQARLFQTWSIAGYLVAKLLLADPSAAKMLITEEDPELVNAFSCMI  644

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR+R RK + KQ+YIV
Sbjct  645   SANPRRQRGRKNS-KQTYIV  663


 Score =   244 bits (623),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  385  NNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFL  564
            N    +SIE+EAW+LL  S+VYYCG+PIGTIAANDP  S++LNYDQVFIRDFIPSGIAFL
Sbjct  170  NKVTVDSIEDEAWNLLLNSVVYYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFL  229

Query  565  LKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPD  744
            LKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D+++TE+VLDPD
Sbjct  230  LKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSSTEEVLDPD  289

Query  745  FGEAAIGRVAPVDSGMF  795
            FGEAAIGRVAPVDSG++
Sbjct  290  FGEAAIGRVAPVDSGLW  306



>ref|XP_008345689.1| PREDICTED: alkaline/neutral invertase CINV1-like [Malus domestica]
 ref|XP_008345695.1| PREDICTED: alkaline/neutral invertase CINV1-like [Malus domestica]
Length=652

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LC+ADG
Sbjct  274   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCIADG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  334   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI  WLV+WMP+KGGYL
Sbjct  394   LVALSFHIREYYWVDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSS+ATTDQSHAILDLIE KW DLVA+MP KICYPAL+
Sbjct  454   IGNLQPAHMDFRFFSLGNLWSVVSSIATTDQSHAILDLIETKWGDLVADMPFKICYPALD  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A+++AE+RI+ DK
Sbjct  514   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMDRPEIAAKAVEIAEKRISRDK  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG F+GKQARLFQTWSIAGYLVAKLL+A+P  AK+LIT ED+EL++AFS ++
Sbjct  574   WPEYYDTKRGRFVGKQARLFQTWSIAGYLVAKLLLADPSKAKILITEEDSELVNAFSCMI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              ANPRRKR RK  +KQ+YIV
Sbjct  634   GANPRRKRGRKN-LKQTYIV  652


 Score =   252 bits (644),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/279 (51%), Positives = 176/279 (63%), Gaps = 54/279 (19%)
 Frame = +1

Query  121  RRCSSNSLLL-----LKDHFKGKSFRVKCSKDLGKITSSSKLCAVRD----FYGLEK---  264
            R CS++S        +   ++GK  + + S+D+     SS +  +R      +G+     
Sbjct  17   RLCSTDSCFXKCSPAISSKYRGKCTKRRVSRDMQMQLLSSXMQQIRTGNYRLHGIRSGLF  76

Query  265  -------PKLLRCYCRPAERGNERIFEDEQG-------RSVHSI-----APNG-------  366
                     +L C C  AE  +    +DE G       +  ++I     +PNG       
Sbjct  77   GKMTVGDSWILSCKCEQAESISGSTTKDENGTWFVDSTKKFNTINNVVNSPNGLGFQDIQ  136

Query  367  ------------QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
                         T+ TV +A      +S+E+EAWDLLR SMVYYCG+P+GTIAA DP  
Sbjct  137  ELKQEKEGLPANGTNGTVRDAFHKTSIDSLEDEAWDLLRESMVYYCGSPVGTIAAKDPTS  196

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
            S+ LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  197  SNTLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  256

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  257  FKVRTVPLDGDESATEEVLDPDFGEAAIGRVAPVDSGLW  295



>ref|XP_006492196.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Citrus 
sinensis]
Length=650

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL + ERIDVQTG+KMILKLCLADG
Sbjct  272   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQTGIKMILKLCLADG  331

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  332   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  391

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMP+KGGYL
Sbjct  392   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPNKGGYL  451

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIV+ LAT DQSHAILDL+EAKW DLVA+MPLKICYPALE
Sbjct  452   IGNLQPAHMDFRFFSLGNIWSIVNGLATRDQSHAILDLMEAKWADLVADMPLKICYPALE  511

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQ  VA +KM RPEIA  A++VAE+R++ DK
Sbjct  512   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAARAVQVAEKRLSRDK  571

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+LFQTWSIAGYLV+K+L+A+P AAK+L T ED+EL++AFS ++
Sbjct  572   WPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTTEEDSELVNAFSCMI  631

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  + Q+YIV
Sbjct  632   SANPRRKRGRKN-LNQTYIV  650


 Score =   254 bits (648),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  319  FEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
            FE E+ +S  S    G T  +V+ A  + +E+EAW+LLR SMVYYCG+PIGTIAANDP  
Sbjct  136  FEQEK-KSFTSNGAAGTTIDSVSKATVDCLEDEAWNLLRDSMVYYCGSPIGTIAANDPTA  194

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
            S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  195  SNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  254

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  255  FKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  293



>gb|KDO46923.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46924.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46925.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46926.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
 gb|KDO46927.1| hypothetical protein CISIN_1g006329mg [Citrus sinensis]
Length=650

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL + ERIDVQTG+KMILKLCLADG
Sbjct  272   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQTGIKMILKLCLADG  331

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  332   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  391

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMP+KGGYL
Sbjct  392   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPNKGGYL  451

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIV+ LAT DQSHAILDL+EAKW DLVA+MPLKICYPALE
Sbjct  452   IGNLQPAHMDFRFFSLGNIWSIVNGLATRDQSHAILDLMEAKWADLVADMPLKICYPALE  511

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQ  VA +KM RPEIA  A++VAE+R++ DK
Sbjct  512   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAARAVQVAEKRLSRDK  571

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+LFQTWSIAGYLV+K+L+A+P AAK+L T ED+EL++AFS ++
Sbjct  572   WPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTTEEDSELVNAFSCMI  631

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR RK  + Q+YI+
Sbjct  632   SANPRRKRGRKN-LNQTYII  650


 Score =   254 bits (649),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  319  FEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
            FE E+ +S  S    G T  +V+ A  + +E+EAW+LLR SMVYYCG+PIGTIAANDP  
Sbjct  136  FEQEK-KSFTSNGAAGTTIDSVSKATVDCLEDEAWNLLRDSMVYYCGSPIGTIAANDPTS  194

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
            S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  195  SNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  254

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  255  FKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  293



>ref|XP_007015893.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY33512.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
Length=623

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  245   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  304

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLA E+ S DLI ALN+R
Sbjct  305   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLASEDGSADLIRALNNR  364

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYS++A+NKFNIYPDQIPPWLV++MP++GGYL
Sbjct  365   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEFMPARGGYL  424

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SLAT DQSHAILDL+EAKW +LVA+MPLKICYPALE
Sbjct  425   IGNLQPAHMDFRFFSLGNLWSIVGSLATVDQSHAILDLVEAKWSELVADMPLKICYPALE  484

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+AE A+ +AERRI  DK
Sbjct  485   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEVAEKAVMLAERRICRDK  544

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+R  FIGKQ+RLFQTWSIAGYLVAKLL+ANP AAK+LI  ED +L++AFS +L
Sbjct  545   WPEYYDTRRARFIGKQSRLFQTWSIAGYLVAKLLLANPSAAKILINEEDADLVNAFSCML  604

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR+KR +KG  KQ +++
Sbjct  605   SANPRKKRGQKG-FKQPFLI  623


 Score =   243 bits (621),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 149/202 (74%), Gaps = 34/202 (17%)
 Frame = +1

Query  277  RCYCRPAERGNERIFEDEQGRSVHSIAPNGQTSATVNNALP-------------------  399
            RC C+ A+  +E   +D  GR   S++ NG+T+  VNNA                     
Sbjct  70   RCKCQKADSISEVTADD--GRPT-SLSINGRTN--VNNAQEFELNQLLKSDKEGFANGDT  124

Query  400  ----------NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPS  549
                       SIEEEAWDLL+ S+VYYCGNPIGTIAA+D + SSILNYDQVFIRDFIPS
Sbjct  125  NGVGTVIDSRKSIEEEAWDLLKESVVYYCGNPIGTIAASDTSSSSILNYDQVFIRDFIPS  184

Query  550  GIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATED  729
            GIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRTVP + D++ TED
Sbjct  185  GIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPRDGDDSVTED  244

Query  730  VLDPDFGEAAIGRVAPVDSGMF  795
            VLDPDFGEAAIGRVAPVDSG++
Sbjct  245  VLDPDFGEAAIGRVAPVDSGLW  266



>ref|XP_010686069.1| PREDICTED: alkaline/neutral invertase CINV1 [Beta vulgaris subsp. 
vulgaris]
Length=617

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/382 (82%), Positives = 341/382 (89%), Gaps = 9/382 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMILKLCLADG
Sbjct  239   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLCLADG  298

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SAL CAREML PE+ S DLI ALNSR
Sbjct  299   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALRCAREMLTPEDGSADLIRALNSR  358

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYW+D++KLNEIYRYKTEEYS++A+NKFNIYPDQIPPWLVDWMP KGGYL
Sbjct  359   LLALSFHIREYYWLDMRKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVDWMPEKGGYL  418

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN WSIVSSLAT+ QSHAILDL EAKW DLVA+MP+KICYPALE
Sbjct  419   IGNLQPAHMDFRFFSLGNFWSIVSSLATSGQSHAILDLFEAKWVDLVADMPIKICYPALE  478

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEWRI+TGGDPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIAE A+KVAERRI+ D+
Sbjct  479   DQEWRIVTGGDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAEKAVKVAERRISKDR  538

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK   FIGKQ+ LFQTWSIAGYLVAKLL+ANPE AK+LI  ED+EL++AFSS++
Sbjct  539   WPEYYDTKGARFIGKQSHLFQTWSIAGYLVAKLLLANPEKAKILINEEDSELVNAFSSLI  598

Query  1890  SANPR-RKRSRKG-AVKQSYIV  1949
                PR RKRSRKG  VKQSYI+
Sbjct  599   ---PRGRKRSRKGVGVKQSYII  617


 Score =   231 bits (590),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAW+LL  S+V YCG+P+GTIAANDP  +SILNYDQVFIRDF+PS IAFLLK +Y
Sbjct  129  DSLEDEAWELLNESIVNYCGSPVGTIAANDPTSTSILNYDQVFIRDFVPSAIAFLLKDDY  188

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            DIVRNFLL+TLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAA
Sbjct  189  DIVRNFLLNTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAA  248

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  249  IGRVAPVDSGLW  260



>emb|CAD19320.1| neutral invertase [Beta vulgaris]
Length=617

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/382 (81%), Positives = 340/382 (89%), Gaps = 9/382 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ER+DVQTGMKMILKLCLADG
Sbjct  239   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERVDVQTGMKMILKLCLADG  298

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SAL CAREML PE+ S DLI ALNSR
Sbjct  299   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALRCAREMLTPEDGSADLIRALNSR  358

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             LLALSFHIREYYW+D++KLNEIYRYKTEEYS++A+NKFNIYPDQIPPWLVDWMP KGGYL
Sbjct  359   LLALSFHIREYYWLDMRKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVDWMPEKGGYL  418

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN WSIVSSLAT+ QSHAILDL EAKW DLVA+MP+KICYPALE
Sbjct  419   IGNLQPAHMDFRFFSLGNFWSIVSSLATSGQSHAILDLFEAKWVDLVADMPIKICYPALE  478

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEWRI+TGGDPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIAE A+KVAERRI+ D+
Sbjct  479   DQEWRIVTGGDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAEKAVKVAERRISKDR  538

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK   FIGKQ+ LFQTWSIAGYLVAKLL+ANPE AK+LI  ED+EL++AFSS++
Sbjct  539   WPEYYDTKGARFIGKQSHLFQTWSIAGYLVAKLLLANPEKAKILINEEDSELVNAFSSLI  598

Query  1890  SANPR-RKRSRKG-AVKQSYIV  1949
                PR RKRSRKG   KQSYI+
Sbjct  599   ---PRGRKRSRKGVGAKQSYII  617


 Score =   231 bits (590),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAW+LL  S+V YCG+P+GTIAANDP  +SILNYDQVFIRDF+PS IAFLLK +Y
Sbjct  129  DSLEDEAWELLNESIVNYCGSPVGTIAANDPTSTSILNYDQVFIRDFVPSAIAFLLKDDY  188

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            DIVRNFLL+TLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAA
Sbjct  189  DIVRNFLLNTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAA  248

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  249  IGRVAPVDSGLW  260



>ref|XP_004249987.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312546.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312547.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
 ref|XP_010312548.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum lycopersicum]
Length=655

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 340/380 (89%), Gaps = 4/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  276   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADG  335

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SALLCAREML PE+ S DLI ALN+R
Sbjct  336   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNR  395

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRY+TEEYSY+A+NKFNIYPDQI PWLVDWMPSKGGYL
Sbjct  396   LVALSFHIREYYWIDMKKLNEIYRYQTEEYSYDAVNKFNIYPDQISPWLVDWMPSKGGYL  455

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SL T DQSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  456   IGNLQPAHMDFRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWTDLVADMPFKICYPALE  515

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQLAVAS+KM RPEIA  A++VAE+RI+ DK
Sbjct  516   GQEWKIITGCDPKNTPWSYHNGGSWPTLLWQLAVASIKMNRPEIAAKAVEVAEKRISQDK  575

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARLFQTWSIAGYLVAKLL+ANP +AK+LI+ ED+ELL+AFS  +
Sbjct  576   WPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLLLANPSSAKILISQEDSELLNAFSCAI  635

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRK+    + +++YIV
Sbjct  636   SSNPRRKKRGPKSPQKTYIV  655


 Score =   253 bits (646),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  325  DEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS  504
            +E  +S  S+ PNG    T+N    NSIE+EAW+LLR SMVYYCG+P+GTIAA DP  S+
Sbjct  139  EENFQSNGSLPPNGLVEDTLNRIAGNSIEDEAWELLRESMVYYCGSPVGTIAAKDPTSST  198

Query  505  --ILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
              +LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  199  ADVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  258

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  259  FKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  297



>ref|XP_006361445.1| PREDICTED: alkaline/neutral invertase CINV1-like [Solanum tuberosum]
Length=655

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 340/380 (89%), Gaps = 4/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  276   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADG  335

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SALLCAREML PE+ S DLI ALN+R
Sbjct  336   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNR  395

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRY+TEEYSY+A+NKFNIYPDQI PWLVDWMPSKGGYL
Sbjct  396   LVALSFHIREYYWIDMKKLNEIYRYQTEEYSYDAVNKFNIYPDQISPWLVDWMPSKGGYL  455

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SL T DQSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  456   IGNLQPAHMDFRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWTDLVADMPFKICYPALE  515

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN G+WPTLLWQLAVAS+KM RPEIA  A++VAE+RI+ DK
Sbjct  516   GQEWKIITGCDPKNTPWSYHNGGAWPTLLWQLAVASIKMNRPEIAAKAVEVAEKRISRDK  575

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK+LI+ ED+ELL+AFS  +
Sbjct  576   WPEYYDTKKARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKILISQEDSELLNAFSCAI  635

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRK+    + +++YIV
Sbjct  636   SSNPRRKKRGPKSPQKTYIV  655


 Score =   251 bits (640),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +1

Query  325  DEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS  504
            +E  +S  S+ PN     T+N    NSIE+EAW+LLR SMVYYCG+P+GTIAA DP  S+
Sbjct  139  EEDFQSNGSLRPNVSAEDTLNRIAGNSIEDEAWELLRESMVYYCGSPVGTIAAKDPTSST  198

Query  505  --ILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
              +LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  199  ADVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  258

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  259  FKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  297



>ref|XP_009787814.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana sylvestris]
 ref|XP_009787815.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana sylvestris]
Length=654

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/380 (81%), Positives = 340/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  276   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADG  335

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SALLCAREML PE+ S DLI ALN+R
Sbjct  336   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNR  395

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  396   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  455

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SL T DQSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  456   IGNLQPAHMDFRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWADLVADMPFKICYPALE  515

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN G+WPTLLWQLAVAS+KM RPEIA  A++VAE+RI+ DK
Sbjct  516   GQEWQIITGCDPKNTPWSYHNGGAWPTLLWQLAVASIKMNRPEIAAKAVEVAEKRISRDK  575

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  F+GKQARLFQTWSIAGYLVAKLL+ANP AAK+LIT ED+ELL+AFS  +
Sbjct  576   WPEYYDTKKARFVGKQARLFQTWSIAGYLVAKLLLANPSAAKILITQEDSELLNAFSCAI  635

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKR  K + K +YIV
Sbjct  636   SSNPRRKRGPKSSQK-TYIV  654


 Score =   252 bits (643),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 2/158 (1%)
 Frame = +1

Query  328  EQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSI  507
            E  +S  S+ PNG     +N    NSIE+EAW+LLR SMVYYCG+P+GTIAA DP  S++
Sbjct  140  EDFQSNGSLPPNGSVQDALNRIAENSIEDEAWELLRESMVYYCGSPVGTIAAQDPTSSNV  199

Query  508  --LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASF  681
              LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASF
Sbjct  200  GVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASF  259

Query  682  KVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  260  KVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  297



>ref|XP_009618314.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana tomentosiformis]
 ref|XP_009618315.1| PREDICTED: alkaline/neutral invertase CINV1-like [Nicotiana tomentosiformis]
Length=654

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/380 (81%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  276   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSSGDLSVQERIDVQTGIKMILRLCLADG  335

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALF+SALLCAREML PE+ S DLI ALN+R
Sbjct  336   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFHSALLCAREMLTPEDGSADLIRALNNR  395

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  396   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  455

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SL T DQSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  456   IGNLQPAHMDFRFFSLGNLWSIVCSLTTDDQSHAILDLIEAKWADLVADMPFKICYPALE  515

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN G+WPTLLWQLAVAS+KM RPEIA  A++VAE RI+ DK
Sbjct  516   GQEWQIITGCDPKNTPWSYHNGGAWPTLLWQLAVASIKMNRPEIAAKAVEVAEERISRDK  575

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  F+GKQARLFQTWSIAGYLVAKLL+ANP AAK+LIT ED+ELL+AFS  +
Sbjct  576   WPEYYDTKKARFVGKQARLFQTWSIAGYLVAKLLLANPSAAKILITQEDSELLNAFSCAI  635

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKR  K + K +YIV
Sbjct  636   SSNPRRKRGPKSSQK-TYIV  654


 Score =   251 bits (641),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 2/158 (1%)
 Frame = +1

Query  328  EQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSI  507
            E  +S  S+ PNG     +N    NSIE+EAW+LLR SMVYYCG+P+GTIAA DP  S++
Sbjct  140  EDFQSNGSLPPNGSVQDALNRIAENSIEDEAWELLRESMVYYCGSPVGTIAAQDPTSSNV  199

Query  508  --LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASF  681
              LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASF
Sbjct  200  GVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASF  259

Query  682  KVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KVRT+PL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  260  KVRTIPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  297



>ref|XP_007015894.1| Alkaline/neutral invertase isoform 2 [Theobroma cacao]
 gb|EOY33513.1| Alkaline/neutral invertase isoform 2 [Theobroma cacao]
Length=624

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 341/381 (90%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  245   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  304

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLA E+ S DLI ALN+R
Sbjct  305   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLASEDGSADLIRALNNR  364

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYS++A+NKFNIYPDQIPPWLV++MP++GGYL
Sbjct  365   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSFDAVNKFNIYPDQIPPWLVEFMPARGGYL  424

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SLAT DQSHAILDL+EAKW +LVA+MPLKICYPALE
Sbjct  425   IGNLQPAHMDFRFFSLGNLWSIVGSLATVDQSHAILDLVEAKWSELVADMPLKICYPALE  484

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLW-QLAVASVKMKRPEIAENAIKVAERRIAGD  1706
             GQEWRIITG DPKNTPWSYHN GSWPTLLW QL VA +KM RPE+AE A+ +AERRI  D
Sbjct  485   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQQLTVACIKMNRPEVAEKAVMLAERRICRD  544

Query  1707  KWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSI  1886
             KWPEYYDT+R  FIGKQ+RLFQTWSIAGYLVAKLL+ANP AAK+LI  ED +L++AFS +
Sbjct  545   KWPEYYDTRRARFIGKQSRLFQTWSIAGYLVAKLLLANPSAAKILINEEDADLVNAFSCM  604

Query  1887  LSANPRRKRSRKGAVKQSYIV  1949
             LSANPR+KR +KG  KQ +++
Sbjct  605   LSANPRKKRGQKG-FKQPFLI  624


 Score =   243 bits (621),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 149/202 (74%), Gaps = 34/202 (17%)
 Frame = +1

Query  277  RCYCRPAERGNERIFEDEQGRSVHSIAPNGQTSATVNNALP-------------------  399
            RC C+ A+  +E   +D  GR   S++ NG+T+  VNNA                     
Sbjct  70   RCKCQKADSISEVTADD--GRPT-SLSINGRTN--VNNAQEFELNQLLKSDKEGFANGDT  124

Query  400  ----------NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPS  549
                       SIEEEAWDLL+ S+VYYCGNPIGTIAA+D + SSILNYDQVFIRDFIPS
Sbjct  125  NGVGTVIDSRKSIEEEAWDLLKESVVYYCGNPIGTIAASDTSSSSILNYDQVFIRDFIPS  184

Query  550  GIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATED  729
            GIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRTVP + D++ TED
Sbjct  185  GIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPRDGDDSVTED  244

Query  730  VLDPDFGEAAIGRVAPVDSGMF  795
            VLDPDFGEAAIGRVAPVDSG++
Sbjct  245  VLDPDFGEAAIGRVAPVDSGLW  266



>ref|XP_002311958.2| hypothetical protein POPTR_0008s02460g [Populus trichocarpa]
 gb|EEE89325.2| hypothetical protein POPTR_0008s02460g [Populus trichocarpa]
Length=663

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/380 (79%), Positives = 343/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  285   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADG  344

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA+EMLAPE+ S DL+ ALN+R
Sbjct  345   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAKEMLAPEDGSADLLRALNNR  404

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+WMP++GGYL
Sbjct  405   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWMPNQGGYL  464

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WS+VS LAT DQS+AILDLIEAKW DLVA+MPLKICYPALE
Sbjct  465   IGNLQPAHMDFRFFSLGNIWSVVSGLATRDQSNAILDLIEAKWSDLVADMPLKICYPALE  524

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A+ +AE+RI+ DK
Sbjct  525   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVDIAEKRISRDK  584

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARLFQTWSIAGYLVAKLL+A+P AA+ML+T ED EL++AFS ++
Sbjct  585   WPEYYDTKKARFIGKQARLFQTWSIAGYLVAKLLLADPSAARMLVTDEDPELVNAFSCMI  644

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKR +K + K+ +IV
Sbjct  645   SSNPRRKRGQKNS-KKPFIV  663


 Score =   245 bits (626),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 3/153 (2%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALPNSI---EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNY  516
             S+A NG      + +   S+   EEEAW+LLR S+V+YCG+PIGTIAANDP  SS+LNY
Sbjct  154  ESLATNGAVGTGRDASRKVSVDPTEEEAWELLRDSVVHYCGSPIGTIAANDPTSSSVLNY  213

Query  517  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV  696
            DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDC+SPGQGLMPASFKVRT 
Sbjct  214  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQGLMPASFKVRTF  273

Query  697  PLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  274  PLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  306



>ref|XP_007010262.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY19072.1| Alkaline/neutral invertase isoform 1 [Theobroma cacao]
Length=652

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 340/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  274   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  334   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGG+L
Sbjct  394   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGFL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW++ S LATTDQSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  454   IGNLQPAHMDFRFFSLGNLWAVASGLATTDQSHAILDLIEAKWADLVADMPFKICYPALE  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  AI VAE+RI+ DK
Sbjct  514   GREWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACMKMNRPEIAAKAISVAEKRISRDK  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQ+ LFQTWSIAGYLVAKLL+A+P AAK+L T ED+EL++AFS ++
Sbjct  574   WPEYYDTKKARFIGKQSHLFQTWSIAGYLVAKLLLADPNAAKILTTEEDSELVNAFSCMI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRRKR  K ++KQ+YIV
Sbjct  634   SANPRRKRGPK-SLKQTYIV  652


 Score =   259 bits (662),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 155/295 (53%), Positives = 183/295 (62%), Gaps = 52/295 (18%)
 Frame = +1

Query  64   SMGV--PALQVLPGELSCRFIRR-CSSNSLLLLKDHF-------KGKSF--RVKCSKDLG  207
            SMG     L VL G +   F    CSSN  L+    +       KG S+  R KC + L 
Sbjct  2    SMGTSEAVLHVLSGAVPRLFSSDLCSSNLDLVFSSKYHIKSVNKKGSSYMQRFKCLR-LA  60

Query  208  KITSSSKLCAVRD--FYG---LEKPKLLRCYCRPAE--------RGNERIFED-------  327
            +    S +C       YG   + + KLLRC C  AE         GN   F D       
Sbjct  61   RCQIGSYMCKPLGGGLYGNRAIGRLKLLRCKCERAESVSGVGMDEGNGAWFVDSAKKLNL  120

Query  328  ----------------EQGRSVHSIAPNGQT---SATVNNALPNSIEEEAWDLLRASMVY  450
                            +  R    +  NG     ++T + A  +SIE+EAW+LLR SMVY
Sbjct  121  NGSINSPNILEFEAVEQLKREKEGLTSNGTVGTGTSTFHKASVDSIEDEAWELLRDSMVY  180

Query  451  YCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE  630
            YCG+PIGTIAANDP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWE
Sbjct  181  YCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWE  240

Query  631  KTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  241  KTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  295



>emb|CDX92345.1| BnaA10g13840D [Brassica napus]
Length=610

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GD+S+ ER+DVQTG+KMILKLCLADG
Sbjct  232   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADG  291

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  292   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNR  351

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  352   LVALSFHIREYYWLDMKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  411

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILD +EAKW +LVA+MP KICYPA+E
Sbjct  412   IGNLQPAHMDFRFFSLGNLWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAME  471

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  472   GEEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDK  531

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  532   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMI  591

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R RK   +Q +IV
Sbjct  592   SANPRRTRGRK-KTQQPFIV  610


 Score =   250 bits (638),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            N  ++ +  +A  NSIE+EAWDLLR S+VYYCG+PIGTIAANDPN +S+LNYDQVFIRDF
Sbjct  109  NLSSNGSTQSAGTNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIRDF  168

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            IPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D++ 
Sbjct  169  IPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSM  228

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  229  TEEVLDPDFGEAAIGRVAPVDSGLW  253



>emb|CDY26937.1| BnaC09g36460D [Brassica napus]
Length=610

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GD+S+ ER+DVQTG+KMILKLCLADG
Sbjct  232   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADG  291

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  292   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  351

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  352   LVALSFHIREYYWLDMKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  411

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVSSLAT DQSHAILD +EAKW +LVA+MP KICYPA+E
Sbjct  412   IGNLQPAHMDFRFFSLGNVWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAME  471

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  472   GEEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDK  531

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  532   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMI  591

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R RK   +Q +IV
Sbjct  592   SANPRRTRGRK-KTQQPFIV  610


 Score =   251 bits (641),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 136/149 (91%), Gaps = 4/149 (3%)
 Frame = +1

Query  349  SIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVF  528
            S++ NG T +    A  NSIE+EAWDLLR S+VYYCG+PIGTIAANDPN +S+LNYDQVF
Sbjct  109  SLSSNGSTQS----AGTNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVF  164

Query  529  IRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEN  708
            IRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ 
Sbjct  165  IRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDG  224

Query  709  DENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            D++ TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  225  DDSMTEEVLDPDFGEAAIGRVAPVDSGLW  253



>ref|XP_009120650.1| PREDICTED: alkaline/neutral invertase CINV1 [Brassica rapa]
Length=610

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 338/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GD+S+ ER+DVQTG+KMILKLCLADG
Sbjct  232   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDVSVQERVDVQTGIKMILKLCLADG  291

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  292   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNR  351

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KK+NEIYRY+TEEYSY A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  352   LVALSFHIREYYWLDMKKINEIYRYQTEEYSYNAVNKFNIYPDQIPSWLVDFMPNRGGYL  411

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILD +EAKW +LVA+MP KICYPA+E
Sbjct  412   IGNLQPAHMDFRFFSLGNLWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAME  471

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  472   GEEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDK  531

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  532   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPSAAKFLTSEEDSDLRNAFSCMI  591

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R RK   +Q +IV
Sbjct  592   SANPRRTRGRK-KTQQPFIV  610


 Score =   250 bits (638),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            N  ++ +  +A  NSIE+EAWDLLR S+VYYCG+PIGTIAANDPN +S+LNYDQVFIRDF
Sbjct  109  NLSSNGSTQSAGTNSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIRDF  168

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            IPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D++ 
Sbjct  169  IPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDDSM  228

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  229  TEEVLDPDFGEAAIGRVAPVDSGLW  253



>emb|CDO99885.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  274   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILRLCLADG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DL+ ALN+R
Sbjct  334   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLLRALNNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV WMP+KGGYL
Sbjct  394   LIALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVGWMPNKGGYL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVS+LATTDQSHAILDL+EAKW DLVA+MP KICYPAL+
Sbjct  454   IGNLQPAHMDFRFFSLGNLWSIVSNLATTDQSHAILDLMEAKWADLVADMPFKICYPALD  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A++VAE+R++ DK
Sbjct  514   GQEWQIITGCDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEVAEKRLSRDK  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQ+RLFQTWSIAGYLVAKLL+ANP AAK+LIT ED+EL++A S  +
Sbjct  574   WPEYYDTKRGRFIGKQSRLFQTWSIAGYLVAKLLLANPGAAKILITEEDSELINALSCAI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              ++PRRKR  K + K +YIV
Sbjct  634   CSSPRRKRGPKPSQK-TYIV  652


 Score =   240 bits (613),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 137/175 (78%), Gaps = 11/175 (6%)
 Frame = +1

Query  304  GNERIF-------EDEQGRSVHSIAPNGQTSATVNNALPNS----IEEEAWDLLRASMVY  450
            GN R F       E +  + +H    N  +  T+ + +       IE EAW+LL+ S+ Y
Sbjct  121  GNVRNFLELGAVKELKHDKELHHSNGNPPSDKTIQDGMNKGKSSFIENEAWELLQESVAY  180

Query  451  YCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE  630
            YCG+P+GTIAA DP  SS+LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWE
Sbjct  181  YCGSPVGTIAAKDPTSSSVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWE  240

Query  631  KTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KTMDC+SPGQGLMPASFKVRTVPL+ D+ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  241  KTMDCHSPGQGLMPASFKVRTVPLDGDDTATEEVLDPDFGEAAIGRVAPVDSGLW  295



>ref|XP_010067152.1| PREDICTED: alkaline/neutral invertase CINV1-like [Eucalyptus 
grandis]
 ref|XP_010067153.1| PREDICTED: alkaline/neutral invertase CINV1-like [Eucalyptus 
grandis]
 gb|KCW65218.1| hypothetical protein EUGRSUZ_G02704 [Eucalyptus grandis]
 gb|KCW65219.1| hypothetical protein EUGRSUZ_G02704 [Eucalyptus grandis]
Length=646

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK SGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  268   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKISGDLSVQERIDVQTGIKMILKLCLADG  327

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+ AREMLAPE+ S DLI ALN+R
Sbjct  328   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALMSAREMLAPEDGSADLIRALNNR  387

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P++GGYL
Sbjct  388   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPNRGGYL  447

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN WSIVS LAT DQSHAILDLIEAKW DLV++MPLKICYPALE
Sbjct  448   IGNLQPAHMDFRFFSLGNFWSIVSGLATVDQSHAILDLIEAKWADLVSDMPLKICYPALE  507

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM R +IA  A+++ ERRI+ D+
Sbjct  508   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRADIAAKAVEIVERRISRDR  567

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARLFQTWSIAGYLVAKLL+A+P AAK+LIT ED  L++AFS ++
Sbjct  568   WPEYYDTKRSRFIGKQARLFQTWSIAGYLVAKLLLADPGAAKILITDEDPALVNAFSCMI  627

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              ANPRRKR RK  +KQSYIV
Sbjct  628   GANPRRKRGRKN-LKQSYIV  646


 Score =   253 bits (647),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  319  FEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
             ++E+  S+ + AP    S+T++ A  + IEEEAWDLLR S+VYYCG+PIGTIAANDP  
Sbjct  133  LKEEKTDSMSNGAP--IASSTIHRANVDPIEEEAWDLLRDSVVYYCGSPIGTIAANDPTS  190

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
            S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPAS
Sbjct  191  SNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPAS  250

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  251  FKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  289



>ref|XP_006400758.1| hypothetical protein EUTSA_v10012973mg [Eutrema salsugineum]
 dbj|BAJ33980.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42211.1| hypothetical protein EUTSA_v10012973mg [Eutrema salsugineum]
Length=622

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 340/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  244   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  303

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  304   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  363

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  364   LVALSFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  423

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILD +EAKW +LVA+MP KICYPA+E
Sbjct  424   LGNLQPAHMDFRFFSLGNLWSIVSSLATNDQSHAILDFVEAKWAELVADMPFKICYPAME  483

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  484   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAIDK  543

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  544   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLENAFSCMI  603

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR+ R RK A +Q +IV
Sbjct  604   SANPRKTRGRKKA-QQPFIV  622


 Score =   249 bits (637),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSAT--VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+   V +  P SIE+EAWDLLR S+VYYCG+PIGTIAANDPN +S+LNYDQVFIR
Sbjct  119  NGSLSSNGNVQSGGPKSIEDEAWDLLRQSIVYYCGSPIGTIAANDPNSTSVLNYDQVFIR  178

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D+
Sbjct  179  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDD  238

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  239  SLTEEVLDPDFGEAAIGRVAPVDSGLW  265



>ref|XP_002874073.1| hypothetical protein ARALYDRAFT_489110 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50332.1| hypothetical protein ARALYDRAFT_489110 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 341/380 (90%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  237   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  296

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  297   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNR  356

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  357   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  416

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLAT DQSHAILDLIEAKW +LVA+MPLKICYPA+E
Sbjct  417   IGNLQPAHMDFRFFTLGNLWSIVSSLATNDQSHAILDLIEAKWAELVADMPLKICYPAME  476

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRI+ DK
Sbjct  477   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRISLDK  536

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  537   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLRNAFSCMI  596

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K A +Q +IV
Sbjct  597   SANPRRTRGPKKA-QQPFIV  615


 Score =   240 bits (613),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSATVN--NALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+  N  +    SIE+EAWDLLR S+V+YCG+PIGTIAANDP+ +S+LNYDQVFIR
Sbjct  112  NGSLSSNGNAQSVGTKSIEDEAWDLLRQSVVFYCGSPIGTIAANDPSSTSVLNYDQVFIR  171

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMP SFKV+TVPL+ D+
Sbjct  172  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPCSFKVKTVPLDGDD  231

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  232  SMTEEVLDPDFGEAAIGRVAPVDSGLW  258



>ref|NP_197643.1| alkaline/neutral invertase [Arabidopsis thaliana]
 sp|Q9FK88.1|INVE_ARATH RecName: Full=Alkaline/neutral invertase E, chloroplastic; Short=A/N-INVE; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09123.1| alkaline/neutral invertase [Arabidopsis thaliana]
 gb|AAL08305.1| AT5g22510/MQJ16_5 [Arabidopsis thaliana]
 gb|ACI46508.1| At5g22510 [Arabidopsis thaliana]
 gb|AED93035.1| alkaline/neutral invertase [Arabidopsis thaliana]
Length=617

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 340/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  239   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  298

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  299   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  358

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  359   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  418

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLA+ DQSHAILD IEAKW +LVA+MPLKICYPA+E
Sbjct  419   IGNLQPAHMDFRFFTLGNLWSIVSSLASNDQSHAILDFIEAKWAELVADMPLKICYPAME  478

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRI+ DK
Sbjct  479   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRISLDK  538

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS +L
Sbjct  539   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLRNAFSCML  598

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K A +Q +IV
Sbjct  599   SANPRRTRGPKKA-QQPFIV  617


 Score =   243 bits (621),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSATVN--NALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+  N  +    SIE+EAWDLLR S+V+YCG+PIGTIAANDPN +S+LNYDQVFIR
Sbjct  114  NGSVSSNGNAQSVGTKSIEDEAWDLLRQSVVFYCGSPIGTIAANDPNSTSVLNYDQVFIR  173

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMP SFKV+TVPL+ D+
Sbjct  174  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPCSFKVKTVPLDGDD  233

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  234  SMTEEVLDPDFGEAAIGRVAPVDSGLW  260



>ref|XP_004150486.1| PREDICTED: uncharacterized protein LOC101217778 [Cucumis sativus]
 ref|XP_004165171.1| PREDICTED: uncharacterized protein LOC101226610 [Cucumis sativus]
 gb|KGN52201.1| hypothetical protein Csa_5G615240 [Cucumis sativus]
Length=638

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 338/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  260   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  319

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  320   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  379

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLVDWMP+KGGYL
Sbjct  380   LVALSFHIREYYWVDLQKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVDWMPTKGGYL  439

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  QSHAILDLIE+KW DLV++MP KICYPALE
Sbjct  440   IGNLQPAHMDFRFFSLGNLWSIVSSLTTIGQSHAILDLIESKWGDLVSDMPFKICYPALE  499

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  AI++AERR++ DK
Sbjct  500   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIASKAIEIAERRLSRDK  559

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G FIGKQARLFQTWSIAGYLV KLL+A P  A +LIT ED++L++AFS ++
Sbjct  560   WPEYYDTKKGRFIGKQARLFQTWSIAGYLVGKLLLAEPSKANILITAEDSDLVNAFSCMI  619

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S++P+RKR +K +   +YIV
Sbjct  620   SSSPKRKRGQKNS-NPTYIV  638


 Score =   248 bits (632),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 170/263 (65%), Gaps = 56/263 (21%)
 Frame = +1

Query  97   GELSCRFIRRCSSNSLLLLKDHFKGKSFRVKCSKDLGKITSSSKLCAVRDFYGLEKPKLL  276
            G LS R + +CSS  L  +   F GKS   KC++                     +P L 
Sbjct  45   GVLSNRNLSKCSSRLLQGIGTSFSGKS---KCNR---------------------RP-LY  79

Query  277  RCYCRPA--------ERGNERIFED--EQGRSVHSIAPNGQTSAT------------VNN  390
             C C+ A        E GN   F D  E  R +++  PNG ++               N 
Sbjct  80   SCRCQQAQSTSGMTPEGGNGTWFGDGAETSRPINN-TPNGSSALEFQDVQFAKQENGTNG  138

Query  391  ALPN--------SIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIP  546
            A+ +        SIE+EAWDLLR S+VYYC +PIGTIAA DP  S++LNYDQVFIRDFIP
Sbjct  139  AVRDPFHKISIESIEDEAWDLLRESIVYYCNSPIGTIAARDPTSSNLLNYDQVFIRDFIP  198

Query  547  SGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATE  726
            SGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE
Sbjct  199  SGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATE  258

Query  727  DVLDPDFGEAAIGRVAPVDSGMF  795
            +VLDPDFGEAAIGRVAPVDSG++
Sbjct  259  EVLDPDFGEAAIGRVAPVDSGLW  281



>ref|XP_008446771.1| PREDICTED: alkaline/neutral invertase CINV1 [Cucumis melo]
Length=644

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  266   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  325

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  326   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  385

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV+WMP+KGGYL
Sbjct  386   LVALSFHIREYYWVDLQKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEWMPTKGGYL  445

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  QSHAILDLIE+KW DLVA+MP KICYPALE
Sbjct  446   IGNLQPAHMDFRFFSLGNLWSIVSSLTTIGQSHAILDLIESKWGDLVADMPFKICYPALE  505

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  AI++AERR++ DK
Sbjct  506   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIASRAIEIAERRLSRDK  565

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT++G FIGKQARLFQTWSIAGYLV KLL+A P  AK+LIT ED++L++AFS ++
Sbjct  566   WPEYYDTRKGRFIGKQARLFQTWSIAGYLVGKLLLAEPSKAKILITEEDSDLVNAFSCMI  625

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S++P+RKR +K +   +YIV
Sbjct  626   SSSPKRKRGQKNS-NPTYIV  644


 Score =   247 bits (630),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 160/243 (66%), Gaps = 10/243 (4%)
 Frame = +1

Query  97   GELSCRFIRRCSSNSLLLLKDHFKGKS-------FRVKCSK---DLGKITSSSKLCAVRD  246
            G LS R + +CSS  L  ++  F GK+       +  +C +     G            D
Sbjct  45   GVLSNRNLSKCSSRLLQGIRTSFSGKAKCNRRPLYSCRCQQAQSTSGMTPEGGNGTWFVD  104

Query  247  FYGLEKPKLLRCYCRPAERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWD  426
                  P   R     A    +  F  ++ +S  S   NG      +     SIE+EAWD
Sbjct  105  GAETSSPINNRPNGSSALEFQDVQFAKQEIKSSISNGTNGAVRDPFHKISIESIEDEAWD  164

Query  427  LLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLH  606
            LLR S+VYYC +PIGTIAA DP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LH
Sbjct  165  LLRESIVYYCNSPIGTIAARDPTSSNLLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILH  224

Query  607  TLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDS  786
            TLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDS
Sbjct  225  TLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDS  284

Query  787  GMF  795
            G++
Sbjct  285  GLW  287



>ref|XP_011032827.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
 ref|XP_011032828.1| PREDICTED: alkaline/neutral invertase CINV1-like [Populus euphratica]
Length=663

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCS DLS+ ERIDVQTG+KMIL+LCLADG
Sbjct  285   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSADLSVQERIDVQTGIKMILRLCLADG  344

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCA+EML PE+ S DL+ ALN+R
Sbjct  345   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAKEMLTPEDGSADLLRALNNR  404

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWL +WMP++GGYL
Sbjct  405   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLAEWMPNQGGYL  464

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WS+VS LAT DQS+AILDLIEAKW DLVA+MPLKICYPALE
Sbjct  465   IGNLQPAHMDFRFFSLGNMWSVVSGLATRDQSNAILDLIEAKWSDLVADMPLKICYPALE  524

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A+ +AE+RI+ DK
Sbjct  525   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAAKAVDIAEKRISRDK  584

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQA LFQTWSIAGYLVAKLL+A+P AA+ML+T ED EL++AFS ++
Sbjct  585   WPEYYDTKKARFIGKQAHLFQTWSIAGYLVAKLLLADPSAARMLVTDEDPELVNAFSCMI  644

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S+NPRRKR +K  +K+ +IV
Sbjct  645   SSNPRRKRGQKN-LKKPFIV  663


 Score =   242 bits (618),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            EEEAW+LLR S+V+YCG+PIGTIAANDP  SS+LN+DQVFIRDFIPSGIAFLLKGEYDIV
Sbjct  178  EEEAWELLRDSVVHYCGSPIGTIAANDPTSSSVLNHDQVFIRDFIPSGIAFLLKGEYDIV  237

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKTMDC+SPGQGLMPASFKVRT PL+ D++ATE+VLDPDFGEAAIGR
Sbjct  238  RNFLLHTLQLQSWEKTMDCHSPGQGLMPASFKVRTFPLDGDDSATEEVLDPDFGEAAIGR  297

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  298  VAPVDSGLW  306



>ref|XP_006287277.1| hypothetical protein CARUB_v10000472mg [Capsella rubella]
 gb|EOA20175.1| hypothetical protein CARUB_v10000472mg [Capsella rubella]
Length=622

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 338/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  244   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  303

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  304   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  363

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  364   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  423

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SLA+ +QSHAILD IEAKW +LVA+MP KICYPA+E
Sbjct  424   IGNLQPAHMDFRFFSLGNLWSIVGSLASNEQSHAILDFIEAKWAELVADMPFKICYPAME  483

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  484   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIAQDK  543

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK LI+ ED++L +AFS ++
Sbjct  544   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLISEEDSDLRNAFSCMI  603

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K   +Q +IV
Sbjct  604   SANPRRTRGPK-KTQQPFIV  622


 Score =   246 bits (629),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSATVN--NALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+  N  +A   SIE+EAWDLLR S+V+YCG+PIGTIAANDPN +S+LNYDQVFIR
Sbjct  119  NGSVSSNGNAQSAGTKSIEDEAWDLLRQSVVFYCGSPIGTIAANDPNSTSVLNYDQVFIR  178

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D+
Sbjct  179  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDD  238

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  239  SMTEEVLDPDFGEAAIGRVAPVDSGLW  265



>ref|XP_004504002.1| PREDICTED: uncharacterized protein LOC101511142 [Cicer arietinum]
Length=635

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 338/380 (89%), Gaps = 8/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  260   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  319

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DL+ ALN+R
Sbjct  320   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLLRALNNR  379

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+K+LNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  380   LVALSFHIREYYWIDLKRLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  439

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+V+SLAT +QSHAILDLIEAKW DLVA+MPLKICYPALE
Sbjct  440   IGNLQPAHMDFRFFSLGNLWSVVNSLATEEQSHAILDLIEAKWSDLVADMPLKICYPALE  499

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWP+LLWQL VA +KM RP IA   +++AERRI+ DK
Sbjct  500   GQEWQIITGSDPKNTPWSYHNAGSWPSLLWQLTVACIKMNRPHIAAKTVEIAERRISRDK  559

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ++L+QTWSIAGYLV+KLL+A+P  A +LIT ED+EL +AF   +
Sbjct  560   WPEYYDTKRSRFIGKQSQLYQTWSIAGYLVSKLLLADPSKANILITEEDSELANAF---I  616

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR KR RK  +KQ+YIV
Sbjct  617   SANPRGKRGRKN-MKQTYIV  635


 Score =   254 bits (650),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            NG  + + +    NSIE+EAWDLLR S+VYYCGNPIGTIAA DPN S++LNYDQVFIRDF
Sbjct  137  NGTIAKSFDKISLNSIEDEAWDLLRESVVYYCGNPIGTIAAKDPNSSNVLNYDQVFIRDF  196

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            IPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++A
Sbjct  197  IPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  256

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  257  TEEVLDPDFGEAAIGRVAPVDSGLW  281



>ref|XP_010093212.1| hypothetical protein L484_008994 [Morus notabilis]
 gb|EXB53710.1| hypothetical protein L484_008994 [Morus notabilis]
Length=645

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 335/380 (88%), Gaps = 7/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  269   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  328

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+AS DL+ ALN+R
Sbjct  329   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDASADLMRALNNR  388

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSYEA+NKFNIYPDQIP WLV++MP KGGYL
Sbjct  389   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYEAVNKFNIYPDQIPTWLVEFMPGKGGYL  448

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLA+ DQSHAILDLIEAKW +LVA MP KICYPALE
Sbjct  449   IGNLQPAHMDFRFFSLGNLWSIVSSLASQDQSHAILDLIEAKWAELVAEMPFKICYPALE  508

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G EWRI+TG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A+KVAE+RI+ DK
Sbjct  509   GVEWRIVTGCDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIALKALKVAEKRISSDK  568

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG F+GKQARLFQ WSIAGYLVAK L+ANP AA +L+  ED+EL +AFS I+
Sbjct  569   WPEYYDTKRGRFVGKQARLFQNWSIAGYLVAKHLLANPSAANILVNEEDSELRNAFSCII  628

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             +A+PR++R  K   K S+IV
Sbjct  629   NASPRKRRGWK---KHSFIV  645


 Score =   251 bits (641),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +1

Query  328  EQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSI  507
            E+  S   +   G     +++   N IEEEAW LLRAS+VYYC NPIGTIAANDP+ +S 
Sbjct  135  EKPESNGKLGAAGTIIDKLHDVRANLIEEEAWSLLRASIVYYCNNPIGTIAANDPSSTST  194

Query  508  LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKV  687
            LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKV
Sbjct  195  LNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKV  254

Query  688  RTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            RTVPL+ D++ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  255  RTVPLDGDDSATEDVLDPDFGEAAIGRVAPVDSGLW  290



>ref|XP_003531388.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
 gb|KHN29129.1| hypothetical protein glysoja_008464 [Glycine soja]
Length=652

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 336/380 (88%), Gaps = 8/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  277   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  336

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  337   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  396

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  397   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  456

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+V+SLAT +QSHAILDLIEAKW DLVA MP KICYPAL+
Sbjct  457   IGNLQPAHMDFRFFSLGNLWSVVNSLATEEQSHAILDLIEAKWSDLVAEMPFKICYPALD  516

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KMKR  IA  A+++AERRI  D+
Sbjct  517   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMKRTHIAAKAVEIAERRILRDR  576

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  F+GKQ+RL+QTWSIAGYLVAKLL+A+P  A  LIT ED+EL++A   ++
Sbjct  577   WPEYYDTKRSRFVGKQSRLYQTWSIAGYLVAKLLLADPSKANTLITEEDSELVNA---LI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR KR RK  ++Q+YIV
Sbjct  634   SANPRGKRGRKN-LRQTYIV  652


 Score =   258 bits (660),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 140/274 (51%), Positives = 170/274 (62%), Gaps = 56/274 (20%)
 Frame = +1

Query  133  SNSLLLLKDHFKGKSFRVKCSKDLGKITSSSKL-------------CAVRDFYGLEKPKL  273
            ++S L L   F+ K  + + S+    I  SS L              +  D+    +P+L
Sbjct  28   NSSDLALHSQFRVKCIKKRSSRHRDLIECSSMLQSRLITQQFQWMGVSFHDYKTYSRPRL  87

Query  274  LRCYCRPAERGNERIFEDEQGRSVHSIAPNGQTSATVNNALP------------------  399
              C C+ AE  +     DE G     +  +G+TS +V+N +                   
Sbjct  88   QTCKCQQAESASGITTGDENG---SRLVNDGETSNSVSNGMSAKHILEFEDVEAQQLKQE  144

Query  400  ----------------------NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
                                  NSIEEEAWDLLR S+VYYCGNPIGTIAA DP  S++LN
Sbjct  145  KEVLSSNLTNGSITDSFDTIGRNSIEEEAWDLLRESVVYYCGNPIGTIAAKDPTSSNVLN  204

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKVRT
Sbjct  205  YDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVRT  264

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  265  VPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  298



>ref|XP_002316508.2| hypothetical protein POPTR_0010s24250g [Populus trichocarpa]
 gb|EEF02679.2| hypothetical protein POPTR_0010s24250g [Populus trichocarpa]
Length=666

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ERIDVQTG+KMIL+LCLADG
Sbjct  288   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERIDVQTGIKMILRLCLADG  347

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  348   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  407

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP++GGYL
Sbjct  408   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNQGGYL  467

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN+WSIVS LAT DQS+AILD IEAKW DL+A+MPLKICYPALE
Sbjct  468   IGNLQPAHMDFRFFSLGNIWSIVSGLATRDQSNAILDFIEAKWSDLIADMPLKICYPALE  527

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL  A +KM RPE+A  A+++AE+RI+ DK
Sbjct  528   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTAACIKMNRPELAARAVEIAEKRISRDK  587

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQA LFQTWSIAGYLVAKLL+A+P AA+ML+  ED EL+SAFS ++
Sbjct  588   WPEYYDTKKARFIGKQAHLFQTWSIAGYLVAKLLLADPSAARMLVMDEDPELVSAFSCMI  647

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S +PRR R +K + K++++V
Sbjct  648   STHPRRNRGQKNS-KKTFMV  666


 Score =   244 bits (624),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 6/154 (4%)
 Frame = +1

Query  349  SIAPNGQTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNY  516
            S+A NG    T  +A P    + IEEEAW+LLR SMVYYCG+PIGTIAANDP  SS+LNY
Sbjct  157  SLATNGAV-GTGRDASPKVSVDPIEEEAWELLRNSMVYYCGSPIGTIAANDPTSSSVLNY  215

Query  517  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV  696
            DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDC+SPGQGLMPASFKVRTV
Sbjct  216  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQGLMPASFKVRTV  275

Query  697  PLENDEN-ATEDVLDPDFGEAAIGRVAPVDSGMF  795
             L+ D++ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  276  RLDGDDDFATEEVLDPDFGEAAIGRVAPVDSGLW  309



>ref|XP_011024247.1| PREDICTED: alkaline/neutral invertase CINV2-like [Populus euphratica]
Length=666

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 339/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL ERIDVQTG+KMIL+LCLADG
Sbjct  288   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQERIDVQTGIKMILRLCLADG  347

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  348   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  407

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PW+V+WMP+ GGYL
Sbjct  408   LVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWVVEWMPNHGGYL  467

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPA MDFRFFSLGN+WSIVS LAT DQS+AILD +EAKW DL+A+MPLKICYPALE
Sbjct  468   IGNLQPAPMDFRFFSLGNIWSIVSGLATRDQSNAILDFVEAKWSDLIADMPLKICYPALE  527

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL  A +KM RPEIA  A+++AE+RI+ DK
Sbjct  528   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTAACIKMNRPEIAARAVEIAEKRISRDK  587

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQA LFQTWSIAGYLVAKLL+A+P AA+ML+T ED EL+SAFS ++
Sbjct  588   WPEYYDTKKARFIGKQAHLFQTWSIAGYLVAKLLLADPSAAQMLVTDEDPELVSAFSCMI  647

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S NPRRKR +K + K++++V
Sbjct  648   STNPRRKRGQKNS-KKTFMV  666


 Score =   244 bits (623),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 6/155 (4%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
             S+A NG    T  +A P    + IEEEAW+LLR SMVYYCG+PIGTIAANDP  SS+LN
Sbjct  156  ESLATNG-VVGTGRDASPKVSVDPIEEEAWELLRNSMVYYCGSPIGTIAANDPTSSSVLN  214

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDC+SPGQGLMPASFKVRT
Sbjct  215  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCHSPGQGLMPASFKVRT  274

Query  694  VPLENDEN-ATEDVLDPDFGEAAIGRVAPVDSGMF  795
            V L+ D++ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  275  VRLDGDDDFATEEVLDPDFGEAAIGRVAPVDSGLW  309



>ref|XP_008363531.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV2-like, 
partial [Malus domestica]
Length=412

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/374 (79%), Positives = 333/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  37    VLDPDFGEAAIGRVAPVBSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  96

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEAS DL+ ALN+R
Sbjct  97    FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASADLVRALNNR  156

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL FHIRE+YWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  157   LVALXFHIREHYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  216

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLIEAKW++LVA+MP KICYPALE
Sbjct  217   IGNLQPAHMDFRFFSLGNLWSIVSSLATDLQSHAILDLIEAKWDELVADMPFKICYPALE  276

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ D 
Sbjct  277   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDN  336

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+L+QTWS+AGYLVAKLL+ANP AAK L+  ED+EL++AFS ++
Sbjct  337   WPEYYDTKRARFIGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMI  396

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  397   SASPRRKRGWKKQI  410


 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  628  EKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            EKTMD YSPGQGLMPA FKVRTVPL+ D+ ATEDVLDPDFGEAAIGRVAPV+SG++
Sbjct  3    EKTMDSYSPGQGLMPAXFKVRTVPLDGDKFATEDVLDPDFGEAAIGRVAPVBSGLW  58



>ref|XP_010493339.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=618

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 337/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  240   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  299

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  300   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSADLIRALNNR  359

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  360   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  419

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGNLWSIV SLA+ +QSHAILD IEAKW +LVA+MP KICYPA+E
Sbjct  420   LGNLQPAHMDFRFFSLGNLWSIVGSLASNEQSHAILDFIEAKWAELVADMPFKICYPAME  479

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  480   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIALDK  539

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  540   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSDEDSDLTNAFSCMI  599

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K   +Q +IV
Sbjct  600   SANPRRTRGPK-KTQQPFIV  618


 Score =   246 bits (627),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 4/149 (3%)
 Frame = +1

Query  349  SIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVF  528
            S++ NG     V +A   S+E+EAWDLLR S+V+YCG+PIGTIAANDPN +S+LNYDQVF
Sbjct  117  SLSSNGN----VQSAGTKSVEDEAWDLLRQSVVFYCGSPIGTIAANDPNSTSVLNYDQVF  172

Query  529  IRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEN  708
            IRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ 
Sbjct  173  IRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDG  232

Query  709  DENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            D++ TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  233  DDSMTEEVLDPDFGEAAIGRVAPVDSGLW  261



>ref|XP_010421041.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Camelina 
sativa]
 ref|XP_010421042.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Camelina 
sativa]
Length=621

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 337/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  243   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  363   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SLA+ +QSHAILD IEAKW +LVA+MP KICYPA+E
Sbjct  423   IGNLQPAHMDFRFFSLGNLWSIVGSLASNEQSHAILDFIEAKWAELVADMPFKICYPAME  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  483   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIALDK  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  543   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLTNAFSCMI  602

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K   +Q +IV
Sbjct  603   SANPRRTRGPK-KTQQPFIV  621


 Score =   246 bits (629),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSAT--VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+   V +A   S+E+EAWDLLR S+V+YCG+PIGTIAANDPN +S+LNYDQVFIR
Sbjct  118  NGSVSSNGNVQSAGTKSVEDEAWDLLRQSIVFYCGSPIGTIAANDPNSTSVLNYDQVFIR  177

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D+
Sbjct  178  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDD  237

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  238  SMTEEVLDPDFGEAAIGRVAPVDSGLW  264



>ref|XP_010454516.1| PREDICTED: alkaline/neutral invertase CINV1-like [Camelina sativa]
Length=621

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 337/380 (89%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKC+GDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  243   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCTGDLSVQERVDVQTGIKMILKLCLADG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREML PE+ S DLI ALN+R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLTPEDGSDDLIRALNNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL+FHIREYYW+D+KK+NEIYRY+TEEYSY+A+NKFNIYPDQIP WLVD+MP++GGYL
Sbjct  363   LVALNFHIREYYWLDLKKINEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVDFMPNRGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV SLA+ +QSHAILD IEAKW +LVA+MP KICYPA+E
Sbjct  423   IGNLQPAHMDFRFFSLGNLWSIVGSLASNEQSHAILDFIEAKWAELVADMPFKICYPAME  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN G+WPTLLWQL VAS+KM RPEIAE A+++AERRIA DK
Sbjct  483   GEEWRIITGSDPKNTPWSYHNGGAWPTLLWQLTVASIKMGRPEIAEKAVELAERRIALDK  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAGYLVAKLL+ANP AAK L + ED++L +AFS ++
Sbjct  543   WPEYYDTKRARFIGKQARLYQTWSIAGYLVAKLLLANPAAAKFLTSEEDSDLTNAFSCMI  602

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPRR R  K   +Q +IV
Sbjct  603   SANPRRTRGPK-KTQQPFIV  621


 Score =   249 bits (635),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +1

Query  361  NGQTSAT--VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            NG  S+   V +A   SIE+EAWDLLR S+V+YCGNPIGTIAANDPN +S+LNYDQVFIR
Sbjct  118  NGSVSSNGNVQSAGTKSIEDEAWDLLRQSVVFYCGNPIGTIAANDPNSTSVLNYDQVFIR  177

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMPASFKV+TVPL+ D+
Sbjct  178  DFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMPASFKVKTVPLDGDD  237

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  238  SMTEEVLDPDFGEAAIGRVAPVDSGLW  264



>ref|XP_006471382.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471383.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471385.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471386.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X2 [Citrus 
sinensis]
 gb|KDO51341.1| hypothetical protein CISIN_1g006488mg [Citrus sinensis]
 gb|AIN45137.1| neutral/alkaline invertase [Citrus suavissima]
Length=643

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/364 (82%), Positives = 330/364 (91%), Gaps = 4/364 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  266   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  325

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREML PE+ S DLI ALN+R
Sbjct  326   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNR  385

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV++MP  GGYL
Sbjct  386   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEFMPHIGGYL  445

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSSLAT DQSHAILDLIEAKW +LVA+MPLKICYPALE
Sbjct  446   IGNLQPAHMDFRFFSLGNLWSVVSSLATVDQSHAILDLIEAKWAELVADMPLKICYPALE  505

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA +KM R EIAE A+K+AER I+GDK
Sbjct  506   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRVEIAEKAVKLAERHISGDK  565

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQ+RL+QTWSIAGYLVAKLL+ NP AAK+L+T ED+EL++AFS ++
Sbjct  566   WPEYYDTKRGRFIGKQSRLYQTWSIAGYLVAKLLLDNPAAAKVLVTEEDSELVNAFSCMI  625

Query  1890  SANP  1901
             SA+P
Sbjct  626   SASP  629


 Score =   261 bits (666),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            +G  + TV+     S+E+EAWDLLR S+VYYCGNP+GTIAANDPNDS+ILNYDQVFIRDF
Sbjct  143  SGSITNTVHKVWAKSVEDEAWDLLRESIVYYCGNPVGTIAANDPNDSTILNYDQVFIRDF  202

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            IPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++A
Sbjct  203  IPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  262

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  263  TEEVLDPDFGEAAIGRVAPVDSGLW  287



>ref|XP_006424304.1| hypothetical protein CICLE_v10028002mg [Citrus clementina]
 gb|ESR37544.1| hypothetical protein CICLE_v10028002mg [Citrus clementina]
Length=643

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/364 (82%), Positives = 330/364 (91%), Gaps = 4/364 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  266   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  325

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREML PE+ S DLI ALN+R
Sbjct  326   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNR  385

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV++MP  GGYL
Sbjct  386   LVALSFHIREYYWIDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEFMPHIGGYL  445

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSSLAT DQSHAILDLIEAKW +LVA+MPLKICYPALE
Sbjct  446   IGNLQPAHMDFRFFSLGNLWSVVSSLATVDQSHAILDLIEAKWAELVADMPLKICYPALE  505

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA +KM R EIAE A+K+AER I+GDK
Sbjct  506   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRVEIAEKAVKLAERHISGDK  565

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQ+RL+QTWSIAGYLVAKLL+ NP AAK+L+T ED+EL++AFS ++
Sbjct  566   WPEYYDTKRGRFIGKQSRLYQTWSIAGYLVAKLLLDNPAAAKVLVTEEDSELVNAFSCMI  625

Query  1890  SANP  1901
             SA+P
Sbjct  626   SASP  629


 Score =   261 bits (666),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            +G  + TV+     S+E+EAWDLLR S+VYYCGNP+GTIAANDPNDS+ILNYDQVFIRDF
Sbjct  143  SGSITNTVHKVWAKSVEDEAWDLLRESIVYYCGNPVGTIAANDPNDSTILNYDQVFIRDF  202

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            IPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++A
Sbjct  203  IPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSA  262

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  263  TEEVLDPDFGEAAIGRVAPVDSGLW  287



>ref|XP_004291628.1| PREDICTED: uncharacterized protein LOC101292085 [Fragaria vesca 
subsp. vesca]
Length=641

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/374 (79%), Positives = 336/374 (90%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  266   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  325

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREMLAPE+AS DL+ AL +R
Sbjct  326   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLGAREMLAPEDASADLMQALKNR  385

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLVD+MPSKGGYL
Sbjct  386   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVDFMPSKGGYL  445

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDL++AKWE+LVA+MP KICYPALE
Sbjct  446   IGNLQPAHMDFRFFSLGNLWSIVSSLATLEQSHAILDLVDAKWEELVADMPFKICYPALE  505

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  AIK+AE+RI+ DK
Sbjct  506   GREWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIASKAIKLAEKRISQDK  565

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+L+QTWS+AGYLVAKLL+ NP AAK ++  ED+EL++AFS ++
Sbjct  566   WPEYYDTKRARFIGKQAQLYQTWSVAGYLVAKLLLDNPSAAKNIVNEEDSELVNAFSCMI  625

Query  1890  SANPRRKRSRKGAV  1931
             S+NPRRKRS K  +
Sbjct  626   SSNPRRKRSWKKQI  639


 Score =   248 bits (632),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +1

Query  361  NGQ-TSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRD  537
            NG+  +A +N      IE+E W LLR SMVYYC NPIGTIAANDP+    LNYDQVFIRD
Sbjct  142  NGKPAAAAINEDSSKKIEDEGWALLRNSMVYYCNNPIGTIAANDPSSPGTLNYDQVFIRD  201

Query  538  FIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDEN  717
            F+PSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE D+ 
Sbjct  202  FVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEGDDY  261

Query  718  ATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  262  ATEDVLDPDFGEAAIGRVAPVDSGLW  287



>ref|XP_003630134.1| Alkaline/neutral invertase [Medicago truncatula]
 gb|AET04610.1| alkaline/neutral invertase [Medicago truncatula]
Length=645

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 337/380 (89%), Gaps = 8/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  270   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  329

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML PE+ S DLI ALN+R
Sbjct  330   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLTPEDGSADLIRALNNR  389

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+K+LNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  390   LVALSFHIREYYWIDMKRLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  449

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSS+AT +QSHAILDLIEAKW DLVA+MPLKICYPALE
Sbjct  450   IGNLQPAHMDFRFFSLGNLWSVVSSMATEEQSHAILDLIEAKWSDLVADMPLKICYPALE  509

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWP+LLWQL  A +KM RP IA  A+++AERRI+ DK
Sbjct  510   GQEWQIITGSDPKNTPWSYHNGGSWPSLLWQLTAACIKMNRPHIAAKAVEIAERRISRDK  569

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ++LFQTWSIAGYLV+KLL+A+P  A +LIT ED++L++A   ++
Sbjct  570   WPEYYDTKRSRFIGKQSQLFQTWSIAGYLVSKLLLADPSKANILITEEDSDLVNA---LI  626

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             +ANP+ KR RK  +KQ+YIV
Sbjct  627   NANPKGKRGRKN-LKQTYIV  645


 Score =   256 bits (654),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 139/164 (85%), Gaps = 5/164 (3%)
 Frame = +1

Query  319  FED----EQGRSV-HSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAA  483
            FED    EQ + V  S   NG  +  +     NSIEEEAWDLLR S+V YCGNPIGTIAA
Sbjct  128  FEDVQLLEQEKEVLSSNVTNGTVTKNLGTISLNSIEEEAWDLLRESVVNYCGNPIGTIAA  187

Query  484  NDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQG  663
             DPN +++LNYDQVFIRDFIPSG+AFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQG
Sbjct  188  KDPNSTNVLNYDQVFIRDFIPSGVAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQG  247

Query  664  LMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            LMPASFKVRTVPLE D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  248  LMPASFKVRTVPLEGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  291



>ref|XP_009404816.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=635

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 331/380 (87%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  257   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  316

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREMLAPE+ S DLI ALN+R
Sbjct  317   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLAPEDGSADLIRALNNR  376

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFH +EYYW+D +KLNEIYRYK EEYSY+A+NKFNIYPDQI PWLV+WMP KGGY 
Sbjct  377   LIALSFHTQEYYWVDKRKLNEIYRYKQEEYSYDAVNKFNIYPDQISPWLVEWMPDKGGYF  436

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+VSSLATT QSHAILDLIEAKW DLVA+MPLKICYPALE
Sbjct  437   IGNLQPAHMDFRFFSLGNLWSVVSSLATTHQSHAILDLIEAKWSDLVADMPLKICYPALE  496

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQLAVA +KM RPEIA  AI VAERR+A DK
Sbjct  497   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLAVACIKMNRPEIAAKAIDVAERRLATDK  556

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA L+QTWSIAG+LVAKLL+  P+AA+ +   ED E+++A + + 
Sbjct  557   WPEYYDTKRARFIGKQAHLYQTWSIAGFLVAKLLIEKPDAARNIWNDEDAEIVNALNIMA  616

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              +NPRRKR RK  +K++YIV
Sbjct  617   DSNPRRKRGRK-VLKKTYIV  635


 Score =   241 bits (616),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 147/194 (76%), Gaps = 8/194 (4%)
 Frame = +1

Query  238  VRDFYGLEKPKLLRCYCRPAERGNERIFEDEQGRSV-----HSIAPNGQTS-ATVNNALP  399
            V D  G+      R +   +     +I  D  G+ V      S+ PN + S  +      
Sbjct  85   VDDADGMTSGDANRTWFTESVSQANQILGDLNGQKVISFENGSVMPNNEASNHSSYKTRG  144

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS--ILNYDQVFIRDFIPSGIAFLLKG  573
            NSIE+EAW LL+ S+VYYCG+P+GTIAA DP+DSS   LNYDQVFIRDFIPSG+AFLLKG
Sbjct  145  NSIEDEAWRLLQDSVVYYCGSPVGTIAAKDPSDSSSNCLNYDQVFIRDFIPSGMAFLLKG  204

Query  574  EYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGE  753
            EYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGE
Sbjct  205  EYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGE  264

Query  754  AAIGRVAPVDSGMF  795
            AAIGRVAPVDSG++
Sbjct  265  AAIGRVAPVDSGLW  278



>ref|XP_009364876.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=624

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/374 (79%), Positives = 333/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCS DLS+ ER+DVQTG+KMILKLCLADG
Sbjct  249   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSRDLSVQERVDVQTGIKMILKLCLADG  308

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLC REMLAPEEAS DL+ ALN+R
Sbjct  309   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCVREMLAPEEASADLVRALNNR  368

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  369   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  428

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLIEAKW++LVA+MP KICYPALE
Sbjct  429   IGNLQPAHMDFRFFSLGNLWSIVSSLATDLQSHAILDLIEAKWDELVADMPFKICYPALE  488

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ DK
Sbjct  489   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDK  548

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+L+QTWS+AGYLVAKLL+ANP AAK L+  ED+EL++AFS ++
Sbjct  549   WPEYYDTKRARFIGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMI  608

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  609   SASPRRKRGWKKQI  622


 Score =   248 bits (632),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW LL+ SMVYYC NP+GTIAANDP+  S LNYDQVFIRDFIPSGIAFLLKGEYDI
Sbjct  141  IEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDI  200

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL+ DE ATEDVLDPDFGEAAIG
Sbjct  201  VRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDEFATEDVLDPDFGEAAIG  260

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  261  RVAPVDSGLW  270



>gb|EMT12815.1| hypothetical protein F775_30387 [Aegilops tauschii]
Length=591

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/381 (79%), Positives = 333/381 (87%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS  ERIDVQTG+K+ILKLCLADG
Sbjct  212   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSFHERIDVQTGIKLILKLCLADG  271

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSALLCAREML PE+ S DLI ALN+R
Sbjct  272   FDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREMLTPEDGSADLIRALNNR  331

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P +GGYL
Sbjct  332   LMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPEGGYL  391

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDL+EAKW DLVA MPLKICYPALE
Sbjct  392   IGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWSDLVAEMPLKICYPALE  451

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A++VAERRI+ DK
Sbjct  452   DQEWKYITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVEVAERRISTDK  511

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQARLFQTWSIAG+LVAKLL+ NPE +++L   ED E  +AF+ + 
Sbjct  512   WPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILCNNEDEEFANAFNLMA  571

Query  1890  -SANPRRKRSRKGAVKQSYIV  1949
              S NP RKR RK A K++YIV
Sbjct  572   DSCNPNRKRGRK-APKKTYIV  591


 Score =   236 bits (601),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 1/133 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +EEEAW LLR S+V YCG+P+GTIAA DPNDSS LNYDQVFIRDF+PSGIAFLLKGEY
Sbjct  101  SDLEEEAWALLRESVVSYCGSPVGTIAACDPNDSSPLNYDQVFIRDFVPSGIAFLLKGEY  160

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEND-ENATEDVLDPDFGEA  756
            DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPLE D E ATE+VLDPDFGEA
Sbjct  161  DIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLEGDEEGATEEVLDPDFGEA  220

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  221  AIGRVAPVDSGLW  233



>gb|EMS48943.1| hypothetical protein TRIUR3_16260 [Triticum urartu]
Length=659

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/393 (77%), Positives = 337/393 (86%), Gaps = 6/393 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS  ERIDVQTG+K+ILKLCLADG
Sbjct  210   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSFHERIDVQTGIKLILKLCLADG  269

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSALLCAREML PE+ S DLI ALN+R
Sbjct  270   FDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREMLTPEDGSADLIRALNNR  329

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P +GGYL
Sbjct  330   LMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPEGGYL  389

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDL+EAKW DLVA MPLKICYPALE
Sbjct  390   IGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWSDLVAEMPLKICYPALE  449

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A++VAERRI+ DK
Sbjct  450   DQEWKYITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAARAVEVAERRISADK  509

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQARLFQTWSIAG+LVAKLL+ NPE +++L   ED E  +AF+ + 
Sbjct  510   WPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILCNNEDEEFANAFNLMA  569

Query  1890  -SANPRRKRSRKGAVKQSYIV*VHYPVFFVVSQ  1985
              S +P RKR RK A K++YIV   +   F + Q
Sbjct  570   DSCSPNRKRGRK-APKKTYIVFSQHSAAFTLPQ  601


 Score =   236 bits (602),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 1/133 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +EEEAW LLR S+V YCG+P+GTIAA DPNDSS LNYDQVFIRDF+PSGIAFLLKGEY
Sbjct  99   SDLEEEAWALLRESVVSYCGSPVGTIAACDPNDSSPLNYDQVFIRDFVPSGIAFLLKGEY  158

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEND-ENATEDVLDPDFGEA  756
            DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPLE D E ATE+VLDPDFGEA
Sbjct  159  DIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLEGDEEGATEEVLDPDFGEA  218

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  219  AIGRVAPVDSGLW  231



>ref|XP_001754878.1| predicted protein [Physcomitrella patens]
 gb|EDQ80332.1| predicted protein [Physcomitrella patens]
Length=606

 Score =   550 bits (1418),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/355 (71%), Positives = 297/355 (84%), Gaps = 4/355 (1%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKC+GD+SL ER+DVQTG+KMILK+CLADGFDMFPTLLVTDGSCMIDR
Sbjct  250   SGLWWIILLRAYGKCTGDISLQERVDVQTGIKMILKVCLADGFDMFPTLLVTDGSCMIDR  309

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFY AL CARE+L PE+ + DLI  +N+RL ALSFHI+EYYW+D+ K
Sbjct  310   RMGIHGHPLEIQALFYQALRCAREILVPEDGAGDLIRQINARLAALSFHIQEYYWLDISK  369

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRYKTEEYS EA+NKFNIYP+Q+  WL+DWMP  GGY IGNLQPAHMDFR+F+LGN
Sbjct  370   VNEIYRYKTEEYSTEAVNKFNIYPEQVSQWLLDWMPETGGYFIGNLQPAHMDFRWFALGN  429

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             +WSI S LAT +Q+  IL L+E+KW+DL+A MP+KIC+PAL   EWRIITG DPKNT WS
Sbjct  430   MWSICSGLATENQAEDILKLVESKWDDLIATMPMKICFPALTEDEWRIITGADPKNTAWS  489

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ   A +KM RP++AE AI++AE+R++ D+WPEYYDTK+G FIGKQAR
Sbjct  490   YHNGGSWPTLLWQFTTACIKMNRPDLAERAIEIAEKRLSRDRWPEYYDTKKGRFIGKQAR  549

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGA  1928
             L+QTWSIAGYL +KLL  NP+AA  L   ED      ++ +L ANP  KR  K +
Sbjct  550   LYQTWSIAGYLTSKLLSKNPDAANWLTCEEDDH----YAILLEANPNLKRKFKAS  600


 Score =   222 bits (566),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            GQ  ++      +++E EAWDLLR ++V YCG P+GTIAANDP D   LNYDQVFIRDFI
Sbjct  109  GQNGSSDGAVAESNLEREAWDLLRDAVVTYCGEPVGTIAANDPTDPHPLNYDQVFIRDFI  168

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDEN-A  720
            PS IAFLLKGE +IVRNFLLHTLQLQSWEKT+DCY PGQGLMPASFKVRTV L+ DE   
Sbjct  169  PSAIAFLLKGETEIVRNFLLHTLQLQSWEKTVDCYCPGQGLMPASFKVRTVYLDGDETKG  228

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
            TE++LDPDFGEAAIGRVAPVDSG++
Sbjct  229  TEEILDPDFGEAAIGRVAPVDSGLW  253



>ref|XP_007159781.1| hypothetical protein PHAVU_002G266600g [Phaseolus vulgaris]
 gb|ESW31775.1| hypothetical protein PHAVU_002G266600g [Phaseolus vulgaris]
Length=644

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 336/380 (88%), Gaps = 8/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  269   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  328

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  329   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  388

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRY TEEYSY+A+NKFNIYPDQI  WLV+WMP+KGGYL
Sbjct  389   LVALSFHIREYYWIDMKKLNEIYRYTTEEYSYDAVNKFNIYPDQISSWLVEWMPNKGGYL  448

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+V+SLAT +QSHAILDLIEAKW DLVA+MP KICYPAL+
Sbjct  449   IGNLQPAHMDFRFFSLGNLWSVVNSLATVEQSHAILDLIEAKWSDLVADMPFKICYPALD  508

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KMKR  IA  A+++AERRI+ D+
Sbjct  509   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTVACIKMKRTHIAAKAVEIAERRISRDR  568

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR   IGKQ+RL+QTWSIAGYLVAKLL+A+P  A +LIT ED+EL++A   ++
Sbjct  569   WPEYYDTKRSRLIGKQSRLYQTWSIAGYLVAKLLLADPSKANILITEEDSELVNA---LI  625

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR KR RK  +KQ+YIV
Sbjct  626   SANPRGKRGRKN-LKQTYIV  644


 Score =   249 bits (637),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +1

Query  319  FEDEQGRSVHS--IAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDP  492
            FED Q   +    +  +  ++ T+ ++   SIEEEAWDLLR S+VYYC NPIGTIAA DP
Sbjct  130  FEDVQVHQLKQKEVLASNVSNGTIKDSFDISIEEEAWDLLRESVVYYCNNPIGTIAAKDP  189

Query  493  NDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMP  672
              S+ LNYDQVFIRDFIPSG+AFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPGQGLMP
Sbjct  190  TSSNTLNYDQVFIRDFIPSGVAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPGQGLMP  249

Query  673  ASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  250  ASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  290



>ref|XP_008355223.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
 ref|XP_008355224.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
 ref|XP_008355225.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
Length=652

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/374 (79%), Positives = 333/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  277   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  336

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEAS DL+ ALN+R
Sbjct  337   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASADLVRALNNR  396

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+AL FHIRE+YWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  397   LVALXFHIREHYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  456

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLIEAKW++LVA+MP KICYPALE
Sbjct  457   IGNLQPAHMDFRFFSLGNLWSIVSSLATDLQSHAILDLIEAKWDELVADMPFKICYPALE  516

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ D 
Sbjct  517   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDN  576

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+L+QTWS+AGYLVAKLL+ANP AAK L+  ED+EL++AFS ++
Sbjct  577   WPEYYDTKRARFIGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMI  636

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  637   SASPRRKRGWKKQI  650


 Score =   247 bits (631),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 149/214 (70%), Gaps = 41/214 (19%)
 Frame = +1

Query  274  LRCYCRPAE--RG------NERIFEDEQGRSVHSIAPNGQTSATVN--------------  387
            + C C+ AE  RG      +  +F D+  ++V S+ PNG TS  ++              
Sbjct  86   MSCKCQQAESLRGATEEDQHGAVFVDKSDKAV-SVPPNGITSPDIDELKVDQQLNQEVGG  144

Query  388  ---NALPNS---------------IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
               N  P +               IEEEAW LL+ SMVYYC NP+GTIAANDP+    LN
Sbjct  145  FGSNTKPTAARKKKGSTRKSKADLIEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPGTLN  204

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRT
Sbjct  205  YDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  264

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ DE ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  265  VPLDGDEFATEDVLDPDFGEAAIGRVAPVDSGLW  298



>ref|XP_008788363.1| PREDICTED: alkaline/neutral invertase CINV1 [Phoenix dactylifera]
 ref|XP_008788372.1| PREDICTED: alkaline/neutral invertase CINV1 [Phoenix dactylifera]
Length=633

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/381 (79%), Positives = 334/381 (88%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  254   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  313

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  314   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  373

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY 
Sbjct  374   LIALSFHIREYYWVDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWVPDKGGYF  433

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  434   IGNLQPAHMDFRFFSLGNLWSIVSSLATVHQSHAILDLIEAKWSDLVADMPFKICYPALE  493

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN G+WPTLLWQLAVA +KM RPEIA  A++VAE+RIA DK
Sbjct  494   GQEWRIITGSDPKNTPWSYHNGGAWPTLLWQLAVACIKMNRPEIAARAVEVAEKRIAADK  553

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  F+GKQ+RL QTWSIAG+LVAKLL+ NP AAK L   ED E+L+A + + 
Sbjct  554   WPEYYDTKQARFLGKQSRLHQTWSIAGFLVAKLLLDNPNAAKTLWNDEDAEILNALNIMG  613

Query  1890  S-ANPRRKRSRKGAVKQSYIV  1949
               +NPRRKR RK  +K++YIV
Sbjct  614   DPSNPRRKRGRK-VLKKTYIV  633


 Score =   249 bits (635),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 179/281 (64%), Gaps = 44/281 (16%)
 Frame = +1

Query  67   MGV--PALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSFRVKCSKDLGKITSSSK  228
            MG+   AL V+PG     F   CS    + S L +     GK  + KCS +L   ++  +
Sbjct  1    MGISEAALHVVPGPAPRHF---CSGLYINTSQLSIPSKPSGKYRKKKCSVNLRSQSNCMR  57

Query  229  LCAVRDFYGLEKPKLLRCYCR--------------------PAERGNERIFEDEQGRSVH  348
            +C V  +    + + L+C C+                    PA + ++ IF D   + V 
Sbjct  58   VCGV--WVINSRSESLKCRCQMTEDITGMTSNDGNGAWLKEPASKASQ-IFADVNSQKVI  114

Query  349  SIAPN------------GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDP  492
             +               G     ++    NS+E+EAW LL+ S+VYYCG+P+GTIAA DP
Sbjct  115  GLENGPAVAIDDKSVLAGSAKHAMHKKRGNSVEDEAWSLLQESVVYYCGSPVGTIAAKDP  174

Query  493  NDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMP  672
            +DS++LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMP
Sbjct  175  SDSNVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMP  234

Query  673  ASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ASFKVRTVPL+ D+ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  235  ASFKVRTVPLDGDDLATEEVLDPDFGEAAIGRVAPVDSGLW  275



>dbj|BAJ89009.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=593

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/381 (78%), Positives = 333/381 (87%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL+  ERIDVQTG+K+ILKLCLADG
Sbjct  214   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTFHERIDVQTGIKLILKLCLADG  273

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCM+DRRMGIHGHPLEIQ+LFYSALLCAREML PE+ S DLI ALNSR
Sbjct  274   FDMFPTLLVTDGSCMMDRRMGIHGHPLEIQSLFYSALLCAREMLTPEDGSADLIRALNSR  333

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P +GGYL
Sbjct  334   LMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPEGGYL  393

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDL+EAKW DLVA MPLKICYPALE
Sbjct  394   IGNLQPAHMDFRFFSLGNLWSIVSSLATTRQSHAILDLVEAKWSDLVAEMPLKICYPALE  453

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A++VAERRI+ DK
Sbjct  454   DQEWKYITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAARAVEVAERRISVDK  513

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKRG FIGKQARLFQTWSIAG+LVAKLL+ NPE +++L   ED E  +AF+ + 
Sbjct  514   WPEYYDTKRGRFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILCNNEDEEFANAFNLMA  573

Query  1890  -SANPRRKRSRKGAVKQSYIV  1949
              S NP RKR RK A+K++YIV
Sbjct  574   DSCNPNRKRGRK-ALKKTYIV  593


 Score =   236 bits (602),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 1/133 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +EEEAW LLR S+V YCG+P+GTIAA DPNDSS LNYDQVFIRDF+PSGIAFLLKGEY
Sbjct  103  SDLEEEAWGLLRESVVSYCGSPVGTIAACDPNDSSPLNYDQVFIRDFVPSGIAFLLKGEY  162

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE-NDENATEDVLDPDFGEA  756
            DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPLE +DE ATE+VLDPDFGEA
Sbjct  163  DIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLEGDDEGATEEVLDPDFGEA  222

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  223  AIGRVAPVDSGLW  235



>ref|XP_007208045.1| hypothetical protein PRUPE_ppa002614mg [Prunus persica]
 gb|EMJ09244.1| hypothetical protein PRUPE_ppa002614mg [Prunus persica]
Length=652

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/374 (79%), Positives = 332/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  277   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  336

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+AS DL+ ALN+R
Sbjct  337   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNR  396

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  397   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  456

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILDLIEAKW++LVA+MP KICYPALE
Sbjct  457   IGNLQPAHMDFRFFSLGNLWSIVSSLATLDQSHAILDLIEAKWDELVADMPFKICYPALE  516

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ D 
Sbjct  517   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVELAEKRISLDN  576

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+LFQTWS AGYLVAK+L+ANP AAK L+  ED+EL + FS ++
Sbjct  577   WPEYYDTKRARFIGKQAQLFQTWSAAGYLVAKILLANPSAAKNLVNEEDSELANIFSCMI  636

Query  1890  SANPRRKRSRKGAV  1931
             S++PRRKR  K  +
Sbjct  637   SSSPRRKRGWKKQI  650


 Score =   252 bits (643),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 145/213 (68%), Gaps = 39/213 (18%)
 Frame = +1

Query  274  LRCYCRPAERGNERIFEDEQ-------GRSVHSIAPNGQTSATVN---------------  387
            + C C+ AE       ED+             SI PNG TS  +N               
Sbjct  86   MSCKCQKAESLTGATAEDQHRDLLVDDSDKATSIPPNGITSPGINEFEVDQQLKHEKGGL  145

Query  388  --NALP---------------NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNY  516
              N  P               NSIE+EAW LL+ SMVYYC NPIGTIAAN+PN +S LNY
Sbjct  146  GSNGKPATAGKHKESRQKVRTNSIEDEAWKLLKNSMVYYCNNPIGTIAANNPNSTSTLNY  205

Query  517  DQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV  696
            DQVFIRDFIPSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV
Sbjct  206  DQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTV  265

Query  697  PLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PL+ D+ ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  266  PLDGDDFATEDVLDPDFGEAAIGRVAPVDSGLW  298



>ref|XP_007035889.1| Neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY06815.1| Neutral invertase isoform 1 [Theobroma cacao]
Length=677

 Score =   557 bits (1436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/355 (71%), Positives = 297/355 (84%), Gaps = 0/355 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK +GD +L ER+DVQTG+ +IL LCL DGFDMFP+LLVTDGSCMIDR
Sbjct  321   SGLWWIILLRAYGKITGDYTLQERVDVQTGISLILNLCLTDGFDMFPSLLVTDGSCMIDR  380

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSAL C+REML   +A+ +L+ A+NSRL ALSFHIREYYW+D+KK
Sbjct  381   RMGIHGHPLEIQALFYSALRCSREMLTVNDATKNLVAAINSRLSALSFHIREYYWVDMKK  440

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGY IGNLQPAHMDFRFF+LGN
Sbjct  441   INEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPDEGGYFIGNLQPAHMDFRFFTLGN  500

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW+IVSSL T+ Q+  +L+LIEAKW+D VANMPLKI YPALE  EWRIITG DPKNTPWS
Sbjct  501   LWAIVSSLGTSKQNEDVLNLIEAKWDDFVANMPLKIIYPALESDEWRIITGSDPKNTPWS  560

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  VA +KM +PE+A+ A+ +AE R++ D+WPEYYDT+ G FIGKQ+R
Sbjct  561   YHNGGSWPTLLWQFTVACIKMGKPELAQKAVALAEERLSADQWPEYYDTRSGKFIGKQSR  620

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRKRSRKGA  1928
             LFQTW++AG+L +K+L+ NP+ A +L   ED ELL      L    RRK SR  A
Sbjct  621   LFQTWTVAGFLTSKMLLQNPQKASLLFWEEDYELLETCVCGLGKTGRRKCSRLAA  675


 Score =   214 bits (544),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 126/172 (73%), Gaps = 6/172 (3%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVN------NALPNSIEEEAWDLLRASMVYYCG  459
            E GN  + ED  G  V+    N      +N          + IE+EAW +LR ++V YCG
Sbjct  153  ETGNGLVKEDNTGIDVNESGVNIDNVKGLNLTETEIEREVSEIEKEAWKILRGAVVNYCG  212

Query  460  NPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTM  639
            +P+GT+AANDP D   LNYDQ+FIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEKT+
Sbjct  213  HPVGTVAANDPADKQPLNYDQIFIRDFVPSALAFLLNGEPEIVKNFLLHTLQLQSWEKTV  272

Query  640  DCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            DCYSPGQGLMPASFKVRT PL+    A E+VLD DFGE+AIGRVAPVDSG++
Sbjct  273  DCYSPGQGLMPASFKVRTAPLDGSSEAFEEVLDADFGESAIGRVAPVDSGLW  324



>ref|XP_006580314.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
 gb|KHN34021.1| hypothetical protein glysoja_030475 [Glycine soja]
Length=652

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 336/380 (88%), Gaps = 8/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMIL+LCLADG
Sbjct  277   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILRLCLADG  336

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAR ML PE+ S DLI ALN+R
Sbjct  337   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCARGMLTPEDGSADLIQALNNR  396

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID+KKLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP+KGGYL
Sbjct  397   LVALSFHIREYYWIDLKKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPNKGGYL  456

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWS+V+SLAT +QSHAILDLIEAKW DLVA MP KICYPAL+
Sbjct  457   IGNLQPAHMDFRFFSLGNLWSVVNSLATEEQSHAILDLIEAKWSDLVAEMPFKICYPALD  516

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHNAGSWPTLLWQL  A +KMKR  IA  A+++AERRI+ D+
Sbjct  517   GQEWQIITGSDPKNTPWSYHNAGSWPTLLWQLTAACIKMKRTHIAAKAVEIAERRISRDR  576

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ++L+QTWSIAGYLVAKLL+A+P  A +LIT ED+EL++A   ++
Sbjct  577   WPEYYDTKRSRFIGKQSQLYQTWSIAGYLVAKLLLADPSKANILITEEDSELVNA---LI  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             SANPR KR RK  ++Q+YIV
Sbjct  634   SANPRGKRGRKN-LRQTYIV  652


 Score =   256 bits (654),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 138/166 (83%), Gaps = 7/166 (4%)
 Frame = +1

Query  319  FEDEQGRSVH-------SIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            FED Q + +        S   NG    + N    NSIEEEAWDLLR S+VYYCGNPIGTI
Sbjct  133  FEDVQAQQLKREKEVLASNLTNGSIKGSFNTIDLNSIEEEAWDLLRESVVYYCGNPIGTI  192

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AA DP  S++LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDC+SPG
Sbjct  193  AAKDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCHSPG  252

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPL+ D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  253  QGLMPASFKVRTVPLDGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  298



>ref|XP_009364274.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=624

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/374 (79%), Positives = 333/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCS DLS+ ER+DVQTG+KMILKLCLADG
Sbjct  249   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSRDLSVQERVDVQTGIKMILKLCLADG  308

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLC REMLAPEEAS DL+ ALN+R
Sbjct  309   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCVREMLAPEEASADLVRALNNR  368

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  369   LVALSFHIREYYWIDMRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  428

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLI+AKW++LVA+MP KICYPALE
Sbjct  429   IGNLQPAHMDFRFFSLGNLWSIVSSLATDLQSHAILDLIDAKWDELVADMPFKICYPALE  488

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ DK
Sbjct  489   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEIAEKRISIDK  548

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+L+QTWS+AGYLVAKLL+ANP AAK L+  ED+EL++AFS ++
Sbjct  549   WPEYYDTKRARFIGKQAQLYQTWSVAGYLVAKLLLANPSAAKNLVNEEDSELINAFSCMI  608

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  609   SASPRRKRGWKKQI  622


 Score =   245 bits (626),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW LL+ SMVYYC NP+GTIAANDP+  S LNYDQVFIRDFIPSGIAFLLKGEYDI
Sbjct  141  IEEEAWTLLKNSMVYYCNNPVGTIAANDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDI  200

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNF+LHTLQLQSWEKTMDCYSPGQGL+PASFKVRTVPL+ DE ATEDVLDPDFGEAAIG
Sbjct  201  VRNFILHTLQLQSWEKTMDCYSPGQGLIPASFKVRTVPLDGDEFATEDVLDPDFGEAAIG  260

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  261  RVAPVDSGLW  270



>ref|XP_008227420.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
 ref|XP_008227431.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=652

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/374 (79%), Positives = 332/374 (89%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADG
Sbjct  277   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADG  336

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+AS DL+ ALN+R
Sbjct  337   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDASADLMRALNNR  396

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID++KLNEIYRY+TEEYSY+A+NKFNIYPDQIP WLV +MPS GGYL
Sbjct  397   LVALSFHIREYYWIDMRKLNEIYRYQTEEYSYDAVNKFNIYPDQIPSWLVGFMPSTGGYL  456

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT DQSHAILDLIEAKW++LVA+MP KICYPALE
Sbjct  457   IGNLQPAHMDFRFFSLGNLWSIVSSLATLDQSHAILDLIEAKWDELVADMPFKICYPALE  516

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A+++AE+RI+ D 
Sbjct  517   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVELAEKRISLDN  576

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQA+LFQTWS AGYLVAKLL+ANP AAK L+  ED+EL + FS ++
Sbjct  577   WPEYYDTKRARFIGKQAQLFQTWSAAGYLVAKLLLANPSAAKNLVNEEDSELANIFSCMI  636

Query  1890  SANPRRKRSRKGAV  1931
             S++PRRKR  K  +
Sbjct  637   SSSPRRKRGWKKQI  650


 Score =   251 bits (642),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +1

Query  355  APNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            A  G+  A+      NSIE+EAW LL+ S+VYYC NPIGTIAAN+PN +S LNYDQVFIR
Sbjct  152  ATAGKHKASTQKVRTNSIEDEAWKLLKNSVVYYCNNPIGTIAANNPNSTSTLNYDQVFIR  211

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIP+GIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL+ D+
Sbjct  212  DFIPTGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLDGDD  271

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
             ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  272  FATEDVLDPDFGEAAIGRVAPVDSGLW  298



>ref|XP_010940279.1| PREDICTED: alkaline/neutral invertase CINV1 isoform X2 [Elaeis 
guineensis]
 ref|XP_010940288.1| PREDICTED: alkaline/neutral invertase CINV1 isoform X2 [Elaeis 
guineensis]
Length=633

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/381 (78%), Positives = 335/381 (88%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  254   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  313

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAP + S DLI ALN+R
Sbjct  314   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPGDGSADLIRALNNR  373

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYK EEYSY+A+NKFNIYPDQI PWLV+WMP KGGYL
Sbjct  374   LIALSFHIREYYWVDMRKLNEIYRYKQEEYSYDAVNKFNIYPDQISPWLVEWMPDKGGYL  433

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  434   IGNLQPAHMDFRFFSLGNLWSIVSSLATVNQSHAILDLIEAKWSDLVADMPFKICYPALE  493

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN G+WPTLLWQLAVA +KM RPEIA  A++VAE+RIA DK
Sbjct  494   GQEWRIITGSDPKNTPWSYHNGGAWPTLLWQLAVACIKMNRPEIAARAVEVAEKRIAADK  553

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQ++L QTWSIAG+LVAKLL+ NP AAK L   ED E+++A + ++
Sbjct  554   WPEYYDTKQARFIGKQSQLHQTWSIAGFLVAKLLLDNPVAAKTLWNDEDAEIINALNIMV  613

Query  1890  S-ANPRRKRSRKGAVKQSYIV  1949
               +NP+RKR RK  +K++YI+
Sbjct  614   DPSNPKRKRGRK-VLKKTYII  633


 Score =   249 bits (635),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 174/277 (63%), Gaps = 36/277 (13%)
 Frame = +1

Query  67   MGV--PALQVLPGELSCRFIRRCSSN-SLLLLKDHFKGKSFRVKCSKDLGKITSSSKLCA  237
            MG+   A+ V+PG     F      N S L +     GK  + KCS  +   ++  ++C 
Sbjct  1    MGISGAAVHVVPGTAPRHFCSGLYINTSQLGISSKPSGKYRKKKCSVYMRSQSNCMRVCG  60

Query  238  VRDFYGLEKPKLLRCYCRPAE--------RGN-----------ERIFEDEQGRSVHSIAP  360
            VR      + K L+C C+  E         GN            +IF D   + V  +  
Sbjct  61   VRVVN--NRSKSLKCQCQMTEGITDMTGKDGNGACLKEPAGKTSQIFTDVNSQKVIGLEN  118

Query  361  N------------GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS  504
                         G     ++    NS+E+EAW LL+ SMVYYCG+P+GTIAA DP+D++
Sbjct  119  GPAMAIDDKSVLAGAAKHAMHKKRGNSVEDEAWSLLQESMVYYCGSPVGTIAAKDPSDNN  178

Query  505  ILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFK  684
            +LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFK
Sbjct  179  VLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFK  238

Query  685  VRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VRT PL+ D+ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  239  VRTAPLDGDDFATEEVLDPDFGEAAIGRVAPVDSGLW  275



>ref|XP_004952630.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=603

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 331/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTGMKMILKLCLADG
Sbjct  231   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGMKMILKLCLADG  290

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  291   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  350

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P KGGY 
Sbjct  351   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPKGGYF  410

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  411   IGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPALE  470

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+A  AI+VAERRIA DK
Sbjct  471   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDK  530

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAG+LVAKLL+  P+AA++L   ED E+L+A S+  
Sbjct  531   WPEYYDTKRARFIGKQSRLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNALST--  588

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  589   ----NRKRGKK-VLKKTYIV  603


 Score =   246 bits (627),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAW+LL+ SMVYYCG+P+GTIAANDPNDS  +NYDQVFIRDFIPSGIAFLLKGEY
Sbjct  121  SSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPVNYDQVFIRDFIPSGIAFLLKGEY  180

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT+PL+ DE+ TE+VLDPDFGEAA
Sbjct  181  EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDEDVTEEVLDPDFGEAA  240

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  241  IGRVAPVDSGLW  252



>ref|XP_009393828.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393829.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
Length=630

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 333/380 (88%), Gaps = 6/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  253   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  312

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL+CAREMLAPE+ S DLI ALN+R
Sbjct  313   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALVCAREMLAPEDGSADLIRALNNR  372

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+WMP KGGY 
Sbjct  373   LIALSFHIREYYWVDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWMPEKGGYF  432

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QS AILDLIEAKW DLVA+MP KICYPALE
Sbjct  433   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSLAILDLIEAKWSDLVADMPFKICYPALE  492

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  AI+VAE+RIA D+
Sbjct  493   GQEWQIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAARAIEVAEKRIAADR  552

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAG+LV KLL+ NP+AA+ +   ED E+++A + I+
Sbjct  553   WPEYYDTKRARFIGKQARLYQTWSIAGFLVVKLLLKNPDAARNIWNDEDAEIVNALNIIV  612

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              +NP RKR RK  +K++YI+
Sbjct  613   DSNP-RKRGRK-VLKKTYII  630


 Score =   236 bits (603),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 175/271 (65%), Gaps = 32/271 (12%)
 Frame = +1

Query  73   VPALQVLPGELSCRFIRRCSSNSLLLLKDHFKGKSFRVKCSKDLGKITSSSKL--CAVRD  246
            V A+  L G +   F     +N+  +   H+K +    + S+ L    S+S++    +RD
Sbjct  6    VVAMHALSGAVPAHFSPSLFANAPHV-AIHYKTRGKYRRKSRALAASCSTSRMRNGCLRD  64

Query  247  FYGLE----KPKLLRCYCRPAER----GNERIFEDEQGRSVHSIAP-NGQTSATVNNA--  393
             YG      +   L+C C+ AE      N+  F +   ++   +   NGQ      N   
Sbjct  65   -YGFRNINNRLLSLKCKCQRAESTSGDANKTWFTEPTSKADQILGELNGQKVVDFENGSV  123

Query  394  -LPN--------------SIEEEAWDLLRASMVYYCGNPIGTIAANDPNDS--SILNYDQ  522
             +PN              S+E+ AW LL+ S+VYYCG P+GTIAA DP+DS  S+LNYDQ
Sbjct  124  IMPNDVSVNQSSDKTRGNSVEDVAWRLLQESVVYYCGTPVGTIAAKDPSDSGSSVLNYDQ  183

Query  523  VFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  702
            VFIRDFIPSG+AFLL GEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFK+RTVPL
Sbjct  184  VFIRDFIPSGMAFLLMGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKIRTVPL  243

Query  703  ENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + D++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  244  DGDDSATEEVLDPDFGEAAIGRVAPVDSGLW  274



>ref|XP_010940271.1| PREDICTED: alkaline/neutral invertase CINV1 isoform X1 [Elaeis 
guineensis]
Length=704

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/381 (78%), Positives = 335/381 (88%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  325   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  384

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAP + S DLI ALN+R
Sbjct  385   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPGDGSADLIRALNNR  444

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYK EEYSY+A+NKFNIYPDQI PWLV+WMP KGGYL
Sbjct  445   LIALSFHIREYYWVDMRKLNEIYRYKQEEYSYDAVNKFNIYPDQISPWLVEWMPDKGGYL  504

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDLIEAKW DLVA+MP KICYPALE
Sbjct  505   IGNLQPAHMDFRFFSLGNLWSIVSSLATVNQSHAILDLIEAKWSDLVADMPFKICYPALE  564

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN G+WPTLLWQLAVA +KM RPEIA  A++VAE+RIA DK
Sbjct  565   GQEWRIITGSDPKNTPWSYHNGGAWPTLLWQLAVACIKMNRPEIAARAVEVAEKRIAADK  624

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQ++L QTWSIAG+LVAKLL+ NP AAK L   ED E+++A + ++
Sbjct  625   WPEYYDTKQARFIGKQSQLHQTWSIAGFLVAKLLLDNPVAAKTLWNDEDAEIINALNIMV  684

Query  1890  S-ANPRRKRSRKGAVKQSYIV  1949
               +NP+RKR RK  +K++YI+
Sbjct  685   DPSNPKRKRGRK-VLKKTYII  704


 Score =   248 bits (634),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 176/283 (62%), Gaps = 40/283 (14%)
 Frame = +1

Query  52   RFLASMGVPALQVLPGELSCRFIRRCS----SNSLLLLKDHFKGKSFRVKCSKDLGKITS  219
            R+   +   A+ V+PG     F   CS    + S L +     GK  + KCS  +   ++
Sbjct  69   RYEMGISGAAVHVVPGTAPRHF---CSGLYINTSQLGISSKPSGKYRKKKCSVYMRSQSN  125

Query  220  SSKLCAVRDFYGLEKPKLLRCYCRPAE--------RGN-----------ERIFEDEQGRS  342
              ++C VR      + K L+C C+  E         GN            +IF D   + 
Sbjct  126  CMRVCGVRVVN--NRSKSLKCQCQMTEGITDMTGKDGNGACLKEPAGKTSQIFTDVNSQK  183

Query  343  VHSIAPN------------GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAAN  486
            V  +               G     ++    NS+E+EAW LL+ SMVYYCG+P+GTIAA 
Sbjct  184  VIGLENGPAMAIDDKSVLAGAAKHAMHKKRGNSVEDEAWSLLQESMVYYCGSPVGTIAAK  243

Query  487  DPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGL  666
            DP+D+++LNYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGL
Sbjct  244  DPSDNNVLNYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGL  303

Query  667  MPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MPASFKVRT PL+ D+ ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  304  MPASFKVRTAPLDGDDFATEEVLDPDFGEAAIGRVAPVDSGLW  346



>ref|XP_002452195.1| hypothetical protein SORBIDRAFT_04g021550 [Sorghum bicolor]
 gb|EES05171.1| hypothetical protein SORBIDRAFT_04g021550 [Sorghum bicolor]
Length=603

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 330/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTGMKMILKLCLADG
Sbjct  231   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGMKMILKLCLADG  290

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLA E+ S DLI ALN+R
Sbjct  291   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAQEDGSADLIRALNNR  350

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY 
Sbjct  351   LIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGGYF  410

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  411   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  470

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+A  AI+VAERRIA DK
Sbjct  471   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDK  530

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARL+QTWSIAG+LVAKLL+  P+AA++L   ED E+L+A S+  
Sbjct  531   WPEYYDTKRARFIGKQARLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNALST--  588

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  589   ----NRKRGKK-VLKKTYIV  603


 Score =   248 bits (634),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             ++  NG  + +V    P     +S+E+EAW+LL+ SMVYYCG+P+GTIAANDPNDS  +
Sbjct  98   QAVGGNGSLNGSVAKPPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPV  157

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  158  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  217

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  218  TIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  252



>ref|XP_001780432.1| predicted protein [Physcomitrella patens]
 gb|EDQ54722.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   537 bits (1383),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/331 (74%), Positives = 284/331 (86%), Gaps = 0/331 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKC+GD S+ ER+DVQTG+KMILK+CLADGFDMFPTLLVTDGSCMIDR
Sbjct  130   SGLWWIILLRAYGKCTGDKSVQERVDVQTGIKMILKVCLADGFDMFPTLLVTDGSCMIDR  189

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFY AL CARE+L PEE + DLI  +NSRL ALSFHI+EYYW+D+ K
Sbjct  190   RMGIHGHPLEIQALFYHALRCAREILLPEEGAQDLIRQINSRLAALSFHIQEYYWLDIVK  249

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYS EA+NKFNIYP+Q+  WL+DW+P  GGY IGNLQPAHMDFR+F+LGN
Sbjct  250   LNEIYRYKTEEYSTEAVNKFNIYPEQVSQWLLDWLPESGGYFIGNLQPAHMDFRWFTLGN  309

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             +WSI   LAT  QS  IL L+E+KW+DLVA MP+KIC+PAL  +EWRIITG DPKNT WS
Sbjct  310   MWSICGGLATPKQSENILRLVESKWQDLVATMPIKICFPALTDEEWRIITGADPKNTAWS  369

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  VA +KM R ++AE A+++AE+R++ D+WPEYYDTK+G FIGKQAR
Sbjct  370   YHNGGSWPTLLWQFTVACIKMNRADLAERAVEIAEKRLSRDRWPEYYDTKKGRFIGKQAR  429

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIED  1856
             L+QTWSIAG+L AKL++ NP AA  L   ED
Sbjct  430   LYQTWSIAGFLTAKLMLKNPNAASWLTCDED  460


 Score =   225 bits (573),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (91%), Gaps = 1/133 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            N++E+EAWDLLR ++V YCG P+GTIAA DP D + LNYDQVFIRDFIPS +AFLLKGE 
Sbjct  1    NALEKEAWDLLREAVVTYCGEPVGTIAAKDPTDPNPLNYDQVFIRDFIPSAVAFLLKGET  60

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE-NDENATEDVLDPDFGEA  756
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV ++ N+EN TE++LDPDFGEA
Sbjct  61   EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVHIDGNEENGTEEILDPDFGEA  120

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  121  AIGRVAPVDSGLW  133



>ref|NP_001047012.1| Os02g0529400 [Oryza sativa Japonica Group]
 sp|Q6H6N5.1|NIN3_ORYSJ RecName: Full=Neutral/alkaline invertase 3, chloroplastic; Short=OsNIN3; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD25431.1| putative alkaline/neutral invertase [Oryza sativa Japonica Group]
 dbj|BAD25614.1| putative alkaline/neutral invertase [Oryza sativa Japonica Group]
 dbj|BAF08926.1| Os02g0529400 [Oryza sativa Japonica Group]
 gb|EAZ23290.1| hypothetical protein OsJ_06987 [Oryza sativa Japonica Group]
 dbj|BAH00419.1| unnamed protein product [Oryza sativa Japonica Group]
Length=606

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 331/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL++ ERIDVQTG+KMILKLCLADG
Sbjct  234   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTVQERIDVQTGIKMILKLCLADG  293

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  294   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  353

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+W+P KGGY 
Sbjct  354   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYF  413

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  414   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  473

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIA  A++VAERRIA DK
Sbjct  474   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMNRPEIAAKAVEVAERRIAIDK  533

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   ED+E+L+A S+  
Sbjct  534   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILSNDEDSEILNALST--  591

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K+++IV
Sbjct  592   ----NRKRGKK-VLKKTFIV  606


 Score =   247 bits (630),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             ++  NG  + +     P     +S+E+EAW+LLR S+VYYCG+P+GTIAANDPND++ +
Sbjct  101  QAVGGNGSVNGSAAKPPPQRRKASSVEDEAWELLRESVVYYCGSPVGTIAANDPNDANPM  160

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  161  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  220

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  221  TIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  255



>ref|XP_006647331.1| PREDICTED: alkaline/neutral invertase CINV2-like [Oryza brachyantha]
Length=608

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 330/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  236   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  295

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  296   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  355

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY 
Sbjct  356   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGGYF  415

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  416   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  475

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIA  A++VAERRIA DK
Sbjct  476   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMNRPEIAAKAVEVAERRIAIDK  535

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   ED E+L+A S+  
Sbjct  536   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILWNDEDAEILNALST--  593

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K+++IV
Sbjct  594   ----NRKRGKK-VLKKTFIV  608


 Score =   248 bits (634),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 178/267 (67%), Gaps = 34/267 (13%)
 Frame = +1

Query  67   MGVP--ALQVLPGELSCRFIRRCSSNSLLLLKDHFKGKSFRVKCSKDLGKITSSSKLCAV  240
            MG+   AL  +PG  +  F     ++SL L+ D  +G+  +V    ++  + +S  L   
Sbjct  1    MGIAEVALHTMPG--AGAFAGHSPASSLPLVADA-RGRRRKV----NINSLPNSRALRGP  53

Query  241  RDFYGLEKPKLLRCYCRPAE------RGNERIFEDEQGRSVHS-----------IAPNGQ  369
              + GL       C C+  +       GN    +D   ++ H+           I  NG 
Sbjct  54   ARYSGLRSAV---CQCQRLDDLARVTEGNGTWVKDAVDKASHALGDVSVPPGQAIGGNGS  110

Query  370  TSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
             + +   + P     +S+E+E W+LLR SMVYYCG+P+GTIAANDPND++ +NYDQVFIR
Sbjct  111  LNGSAVKSPPQRCKVSSVEDEGWELLRESMVYYCGSPVGTIAANDPNDANPMNYDQVFIR  170

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DFIPSG+AFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT+PL+ DE
Sbjct  171  DFIPSGVAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDE  230

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  231  DATEEVLDPDFGEAAIGRVAPVDSGLW  257



>ref|XP_008661659.1| PREDICTED: uncharacterized protein LOC100274465 isoform X1 [Zea 
mays]
 gb|ACF84899.1| unknown [Zea mays]
 gb|ACG27641.1| alkaline/neutral invertase [Zea mays]
 gb|AFW55780.1| alkaline/neutral invertase isoform 1 [Zea mays]
 gb|AFW55781.1| alkaline/neutral invertase isoform 2 [Zea mays]
Length=601

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 329/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTGMKMILKLCLADG
Sbjct  229   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGMKMILKLCLADG  288

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML  E+ S DLI ALN+R
Sbjct  289   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTQEDGSADLIRALNNR  348

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY 
Sbjct  349   LIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGGYF  408

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  409   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  468

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+A  AI+VAERRIA DK
Sbjct  469   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDK  528

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAG+LVAKLL+  P+AA++L   ED E+L+A S+  
Sbjct  529   WPEYYDTKRARFIGKQSRLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNASST--  586

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  587   ----NRKRGKK-VLKKTYIV  601


 Score =   247 bits (631),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             +++ NG  + +     P     +S+E+EAW+LL+ SMVYYCG+P+GTIAANDPNDS  +
Sbjct  96   QAVSGNGGLNGSAAKTPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPV  155

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  156  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  215

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  216  TIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  250



>gb|EAY86114.1| hypothetical protein OsI_07486 [Oryza sativa Indica Group]
Length=624

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 330/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDL++ ERIDVQTG+KMILKLCLADG
Sbjct  252   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLTVQERIDVQTGIKMILKLCLADG  311

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALN+R
Sbjct  312   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNNR  371

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+W+P KGGY 
Sbjct  372   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYF  431

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  432   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  491

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIA  A++VAERRIA DK
Sbjct  492   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASIKMNRPEIAAKAVEVAERRIAIDK  551

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   ED E+L+A S+  
Sbjct  552   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILSNDEDAEILNALST--  609

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K+++IV
Sbjct  610   ----NRKRGKK-VLKKTFIV  624


 Score =   236 bits (601),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 136/173 (79%), Gaps = 23/173 (13%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             ++  NG  + +     P     +S+E+EAW+LLR S+VYYCG+P+GTIAANDPND++ +
Sbjct  101  QAVGGNGSVNGSAAKPPPQRRKASSVEDEAWELLRESVVYYCGSPVGTIAANDPNDANPM  160

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQ------------------SWEKT  636
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQ                  SWEKT
Sbjct  161  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQVFFFRHIIALSLEEVRTMSWEKT  220

Query  637  MDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MDC+SPGQGLMPASFKVRT+PL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  221  MDCHSPGQGLMPASFKVRTIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  273



>emb|CAM32308.1| neutral/alkaline invertase [Lolium perenne]
Length=603

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 330/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  231   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  290

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREML PE+ S DLI ALN+R
Sbjct  291   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNR  350

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+W+P KGGY 
Sbjct  351   LVALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYF  410

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  411   IGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPALE  470

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EW+IITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIA  A+++AERRIA DK
Sbjct  471   NLEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASLKMNRPEIAAKAVEIAERRIATDK  530

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   EDTE+L+AFS+  
Sbjct  531   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILWNDEDTEILNAFST--  588

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  589   ----NRKRGKK-VLKKTYIV  603


 Score =   248 bits (632),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             +I  N   S      LP     +S+E+EAWDLLR S+V YCG+P+GTIAANDPNDS+  
Sbjct  98   QAIGGNASLSGNPEKVLPRRRNLSSVEDEAWDLLRESVVNYCGSPVGTIAANDPNDSNPA  157

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  158  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  217

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DENATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  218  TIPLDGDENATEEVLDPDFGEAAIGRVAPVDSGLW  252



>emb|CAA05869.1| alkaline/neutral invertase [Lolium temulentum]
Length=571

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 330/380 (87%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  199   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  258

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREML PE+ S DLI ALN+R
Sbjct  259   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNR  318

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+W+P KGGY 
Sbjct  319   LVALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYF  378

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  379   IGNLQPAHMDFRFFSLGNLWSIVSSLATTQQSHAILDLIESKWSDLVAEMPLKICYPALE  438

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EW+IITG DPKNTPWSYHN GSWPTLLWQL VAS+KM RPEIA  A+++AERRIA DK
Sbjct  439   NLEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVASLKMNRPEIAAKAVEIAERRIATDK  498

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   EDTE+L+AFS+  
Sbjct  499   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILWNDEDTEILNAFST--  556

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  557   ----NRKRGKK-VLKKTYIV  571


 Score =   246 bits (628),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             ++  N   S      LP     +S+E+EAWDLLR S+V YCG+P+GTIAANDPNDS+  
Sbjct  66   QALGGNASLSGNPEKVLPRRRNLSSVEDEAWDLLRESVVNYCGSPVGTIAANDPNDSNPA  125

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  126  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  185

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DENATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  186  TIPLDGDENATEEVLDPDFGEAAIGRVAPVDSGLW  220



>ref|XP_003579686.1| PREDICTED: alkaline/neutral invertase CINV1-like [Brachypodium 
distachyon]
Length=584

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/381 (77%), Positives = 330/381 (87%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGD+S  ERIDVQTG+K+ILKLCLADG
Sbjct  205   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDMSFHERIDVQTGIKLILKLCLADG  264

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL ARE+L PE+ S DLI ALNSR
Sbjct  265   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSARELLTPEDGSADLIRALNSR  324

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV+W+P KGGY 
Sbjct  325   LMALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVEWIPPKGGYF  384

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDL+EAKW DLVA MP+KIC+PALE
Sbjct  385   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLVEAKWSDLVAEMPMKICHPALE  444

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+ ITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A++VAERRI+ DK
Sbjct  445   GQEWKFITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMDRPEIAARAVEVAERRISSDK  504

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQARLFQTWSIAG+LVAKLL+ NPE +++L   ED E+L+A S + 
Sbjct  505   WPEYYDTKRARFIGKQARLFQTWSIAGFLVAKLLLENPEKSRILWNNEDEEILNALSLMA  564

Query  1890  SA-NPRRKRSRKGAVKQSYIV  1949
              A N +RKR RK  +K++YIV
Sbjct  565   DASNSKRKRGRK-VLKRTYIV  584


 Score =   229 bits (584),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 5/154 (3%)
 Frame = +1

Query  334  GRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
            G +  S+AP  Q         P  +EEEAW LLR S+V YCG+P+GTIAA DPND+  LN
Sbjct  78   GAAKPSLAPTPQKRRRA----PCDVEEEAWGLLRESVVRYCGSPVGTIAACDPNDACPLN  133

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDF+PSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR 
Sbjct  134  YDQVFIRDFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRV  193

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +PL+ D   TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  194  IPLD-DNGTTEEVLDPDFGEAAIGRVAPVDSGLW  226



>ref|XP_008385536.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
Length=547

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/374 (77%), Positives = 328/374 (88%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGD+S+ ER+DVQTG+KMILKLCLADG
Sbjct  172   VLDPDFGDAAIGRVAPVDSGLWWIILLRAYGKCSGDVSVQERVDVQTGIKMILKLCLADG  231

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREMLAPEEAS DL  ALN+R
Sbjct  232   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLGAREMLAPEEASADLARALNNR  291

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID +KLNEIYRY+TEEYSY+A+NKFNIYPDQIP WL+ +MPS GGYL
Sbjct  292   LVALSFHIREYYWIDSRKLNEIYRYRTEEYSYDAVNKFNIYPDQIPSWLMGFMPSTGGYL  351

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDLIE+KW++LVA MP KICYPALE
Sbjct  352   IGNLQPAHMDFRFFSLGNLWSIVSSLATDEQSHAILDLIESKWDELVAEMPFKICYPALE  411

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+II G DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A++VAE+RI+ D 
Sbjct  412   GQEWQIIAGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEVAEKRISMDN  471

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGK+A+L+QTWS AGYLVAKLL+A+P AAK L+  ED+EL++A S ++
Sbjct  472   WPEYYDTKRARFIGKKAQLYQTWSAAGYLVAKLLLADPSAAKNLVNEEDSELVNALSCMI  531

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  532   SASPRRKRGWKNQI  545


 Score =   242 bits (617),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW LL+ SMVYYC +P+GTIAANDP+  S LNYDQVFIRDFIPSGIAFLLKGEYDI
Sbjct  64   IEEEAWTLLKNSMVYYCNSPVGTIAANDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDI  123

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNF+L+TLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE D+ ATEDVLDPDFG+AAIG
Sbjct  124  VRNFILYTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEGDDFATEDVLDPDFGDAAIG  183

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  184  RVAPVDSGLW  193



>ref|NP_001142296.1| alkaline/neutral invertase isoform 1 [Zea mays]
 gb|ACF88123.1| unknown [Zea mays]
Length=601

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 328/380 (86%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTGMKMILKLCLADG
Sbjct  229   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGMKMILKLCLADG  288

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML  E+ S DLI ALN+R
Sbjct  289   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTQEDGSADLIRALNNR  348

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQI PWLV+W+P KGGY 
Sbjct  349   LIALSFHIREYYWLDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQISPWLVEWIPPKGGYF  408

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  409   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  468

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+A  AI+VAERRIA DK
Sbjct  469   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPELAAKAIEVAERRIATDK  528

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WP YYDTKR  FIGKQ+RL+QTWSIAG+LVAKLL+  P+AA++L   ED E+L+A S+  
Sbjct  529   WPVYYDTKRARFIGKQSRLYQTWSIAGFLVAKLLIEKPDAARILWNDEDAEILNASST--  586

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  587   ----NRKRGKK-VLKKTYIV  601


 Score =   247 bits (631),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALP-----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSIL  510
             +++ NG  + +     P     +S+E+EAW+LL+ SMVYYCG+P+GTIAANDPNDS  +
Sbjct  96   QAVSGNGGLNGSAAKTPPQRRKSSSVEDEAWELLQESMVYYCGSPVGTIAANDPNDSDPV  155

Query  511  NYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVR  690
            NYDQVFIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR
Sbjct  156  NYDQVFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVR  215

Query  691  TVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+PL+ DE+ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  216  TIPLDGDEDATEEVLDPDFGEAAIGRVAPVDSGLW  250



>ref|XP_008349784.1| PREDICTED: alkaline/neutral invertase CINV1-like [Malus domestica]
Length=654

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/374 (77%), Positives = 328/374 (88%), Gaps = 4/374 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGD+S+ ER+DVQTG+KMILKLCLADG
Sbjct  279   VLDPDFGDAAIGRVAPVDSGLWWIILLRAYGKCSGDVSVQERVDVQTGIKMILKLCLADG  338

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREMLAPEEAS DL  ALN+R
Sbjct  339   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLGAREMLAPEEASADLARALNNR  398

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYWID +KLNEIYRY+TEEYSY+A+NKFNIYPDQIP WL+ +MPS GGYL
Sbjct  399   LVALSFHIREYYWIDSRKLNEIYRYRTEEYSYDAVNKFNIYPDQIPSWLMGFMPSTGGYL  458

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT +QSHAILDLIE+KW++LVA MP KICYPALE
Sbjct  459   IGNLQPAHMDFRFFSLGNLWSIVSSLATDEQSHAILDLIESKWDELVAEMPFKICYPALE  518

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEW+II G DPKNTPWSYHN GSWPTLLWQL VA +K+ RPEIA  A++VAE+RI+ D 
Sbjct  519   GQEWQIIAGSDPKNTPWSYHNGGSWPTLLWQLTVACIKLNRPEIAAKAVEVAEKRISMDN  578

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGK+A+L+QTWS AGYLVAKLL+A+P AAK L+  ED+EL++A S ++
Sbjct  579   WPEYYDTKRARFIGKKAQLYQTWSAAGYLVAKLLLADPSAAKNLVNEEDSELVNALSCMI  638

Query  1890  SANPRRKRSRKGAV  1931
             SA+PRRKR  K  +
Sbjct  639   SASPRRKRGWKNQI  652


 Score =   244 bits (624),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +1

Query  301  RGNERIFEDEQGRSVHSIAPNGQTS-ATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            + ++++  ++ G   +S A   + S  +   +  N IEEEAW L++ SMVYYC NPIGTI
Sbjct  135  KADQQLKHEDGGFGSNSKATAARKSKGSTQKSKANLIEEEAWTLIKNSMVYYCNNPIGTI  194

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            A+NDP+  S LNYDQVFIRDFIPSGIAFLLKGEYDIVRNF+L+TLQLQSWEKTMDCYSPG
Sbjct  195  ASNDPSSPSTLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILYTLQLQSWEKTMDCYSPG  254

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTVPLE D+ ATEDVLDPDFG+AAIGRVAPVDSG++
Sbjct  255  QGLMPASFKVRTVPLEGDDFATEDVLDPDFGDAAIGRVAPVDSGLW  300



>gb|EAY94016.1| hypothetical protein OsI_15793 [Oryza sativa Indica Group]
Length=574

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/381 (77%), Positives = 331/381 (87%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  195   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  254

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALNSR
Sbjct  255   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNSR  314

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P KGGY 
Sbjct  315   LIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPKGGYF  374

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT+ QS AILDL+EAKW DLVA+MP+KICYPALE
Sbjct  375   IGNLQPAHMDFRFFSLGNLWSIVSSLATSHQSDAILDLVEAKWSDLVADMPMKICYPALE  434

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNTPWSYHN GSWPTLLWQL VA +K+ R EIA  A++VAERRIA DK
Sbjct  435   DQEWKFITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKVDRSEIAAKAVEVAERRIANDK  494

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RLFQTW+IAG+LVAK L+ NP+ +++L   ED E+L+A + + 
Sbjct  495   WPEYYDTKRARFIGKQSRLFQTWTIAGFLVAKQLLENPDKSRILWNNEDEEILNAMNRMT  554

Query  1890  SA-NPRRKRSRKGAVKQSYIV  1949
              A N +R+R RKG +K++YIV
Sbjct  555   DASNLKRRRGRKG-LKKTYIV  574


 Score =   234 bits (596),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  397  PNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGE  576
            P+ +E+EAW LLR S+V YCG+P+GTIAA DPND+S LNYDQVFIRDF+PSGIAFLLKG+
Sbjct  84   PHDVEDEAWGLLRESVVRYCGSPVGTIAACDPNDASPLNYDQVFIRDFVPSGIAFLLKGD  143

Query  577  YDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEA  756
            Y+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPL+ D++ TE+VLDPDFGEA
Sbjct  144  YEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLDGDDDVTEEVLDPDFGEA  203

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  204  AIGRVAPVDSGLW  216



>ref|XP_006653369.1| PREDICTED: alkaline/neutral invertase CINV2-like [Oryza brachyantha]
Length=574

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/381 (77%), Positives = 329/381 (86%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  195   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  254

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALNSR
Sbjct  255   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNSR  314

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P KGGY 
Sbjct  315   LIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPKGGYF  374

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT+ QS AILDL+EAKW DLVA+MP+KICYPALE
Sbjct  375   IGNLQPAHMDFRFFSLGNLWSIVSSLATSHQSTAILDLVEAKWSDLVADMPMKICYPALE  434

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNT WSYHN GSWPTLLWQL VA +KM R EIA  A++VAERRIA DK
Sbjct  435   DQEWKFITGSDPKNTAWSYHNGGSWPTLLWQLTVACIKMDRSEIAAKAVEVAERRIANDK  494

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RLFQTW+IAGYLVAK L+ NP+ +++L   ED E+L+A + + 
Sbjct  495   WPEYYDTKRARFIGKQSRLFQTWTIAGYLVAKQLLENPDKSRILWNNEDEEILNALNRMT  554

Query  1890  SA-NPRRKRSRKGAVKQSYIV  1949
              A N +R+R RK  +K++YIV
Sbjct  555   DASNLKRRRGRK-VLKKTYIV  574


 Score =   235 bits (599),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +1

Query  334  GRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILN  513
            GRSV+  AP            P  +E+EAW LLR S+V YCG+P+GTIAA DPND+S LN
Sbjct  64   GRSVNGAAPAPAPKRKQRRG-PQDVEDEAWGLLRESVVRYCGSPVGTIAACDPNDASPLN  122

Query  514  YDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRT  693
            YDQVFIRDF+PSG+AFLL+G+Y+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFK+R 
Sbjct  123  YDQVFIRDFVPSGVAFLLRGDYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKIRV  182

Query  694  VPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VPL+ +++ATE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  183  VPLDGEDDATEEVLDPDFGEAAIGRVAPVDSGLW  216



>ref|XP_003575059.1| PREDICTED: alkaline/neutral invertase CINV1 [Brachypodium distachyon]
 ref|XP_010235489.1| PREDICTED: alkaline/neutral invertase CINV1 [Brachypodium distachyon]
Length=603

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/380 (77%), Positives = 327/380 (86%), Gaps = 11/380 (3%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCL DG
Sbjct  231   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLTDG  290

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALL AREML PE+ S DLI ALN+R
Sbjct  291   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLSAREMLTPEDGSADLIRALNNR  350

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+W+P KGGY 
Sbjct  351   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWIPPKGGYF  410

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSLATT QSHAILDLIE+KW DLVA MPLKICYPALE
Sbjct  411   IGNLQPAHMDFRFFALGNLWSIVSSLATTHQSHAILDLIESKWSDLVAEMPLKICYPALE  470

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+IITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIA  A+++AERRIA DK
Sbjct  471   NQEWKIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAAKAVEIAERRIATDK  530

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RL+QTWSIAGYLVAK L+  P+AA++L   ED E+L+A S+  
Sbjct  531   WPEYYDTKRARFIGKQSRLYQTWSIAGYLVAKQLLDKPDAARILWNDEDAEILNALST--  588

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
                  RKR +K  +K++YIV
Sbjct  589   ----NRKRGKK-VLKKTYIV  603


 Score =   240 bits (613),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +S+E+EAWDLLR S+V YCG P+GTIAANDPNDS+  NYDQVFIRDFIPSG+AFLLKGEY
Sbjct  121  SSVEDEAWDLLRDSIVNYCGIPVGTIAANDPNDSNPANYDQVFIRDFIPSGVAFLLKGEY  180

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRT+PL+ D++ATE+VLDPDFGEAA
Sbjct  181  EIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTIPLDGDDDATEEVLDPDFGEAA  240

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  241  IGRVAPVDSGLW  252



>emb|CAE04902.1| OSJNBa0042I15.24 [Oryza sativa Japonica Group]
 emb|CAH66504.1| H0321H01.13 [Oryza sativa Indica Group]
Length=574

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/381 (76%), Positives = 330/381 (87%), Gaps = 6/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  195   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  254

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI ALNSR
Sbjct  255   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSADLIRALNSR  314

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+W+P KGGY 
Sbjct  315   LIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWIPPKGGYF  374

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT+ QS AILDL+EAKW DLVA+MP+KICYPALE
Sbjct  375   IGNLQPAHMDFRFFSLGNLWSIVSSLATSHQSDAILDLVEAKWSDLVADMPMKICYPALE  434

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              QEW+ ITG DPKNT WSYHN GSWPTLLWQL VA +K+ R EIA  A++VAERRIA DK
Sbjct  435   DQEWKFITGSDPKNTAWSYHNGGSWPTLLWQLTVACIKVDRSEIAAKAVEVAERRIANDK  494

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGKQ+RLFQTW+IAG+LVAK L+ NP+ +++L   ED E+L+A + + 
Sbjct  495   WPEYYDTKRARFIGKQSRLFQTWTIAGFLVAKQLLENPDKSRILWNNEDEEILNAMNRMT  554

Query  1890  SA-NPRRKRSRKGAVKQSYIV  1949
              A N +R+R RKG +K++YIV
Sbjct  555   DASNLKRRRGRKG-LKKTYIV  574


 Score =   234 bits (597),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  397  PNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGE  576
            P+ +E+EAW LLR S+V YCG+P+GTIAA DPND+S LNYDQVFIRDF+PSGIAFLLKG+
Sbjct  84   PHDVEDEAWGLLRESVVRYCGSPVGTIAACDPNDASPLNYDQVFIRDFVPSGIAFLLKGD  143

Query  577  YDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEA  756
            Y+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPL+ D++ TE+VLDPDFGEA
Sbjct  144  YEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLDGDDDVTEEVLDPDFGEA  203

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  204  AIGRVAPVDSGLW  216



>ref|XP_004975545.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=584

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 328/381 (86%), Gaps = 7/381 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMI+KLCLADG
Sbjct  206   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMIVKLCLADG  265

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREML PE+ S DLI A+N+R
Sbjct  266   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTPEDGSDDLIRAMNNR  325

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIP WLV W+P KGGY 
Sbjct  326   LIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPSWLVQWIPPKGGYF  385

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  QSHAILDLIEAKW DLVA MP+KICYPALE
Sbjct  386   IGNLQPAHMDFRFFSLGNLWSIVSSLATDHQSHAILDLIEAKWTDLVAEMPMKICYPALE  445

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EW+ ITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPEIAE A++VAERRIA DK
Sbjct  446   DEEWKFITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPEIAERAVEVAERRIARDK  505

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTKR  FIGK++RLFQTWSIAG+LVAKLL+   + +++L   ED ++L+A S + 
Sbjct  506   WPEYYDTKRARFIGKKSRLFQTWSIAGFLVAKLLLETRDKSRILCNNEDEDILNALSLMA  565

Query  1890  S-ANPRRKRSRKGAVKQSYIV  1949
               ++PRR+R ++  V ++YIV
Sbjct  566   DGSSPRRRRGKR--VPKTYIV  584


 Score =   229 bits (583),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +1

Query  325  DEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS  504
            D  GRSV+  A     +A         +E+E W+LLR S+V YCG+P+GTIAA DP+D +
Sbjct  71   DADGRSVNGGAKPHAQAAPRGRRAAADVEDEGWELLRESVVRYCGSPVGTIAACDPDDPT  130

Query  505  ILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFK  684
             LNYDQVFIRDF+PSG+AFLLKGE+DIVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFK
Sbjct  131  PLNYDQVFIRDFVPSGVAFLLKGEHDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFK  190

Query  685  VRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            VR +PL+ +++A E+VLDPDFGEAAIGRVAPVDSG++
Sbjct  191  VRVIPLDGEDDAIEEVLDPDFGEAAIGRVAPVDSGLW  227



>ref|XP_006407938.1| hypothetical protein EUTSA_v10020219mg [Eutrema salsugineum]
 gb|ESQ49391.1| hypothetical protein EUTSA_v10020219mg [Eutrema salsugineum]
Length=668

 Score =   537 bits (1384),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/349 (70%), Positives = 290/349 (83%), Gaps = 0/349 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK +GD +L ERIDVQTG+K+ILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  309   SGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDR  368

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+N+RL ALSFHIREYYW+D+KK
Sbjct  369   RMGIHGHPLEIQALFYSALRCAREMLNVNDGTKNLVAAVNNRLSALSFHIREYYWVDIKK  428

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRY TEEYS +A NKFNIYPDQIP WLV W+P++GGY IGNLQPAHMDFRFF+LGN
Sbjct  429   INEIYRYNTEEYSADATNKFNIYPDQIPSWLVGWIPNQGGYFIGNLQPAHMDFRFFTLGN  488

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW+++SSL   +Q+  ++ LIE KW DLVANMPLKIC+PALE  EWRIITG DPKNTPWS
Sbjct  489   LWAVISSLGNQEQNEGVMTLIEEKWGDLVANMPLKICFPALEQDEWRIITGSDPKNTPWS  548

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  +A +K+ + E+A+ A+ VAE+R+  D+WPEYYDT+ G F+GKQ+R
Sbjct  549   YHNGGSWPTLLWQFTLACIKVGKLELAKKAVAVAEKRLKEDEWPEYYDTRSGRFVGKQSR  608

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSANPRRK  1910
             L+QTW+IAG+L +K L+  PE A +L   ED +LL      LS +  RK
Sbjct  609   LYQTWTIAGFLASKKLIEQPEKASLLFWQEDYQLLETCVCGLSKSSARK  657


 Score =   206 bits (523),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LLR ++V YCG P+GT+AANDP D   LNYDQVFIRDF+PS  AFLL GE +IV
Sbjct  184  EKEAWKLLRGAVVNYCGFPVGTVAANDPGDKQTLNYDQVFIRDFVPSAYAFLLDGEGEIV  243

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DC+SPG GLMPASFKV+ VPLE ++ + E+VLD DFGE+AIGR
Sbjct  244  RNFLLHTLQLQSWEKTVDCHSPGPGLMPASFKVKPVPLEGNDGSFEEVLDADFGESAIGR  303

Query  769  VAPVDSGMF  795
            V+PVDSG++
Sbjct  304  VSPVDSGLW  312



>gb|KHG09699.1| Enolase-like protein ENO4 [Gossypium arboreum]
Length=643

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/382 (77%), Positives = 331/382 (87%), Gaps = 9/382 (2%)
 Frame = +3

Query  816   IIVICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLA  983
             + V+ P+F  + I       SGLWWIILLRAYGKCSGDLSL +RIDVQTG++MIL+LCLA
Sbjct  267   VEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSLQDRIDVQTGIRMILRLCLA  326

Query  984   DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALN  1163
             DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LF+SALL AREML PE+ S DL  ALN
Sbjct  327   DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFFSALLSAREMLTPEDGSDDLTRALN  386

Query  1164  SRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGG  1343
             +RL+ALSFHIREYYWID+ K+NEIYRYKTEEYS++A+NKFNIYPDQI PWLV+WMP KGG
Sbjct  387   NRLIALSFHIREYYWIDLVKINEIYRYKTEEYSFDAVNKFNIYPDQISPWLVEWMPHKGG  446

Query  1344  YLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPA  1523
             YLIGNLQPAHMDFRFFSLGN W+IVS LATT QSHAIL+LIEAKW DLVA MP KICYPA
Sbjct  447   YLIGNLQPAHMDFRFFSLGNFWAIVSGLATTSQSHAILELIEAKWADLVAEMPFKICYPA  506

Query  1524  LEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAG  1703
             LEG+EW+IITG DPKNTPWSYHNAGSWPTLLWQL VA +KM RPEIA  A+ VAE+RI+ 
Sbjct  507   LEGREWQIITGCDPKNTPWSYHNAGSWPTLLWQLTVACIKMNRPEIAAKAVAVAEKRISS  566

Query  1704  DKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSS  1883
             DKWPEYYDTK+  FIGKQARLFQTWSIAG+LVAKLL+A+P AAKML T ED+EL+ AFSS
Sbjct  567   DKWPEYYDTKKARFIGKQARLFQTWSIAGFLVAKLLLADPNAAKMLTTEEDSELVDAFSS  626

Query  1884  ILSANPRRKRSRKGAVKQSYIV  1949
             ++  NPRRKR  K     +YIV
Sbjct  627   LVCGNPRRKRGPK-----TYIV  643


 Score =   246 bits (628),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = +1

Query  319  FEDEQ--GRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDP  492
            FED +   R    +A  G  + T   +  +SIE+EAW LLR SMVYYCG+PIGTIAANDP
Sbjct  130  FEDSELLKREKEMLASAGTGTTTFYKSGIDSIEDEAWSLLRDSMVYYCGSPIGTIAANDP  189

Query  493  NDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMP  672
             DS +LNYDQVFIRDFIPSGIA LLKGEYDIV+NF+LHTLQLQSWEKTMDC+SPGQGLMP
Sbjct  190  TDSGVLNYDQVFIRDFIPSGIALLLKGEYDIVKNFILHTLQLQSWEKTMDCHSPGQGLMP  249

Query  673  ASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            ASFKVR+ PL+ D++AT +VLDPDFGEAAIGRVAPVDSG++
Sbjct  250  ASFKVRSTPLDGDDSATVEVLDPDFGEAAIGRVAPVDSGLW  290



>ref|XP_006851551.1| hypothetical protein AMTR_s00040p00181990 [Amborella trichopoda]
 gb|ERN13132.1| hypothetical protein AMTR_s00040p00181990 [Amborella trichopoda]
Length=646

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/380 (76%), Positives = 329/380 (87%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ER+DVQTGM+MILKLCLADG
Sbjct  268   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERVDVQTGMQMILKLCLADG  327

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  AREML PE++S DL+ ALN+R
Sbjct  328   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSAREMLTPEDSSADLMRALNNR  387

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D+KKLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV+WMP  GGY 
Sbjct  388   LIALSFHIREYYWVDMKKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPDTGGYF  447

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIV +LAT +QS AILDL+E+KW D VA+MP KICYPALE
Sbjct  448   IGNLQPAHMDFRFFSLGNLWSIVCNLATREQSEAILDLVESKWGDFVADMPFKICYPALE  507

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTPWSYHN GSWPTLLWQL VA +KM RP +A  AIK+AE RI+ ++
Sbjct  508   GQEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMNRPHLAAKAIKIAEARISRER  567

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+  FIGKQARL+QTWSIAG+LV+KLL+ NPE  K+L   ED EL++AF  +L
Sbjct  568   WPEYYDTKKARFIGKQARLYQTWSIAGFLVSKLLLRNPETIKILTCEEDAELVNAFYCML  627

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
              ANP+RKR+RK + K SYIV
Sbjct  628   DANPKRKRNRKKSSK-SYIV  646


 Score =   246 bits (629),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 150/211 (71%), Gaps = 30/211 (14%)
 Frame = +1

Query  253  GLEKPKLLRCYCRPAERGNERIFED-------EQGRSVHSIAPNGQTSATVNNALPNS--  405
            G  +P +L C+ + ++R  + + +D       E  ++  S   NG +     +  PNS  
Sbjct  79   GQNRPLILPCHGQKSDRLGDILGKDGNGAWSPETAKNDFSPELNGNSGLAFGSQSPNSEK  138

Query  406  ---------------------IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQ  522
                                 +E EAWDLL+A+MV YCG+PIGTIAANDP D SILNYDQ
Sbjct  139  RETTLKSDYFGNESIDERESAVEREAWDLLQAAMVNYCGSPIGTIAANDPTDPSILNYDQ  198

Query  523  VFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  702
            +FIRDFIPSGIAFLLKGEY+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVRTVPL
Sbjct  199  IFIRDFIPSGIAFLLKGEYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPL  258

Query  703  ENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            E D+ ATEDVLDPDFGEAAIGRVAPVDSG++
Sbjct  259  EGDDTATEDVLDPDFGEAAIGRVAPVDSGLW  289



>ref|XP_010031481.1| PREDICTED: alkaline/neutral invertase CINV1-like isoform X3 [Eucalyptus 
grandis]
Length=590

 Score =   499 bits (1286),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/261 (87%), Positives = 246/261 (94%), Gaps = 0/261 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTG+KMILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  288   SGLWWIILLRAYGKCSGDLSVQERVDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDR  347

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQ+LFYSALLCAREML PE+AS DLI ALN+RL+ALSFHIREYYWID++K
Sbjct  348   RMGIHGHPLEIQSLFYSALLCAREMLTPEDASADLIQALNNRLIALSFHIREYYWIDMRK  407

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWL  WMP+KGGYLIGNLQPAHMDFRFFSLGN
Sbjct  408   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLAGWMPNKGGYLIGNLQPAHMDFRFFSLGN  467

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LWSIVSSLAT DQSHAILDLIEAKW DLVA+MP KICYPALEGQEWRI+TG DPKNTPWS
Sbjct  468   LWSIVSSLATVDQSHAILDLIEAKWADLVADMPFKICYPALEGQEWRIVTGSDPKNTPWS  527

Query  1584  YHNAGSWPTLLWQLAVASVKM  1646
             YHN GSWPTLLWQ++  S+ +
Sbjct  528   YHNGGSWPTLLWQVSSLSMSL  548


 Score =   239 bits (610),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 3/147 (2%)
 Frame = +1

Query  364  GQTSAT---VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            GQ  AT   V      S+E+EAW+L+R S+ YYC NPIGTIAANDP+  SILNYDQVFIR
Sbjct  145  GQPEATREKVQKISSKSMEDEAWELMRDSIAYYCNNPIGTIAANDPSCPSILNYDQVFIR  204

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PSGIAFLLKGEYDIVRNF+LHTLQLQSWEKTMD YSPGQGLMPASFKVRTVPL  D 
Sbjct  205  DFVPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDSYSPGQGLMPASFKVRTVPLNGDN  264

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +ATE++LDPDFGEAAIGRVAPVDSG++
Sbjct  265  SATEEILDPDFGEAAIGRVAPVDSGLW  291



>emb|CDY05271.1| BnaC05g45320D [Brassica napus]
Length=664

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/335 (72%), Positives = 289/335 (86%), Gaps = 0/335 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK +GD +L ERIDVQTG+K+ILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  304   SGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDR  363

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYS+L CAREML   + + +L+ A+NSRL ALSFHIREYYW+D+KK
Sbjct  364   RMGIHGHPLEIQALFYSSLRCAREMLNVNDETKNLVAAVNSRLSALSFHIREYYWVDIKK  423

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRY TEEYS +A NKFNIYP+QIP WLVDW+P++GGY IGNLQPAHMDFRFF+LGN
Sbjct  424   INEIYRYNTEEYSADATNKFNIYPEQIPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGN  483

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW++VSSL + +Q+  ++ LIE KW+DLVANMPLKIC+PALE +EWRIITG DPKNTPWS
Sbjct  484   LWAVVSSLGSQEQNEGVMALIEEKWDDLVANMPLKICFPALEQEEWRIITGSDPKNTPWS  543

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  +A +KM + ++A+ A+ VAE+R+  D+WPEYYDT+ G F+GKQ+R
Sbjct  544   YHNGGSWPTLLWQFTLACIKMGKLDLAKKAVAVAEKRLKEDQWPEYYDTRSGRFVGKQSR  603

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELL  1868
             L+QTW+IAG+L +K L+  PE A +L   ED +LL
Sbjct  604   LYQTWTIAGFLASKKLIEQPEKASLLFWEEDYQLL  638


 Score =   196 bits (497),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = +1

Query  349  SIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQV  525
            ++   G+T   V+ +     E EAW LLR ++V YCG P+GT+AANDP D    LNYDQV
Sbjct  161  NVGVKGETERVVSQS---EAEREAWKLLRGAVVNYCGFPVGTVAANDPGDKQKTLNYDQV  217

Query  526  FIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE  705
            FIRDF+PS  AFLL G+ +IVRNFLL TLQLQSWEKT+DC+SPG GLMPASFKV++VPLE
Sbjct  218  FIRDFVPSAYAFLLDGDGEIVRNFLLQTLQLQSWEKTVDCHSPGPGLMPASFKVKSVPLE  277

Query  706  NDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
             ++ + E+ LD DFGE+AIGRV+PVDSG++
Sbjct  278  GNDGSFEECLDADFGESAIGRVSPVDSGLW  307



>ref|XP_002975181.1| hypothetical protein SELMODRAFT_267827 [Selaginella moellendorffii]
 ref|XP_002977587.1| hypothetical protein SELMODRAFT_151967 [Selaginella moellendorffii]
 gb|EFJ21591.1| hypothetical protein SELMODRAFT_151967 [Selaginella moellendorffii]
 gb|EFJ23966.1| hypothetical protein SELMODRAFT_267827 [Selaginella moellendorffii]
Length=476

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/371 (75%), Positives = 316/371 (85%), Gaps = 4/371 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGK +GD +L ER+DVQTGMKMILKLCLADG
Sbjct  98    VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSTGDYTLQERVDVQTGMKMILKLCLADG  157

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML  E++++DLI  L SR
Sbjct  158   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLISEDSALDLIRTLTSR  217

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+ KLNEIYRYKTEEYS+EA+NKFNIYPD + PWLVDW+P+KGGYL
Sbjct  218   LSALSFHIREYYWVDMGKLNEIYRYKTEEYSHEAVNKFNIYPDHLSPWLVDWIPNKGGYL  277

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGNLW+IVSSLAT +Q+  ILDLIEA+W D V NMP+KICYPAL+
Sbjct  278   VGNLQPAHMDFRFFSLGNLWAIVSSLATPEQAEGILDLIEARWVDFVGNMPMKICYPALQ  337

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRIITG DPKNTPWSYHN GSWPTLLWQL VA +KM RPE+AE AI+VAE+RI+ D+
Sbjct  338   GEEWRIITGSDPKNTPWSYHNGGSWPTLLWQLTVACIKMGRPEMAERAIEVAEKRISRDR  397

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+   F+GKQARL+QTWSIAGYLVAK+L+  P+A K+L   ED  LL A S  L
Sbjct  398   WPEYYDTRAARFVGKQARLYQTWSIAGYLVAKMLLDKPDAVKILTCEEDLALLEAMSCSL  457

Query  1890  SANPRRKRSRK  1922
              ANPR KR RK
Sbjct  458   DANPRIKRKRK  468


 Score =   216 bits (550),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/119 (86%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +1

Query  442  MVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQ  621
            MVYYCG P+GTIAANDP D   LNYDQVFIRDFIPS IAFLLKGE DIVRNFLLHTLQLQ
Sbjct  1    MVYYCGTPVGTIAANDPTDGHPLNYDQVFIRDFIPSAIAFLLKGETDIVRNFLLHTLQLQ  60

Query  622  SWEKTMDCYSPGQGLMPASFKVRTVPLEND-ENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SWEKT+DCY+PGQGLMPASFKVRTVPLE D  N TE+VLDPDFGEAAIGRVAPVDSG++
Sbjct  61   SWEKTVDCYNPGQGLMPASFKVRTVPLEGDPANGTEEVLDPDFGEAAIGRVAPVDSGLW  119



>ref|XP_001781871.1| predicted protein [Physcomitrella patens]
 gb|EDQ53326.1| predicted protein [Physcomitrella patens]
Length=463

 Score =   524 bits (1349),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 282/331 (85%), Gaps = 2/331 (1%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKC+GDL+L ER+DVQTG+KMILK+CLADGFDMFP+LLVTDGS MIDR
Sbjct  135   SGLWWIILLRAYGKCTGDLTLQERVDVQTGIKMILKVCLADGFDMFPSLLVTDGSMMIDR  194

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMG HGHPLEIQALFY AL CA+EML PE  + DLI ++NSRL ALSFHI+EYYW+D++K
Sbjct  195   RMGTHGHPLEIQALFYHALRCAKEMLHPE--AHDLIRSVNSRLAALSFHIQEYYWLDIRK  252

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY+TEEYS +A+NKFNIYPDQI  WL+DW+P +GGY IGNLQPAHMDFR+F+LGN
Sbjct  253   LNEIYRYRTEEYSSDAVNKFNIYPDQISRWLLDWLPEQGGYFIGNLQPAHMDFRWFTLGN  312

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             +WSI S+LAT +QS  IL L+E KWEDL+  MPLKICYP LE  EWRIITG DPKNT WS
Sbjct  313   IWSICSALATKEQSEEILTLVEKKWEDLIGTMPLKICYPTLEEDEWRIITGADPKNTAWS  372

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWP LLWQ  +A +KM R ++AE A+ +AE+R++ D WPEYYDTK G FIGKQAR
Sbjct  373   YHNGGSWPVLLWQFTLACIKMGRSDLAEKAVAIAEKRLSKDWWPEYYDTKSGRFIGKQAR  432

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIED  1856
             L+QTWSIAGYL +KLL+ NP+A K L   +D
Sbjct  433   LYQTWSIAGYLTSKLLLKNPDAVKWLTCEDD  463


 Score =   205 bits (522),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E EAW LL+ ++V YCG P+GTIAANDP D   LNYDQVFIRDFIPS IAFLLKGE++I
Sbjct  8    LEAEAWRLLKKAVVSYCGQPVGTIAANDPTDPYPLNYDQVFIRDFIPSAIAFLLKGEHEI  67

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE-NATEDVLDPDFGEAAI  762
            VRNF+ HTLQLQSWEKT+DCY+PGQGLMPASFKV+TV L+ +    TE++L PDFGEAAI
Sbjct  68   VRNFIHHTLQLQSWEKTVDCYTPGQGLMPASFKVQTVFLDREGVKETEEILQPDFGEAAI  127

Query  763  GRVAPVDSGMF  795
            GRVAPVDSG++
Sbjct  128  GRVAPVDSGLW  138



>emb|CDY24687.1| BnaA05g30860D [Brassica napus]
Length=652

 Score =   541 bits (1393),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/335 (72%), Positives = 290/335 (87%), Gaps = 0/335 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK +GD +L ERIDVQTG+K+ILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  292   SGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDR  351

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYS+L CAREML   + + +L+ A+NSRL ALSFHIREYYW+D+KK
Sbjct  352   RMGIHGHPLEIQALFYSSLRCAREMLNVNDETKNLVAAVNSRLSALSFHIREYYWVDIKK  411

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRY TEEYS +A NKFNIYP+QIP WLVDW+P++GGY IGNLQPAHMDFRFF+LGN
Sbjct  412   INEIYRYNTEEYSADATNKFNIYPEQIPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGN  471

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW++VSSL + +Q+  ++ LIE KW+DLVANMPLKIC+PALE +EWRIITG DPKNTPWS
Sbjct  472   LWAVVSSLGSQEQNEGVMALIEEKWDDLVANMPLKICFPALEQEEWRIITGSDPKNTPWS  531

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  +A +KM++ ++A+ A+ VAE+R+  D+WPEYYDTK G F+GKQ+R
Sbjct  532   YHNGGSWPTLLWQFTLACIKMEKLDLAKKAVAVAEKRLKEDQWPEYYDTKSGRFVGKQSR  591

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELL  1868
             L+QTW+IAG+L +K L+  PE A +L   ED +LL
Sbjct  592   LYQTWTIAGFLASKKLIEQPEKASLLFWEEDYQLL  626


 Score =   186 bits (472),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            E EAW LLR S+V YCG P+GT+AANDP D    LNYDQVFIRDF+PS  AFLL G+ +I
Sbjct  168  EREAWRLLRGSVVNYCGFPVGTVAANDPGDKQKTLNYDQVFIRDFVPSAYAFLLDGDGEI  227

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLL TLQLQSWEKT+DC+SPG GLMPASFKV++  LE ++ + E+ LD DFGE+AIG
Sbjct  228  VRNFLLQTLQLQSWEKTVDCHSPGPGLMPASFKVKS--LEGNDGSFEECLDADFGESAIG  285

Query  766  RVAPVDSGMF  795
            RV+PVDSG++
Sbjct  286  RVSPVDSGLW  295



>ref|XP_009147157.1| PREDICTED: alkaline/neutral invertase CINV2 [Brassica rapa]
Length=652

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/335 (72%), Positives = 289/335 (86%), Gaps = 0/335 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGK +GD +L ERIDVQTG+K+ILKLCLADGFDMFPTLLVTDGSCMIDR
Sbjct  292   SGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDMFPTLLVTDGSCMIDR  351

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYS+L CAREML   + + +L+ A+NSRL ALSFHIREYYW+D+KK
Sbjct  352   RMGIHGHPLEIQALFYSSLRCAREMLNVNDETKNLVAAVNSRLSALSFHIREYYWVDIKK  411

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             +NEIYRY TEEYS +A NKFNIYP+QIP WLVDW+P++GGY IGNLQPAHMDFRFF+LGN
Sbjct  412   INEIYRYNTEEYSADATNKFNIYPEQIPSWLVDWIPNRGGYFIGNLQPAHMDFRFFTLGN  471

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW++VSSL + +Q+  ++ LIE KW+DLVANMPLKIC+PALE +EWRIITG DPKNTPWS
Sbjct  472   LWAVVSSLGSQEQNEGVMALIEEKWDDLVANMPLKICFPALEQEEWRIITGSDPKNTPWS  531

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQAR  1763
             YHN GSWPTLLWQ  +A +KM++ ++A+ A+ VAE+R+  D+WPEYYDTK G F+GKQ+R
Sbjct  532   YHNGGSWPTLLWQFTLACIKMEKLDLAKKAVAVAEKRLKEDQWPEYYDTKSGRFVGKQSR  591

Query  1764  LFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELL  1868
             L+QTW+ AG+L +K L+  PE A +L   ED +LL
Sbjct  592   LYQTWTNAGFLASKKLIEQPEKASLLFWEEDYQLL  626


 Score =   185 bits (469),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 3/130 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            E EAW LLR ++V YCG P+GT+AANDP D    LNYDQVFIRDF+PS  AFLL G+ +I
Sbjct  168  EREAWRLLRGAVVNYCGFPVGTVAANDPGDKQKTLNYDQVFIRDFVPSAYAFLLDGDGEI  227

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLL TLQLQSWEKT+DC+SPG GLMPASFKV++  LE ++ + E+ LD DFGE+AIG
Sbjct  228  VRNFLLQTLQLQSWEKTVDCHSPGPGLMPASFKVKS--LEGNDGSFEECLDADFGESAIG  285

Query  766  RVAPVDSGMF  795
            RV+PVDSG++
Sbjct  286  RVSPVDSGLW  295



>gb|EEE60952.1| hypothetical protein OsJ_14709 [Oryza sativa Japonica Group]
Length=557

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/391 (72%), Positives = 322/391 (82%), Gaps = 16/391 (4%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  168   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  227

Query  990   FDMFPTLLVTDGSCMIDRRMG----------IHGHPLEIQALFYSALLCAREMLAPEEAS  1139
             FDMFPTLLVTDGSCMIDRRM           ++       ALFYSALLCAREML PE+ S
Sbjct  228   FDMFPTLLVTDGSCMIDRRMESMTPIGNSVLLYNSTYRTTALFYSALLCAREMLTPEDGS  287

Query  1140  IDLITALNSRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLV  1319
              DLI ALNSRL+ALSFHIREYYW+D +KLNEIYRYKTEEYSY+A+NKFNIYPDQIPPWLV
Sbjct  288   ADLIRALNSRLIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLV  347

Query  1320  DWMPSKGGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANM  1499
             +W+P KGGY IGNLQPAHMDFRFFSLGNLWSIVSSLAT+ QS AILDL+EAKW DLVA+M
Sbjct  348   EWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATSHQSDAILDLVEAKWSDLVADM  407

Query  1500  PLKICYPALEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIK  1679
             P+KICYPALE QEW+ ITG DPKNT WSYHN GSWPTLLWQL VA +K+ R EIA  A++
Sbjct  408   PMKICYPALEDQEWKFITGSDPKNTAWSYHNGGSWPTLLWQLTVACIKVDRSEIAAKAVE  467

Query  1680  VAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDT  1859
             VAERRIA DKWPEYYDTKR  FIGKQ+RLFQTW+IAG+LVAK L+ NP+ +++L   ED 
Sbjct  468   VAERRIANDKWPEYYDTKRARFIGKQSRLFQTWTIAGFLVAKQLLENPDKSRILWNNEDE  527

Query  1860  ELLSAFSSILSA-NPRRKRSRKGAVKQSYIV  1949
             E+L+A + +  A N +R+R RKG +K++YIV
Sbjct  528   EILNAMNRMTDASNLKRRRGRKG-LKKTYIV  557


 Score =   234 bits (598),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  397  PNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGE  576
            P+ +E+EAW LLR S+V YCG+P+GTIAA DPND+S LNYDQVFIRDF+PSGIAFLLKG+
Sbjct  57   PHDVEDEAWGLLRESVVRYCGSPVGTIAACDPNDASPLNYDQVFIRDFVPSGIAFLLKGD  116

Query  577  YDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEA  756
            Y+IVRNF+LHTLQLQSWEKTMDC+SPGQGLMPASFKVR VPL+ D++ TE+VLDPDFGEA
Sbjct  117  YEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRVVPLDGDDDVTEEVLDPDFGEA  176

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  177  AIGRVAPVDSGLW  189



>tpg|DAA45080.1| TPA: hypothetical protein ZEAMMB73_402946 [Zea mays]
Length=400

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  22    VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  81

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM+   + S +LI A+N+R
Sbjct  82    FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMIGVTDGSKNLIRAINNR  141

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  142   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYL  201

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIEAKW+D+VANMPLKICYPALE
Sbjct  202   IGNLQPAHMDFRFFSLGNLWAIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALE  261

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A  A++VAE+R++ DK
Sbjct  262   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDK  321

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTWSIAGYL +K+L+  PE A +L+  ED ELL   +  L
Sbjct  322   WPEYYDTRTGRFIGKQSRLYQTWSIAGYLSSKMLLDCPEMASILVCDEDFELLEGCACSL  381

Query  1890  SANPRRKRSRKGAVKQ  1937
             + N R K SR+ A  Q
Sbjct  382   NKNARTKCSRRAAKSQ  397


 Score = 72.4 bits (176),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  667  MPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            MPASFKVR+VPL+ +  A E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  1    MPASFKVRSVPLDGNSEAFEEVLDPDFGESAIGRVAPVDSGLW  43



>ref|XP_010553709.1| PREDICTED: alkaline/neutral invertase CINV2 [Tarenaya hassleriana]
Length=659

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/376 (72%), Positives = 311/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+++KLCLADG
Sbjct  280   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERIDVQTGIKLVMKLCLADG  339

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML+  E+S DL  A+N+R
Sbjct  340   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSINESSQDLTRAINNR  399

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIPPWL+DW+P +GGYL
Sbjct  400   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPDQIPPWLMDWIPEQGGYL  459

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+ AIL+LIEAKWED++ +MPLKICYPALE
Sbjct  460   IGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNEAILNLIEAKWEDIIGHMPLKICYPALE  519

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+AE A+ VAE+R+ GD+
Sbjct  520   YDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRPELAEKALSVAEKRLPGDR  579

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+I+G+L +KLL+ NPE A +L   ED ELL      L
Sbjct  580   WPEYYDTRTGKFIGKQSRLHQTWTISGFLTSKLLLENPEMASLLFWDEDYELLEICVCAL  639

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  640   SKTGRKKCSRVAAKTQ  655


 Score =   220 bits (560),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  175  EKEAWRLLENAVVRYCGSPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLKGEREIV  234

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVP+  DEN TEDVLDPDFGE+AIGR
Sbjct  235  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPI--DENNTEDVLDPDFGESAIGR  292

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  293  VAPVDSGLW  301



>ref|NP_176049.1| alkaline/neutral invertase A [Arabidopsis thaliana]
 sp|Q9FXA8.1|INVA_ARATH RecName: Full=Alkaline/neutral invertase A, mitochondrial; Short=A/N-INVA; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG09107.1|AC009323_18 Putative invertase [Arabidopsis thaliana]
 gb|AAM53335.1| putative alkaline/neutral invertase [Arabidopsis thaliana]
 gb|AAP37746.1| At1g56560 [Arabidopsis thaliana]
 gb|AEE33409.1| alkaline/neutral invertase A [Arabidopsis thaliana]
Length=616

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 314/376 (84%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  237   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  296

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S DL+ A+N+R
Sbjct  297   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKDLVRAINNR  356

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  357   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  416

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WSIVSSLAT  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  417   LGNLQPAHMDFRFFTLGNFWSIVSSLATPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  476

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ VAE+R+  D+
Sbjct  477   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALAVAEKRLLADR  536

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  537   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  596

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  597   RKSDRKKCSRVAAKTQ  612


 Score =   217 bits (553),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE DIV
Sbjct  132  EKEAWRILENAVVRYCGSPVGTVAANDPGDKMPLNYDQVFIRDFVPSALAFLLKGEGDIV  191

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  192  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  249

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  250  VAPVDSGLW  258



>ref|XP_002891983.1| hypothetical protein ARALYDRAFT_474815 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68242.1| hypothetical protein ARALYDRAFT_474815 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 314/376 (84%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  227   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  286

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  287   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  346

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  347   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  406

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WSIVSSLAT  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  407   LGNLQPAHMDFRFFTLGNFWSIVSSLATPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  466

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ VAE+R+  D+
Sbjct  467   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALAVAEKRLLADR  526

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  527   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  586

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  587   RKSDRKKCSRVAAKTQ  602


 Score =   221 bits (562),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 129/162 (80%), Gaps = 6/162 (4%)
 Frame = +1

Query  310  ERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAAND  489
            ERI + E+  +V  +  N +T   V     +  E+EAW +L  ++V YCG+P+GT+AAND
Sbjct  93   ERIHKIEEEETVSKV--NVETERVVREE--SEAEKEAWRILENAVVRYCGSPVGTVAAND  148

Query  490  PNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLM  669
            P D   LNYDQVFIRDF+PS +AFLLKGE DIVRNFLLHTLQLQSWEKT+DCYSPGQGLM
Sbjct  149  PGDKMPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQGLM  208

Query  670  PASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PASFKVRTV L  DEN TE+VLDPDFGE+AIGRVAPVDSG++
Sbjct  209  PASFKVRTVAL--DENTTEEVLDPDFGESAIGRVAPVDSGLW  248



>ref|XP_006302021.1| hypothetical protein CARUB_v10020003mg [Capsella rubella]
 gb|EOA34919.1| hypothetical protein CARUB_v10020003mg [Capsella rubella]
Length=610

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  231   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  290

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  291   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  350

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  351   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  410

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WSIVSSL T  Q+ AIL+LIEAKWED++ NMPLKICYPALE
Sbjct  411   LGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLIEAKWEDIIGNMPLKICYPALE  470

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE AI +AE+R+  D+
Sbjct  471   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKAIALAEKRLMADR  530

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  531   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  590

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  591   RKSDRKKCSRVAAKTQ  606


 Score =   218 bits (556),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 131/181 (72%), Gaps = 15/181 (8%)
 Frame = +1

Query  292  PAERGNERIFEDEQG----RSVHSIAPNGQTSATVNNALP---------NSIEEEAWDLL  432
            P ++   RI  D Q       +H I    +T + VN             +  E+EAW +L
Sbjct  74   PTDKSFGRIHVDVQSGVIVERIHKIESEEETVSGVNVETSGDGKVVREESEAEKEAWRIL  133

Query  433  RASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTL  612
              ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE DIVRNFLLHTL
Sbjct  134  EDAVVRYCGSPVGTVAANDPGDKMPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTL  193

Query  613  QLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGM  792
            QLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGRVAPVDSG+
Sbjct  194  QLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGRVAPVDSGL  251

Query  793  F  795
            +
Sbjct  252  W  252



>gb|KFK22543.1| hypothetical protein AALP_AAs68488U000500 [Arabis alpina]
Length=617

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/373 (70%), Positives = 313/373 (84%), Gaps = 4/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  240   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDVQTGIKLIMNLCLADG  299

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL+C+REML+  ++S +L+ A+N+R
Sbjct  300   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALICSREMLSVNDSSKNLVRAINNR  359

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  360   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  419

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WS+VSSL+T  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  420   LGNLQPAHMDFRFFSLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  479

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  480   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKAVALAEKRLMADR  539

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AGYL +KLL+ANPE A +L   ED ELL      L
Sbjct  540   WPEYYDTRSGKFIGKQSRLYQTWTVAGYLTSKLLLANPEMASLLFWEEDYELLDICVCGL  599

Query  1890  SANPRRKRSRKGA  1928
             S   R+K SR  A
Sbjct  600   SKTGRKKCSRVAA  612


 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 8/166 (5%)
 Frame = +1

Query  310  ERIFEDEQ---GRSVHSIAPNGQT-SATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTI  477
            ERI   +Q   G SV  +  N +T    V     +  E+EAW +L  ++V YCG+P+GT+
Sbjct  100  ERIHNKDQETLGESVSRVEINVETLGGKVREE--SEAEKEAWRILEDAVVRYCGSPVGTV  157

Query  478  AANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPG  657
            AANDP D   LNYDQVFIRDF+PS +AFLLKG+ DIVRNFLLHTLQLQSWEKT+DCYSPG
Sbjct  158  AANDPGDKLPLNYDQVFIRDFVPSALAFLLKGQGDIVRNFLLHTLQLQSWEKTVDCYSPG  217

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVRTV L  D+N TE+VLDPDFGE+AIGRVAPVDSG++
Sbjct  218  QGLMPASFKVRTVAL--DDNTTEEVLDPDFGESAIGRVAPVDSGLW  261



>ref|XP_008655058.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655060.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655063.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655066.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655067.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655070.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655073.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655075.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655078.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655082.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 ref|XP_008655086.1| PREDICTED: alkaline/neutral invertase CINV2-like [Zea mays]
 tpg|DAA45081.1| TPA: hypothetical protein ZEAMMB73_402946 [Zea mays]
Length=625

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 314/379 (83%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  247   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  306

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM+   + S +LI A+N+R
Sbjct  307   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMIGVTDGSKNLIRAINNR  366

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  367   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYL  426

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIEAKW+D+VANMPLKICYPALE
Sbjct  427   IGNLQPAHMDFRFFSLGNLWAIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALE  486

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A  A++VAE+R++ DK
Sbjct  487   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDK  546

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTWSIAGYL +K+L+  PE A +L+  ED ELL   +  L
Sbjct  547   WPEYYDTRTGRFIGKQSRLYQTWSIAGYLSSKMLLDCPEMASILVCDEDFELLEGCACSL  606

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             + N R K SR+ A  Q  +
Sbjct  607   NKNARTKCSRRAAKSQVLV  625


 Score =   216 bits (549),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL  ++V YCG+ +GT+AANDP+ S +LNYDQVFIRDF+PS IAFLLKGE DIV
Sbjct  140  EKEAWWLLSRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLKGESDIV  199

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            +NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E+VLDPDFGE+AIGR
Sbjct  200  KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVLDPDFGESAIGR  259

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  260  VAPVDSGLW  268



>gb|EMT27375.1| hypothetical protein F775_29966 [Aegilops tauschii]
Length=416

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  38    VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  97

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM++ ++ S +LI  +N+R
Sbjct  98    FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSTDDGSKNLIRVINNR  157

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  158   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPDKGGYL  217

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIE KW+D+VANMPLKICYPALE
Sbjct  218   IGNLQPAHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALE  277

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A  A++  E+R++ DK
Sbjct  278   YEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLARRAVEAVEKRLSDDK  337

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+  PE A +LI  ED ELL   +  L
Sbjct  338   WPEYYDTRTGRFIGKQSRLYQTWTIAGFLSSKMLLDCPEMASILICDEDLELLEGCACGL  397

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S + R K SR+ A  Q  +
Sbjct  398   SNSARIKCSRRAARSQVLV  416


 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  622  SWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  2    SWEKTVDCYSPGQGLMPASFKVRSVPLDGNNEAFEEVLDPDFGESAIGRVAPVDSGLW  59



>ref|XP_010511297.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=607

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  228   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  287

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  288   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  347

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  348   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  407

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WSIVSSL T  Q+ AIL+L+EAKW+D++ NMPLKICYPALE
Sbjct  408   LGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLMEAKWDDIIGNMPLKICYPALE  467

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  468   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  527

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  528   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  587

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  588   RKSDRKKCSRVAAKTQ  603


 Score =   217 bits (552),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  123  EKEAWRILENAIVRYCGSPVGTVAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGEIV  182

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  183  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  240

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  241  VAPVDSGLW  249



>ref|XP_002978791.1| hypothetical protein SELMODRAFT_443960 [Selaginella moellendorffii]
 gb|EFJ20238.1| hypothetical protein SELMODRAFT_443960 [Selaginella moellendorffii]
Length=606

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/370 (72%), Positives = 307/370 (83%), Gaps = 4/370 (1%)
 Frame = +3

Query  813   CIIVICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCL  980
             C  ++ P+F  + I       SGLWWIILLRAYGK +GDLSL ER+DVQTG++MILKLCL
Sbjct  236   CEEILDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSTGDLSLQERMDVQTGIRMILKLCL  295

Query  981   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITAL  1160
             +DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CA+EML P+E S  L+TA+
Sbjct  296   SDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALQCAKEMLIPDEKSHQLLTAV  355

Query  1161  NSRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKG  1340
             NSRL ALSFHIREYYW+D+ KLNEIYRYKTEEYS+EA+NKFNIYP+QIP WL DWMP  G
Sbjct  356   NSRLSALSFHIREYYWLDIAKLNEIYRYKTEEYSHEAVNKFNIYPEQIPDWLADWMPDHG  415

Query  1341  GYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYP  1520
             GY IGNLQPAHMDFRFFSLGNLW+IVSSLAT  QS  ILDLI+ +W+ LV +MPLKIC+P
Sbjct  416   GYFIGNLQPAHMDFRFFSLGNLWAIVSSLATPQQSSGILDLIQDRWKHLVGSMPLKICFP  475

Query  1521  ALEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIA  1700
             A E +EWRIITGGDPKNT WSYHN GSWPTL+WQ  +A +KM R E+A  A+++ ERRI+
Sbjct  476   AFENEEWRIITGGDPKNTAWSYHNGGSWPTLIWQFTLACIKMGRSEVAYEALEIMERRIS  535

Query  1701  GDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFS  1880
              D+WPEYYD++ G FIGKQ+RLFQTWSIAGYLVAK L+ANPEAA  L   ED  LL AFS
Sbjct  536   RDRWPEYYDSRTGKFIGKQSRLFQTWSIAGYLVAKQLLANPEAAAYLTCEEDPGLLDAFS  595

Query  1881  SILSANPRRK  1910
               +S+   +K
Sbjct  596   CRISSKQPKK  605


 Score =   202 bits (514),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
             E+EAW LLRAS+V+Y G P+GTIAANDP D+S LNYDQVFIRDF+P+GIAFLLKGE  I
Sbjct  133  FEQEAWRLLRASIVHYQGCPVGTIAANDPTDASALNYDQVFIRDFVPAGIAFLLKGEPAI  192

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLL TL+LQSWEKT+D YSPGQGLMPASFKV++V  E  E+  E++LDPDFGEAAIG
Sbjct  193  VRNFLLCTLRLQSWEKTVDFYSPGQGLMPASFKVQSVAAE--EDTCEEILDPDFGEAAIG  250

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  251  RVAPVDSGLW  260



>ref|XP_010480269.1| PREDICTED: alkaline/neutral invertase CINV2-like [Camelina sativa]
Length=612

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  233   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  292

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  293   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  352

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  353   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  412

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WSIVSSL T  Q+ AIL+L+EAKW+D++ NMPLKICYPALE
Sbjct  413   LGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLMEAKWDDIIGNMPLKICYPALE  472

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  473   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  532

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  533   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  592

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  593   RKSDRKKCSRVAAKTQ  608


 Score =   218 bits (555),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE DIV
Sbjct  128  EKEAWRILENAIVRYCGSPVGTVAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIV  187

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  188  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  245

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  246  VAPVDSGLW  254



>ref|XP_006392417.1| hypothetical protein EUTSA_v10023341mg [Eutrema salsugineum]
 gb|ESQ29703.1| hypothetical protein EUTSA_v10023341mg [Eutrema salsugineum]
Length=637

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 314/376 (84%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  258   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  317

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  318   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  377

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  378   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  437

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WS+VSSL+T  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  438   LGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  497

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  498   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  557

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL      L
Sbjct  558   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICVCGL  617

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R+K SR  A  Q
Sbjct  618   SKSGRKKCSRIAAKTQ  633


 Score =   219 bits (558),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 128/164 (78%), Gaps = 6/164 (4%)
 Frame = +1

Query  310  ERIFEDEQ--GRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAA  483
            ERI +DE+  G  V  +  N   S  V     +  E+EAW +L  ++V YCG+P+GT+AA
Sbjct  120  ERIHKDEETVGEPVSRVEVNEIRSGEVREE--SEAEKEAWRILEDAVVRYCGSPVGTVAA  177

Query  484  NDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQG  663
            NDP D   LNYDQVFIRDF+PS +AFLLKGE DIVRNFLLHTLQLQSWEKT+DCYSPGQG
Sbjct  178  NDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGDIVRNFLLHTLQLQSWEKTVDCYSPGQG  237

Query  664  LMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            LMPASFKVRTV L  DEN  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  238  LMPASFKVRTVAL--DENTAEEVLDPDFGESAIGRVAPVDSGLW  279



>ref|XP_002465359.1| hypothetical protein SORBIDRAFT_01g037120 [Sorghum bicolor]
 gb|EER92357.1| hypothetical protein SORBIDRAFT_01g037120 [Sorghum bicolor]
Length=626

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 314/379 (83%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  248   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  307

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM+   + S +LI A+N+R
Sbjct  308   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMIGVTDGSKNLIRAINNR  367

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  368   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYL  427

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIEAKW+D+VANMPLKICYPALE
Sbjct  428   IGNLQPAHMDFRFFSLGNLWAIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALE  487

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A  A++VAE+R++ DK
Sbjct  488   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDK  547

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+  PE A +L+  ED ELL   +  L
Sbjct  548   WPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPEMASILVCDEDFELLEGCACSL  607

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             + N R K SR+ A  Q  +
Sbjct  608   NKNARTKCSRRAAKSQVLV  626


 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL  ++V YCG+ +GT+AANDP+ S +LNYDQVFIRDF+PS IAFLLKGE DIV
Sbjct  141  EKEAWWLLSRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLKGESDIV  200

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            +NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E+VLDPDFGE+AIGR
Sbjct  201  KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVLDPDFGESAIGR  260

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  261  VAPVDSGLW  269



>ref|XP_010270854.1| PREDICTED: alkaline/neutral invertase CINV2 [Nelumbo nucifera]
Length=673

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/380 (70%), Positives = 313/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  295   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLTDG  354

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML  ++ S +L+TA+N+R
Sbjct  355   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVDDGSKNLVTAINNR  414

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLV+W+P +GGYL
Sbjct  415   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVEWIPEQGGYL  474

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIE KW+DLV  MPLKICYP+L+
Sbjct  475   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEDKWDDLVGQMPLKICYPSLD  534

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KMKRPE+A  AI +AE R++ D+
Sbjct  535   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMKRPELARKAITLAEERLSMDQ  594

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+ NPE A ML+  ED E+L      L
Sbjct  595   WPEYYDTRNGRFIGKQSRLYQTWTIAGYLTSKMLLDNPEMASMLLMDEDYEVLQTCRCAL  654

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  655   SKTGRKKCSR-GAAKAQILV  673


 Score =   220 bits (560),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPN---GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPI  468
            ERG +     EQ   VH +  +    +T  + +      IE+EAW LL+ ++V YCG+PI
Sbjct  148  ERGVDEGKGQEQQEHVHPVETSEGLKETEISTHKREVTEIEKEAWKLLQNAVVNYCGSPI  207

Query  469  GTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCY  648
            GT+AANDP D   LNYDQVFIRDF+PS +AFLL+GE +IVRNFLLHTLQLQSWEKT+DCY
Sbjct  208  GTVAANDPADKMPLNYDQVFIRDFVPSALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCY  267

Query  649  SPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SPGQGLMPASFKVRTVPL+      E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  268  SPGQGLMPASFKVRTVPLDGSTGTFEEVLDPDFGESAIGRVAPVDSGLW  316



>ref|XP_006841615.1| hypothetical protein AMTR_s00003p00222410 [Amborella trichopoda]
 gb|ERN03290.1| hypothetical protein AMTR_s00003p00222410 [Amborella trichopoda]
Length=648

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCLADG
Sbjct  270   ILDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIKLILNLCLADG  329

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM+   + + +L+ A+N+R
Sbjct  330   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMITINDGTKNLMRAVNNR  389

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A+NKFNIYP+QIP WLV+W+P KGGYL
Sbjct  390   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAVNKFNIYPEQIPSWLVEWIPDKGGYL  449

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSL T +Q+ +IL+LIE+KW+DLV  MPLKIC+PALE
Sbjct  450   IGNLQPAHMDFRFFSLGNLWAIVSSLTTPEQAESILNLIESKWDDLVGKMPLKICFPALE  509

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHNAGSWPTLLWQ   A +KM RP++A+ A+ VAE+R++ D 
Sbjct  510   YEEWRIITGSDPKNTPWSYHNAGSWPTLLWQFTAACIKMGRPDMAKRALAVAEKRLSKDL  569

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+   FIGKQARL+QTW+IAG+L AK+L+ NPE A ML   ED ELL   S  L
Sbjct  570   WPEYYDTRSARFIGKQARLYQTWTIAGFLTAKMLLDNPELACMLTCEEDLELLEGCSCPL  629

Query  1890  SANPRRKRSRKGAVKQ  1937
             SA+PR K SR  A  Q
Sbjct  630   SASPRTKCSRNAARSQ  645


 Score =   217 bits (552),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            ++IE+EAW LL A++V YCG+PIG++AAN+P D+S LNYDQVFIRDF+PS +A+LLKG+ 
Sbjct  160  SAIEKEAWRLLNAAVVNYCGSPIGSVAANNPADNSPLNYDQVFIRDFVPSALAYLLKGDR  219

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E++LDPDFGE+A
Sbjct  220  EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSHEAFEEILDPDFGESA  279

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  280  IGRVAPVDSGLW  291



>ref|XP_010415004.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X1 [Camelina 
sativa]
Length=612

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  233   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  292

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  293   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  352

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  353   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  412

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WSIVSSL T  Q+ AIL+L+EAKW+D++ NMPLKICYPALE
Sbjct  413   LGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLMEAKWDDIIGNMPLKICYPALE  472

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RP++AE A+ +AE+R+  D+
Sbjct  473   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPKLAEKALALAEKRLMADR  532

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED ELL   +  L
Sbjct  533   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELLDICACGL  592

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  593   RKSDRKKCSRVAAKTQ  608


 Score =   218 bits (555),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE DIV
Sbjct  128  EKEAWRILENAIVRYCGSPVGTVAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIV  187

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  188  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  245

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  246  VAPVDSGLW  254



>ref|XP_004984582.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=621

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 315/379 (83%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  243   ILDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM++  + S +LI A+N+R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMISVNDGSKNLIRAINNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  363   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPVKGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLAT  Q+  IL+LIEAKW+D+VANMPLKICYPALE
Sbjct  423   IGNLQPAHMDFRFFSLGNLWSIVSSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALE  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A  A++VAE+R++ DK
Sbjct  483   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLARRAVEVAEKRLSDDK  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+  PE A +LI  ED ELL   +  L
Sbjct  543   WPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPEMASILICDEDFELLEGCACSL  602

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             + + R K SR+ A  Q  +
Sbjct  603   NKSARIKCSRRAAKSQVLV  621


 Score =   214 bits (544),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL  ++V YCG+ +GT+AANDP+ S +LNYDQVFIRDF+PS IAFLLKGE DIV
Sbjct  136  EKEAWWLLGRAVVNYCGSAVGTVAANDPSTSQMLNYDQVFIRDFVPSAIAFLLKGESDIV  195

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            +NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E++LDPDFGE+AIGR
Sbjct  196  KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEILDPDFGESAIGR  255

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  256  VAPVDSGLW  264



>gb|KDP27968.1| hypothetical protein JCGZ_19048 [Jatropha curcas]
Length=584

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 311/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWI+LLRAYGK +GD SL ERIDVQTG+++IL LCL+DG
Sbjct  206   VLDPDFGESAIGRVAPVDSGLWWIMLLRAYGKITGDYSLQERIDVQTGIRLILNLCLSDG  265

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + +  L+ A+N+R
Sbjct  266   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIINDGTKKLVAAVNNR  325

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  326   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  385

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T+ Q+  IL+LIEAKW+DL+A+MPLKICYPALE
Sbjct  386   IGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEAKWDDLMADMPLKICYPALE  445

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A+ A+ +AE+R++ D+
Sbjct  446   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAQKAVSLAEKRLSVDQ  505

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYD +RG FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED +LL      L
Sbjct  506   WPEYYDMRRGRFIGKQSRLYQTWTIAGFLASKMLLKNPEKASLLYWEEDYDLLETCVCAL  565

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  566   SKTNRKKCSRFAARSQ  581


 Score =   219 bits (558),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 138/188 (73%), Gaps = 12/188 (6%)
 Frame = +1

Query  256  LEKPKLLRCYCRPAERGNERIFEDEQGRSV--HSIAPNGQTSATVNNALPN------SIE  411
            L+KP ++       E GN  + +DE    V  +  + N      +N   PN       IE
Sbjct  44   LKKPLVIE----KIETGNNALKKDETSNRVDINGTSVNIDYLKGLNETSPNVEREVSEIE  99

Query  412  EEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVR  591
            +EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE +IV+
Sbjct  100  KEAWKLLQGAIVNYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEPEIVK  159

Query  592  NFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRV  771
            NFLL+TLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+ ++ A E+VLDPDFGE+AIGRV
Sbjct  160  NFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNDGAFEEVLDPDFGESAIGRV  219

Query  772  APVDSGMF  795
            APVDSG++
Sbjct  220  APVDSGLW  227



>emb|CDY04446.1| BnaA03g59380D [Brassica napus]
Length=622

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  243   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDVQTGIKLIMNLCLADG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+++R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSSNLVRAISNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  363   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WS+VSSL+T  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  423   LGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  483   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A  L   ED ELL      L
Sbjct  543   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASKLFWEEDYELLDICVCGL  602

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  603   SKSGRRKCSRVAAKTQ  618


 Score =   215 bits (547),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  138  EKEAWRILEDAVVRYCGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGEIV  197

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  198  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  255

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  256  VAPVDSGLW  264



>ref|NP_001049936.1| Os03g0314800 [Oryza sativa Japonica Group]
 sp|Q10MC0.1|NIN1_ORYSJ RecName: Full=Neutral/alkaline invertase 1, mitochondrial; Short=OsNIN1; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF95611.1| beta-fructofuranosidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11850.1| Os03g0314800 [Oryza sativa Japonica Group]
Length=628

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL CAREM++  + S  LI A+N R
Sbjct  310   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVSVNDGSNSLIRAINYR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  370   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I+SSLAT  Q+  IL+LIEAKWED++ANMPLKICYPALE
Sbjct  430   IGNLQPAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWEDIIANMPLKICYPALE  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ AI+VAE+R++ DK
Sbjct  490   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLAQRAIEVAEKRLSEDK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+  PE A +LI  ED ELL   +  +
Sbjct  550   WPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPELASILICEEDLELLEGCACSV  609

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R K SR+ A  Q
Sbjct  610   NKSARTKCSRRAARSQ  625


 Score =   212 bits (539),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = +1

Query  379  TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGI  555
            TV +   ++ E+EAW LL  S+V YCG  +GT+AANDP+ ++ +LNYDQVFIRDF+PS I
Sbjct  132  TVRSRKESTEEKEAWSLLGRSVVSYCGTAVGTVAANDPSTANQMLNYDQVFIRDFVPSAI  191

Query  556  AFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVL  735
            AFLLKGE DIV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR++PL+ +  A E+VL
Sbjct  192  AFLLKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSIPLDGNSEAFEEVL  251

Query  736  DPDFGEAAIGRVAPVDSGMF  795
            DPDFGE+AIGRVAPVDSG++
Sbjct  252  DPDFGESAIGRVAPVDSGLW  271



>ref|XP_009124460.1| PREDICTED: alkaline/neutral invertase CINV2 [Brassica rapa]
Length=632

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  253   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDVQTGIKLIMNLCLADG  312

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+++R
Sbjct  313   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSSNLVRAISNR  372

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  373   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  432

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WS+VSSL+T  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  433   LGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  492

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  493   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  552

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A  L   ED ELL      L
Sbjct  553   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASKLFWEEDYELLDICVCGL  612

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  613   SKSGRRKCSRVAAKTQ  628


 Score =   215 bits (547),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  148  EKEAWRILEDAVVRYCGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGEIV  207

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  208  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  265

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  266  VAPVDSGLW  274



>emb|CDY04374.1| BnaC04g18190D [Brassica napus]
Length=626

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  247   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFSLQERIDVQTGIKLIMNLCLADG  306

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  307   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSNNLVRAINNR  366

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  367   LSALSFHIREYYWVDIRKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  426

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGN WS+VSSL+T  Q+ AIL+LIEAKW+D++ NMPLKICYPALE
Sbjct  427   LGNLQPAHMDFRFFTLGNFWSVVSSLSTPKQNEAILNLIEAKWDDIIGNMPLKICYPALE  486

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R+  D+
Sbjct  487   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPELAEKALALAEKRLMADR  546

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A  L   ED ELL      L
Sbjct  547   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASKLFWEEDYELLDICVCGL  606

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R+K SR  A  Q
Sbjct  607   SKSGRKKCSRVAAKTQ  622


 Score =   214 bits (546),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  142  EKEAWRILEDAVVRYCGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEGEIV  201

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  202  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  259

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  260  VAPVDSGLW  268



>ref|XP_003558048.1| PREDICTED: alkaline/neutral invertase CINV1-like [Brachypodium 
distachyon]
Length=621

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/379 (69%), Positives = 315/379 (83%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  243   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLSDG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM++  + S +LI A+N+R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSINDGSKNLIRAINNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  363   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIE KW+D+VANMPLKICYPALE
Sbjct  423   IGNLQPAHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALE  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A++  E+R++ DK
Sbjct  483   YEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRHDLAQRAVEAVEKRLSDDK  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+A+PE A +LI  ED ELL   +  L
Sbjct  543   WPEYYDTRTGRFIGKQSRLYQTWTIAGFLSSKMLLASPEIASILICDEDLELLEGCACGL  602

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             + + R K SR+ A  Q  +
Sbjct  603   NKSARIKCSRRAARSQVLV  621


 Score =   209 bits (533),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = +1

Query  379  TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGI  555
             V N   +  E+EAW LL  ++V YCG+ +GT+AANDP+ ++ +LNYDQVFIRDF+PS I
Sbjct  125  AVRNREQSPQEKEAWWLLSRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAI  184

Query  556  AFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVL  735
            AFLLKGE DIV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E+VL
Sbjct  185  AFLLKGESDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNSEAFEEVL  244

Query  736  DPDFGEAAIGRVAPVDSGMF  795
            DPDFGE+AIGRVAPVDSG++
Sbjct  245  DPDFGESAIGRVAPVDSGLW  264



>gb|EEC75120.1| hypothetical protein OsI_11302 [Oryza sativa Indica Group]
 gb|EEE58943.1| hypothetical protein OsJ_10618 [Oryza sativa Japonica Group]
Length=683

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL CAREM++  + S  LI A+N R
Sbjct  310   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVSVNDGSNSLIRAINYR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  370   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPEKGGYL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I+SSLAT  Q+  IL+LIEAKWED++ANMPLKICYPALE
Sbjct  430   IGNLQPAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWEDIIANMPLKICYPALE  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ AI+VAE+R++ DK
Sbjct  490   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRRDLAQRAIEVAEKRLSEDK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+  PE A +LI  ED ELL   +  +
Sbjct  550   WPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLDCPELASILICEEDLELLEGCACSV  609

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R K SR+ A  Q
Sbjct  610   NKSARTKCSRRAARSQ  625


 Score =   213 bits (541),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = +1

Query  379  TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGI  555
            TV +   ++ E+EAW LL  S+V YCG  +GT+AANDP+ ++ +LNYDQVFIRDF+PS I
Sbjct  132  TVRSRKESTEEKEAWSLLGRSVVSYCGTAVGTVAANDPSTANQMLNYDQVFIRDFVPSAI  191

Query  556  AFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVL  735
            AFLLKGE DIV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR++PL+ +  A E+VL
Sbjct  192  AFLLKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSIPLDGNSEAFEEVL  251

Query  736  DPDFGEAAIGRVAPVDSGMF  795
            DPDFGE+AIGRVAPVDSG++
Sbjct  252  DPDFGESAIGRVAPVDSGLW  271



>ref|XP_010415005.1| PREDICTED: alkaline/neutral invertase CINV2-like isoform X2 [Camelina 
sativa]
Length=612

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 312/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ERIDVQTG+K+I+ LCLADG
Sbjct  233   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDFSLQERIDVQTGIKLIMNLCLADG  292

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML+  ++S +L+ A+N+R
Sbjct  293   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLSVNDSSKNLVRAINNR  352

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIPPWL+DW+P +GGYL
Sbjct  353   LSALSFHIREYYWVDIKKINEIYRYKTEEYSTDATNKFNIYPEQIPPWLMDWIPEQGGYL  412

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFFSLGN WSIVSSL T  Q+ AIL+L+EAKW+D++ NMPLKICYPALE
Sbjct  413   LGNLQPAHMDFRFFSLGNFWSIVSSLGTPKQNEAILNLMEAKWDDIIGNMPLKICYPALE  472

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               +WRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RP++AE A+ +AE+R+  D+
Sbjct  473   YDDWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACMKMGRPKLAEKALALAEKRLMADR  532

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +KLL+ANPE A +L   ED EL    +  L
Sbjct  533   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKLLLANPEMASLLFWEEDYELQDICACGL  592

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  593   RKSDRKKCSRVAAKTQ  608


 Score =   218 bits (555),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW +L  ++V YCG+P+GT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE DIV
Sbjct  128  EKEAWRILENAIVRYCGSPVGTVAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGDIV  187

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DEN TE+VLDPDFGE+AIGR
Sbjct  188  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DENTTEEVLDPDFGESAIGR  245

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  246  VAPVDSGLW  254



>gb|EMS48780.1| hypothetical protein TRIUR3_08899 [Triticum urartu]
Length=576

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 312/379 (82%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  198   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  257

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM++ ++ S +LI  +N+R
Sbjct  258   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSTDDGSKNLIRVINNR  317

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  318   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPDKGGYL  377

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIE KW+D+VANMPLKICYPALE
Sbjct  378   IGNLQPAHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALE  437

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A  A++  E+R++ DK
Sbjct  438   YEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLARRAVEAVEKRLSDDK  497

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+  PE A +LI  ED ELL   +  L
Sbjct  498   WPEYYDTRTGRFIGKQSRLYQTWTIAGFLSSKMLLDCPEMASILICDEDLELLEGCACGL  557

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S + R K SR+ A  Q  +
Sbjct  558   SNSARIKCSRRAARSQVLV  576


 Score =   190 bits (483),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 117/166 (70%), Gaps = 37/166 (22%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            E+EAW LL  ++V YCG+ +GT+AANDP+ ++ +LNYDQVFIRDF+PS IAFLL+GE DI
Sbjct  54   EKEAWWLLNRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAIAFLLRGESDI  113

Query  586  VRNFLLHTLQLQ------------------------------------SWEKTMDCYSPG  657
            V+NFLLHTLQLQ                                    SWEKT+DCYSPG
Sbjct  114  VKNFLLHTLQLQRWALANLDSYVTADFWTRRKCHGRHTAVEPRADSSTSWEKTVDCYSPG  173

Query  658  QGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            QGLMPASFKVR+VPL+ +  A E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  174  QGLMPASFKVRSVPLDGNNEAFEEVLDPDFGESAIGRVAPVDSGLW  219



>dbj|BAJ94475.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00808.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 313/379 (83%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  241   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  300

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREM++ ++ S +LI  +N+R
Sbjct  301   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMVSTDDGSKNLIRVVNNR  360

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  361   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLADWIPDKGGYL  420

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSLAT  Q+  IL+LIE KW+D+VANMPLKICYPALE
Sbjct  421   IGNLQPAHMDFRFFSLGNLWAIVSSLATQKQAEGILNLIETKWDDIVANMPLKICYPALE  480

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A  A++  E+R++ DK
Sbjct  481   YEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLARRAVEAVEKRLSDDK  540

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+  PE A +LI  ED ELL   +  L
Sbjct  541   WPEYYDTRTGRFIGKQSRLYQTWTIAGFLSSKMLLDCPEMASILICDEDLELLEGCACGL  600

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S + R K SR+ A  Q  +
Sbjct  601   SNSARIKCSRRAARSQVLV  619


 Score =   208 bits (530),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 117/130 (90%), Gaps = 1/130 (1%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            E+EAW LL  ++V YCG+ +GT+AANDP+ ++ +LNYDQVFIRDF+PS IAFLL+GE DI
Sbjct  133  EKEAWWLLNRAVVNYCGSAVGTVAANDPSTANHMLNYDQVFIRDFVPSAIAFLLRGESDI  192

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+ +  A E+VLDPDFGE+AIG
Sbjct  193  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDGNNEAFEEVLDPDFGESAIG  252

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  253  RVAPVDSGLW  262



>ref|XP_009381188.1| PREDICTED: alkaline/neutral invertase CINV2-like [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/370 (71%), Positives = 302/370 (82%), Gaps = 4/370 (1%)
 Frame = +3

Query  831   PNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDM  998
             P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DGFDM
Sbjct  266   PDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLSDGFDM  325

Query  999   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLA  1178
             FPTLLVTDGSCMIDRRMGIHGHPLEIQALFY AL C+REM+A  + S  L+ A+N+RL A
Sbjct  326   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYCALRCSREMIAVNDGSKSLLRAINNRLSA  385

Query  1179  LSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGN  1358
             LSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WLVDW+P KGGY IGN
Sbjct  386   LSFHIREYYWVDMKKINEIYRYKTEEYSQDAINKFNIYPEQIPGWLVDWVPEKGGYFIGN  445

Query  1359  LQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQE  1538
             LQPAHMDFRFFSLGNLW+IVSSLAT  Q+  ILDLIE KW+DLV NMPLKICYPALE +E
Sbjct  446   LQPAHMDFRFFSLGNLWAIVSSLATPRQAEGILDLIEEKWDDLVGNMPLKICYPALEYEE  505

Query  1539  WRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPE  1718
             WRIITG DPKNTPWSYHN GSWPTLLWQ   A +KM RPE+A  AI +AE R++ DKWPE
Sbjct  506   WRIITGSDPKNTPWSYHNGGSWPTLLWQFTSACIKMGRPELARKAITIAENRLSNDKWPE  565

Query  1719  YYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSAN  1898
             YYDT  G FIGKQ+RL+QTW+IAG+L +KLL+ NPE A +L   ED ELL   +  L  +
Sbjct  566   YYDTPTGRFIGKQSRLYQTWTIAGFLASKLLLENPEMASILTFEEDLELLEGCACNLIKS  625

Query  1899  PRRKRSRKGA  1928
             PR + SR  A
Sbjct  626   PRTQCSRHAA  635


 Score =   204 bits (518),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL+ ++V YCG+P+GT+AA DP  +  LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  157  EKEAWRLLKNAVVEYCGSPVGTVAATDPA-AEALNYDQVFIRDFVPSALAFLLKGETEIV  215

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLL+TLQLQSWEKT+DCYSPGQGLMPASFKVR+VPL+  ++  E++LDPDFGE+AIGR
Sbjct  216  RNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRSVPLDVSKDEVEEMLDPDFGESAIGR  275

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  276  VAPVDSGLW  284



>emb|CAL64380.1| putative neutral invertase [Prunus persica]
Length=418

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+D QTG++++L LCL +G
Sbjct  40    VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDFQTGIRLVLNLCLKNG  99

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+ A+N+R
Sbjct  100   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKDLVAAINNR  159

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYPDQIP WLVDW+P +GG+L
Sbjct  160   LSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGFL  219

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIEAKW+D VA MPLKICYPALE
Sbjct  220   IGNLQPAHMDFRFFTLGNLWSIVSSLGTHKQNEDILNLIEAKWDDFVAQMPLKICYPALE  279

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R++ D+
Sbjct  280   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVDLAEKRLSADQ  339

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L+  ED ELL      L
Sbjct  340   WPEYYDTKSGRFIGKQSRLFQTWTIAGYLTSKMLLENPEKASLLLWEEDYELLETCVCAL  399

Query  1890  SANPRRKRSRKGAVKQ  1937
             +    +K SR  A  Q
Sbjct  400   TKTGXKKCSRLAAKXQ  415


 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +1

Query  613  QLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGM  792
            QLQSWEKT+DC+SPGQGLMPASFKV+TVPL+      E+VLDPDFGE+AIGRVAPVDSG+
Sbjct  1    QLQSWEKTVDCHSPGQGLMPASFKVKTVPLDGMNGEFEEVLDPDFGESAIGRVAPVDSGL  60

Query  793  F  795
            +
Sbjct  61   W  61



>ref|XP_004144808.1| PREDICTED: uncharacterized protein LOC101218389 [Cucumis sativus]
Length=589

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L +R+DVQTG+KMIL LCL DG
Sbjct  211   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQDRVDVQTGLKMILNLCLTDG  270

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  271   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINNR  330

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  331   LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPDQIPQWLMDWVPEEGGYL  390

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW DLV +MPLKICYPALE
Sbjct  391   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWGDLVGHMPLKICYPALE  450

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ VAE+RI+ D+
Sbjct  451   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRFEMAKKAVAVAEKRISNDR  510

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+LV NPE A  L   ED ELL      L
Sbjct  511   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVENPELASSLFWEEDYELLEICVCAL  570

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  571   SKTGRKKCSRGAARSQ  586


 Score =   213 bits (543),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 128/171 (75%), Gaps = 10/171 (6%)
 Frame = +1

Query  307  NERIFEDEQGR-SVHSIAPNGQTSATVNNAL-------PNSIEEEAWDLLRASMVYYCGN  462
            +E I  +E  R  V S   NG+    +N A         + IE+EAW LLR ++V YCG+
Sbjct  64   DENIVGEEDSRIEVGSEHVNGENLEDLNKAKVITSKREESDIEKEAWRLLREAVVTYCGS  123

Query  463  PIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMD  642
            P+GT+AANDP D   LNYDQVFIRDFIPS +AFLL GE +IVRNFLLHTL  QSWEKT+D
Sbjct  124  PVGTMAANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLHFQSWEKTVD  183

Query  643  CYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            CYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  184  CYSPGQGLMPASFKVRTVPL--DGNNFEEVLDPDFGESAIGRVAPVDSGLW  232



>ref|XP_002277312.2| PREDICTED: alkaline/neutral invertase CINV2 [Vitis vinifera]
Length=673

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  295   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLTDG  354

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +ASI+L+ A+N+R
Sbjct  355   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINLVRAINNR  414

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  415   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWVPEEGGYL  474

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  ILD I+AKW+DLV +MPLKICYPALE
Sbjct  475   IGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLKICYPALE  534

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+  AE+R+A D+
Sbjct  535   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAEKRLAVDR  594

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L   ED +LL      L
Sbjct  595   WPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLLEICVCGL  654

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   RRK SR  A  Q
Sbjct  655   SKTGRRKCSRFAARSQ  670


 Score =   219 bits (559),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL+ S+V YCG+PIGT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  188  EKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGEIV  247

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+ +  A E+VLDPDFGE+AIGR
Sbjct  248  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNNEAHEEVLDPDFGESAIGR  307

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  308  VAPVDSGLW  316



>emb|CBI39621.3| unnamed protein product [Vitis vinifera]
Length=647

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  269   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLTDG  328

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +ASI+L+ A+N+R
Sbjct  329   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINLVRAINNR  388

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  389   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWVPEEGGYL  448

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  ILD I+AKW+DLV +MPLKICYPALE
Sbjct  449   IGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLKICYPALE  508

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+  AE+R+A D+
Sbjct  509   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAEKRLAVDR  568

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L   ED +LL      L
Sbjct  569   WPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLLEICVCGL  628

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   RRK SR  A  Q
Sbjct  629   SKTGRRKCSRFAARSQ  644


 Score =   219 bits (559),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL+ S+V YCG+PIGT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  162  EKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGEIV  221

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+ +  A E+VLDPDFGE+AIGR
Sbjct  222  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNNEAHEEVLDPDFGESAIGR  281

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  282  VAPVDSGLW  290



>ref|XP_007225679.1| hypothetical protein PRUPE_ppa002847mg [Prunus persica]
 gb|AFI57906.1| alkaline/neutral invertase C [Prunus persica]
 gb|EMJ26878.1| hypothetical protein PRUPE_ppa002847mg [Prunus persica]
Length=628

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+D QTG++++L LCL +G
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDFQTGIRLVLNLCLKNG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+ A+N+R
Sbjct  310   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKDLVAAINNR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYPDQIP WLVDW+P +GG+L
Sbjct  370   LSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGFL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIEAKW+D VA MPLKICYPALE
Sbjct  430   IGNLQPAHMDFRFFTLGNLWSIVSSLGTHKQNEDILNLIEAKWDDFVAQMPLKICYPALE  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R++ D+
Sbjct  490   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVDLAEKRLSADQ  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L+  ED ELL      L
Sbjct  550   WPEYYDTKSGRFIGKQSRLFQTWTIAGYLTSKMLLENPEKASLLLWEEDYELLETCVCAL  609

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   R+K SR  A  Q
Sbjct  610   TKTGRKKCSRLAAKSQ  625


 Score =   214 bits (545),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S+V YCGNP+GT+AA DP D + LNYDQVFIRDF+PS +AFLL GE DI
Sbjct  142  IEKEAWSLLRDSVVSYCGNPVGTLAATDPADKTPLNYDQVFIRDFVPSALAFLLNGEADI  201

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKV+TVPL+      E+VLDPDFGE+AIG
Sbjct  202  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVKTVPLDGMNGEFEEVLDPDFGESAIG  261

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  262  RVAPVDSGLW  271



>ref|XP_004495636.1| PREDICTED: uncharacterized protein LOC101503498 [Cicer arietinum]
Length=635

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 311/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER+DVQTG+KMILKLCL DG
Sbjct  257   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERVDVQTGLKMILKLCLTDG  316

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+RE+LA  + + DL+ A+N+R
Sbjct  317   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREVLAVTDGTNDLVRAINNR  376

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIR+YYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP W++DW+P KGGYL
Sbjct  377   LSALSFHIRQYYWVDMKKINEIYRYKTEEYSMDAINKFNIYPEQIPFWVMDWIPEKGGYL  436

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL+T  Q+ AIL+LIEAKW+DLV +MPLKICYPAL+
Sbjct  437   IGNLQPAHMDFRFFTLGNLWSIVSSLSTPRQNEAILNLIEAKWDDLVGHMPLKICYPALD  496

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  497   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVDLAEKRLPVDS  556

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+IAG+L +K+L+ NP+ A ML   ED ELL      L
Sbjct  557   WPEYYDTRSGKFIGKQARLYQTWTIAGFLTSKMLLKNPKMASMLFCEEDYELLDICVCGL  616

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R+K SR  A  Q
Sbjct  617   SKSGRKKCSRVAAKSQ  632


 Score =   211 bits (537),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +++E++AW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDFIPS +AFLLKG+ 
Sbjct  149  SNVEKQAWKLLKDAVVTYCGNPVGTVAANDPGDKLPLNYDQVFIRDFIPSALAFLLKGDN  208

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L+ D    E+VLDPDFGE+A
Sbjct  209  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVALDGD--TREEVLDPDFGESA  266

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  267  IGRVAPVDSGLW  278



>ref|XP_008453273.1| PREDICTED: alkaline/neutral invertase CINV1-like [Cucumis melo]
Length=677

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/380 (70%), Positives = 310/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L +R+DVQTG+KMIL LCL DG
Sbjct  299   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQDRVDVQTGLKMILNLCLTDG  358

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  359   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINNR  418

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPDQIPQWLMDWVPEEGGYL  478

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW DLV +MPLKICYPALE
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWGDLVGHMPLKICYPALE  538

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ VAE+RI+GD+
Sbjct  539   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLEMAKKAVAVAEKRISGDR  598

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTWSIAG+L +K+LV NPE A  L   ED ELL      L
Sbjct  599   WPEYYDTRTGKFIGKQSRLYQTWSIAGFLTSKMLVENPELASSLFWEEDYELLEICVCAL  658

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA +   +V
Sbjct  659   SKTGRKKCSR-GAARSHILV  677


 Score =   215 bits (547),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR ++V YCG+P+GT+AANDP D   LNYDQVFIRDFIPS +AFLL GE +I
Sbjct  193  IEKEAWRLLREAVVTYCGSPVGTMAANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEI  252

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  253  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNNFEEVLDPDFGESAIG  310

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  311  RVAPVDSGLW  320



>ref|XP_006649984.1| PREDICTED: alkaline/neutral invertase CINV2-like [Oryza brachyantha]
Length=622

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 313/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  244   VLDPDFGESAIGRVAPVDSGLWWIILLRAYSKITGDYALQERVDVQTGIRLILNLCLSDG  303

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL CAREM++  + S  LI A+N+R
Sbjct  304   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCAREMVSINDGSSSLIRAINNR  363

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRY+TEEYS++AINKFNIYP+QIP WL DW+P KGGYL
Sbjct  364   LSALSFHIREYYWVDMKKINEIYRYRTEEYSHDAINKFNIYPEQIPTWLADWIPEKGGYL  423

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I+SSLAT  Q+  IL+LIEAKW+D+VANMPLKICYPALE
Sbjct  424   IGNLQPAHMDFRFFSLGNLWAIISSLATQRQAEGILNLIEAKWDDIVANMPLKICYPALE  483

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKN PWSYHN GSWPTLLWQ  +A +KM R ++A+ A++VAE+R++ DK
Sbjct  484   YEEWRIITGSDPKNMPWSYHNGGSWPTLLWQFTLACIKMGRRDLAQRAVEVAEKRLSDDK  543

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+A PE A +LI  ED ELL   +  +
Sbjct  544   WPEYYDTRTGRFIGKQSRLYQTWTIAGYLSSKMLLACPELASILICEEDLELLEGCACSV  603

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R K SR+ A  Q
Sbjct  604   NKSARTKCSRRAARSQ  619


 Score =   216 bits (549),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = +1

Query  379  TVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGI  555
            TV + + ++ E+EAW LL  S+V YCG  +GT+AANDP+ +S +LNYDQVFIRDFIPS I
Sbjct  126  TVRSRVESTQEKEAWSLLGRSVVNYCGTAVGTVAANDPSTASQMLNYDQVFIRDFIPSAI  185

Query  556  AFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVL  735
            AFLLKGE DIV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR++PL+ +  A E+VL
Sbjct  186  AFLLKGEGDIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSIPLDGNSEAFEEVL  245

Query  736  DPDFGEAAIGRVAPVDSGMF  795
            DPDFGE+AIGRVAPVDSG++
Sbjct  246  DPDFGESAIGRVAPVDSGLW  265



>ref|XP_008223426.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=680

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+D QTG++++L LCL +G
Sbjct  302   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDFQTGIRLVLNLCLKNG  361

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +++ DL+ A+N+R
Sbjct  362   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDSTKDLVAAINNR  421

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  422   LSALSFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  481

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFR F+LGNLWSIVSSL T  Q+  IL+LIEAKW+D VA MPLKICYPALE
Sbjct  482   IGNLQPAHMDFRLFTLGNLWSIVSSLGTHKQNEGILNLIEAKWDDFVAQMPLKICYPALE  541

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R++ D+
Sbjct  542   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVDLAEKRLSADQ  601

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L+  ED ELL      L
Sbjct  602   WPEYYDTKSGRFIGKQSRLFQTWTIAGYLTSKMLLENPEKASLLLWEEDYELLETCVCAL  661

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   R+K SR  A  Q
Sbjct  662   TKTGRKKCSRLAAKSQ  677


 Score =   217 bits (552),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S+V YCGNP+GT+AA DP D + LNYDQVFIRDF+PS +AFLL GE DI
Sbjct  194  IEKEAWSLLRDSVVSYCGNPVGTLAATDPADKTPLNYDQVFIRDFVPSALAFLLNGEADI  253

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKV+TVPL+    A E+VLDPDFGE+AIG
Sbjct  254  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVKTVPLDGMNGAFEEVLDPDFGESAIG  313

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  314  RVAPVDSGLW  323



>emb|CAN63178.1| hypothetical protein VITISV_029106 [Vitis vinifera]
Length=673

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  294   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM    + + +L+ A+N+R
Sbjct  354   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMJTVNDGTKNLVRAINNR  413

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  414   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLVDWIPDQGGYL  473

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  474   IGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPALE  533

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+ +AE R++ D 
Sbjct  534   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVALAEERLSVDH  593

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED ELL      L
Sbjct  594   WPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICVCAL  653

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  654   SKTGRKKCSRSAARSQ  669


 Score =   221 bits (564),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            G     V   +P  IE+EAW LLR+++V YCGNP+GT+AANDP D   LNYDQVFIRDF+
Sbjct  173  GLNKEKVEREVP-EIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYDQVFIRDFV  231

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENAT  723
            PS +AFLLKGE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A 
Sbjct  232  PSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGGNGAF  291

Query  724  EDVLDPDFGEAAIGRVAPVDSGMF  795
            E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  292  EEVLDPDFGESAIGRVAPVDSGLW  315



>gb|KHN16041.1| hypothetical protein glysoja_012017 [Glycine soja]
Length=651

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER DVQTG+KMIL LCL DG
Sbjct  273   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQTGLKMILNLCLTDG  332

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +LI A+N+R
Sbjct  333   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVATDGTKNLIRAINNR  392

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  393   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSTDAINKFNIYPEQIPLWLMDWIPEEGGYL  452

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  Q+HAIL+LIEAKW+DLV +MPLKICYPAL+
Sbjct  453   IGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDLVGHMPLKICYPALD  512

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI+TG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  513   NEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVALAEKRLPVDS  572

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQAR++QTW+IAG+L +K+L+ NPE A ML   ED ELL      L
Sbjct  573   WPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWEEDYELLDICVCGL  632

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R++ SR  A  Q
Sbjct  633   SKSGRKRCSRGAARSQ  648


 Score =   214 bits (544),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDFIPS +AFLL+GE +I
Sbjct  167  VEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKIPLNYDQVFIRDFIPSALAFLLRGESEI  226

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DE+  E+VLDPDFGE+AIG
Sbjct  227  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DEDNHEEVLDPDFGESAIG  284

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  285  RVAPVDSGLW  294



>ref|XP_003555178.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=652

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER DVQTG+KMIL LCL DG
Sbjct  274   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQTGLKMILNLCLTDG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +LI A+N+R
Sbjct  334   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVATDGTKNLIRAINNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  394   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPLWLMDWIPEEGGYL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  Q+HAIL+LIEAKW+DLV +MPLKICYPAL+
Sbjct  454   IGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDLVGHMPLKICYPALD  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI+TG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  514   NEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVALAEKRLPVDS  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQAR++QTW+IAG+L +K+L+ NPE A ML   ED ELL      L
Sbjct  574   WPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWEEDYELLDICVCGL  633

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R++ SR  A  Q
Sbjct  634   SKSGRKRCSRGAARSQ  649


 Score =   213 bits (543),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDFIPS +AFLL+GE +I
Sbjct  168  VEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKLPLNYDQVFIRDFIPSALAFLLRGESEI  227

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DE+  E+VLDPDFGE+AIG
Sbjct  228  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DEDNHEEVLDPDFGESAIG  285

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  286  RVAPVDSGLW  295



>gb|KGN61014.1| hypothetical protein Csa_2G034660 [Cucumis sativus]
Length=677

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L +R+DVQTG+KMIL LCL DG
Sbjct  299   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQDRVDVQTGLKMILNLCLTDG  358

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  359   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINNR  418

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPDQIPQWLMDWVPEEGGYL  478

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW DLV +MPLKICYPALE
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWGDLVGHMPLKICYPALE  538

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ VAE+RI+ D+
Sbjct  539   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRFEMAKKAVAVAEKRISNDR  598

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+LV NPE A  L   ED ELL      L
Sbjct  599   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVENPELASSLFWEEDYELLEICVCAL  658

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  659   SKTGRKKCSRGAARSQ  674


 Score =   216 bits (551),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 10/171 (6%)
 Frame = +1

Query  307  NERIFEDEQGR-SVHSIAPNGQTSATVNNAL-------PNSIEEEAWDLLRASMVYYCGN  462
            +E I  +E  R  V S   NG+    +N A         + IE+EAW LLR ++V YCG+
Sbjct  152  DENIVGEEDSRIEVGSEHVNGENLEDLNKAKVITSKREESDIEKEAWRLLREAVVTYCGS  211

Query  463  PIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMD  642
            P+GT+AANDP D   LNYDQVFIRDFIPS +AFLL GE +IVRNFLLHTLQLQSWEKT+D
Sbjct  212  PVGTMAANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLQLQSWEKTVD  271

Query  643  CYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            CYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  272  CYSPGQGLMPASFKVRTVPL--DGNNFEEVLDPDFGESAIGRVAPVDSGLW  320



>ref|XP_004302290.1| PREDICTED: uncharacterized protein LOC101304591 [Fragaria vesca 
subsp. vesca]
Length=671

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/376 (70%), Positives = 305/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  293   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  352

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA  + S +L+ A+N+R
Sbjct  353   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAVNDGSKNLVRAINNR  412

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGY 
Sbjct  413   LSALSFHIREYYWVDMRKMNEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYF  472

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+L+EAKW+DLV +MPLKICYPALE
Sbjct  473   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLVEAKWDDLVGHMPLKICYPALE  532

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+AE A+ +AE+++  D+
Sbjct  533   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAEKAVALAEKKLRADR  592

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAG+L  K+LV NPE A +L   ED ELL      L
Sbjct  593   WPEYYDTRTGKFIGKQSRLHQTWTIAGFLTTKMLVQNPEKAALLFWEEDYELLEICVCAL  652

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R+K SR  A  Q
Sbjct  653   SKSGRKKCSRGAARSQ  668


 Score =   221 bits (564),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 130/168 (77%), Gaps = 7/168 (4%)
 Frame = +1

Query  307  NERIFEDEQGRSVHSIAPNGQTSATVNNALPNS-----IEEEAWDLLRASMVYYCGNPIG  471
            +E +  +EQ R   +I  N +        L +      IE+EAW LLR S+V YCG+P+G
Sbjct  149  DENVVGEEQSRIEVAIDENVEGVDEQAKVLSSEREFSDIEKEAWRLLRESVVTYCGSPVG  208

Query  472  TIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYS  651
            T+AANDPND   LNYDQVFIRDF+PS +AFLLKGE +IVRNFLLHTLQLQSWEKT+DCYS
Sbjct  209  TVAANDPNDKLPLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDCYS  268

Query  652  PGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PGQGLMPASFKVR VPL  DEN  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  269  PGQGLMPASFKVRIVPL--DENKFEEVLDPDFGESAIGRVAPVDSGLW  314



>ref|XP_010102907.1| hypothetical protein L484_005970 [Morus notabilis]
 gb|EXB94375.1| hypothetical protein L484_005970 [Morus notabilis]
Length=687

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 311/376 (83%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  309   ILDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  368

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+AL C+REM+   +++ +L+ A+N+R
Sbjct  369   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCSREMVIVNDSTKNLVAAINNR  428

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  429   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPEEGGYL  488

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T  Q+  IL+LIEAKW+DL+  MPLKICYPALE
Sbjct  489   IGNLQPAHMDFRFFTLGNLWAIVSSLGTQKQNEGILNLIEAKWDDLMGQMPLKICYPALE  548

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI TGGDPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+ +AE+R+A D+
Sbjct  549   YEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVDLAEKRLAVDQ  608

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L+  ED ELL     +L
Sbjct  609   WPEYYDTKSGRFIGKQSRLYQTWTIAGFLASKMLLENPEKASLLLWEEDYELLETCVCVL  668

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   RRK SR  +  Q
Sbjct  669   NKTSRRKCSRFASRSQ  684


 Score =   209 bits (531),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL  S+V YCG+P+GT+AAN P D   +NYDQVFIRDF+PS +AFLL GE +I
Sbjct  201  IEKEAWKLLWDSVVMYCGHPVGTVAANVPVDKQPVNYDQVFIRDFVPSALAFLLNGEPEI  260

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKVRTVPL+  + A E++LDPDFGE+AIG
Sbjct  261  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVRTVPLDGSDGAFEEILDPDFGESAIG  320

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  321  RVAPVDSGLW  330



>gb|AFS17279.1| neutral/alkaline invertase [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=556

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/370 (71%), Positives = 304/370 (82%), Gaps = 4/370 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL E++DVQTG+++IL LCL +G
Sbjct  178   VLDPDFGESAIGRAAPVDSGLWWIILLRAYGKITGDYSLQEKVDVQTGIRLILNLCLTNG  237

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML     +  L+ A+N+R
Sbjct  238   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNNGTKSLVAAINNR  297

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KKLNEIYRYKTEEYS +AINKFNIYP+QIP WLVDW+P +GGY 
Sbjct  298   LSALSFHMREYYWVDLKKLNEIYRYKTEEYSTDAINKFNIYPEQIPSWLVDWIPEQGGYF  357

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ +IL+LI+AKWEDL+A+MPLKICYPALE
Sbjct  358   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPQQNESILNLIDAKWEDLIADMPLKICYPALE  417

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++AE AI VAE+R++ DK
Sbjct  418   SEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRLDLAEKAITVAEKRLSVDK  477

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G FIGKQARLFQTW+IAGYL +K L+ NP+ A  L+  ED ELL       
Sbjct  478   WPEYYDTKKGRFIGKQARLFQTWTIAGYLTSKKLLENPDIASSLMFDEDYELLEICVCAF  537

Query  1890  SANPRRKRSR  1919
             S   R+K SR
Sbjct  538   SKAGRKKCSR  547


 Score =   219 bits (557),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + IEEEAW+LLR+S+V YCGNP+GT+AANDPND   LNYDQVFIRDF+PS +AFLL GE 
Sbjct  68   SEIEEEAWELLRSSVVNYCGNPVGTVAANDPNDKQPLNYDQVFIRDFVPSALAFLLNGEG  127

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            DIV+NFLLHTLQLQSWEKT+DCYSP QGLMPASFKV TV L   E A E+VLDPDFGE+A
Sbjct  128  DIVKNFLLHTLQLQSWEKTVDCYSPRQGLMPASFKVSTVSLNGKEGAFEEVLDPDFGESA  187

Query  760  IGRVAPVDSGMF  795
            IGR APVDSG++
Sbjct  188  IGRAAPVDSGLW  199



>emb|CBI22843.3| unnamed protein product [Vitis vinifera]
Length=673

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  294   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + + +L+ A+N+R
Sbjct  354   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGTKNLVRAINNR  413

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  414   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLVDWIPDQGGYL  473

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  474   IGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPALE  533

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+ +AE R++ D 
Sbjct  534   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVALAEERLSVDH  593

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED ELL      L
Sbjct  594   WPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICVCAL  653

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  654   SKTGRKKCSRSAARSQ  669


 Score =   221 bits (564),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            G     V   +P  IE+EAW LLR+++V YCGNP+GT+AANDP D   LNYDQVFIRDF+
Sbjct  173  GLNKEKVEREVP-EIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYDQVFIRDFV  231

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENAT  723
            PS +AFLLKGE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A 
Sbjct  232  PSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGGNGAF  291

Query  724  EDVLDPDFGEAAIGRVAPVDSGMF  795
            E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  292  EEVLDPDFGESAIGRVAPVDSGLW  315



>gb|ADF27783.1| neutral/alkaline invertase 2 [Orobanche ramosa]
Length=666

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 310/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTGMK+IL LCL+DG
Sbjct  288   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGMKLILNLCLSDG  347

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHG+PLEIQALFYSAL C+REMLA E++S +L+ A+N+R
Sbjct  348   FDMFPSLLVTDGSCMIDRRMGIHGYPLEIQALFYSALRCSREMLALEDSSKNLVRAINNR  407

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+ W+P +GGYL
Sbjct  408   LSALSFHIREYYWVDLKKINEIYRYKTEEYSTEATNKFNIYPEQIPDWLMHWIPERGGYL  467

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+L+EAKW+DL+  MPLKICYPALE
Sbjct  468   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLVEAKWDDLIGQMPLKICYPALE  527

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++AE AI  AE+R+  D+
Sbjct  528   SEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRTDLAEKAINSAEKRLPVDQ  587

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTWSIAGYL +K+L+ NPE A +L   ED +LL      L
Sbjct  588   WPEYYDTRNGKFIGKQARLYQTWSIAGYLTSKMLLENPEMASVLFWDEDYDLLEICVCAL  647

Query  1890  SANPRRKRSRKGAVKQ  1937
             S++ R+K SR  A  Q
Sbjct  648   SSSTRKKCSRMLAKSQ  663


 Score =   216 bits (549),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E+EAW LLR ++V YCG+P+GT+AANDPND   LNYDQVFIRDF+PS  AFLLKGE +I
Sbjct  182  VEKEAWRLLRNAVVSYCGSPVGTLAANDPNDKLPLNYDQVFIRDFVPSAFAFLLKGEGEI  241

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  D+N  E+VLDPDFGE+AIG
Sbjct  242  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DDNKFEEVLDPDFGESAIG  299

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  300  RVAPVDSGLW  309



>ref|XP_008793361.1| PREDICTED: alkaline/neutral invertase CINV2 [Phoenix dactylifera]
Length=670

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  292   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLSDG  351

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + S +L+ A+N+R
Sbjct  352   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITINDTSKNLVRAINNR  411

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYWID+KK+NEIYRYKTEEYS+ A+NKFNIYP+QIP WL DW+P KGGYL
Sbjct  412   LSALSFHIREYYWIDMKKINEIYRYKTEEYSHNAVNKFNIYPEQIPSWLADWIPEKGGYL  471

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN W+IVSSLAT  Q+  IL+LIE KW+DLVANMP KICYPALE
Sbjct  472   IGNLQPAHMDFRFFSLGNFWAIVSSLATPRQAEGILNLIEDKWDDLVANMPFKICYPALE  531

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A+ A+ VAE+R++ DK
Sbjct  532   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQRAVTVAEKRLSNDK  591

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+ L+QTW+IAG+L++K+ + NPE A +L   ED ELL      L
Sbjct  592   WPEYYDTRTGRFIGKQSHLYQTWTIAGFLISKMFLENPEIAMILTCEEDLELLEGCICSL  651

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R K SR  A  Q
Sbjct  652   RKSSRAKCSRLAARSQ  667


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW LL  ++V YCG+P+GT+AANDP   + LNYDQVFIRDF+P+ IAFLLKGE 
Sbjct  182  SEVEKEAWRLLNKAVVSYCGSPVGTVAANDPTALNQLNYDQVFIRDFVPAAIAFLLKGES  241

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            D+VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+A
Sbjct  242  DVVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESA  301

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  302  IGRVAPVDSGLW  313



>ref|XP_010024149.1| PREDICTED: alkaline/neutral invertase CINV1 [Eucalyptus grandis]
 gb|KCW60578.1| hypothetical protein EUGRSUZ_H03308 [Eucalyptus grandis]
Length=676

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+I+ LCL DG
Sbjct  298   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLIMNLCLTDG  357

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+AL C+REML+  + S +L+ A+N+R
Sbjct  358   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYNALRCSREMLSVNDGSKNLVRAINNR  417

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P  GGYL
Sbjct  418   LSALSFHIREYYWVDMRKINEIYRYKTEEYSTDATNKFNIYPDQIPLWLMDWIPENGGYL  477

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFR F+LGNLWSIVSSL T  Q+ AIL+LIEAKW+DL+ +MPLKICYPALE
Sbjct  478   IGNLQPAHMDFRLFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLIGHMPLKICYPALE  537

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R++ D+
Sbjct  538   NEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVALAEKRLSEDR  597

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAG+L +K+L+ NPE A  L   ED ELL      L
Sbjct  598   WPEYYDTRTGRFIGKQSRLFQTWTIAGFLTSKMLLENPETASNLFWEEDYELLEICVCAL  657

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  658   SKSGRRKCSRGAARSQ  673


 Score =   218 bits (556),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW LL  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE 
Sbjct  190  SQVEKEAWRLLEEAIVMYCGSPVGTMAANDPGDKQPLNYDQVFIRDFVPSALAFLLKGEG  249

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  DEN  E+VLDPDFGE+A
Sbjct  250  EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DENKVEEVLDPDFGESA  307

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  308  IGRVAPVDSGLW  319



>ref|XP_010938195.1| PREDICTED: alkaline/neutral invertase CINV1-like [Elaeis guineensis]
Length=649

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/376 (70%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  271   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLSDG  330

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + S +L+ A+N+R
Sbjct  331   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITINDTSKNLVRAINNR  390

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS  A+NKFNIYP+QIP WL DW+P KGGYL
Sbjct  391   LSALSFHIREYYWVDMKKINEIYRYKTEEYSQNAVNKFNIYPEQIPYWLADWIPEKGGYL  450

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN W+IVSSL T  Q+  IL+LIE KW+DLVANMP KICYPALE
Sbjct  451   IGNLQPAHMDFRFFSLGNFWAIVSSLTTPRQAEGILNLIEDKWDDLVANMPFKICYPALE  510

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A+ A+ VAE+R++ DK
Sbjct  511   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQRAVAVAEKRLSNDK  570

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+LV+KLL+A PE A +L   ED ELL      L
Sbjct  571   WPEYYDTRAGRFIGKQSRLYQTWTIAGFLVSKLLLAYPEIATILTCEEDLELLEGCICGL  630

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R K SR  A  Q
Sbjct  631   NKSSRTKCSRLAARSQ  646


 Score =   211 bits (537),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW  L  ++  YCG+P+GT+AANDP   S LNYDQVFIRDF+PS IAFL+KGE 
Sbjct  161  SEVEKEAWRFLNKAVASYCGSPVGTVAANDPTTLSQLNYDQVFIRDFVPSAIAFLIKGES  220

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            D+VRNFLLH +QLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+A
Sbjct  221  DVVRNFLLHIVQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESA  280

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  281  IGRVAPVDSGLW  292



>ref|XP_004158710.1| PREDICTED: uncharacterized LOC101218389 [Cucumis sativus]
Length=601

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 305/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK + D +L +R+DVQTG+KMIL LCL DG
Sbjct  223   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITRDYALQDRVDVQTGLKMILNLCLTDG  282

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  283   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINNR  342

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  343   LSALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPDQIPQWLMDWVPEEGGYL  402

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW DLV +MPLKICYPALE
Sbjct  403   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWGDLVGHMPLKICYPALE  462

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ VAE+RI+ D+
Sbjct  463   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRFEMAKKAVAVAEKRISNDR  522

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+LV NPE A  L   ED ELL      L
Sbjct  523   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKMLVENPELASSLFWEEDYELLEICVCAL  582

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  583   SKTGRKKCSRGAARSQ  598


 Score =   216 bits (551),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 10/171 (6%)
 Frame = +1

Query  307  NERIFEDEQGR-SVHSIAPNGQTSATVNNAL-------PNSIEEEAWDLLRASMVYYCGN  462
            +E I  +E  R  V S   NG+    +N A         + IE+EAW LLR ++V YCG+
Sbjct  76   DENIVGEEDSRIEVGSEHVNGENLEDLNKAKVITSKREESDIEKEAWRLLREAVVTYCGS  135

Query  463  PIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMD  642
            P+GT+AANDP D   LNYDQVFIRDFIPS +AFLL GE +IVRNFLLHTLQLQSWEKT+D
Sbjct  136  PVGTMAANDPADKQPLNYDQVFIRDFIPSALAFLLNGEGEIVRNFLLHTLQLQSWEKTVD  195

Query  643  CYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            CYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  196  CYSPGQGLMPASFKVRTVPL--DGNNFEEVLDPDFGESAIGRVAPVDSGLW  244



>gb|KHG04460.1| hypothetical protein F383_29023 [Gossypium arboreum]
Length=677

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/372 (70%), Positives = 306/372 (82%), Gaps = 4/372 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL +R+DVQTG+++IL LCL DG
Sbjct  303   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQDRVDVQTGIRLILNLCLTDG  362

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +A+ +L+ A+N+R
Sbjct  363   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDATKNLVAAVNNR  422

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRY TEEYS +AINKFNIYPDQIP WLVDW+P +GGY 
Sbjct  423   LSALSFHIREYYWVDMKKINEIYRYNTEEYSTDAINKFNIYPDQIPSWLVDWIPDEGGYF  482

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T  Q+  +LDLIEAKW+DLVANMPLKI YPALE
Sbjct  483   IGNLQPAHMDFRFFTLGNLWAIVSSLGTPKQNKDVLDLIEAKWDDLVANMPLKIIYPALE  542

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +PE+A+ A+ +AE R+A D+
Sbjct  543   SDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQRAVALAEERLAVDQ  602

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +K+L+ NPE A +L   ED ELL      L
Sbjct  603   WPEYYDTRSGRFIGKQSRLYQTWTVAGFLTSKMLLQNPEKASLLFWEEDYELLETCVCGL  662

Query  1890  SANPRRKRSRKG  1925
             S N RRK SR G
Sbjct  663   SKNGRRKCSRLG  674


 Score =   218 bits (556),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 128/172 (74%), Gaps = 6/172 (3%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNALP------NSIEEEAWDLLRASMVYYCG  459
            E G+  + ED  G +V     N       N   P      + IE+EAW++LR ++V YCG
Sbjct  153  ETGDGLVKEDNTGINVSESDVNTNNVEGSNLTEPRIEREVSEIEKEAWNILRGAVVSYCG  212

Query  460  NPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTM  639
            NP+GTIAANDP D   LNYDQ+FIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEKT+
Sbjct  213  NPVGTIAANDPADKQPLNYDQIFIRDFVPSALAFLLNGEAEIVKNFLLHTLQLQSWEKTV  272

Query  640  DCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            DCYSPGQGLMPASFKVRTVP +    A E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  273  DCYSPGQGLMPASFKVRTVPRDGSPEAFEEVLDPDFGESAIGRVAPVDSGLW  324



>gb|AHD25653.1| neutral invertase 2 (chloroplast) [Camellia sinensis]
Length=675

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 310/381 (81%), Gaps = 4/381 (1%)
 Frame = +3

Query  816   IIVICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLA  983
             + V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++ILKLCL 
Sbjct  295   VDVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQERVDVQTGIRLILKLCLT  354

Query  984   DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALN  1163
             DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  +REML   + + +L+ A+N
Sbjct  355   DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLIVNDGTKNLVAAVN  414

Query  1164  SRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGG  1343
             +RL ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+  +GG
Sbjct  415   NRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWISEEGG  474

Query  1344  YLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPA  1523
             YLIGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIEAKW+D VA+MPLKICYPA
Sbjct  475   YLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEGILNLIEAKWDDFVAHMPLKICYPA  534

Query  1524  LEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAG  1703
             LE  EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KMK+PE+A  AI +AE+R++ 
Sbjct  535   LEYDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMKKPELARKAIDLAEKRLSE  594

Query  1704  DKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSS  1883
             D+WPEYYDT+ G FIGKQ+RLFQTW+IAG+L +K+L+ NPE A +L   ED ELL     
Sbjct  595   DQWPEYYDTRSGRFIGKQSRLFQTWTIAGFLTSKMLLDNPEMASLLFWDEDYELLEICVC  654

Query  1884  ILSANPRRKRSRKGAVKQSYI  1946
              LS   R+K SR  A  Q +I
Sbjct  655   ALSKTGRKKCSRGLAKSQIHI  675


 Score =   214 bits (544),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + IE+EAW+LLR ++V YCGNP+GT+AA DP D   LNYDQVFIRDF+PS +AFLL GE 
Sbjct  187  SKIEKEAWELLRGAVVDYCGNPVGTVAAKDPADKQPLNYDQVFIRDFVPSALAFLLNGEG  246

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR VPL+    A  DVLDPDFGE+A
Sbjct  247  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRPVPLDGSNGAFVDVLDPDFGESA  306

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  307  IGRVAPVDSGLW  318



>emb|CAP59645.1| putative neutral invertase [Vitis vinifera]
Length=674

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/377 (70%), Positives = 307/377 (81%), Gaps = 5/377 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  295   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLTDG  354

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +ASI+L+ A+N+R
Sbjct  355   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINLVRAINNR  414

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  415   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWVPEEGGYL  474

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  ILD I+AKW+DLV +MPLKICYPALE
Sbjct  475   IGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLKICYPALE  534

Query  1530  GQEWRIITGGDPKNT-PWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGD  1706
              +EWRIITG DPKNT PWSYHN GSWPTLLWQ  +A +KM RPE+A  A+  AE+R+A D
Sbjct  535   YEEWRIITGSDPKNTSPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAEKRLAVD  594

Query  1707  KWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSI  1886
             +WPEYYDT+ G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L   ED +LL      
Sbjct  595   RWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLLEICVCG  654

Query  1887  LSANPRRKRSRKGAVKQ  1937
             LS   RRK SR  A  Q
Sbjct  655   LSKTGRRKCSRFAARSQ  671


 Score =   220 bits (560),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL+ S+V YCG+PIGT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  188  EKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGEIV  247

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+ +  A E+VLDPDFGE+AIGR
Sbjct  248  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNNEAHEEVLDPDFGESAIGR  307

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  308  VAPVDSGLW  316



>ref|XP_006645848.1| PREDICTED: alkaline/neutral invertase CINV2-like, partial [Oryza 
brachyantha]
Length=542

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 307/380 (81%), Gaps = 7/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  165   VLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDYALQERVDVQTGIKLILSLCLSDG  224

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  225   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVLNDGSKNLLRAINNR  284

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  285   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  344

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKICYPA+E
Sbjct  345   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAME  404

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R+  DK
Sbjct  405   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLTADK  464

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  465   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  524

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R + SR+ A  +S++V
Sbjct  525   SKK-RTRCSRRAA--KSHVV  541


 Score =   205 bits (521),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  421  WDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFL  600
            W LLR ++V YCG P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE +IVRNFL
Sbjct  62   WRLLRRAVVSYCGAPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  121

Query  601  LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPV  780
            LHTLQLQSWEKT+DCYSPGQGLMPASFK+R VPL+++  A E+VLDPDFGE+AIGRVAPV
Sbjct  122  LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  181

Query  781  DSGMF  795
            DSG++
Sbjct  182  DSGLW  186



>emb|CDP15231.1| unnamed protein product [Coffea canephora]
Length=671

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 311/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  293   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLSDG  352

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML  ++ S +LI A+N+R
Sbjct  353   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLRVDDGSKNLIRAINNR  412

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+DW+P KGGYL
Sbjct  413   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMDWIPEKGGYL  472

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW+DLV  MPLKICYPALE
Sbjct  473   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDLVGLMPLKICYPALE  532

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A+ +AE R+  D+
Sbjct  533   SEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRMDLAKKAVDLAETRLPADR  592

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F+GKQARL+QTW+IAGYL +K+L+ NPE A +L   ED +LL      L
Sbjct  593   WPEYYDTRYGKFVGKQARLYQTWTIAGYLTSKMLLENPEMASLLFWEEDYDLLEICVCAL  652

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  653   SKSGRKKCSR-GAAKSQILV  671


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +++EAW LL  ++V YCG+P+GT+AANDPND   LNYDQVFIRDF+PS +AFLLKG+ 
Sbjct  185  SEVDKEAWRLLENAVVSYCGSPVGTLAANDPNDKLPLNYDQVFIRDFVPSALAFLLKGDS  244

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  DEN  E+VLDPDFGE+A
Sbjct  245  EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DENKFEEVLDPDFGESA  302

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  303  IGRVAPVDSGLW  314



>ref|XP_003535315.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=651

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/376 (70%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER DVQTG+KMIL LCL DG
Sbjct  273   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCSLQERADVQTGLKMILNLCLTDG  332

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +LI A+N+R
Sbjct  333   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVATDGTNNLIRAINNR  392

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  393   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSTDAINKFNIYPEQIPLWLMDWIPEEGGYL  452

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  Q+ AIL+LIEAKW+DLV +MPLKICYPAL+
Sbjct  453   IGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNQAILNLIEAKWDDLVGHMPLKICYPALD  512

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI+TG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  513   NEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVALAEKRLPVDS  572

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQAR++QTW+IAG+L +K+L+ NPE A ML   ED ELL      L
Sbjct  573   WPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWEEDYELLDICVCGL  632

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R++ SR  A  Q
Sbjct  633   SKSGRKRCSRGAARSQ  648


 Score =   214 bits (544),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDFIPS +AFLL+GE +I
Sbjct  167  VEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKIPLNYDQVFIRDFIPSALAFLLRGESEI  226

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DE+  E+VLDPDFGE+AIG
Sbjct  227  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DEDNHEEVLDPDFGESAIG  284

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  285  RVAPVDSGLW  294



>ref|XP_010045364.1| PREDICTED: alkaline/neutral invertase CINV2 [Eucalyptus grandis]
 gb|KCW87538.1| hypothetical protein EUGRSUZ_B03984 [Eucalyptus grandis]
Length=671

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/377 (69%), Positives = 307/377 (81%), Gaps = 4/377 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER++VQTG+++IL LCL DG
Sbjct  293   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVEVQTGIRLILNLCLTDG  352

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +A+  L+ A+N+R
Sbjct  353   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATTKLVAAINNR  412

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRY TEEYS EAINKFNIYPDQIP WLVDW+P  GGYL
Sbjct  413   LSALSFHIREYYWVDMKKINEIYRYNTEEYSTEAINKFNIYPDQIPSWLVDWIPETGGYL  472

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+I+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  473   IGNLQPAHMDFRFFTLGNLWAIISSLGTQKQNEGILNLIEAKWDDLVAHMPLKICYPALE  532

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWR+ITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +P +A+ A+ +AE+R++ D 
Sbjct  533   SEEWRLITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPGLAKKAVDLAEKRLSADD  592

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAG+L +K+L+  PE A ML   ED ELL      L
Sbjct  593   WPEYYDTRSGRFIGKQSRLFQTWTIAGFLTSKMLLEKPELASMLFWEEDYELLEICVCSL  652

Query  1890  SANPRRKRSRKGAVKQS  1940
               + R+K SR+ A  QS
Sbjct  653   GKSGRKKCSRRNARSQS  669


 Score =   218 bits (554),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + IE+EAW LLR+++V YCGNP+GT+AAND  D   LNYDQVFIRDF+PS +AFLL GE 
Sbjct  183  SEIEKEAWKLLRSAVVNYCGNPVGTVAANDLTDKQALNYDQVFIRDFVPSALAFLLNGEG  242

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR VPLE  + A E+VLDPDFGE+A
Sbjct  243  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRGVPLEGSDGAFEEVLDPDFGESA  302

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  303  IGRVAPVDSGLW  314



>ref|XP_003591226.1| Neutral invertase [Medicago truncatula]
 gb|AES61477.1| neutral/alkaline invertase [Medicago truncatula]
Length=594

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 312/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER+DVQTG+KMILKLCL DG
Sbjct  216   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERVDVQTGLKMILKLCLTDG  275

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+ A+N+R
Sbjct  276   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVTDGTNDLVRAINNR  335

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIR+YYW+D+KK+NEIYRY TEEYS +AINKFNIYP+QIP W++DW+P KGGYL
Sbjct  336   LSALSFHIRQYYWVDMKKINEIYRYNTEEYSMDAINKFNIYPEQIPFWVMDWIPEKGGYL  395

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL+T  Q+ AIL+LIEAKW++LV +MPLKICYPAL+
Sbjct  396   IGNLQPAHMDFRFFTLGNLWSIISSLSTPRQNEAILNLIEAKWDELVGHMPLKICYPALD  455

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  456   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVDLAEKRLPVDS  515

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +KLL+ NP+ A ML + ED +LL      L
Sbjct  516   WPEYYDTRSGKFIGKQSRLYQTWTIAGFLTSKLLLKNPKMASMLFSEEDYDLLDICVCGL  575

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  576   SKRGRKKCSR-GAAKSQILV  594


 Score =   204 bits (520),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +1

Query  274  LRCYCRPAE-RGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVY  450
            ++C+    E R NE  FE    +   ++ P    S  V     + +E++AW LL+ ++V 
Sbjct  65   VQCFSTSVETRVNENNFERIYIQGGVNVKPLVVESVVVKEEEESHVEKQAWKLLKDAVVT  124

Query  451  YCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWE  630
            YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKG+ +IV+ FLLHTLQLQSWE
Sbjct  125  YCGNPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGDTEIVKYFLLHTLQLQSWE  184

Query  631  KTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KT+DCYSPGQGLMPASFKVRTV L+ D    E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  185  KTVDCYSPGQGLMPASFKVRTVALDGD--TREEVLDPDFGESAIGRVAPVDSGLW  237



>ref|XP_010667189.1| PREDICTED: alkaline/neutral invertase CINV2-like [Beta vulgaris 
subsp. vulgaris]
Length=682

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/369 (71%), Positives = 306/369 (83%), Gaps = 4/369 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD S+ ER+DVQTG+++IL LCL +G
Sbjct  304   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSVQERVDVQTGIRLILNLCLTNG  363

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+ EMLA  + + +L+  +N+R
Sbjct  364   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSLEMLAVNDGTKNLVATINNR  423

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIRE+YW+D+KKLNEIYRY TEEYS +AINKFNIYP+QIP WL DW+P  GGYL
Sbjct  424   LSALSFHIREHYWVDIKKLNEIYRYNTEEYSTDAINKFNIYPEQIPSWLGDWIPEHGGYL  483

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+ ++L+LIEAKW+DLVA+MPLKICYPALE
Sbjct  484   IGNLQPAHMDFRFFTLGNLWSIISSLGTPQQNKSVLNLIEAKWDDLVADMPLKICYPALE  543

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KMKRPE+AE AI +AE+R++ DK
Sbjct  544   SEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMKRPELAEKAIALAEKRLSVDK  603

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK+G FIGKQARLFQTW++AGYL +KLL+  P+AA  LI  ED ELL      L
Sbjct  604   WPEYYDTKKGRFIGKQARLFQTWTVAGYLTSKLLLEKPDAASALIFDEDYELLEICVCSL  663

Query  1890  SANPRRKRS  1916
             S   R+K S
Sbjct  664   SKGGRKKCS  672


 Score =   220 bits (560),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW+LLR+S+V YCGNP+GT+AAND +D+  LNYDQVFIRDF+PS +AFLL GE DI
Sbjct  196  IEEEAWELLRSSIVNYCGNPVGTVAANDLSDNQQLNYDQVFIRDFVPSALAFLLNGEGDI  255

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR VPL+  E A ++VLDPDFGE+AIG
Sbjct  256  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRPVPLDGKEGAFKEVLDPDFGESAIG  315

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  316  RVAPVDSGLW  325



>gb|AGG41122.1| putative neutral/alkaline invertase [Saccharum hybrid cultivar 
FN-41]
Length=629

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/373 (70%), Positives = 303/373 (81%), Gaps = 5/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD +LLER+DVQTG+++IL LCLADG
Sbjct  253   VLDPDFGGAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQTGIQLILSLCLADG  312

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML     S +LI A+N+R
Sbjct  313   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVNNGSKNLIRAINTR  372

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  373   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  432

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKICYPA+E
Sbjct  433   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAME  492

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  493   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLSDDK  552

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  553   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  612

Query  1890  SANPRRKRSRKGA  1928
             S   R + SR+ A
Sbjct  613   STK-RTRCSRRAA  624


 Score =   205 bits (522),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 116/147 (79%), Gaps = 4/147 (3%)
 Frame = +1

Query  367  QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            QT   V  A P       E EAW LLR ++V YCG P+GT+AA DP  +  LNYDQVFIR
Sbjct  128  QTDEAVEPAAPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIR  187

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PS +AFL++GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ + 
Sbjct  188  DFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENN  247

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
               E+VLDPDFG AAIGRVAPVDSG++
Sbjct  248  EGFEEVLDPDFGGAAIGRVAPVDSGLW  274



>gb|AGG41113.1| putative neutral/alkaline invertase [Saccharum hybrid cultivar 
FN-41]
Length=629

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/373 (70%), Positives = 303/373 (81%), Gaps = 5/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD +LLER+DVQTG+++IL LCLADG
Sbjct  253   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQTGIQLILSLCLADG  312

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML     S +LI A+N+R
Sbjct  313   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVNNGSKNLIRAINTR  372

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  373   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  432

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKICYPA+E
Sbjct  433   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAME  492

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  493   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLSDDK  552

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  553   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  612

Query  1890  SANPRRKRSRKGA  1928
             S   R + SR+ A
Sbjct  613   STK-RTRCSRRAA  624


 Score =   208 bits (529),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 117/147 (80%), Gaps = 4/147 (3%)
 Frame = +1

Query  367  QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            QT   V  A P       E EAW LLR ++V YCG P+GT+AA DP  +  LNYDQVFIR
Sbjct  128  QTDEAVEPAAPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIR  187

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PS +AFL++GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ + 
Sbjct  188  DFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENN  247

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
               E+VLDPDFGEAAIGRVAPVDSG++
Sbjct  248  EGFEEVLDPDFGEAAIGRVAPVDSGLW  274



>gb|AHF27220.1| invertase [Hevea brasiliensis]
Length=683

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/377 (68%), Positives = 310/377 (82%), Gaps = 4/377 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYG+ + D +L ERIDVQTG+++IL LCL+DG
Sbjct  305   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITSDYALQERIDVQTGIRLILNLCLSDG  364

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+AL CAREML   + + +L+TA+N+R
Sbjct  365   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCAREMLIVNDGTKNLVTAVNNR  424

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  425   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  484

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+I+SSL T  Q+  IL+LIE+KW+DLVA+MPLKICYPALE
Sbjct  485   IGNLQPAHMDFRFFTLGNLWAIISSLGTIKQNEGILNLIESKWDDLVAHMPLKICYPALE  544

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EW IITG DPKNTPWSYHN GSWPTLLWQ  +A VKM RPE+A+ A+ +AE+R++ D+
Sbjct  545   YEEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACVKMGRPELAQRAVDLAEKRLSLDQ  604

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAG+L +K L+ NPE A +L   ED +LL      L
Sbjct  605   WPEYYDTRSGRFIGKQSRLFQTWTIAGFLTSKKLLENPEKASLLFWDEDYDLLETCVCAL  664

Query  1890  SANPRRKRSRKGAVKQS  1940
             S   R+K SR  +  Q+
Sbjct  665   SKTSRKKCSRIASRSQN  681


 Score =   215 bits (548),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 134/178 (75%), Gaps = 10/178 (6%)
 Frame = +1

Query  289  RPAERGNERIFEDEQGRSVHSIAPN---------GQTSATVNNALPNSIEEEAWDLLRAS  441
            +  E GN+ + E+++   +     N          +T++ V   + + IE+EAW LL+ +
Sbjct  150  KKIETGNDVVKEEDKSNRIEINGTNVNIDYLKGLNETASKVEREV-SEIEKEAWKLLQGA  208

Query  442  MVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQ  621
            +V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL G+ +IV+NFLL+TLQLQ
Sbjct  209  IVNYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGDAEIVKNFLLYTLQLQ  268

Query  622  SWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SWEKT+DCYSPGQGLMPASFKVRT PL+  + A E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  269  SWEKTVDCYSPGQGLMPASFKVRTAPLDGSDGAFEEVLDPDFGESAIGRVAPVDSGLW  326



>ref|XP_009337633.1| PREDICTED: alkaline/neutral invertase CINV2 [Pyrus x bretschneideri]
Length=676

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  298   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  357

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA  + S +L+ A+N+R
Sbjct  358   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAVNDGSKNLVRAINNR  417

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGY 
Sbjct  418   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYF  477

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ A+L+LIEAKW+DLV +MPLKI YPALE
Sbjct  478   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDAVLNLIEAKWDDLVGHMPLKISYPALE  537

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A  +AE+R+  D+
Sbjct  538   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAAALAEKRLRSDR  597

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+IAG+L  K+L+ NPE A +L   ED ELL      L
Sbjct  598   WPEYYDTRTGKFIGKQARLYQTWTIAGFLTTKMLLENPEKAALLFWDEDYELLEICVCAL  657

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  658   SKSGRKKCSR-GAAKSQILV  676


 Score =   227 bits (578),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 134/170 (79%), Gaps = 12/170 (7%)
 Frame = +1

Query  307  NERIFEDEQGRSVHSIAPNGQTSATVNNALP-------NSIEEEAWDLLRASMVYYCGNP  465
            +E I  +E+ R       +G+ S ++N A         + IE+EAW LLR S+V YCGNP
Sbjct  155  DENIVREEESRIE---VGDGKKSESLNEATVVTSEREYSDIEKEAWRLLRDSVVTYCGNP  211

Query  466  IGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDC  645
            +GT+AANDP D  +LNYDQVFIRDF+PS +AFLLKGE +IVRNFLLHTLQLQSWEKT+DC
Sbjct  212  VGTVAANDPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTVDC  271

Query  646  YSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            YSPGQGLMPASFKVRTVPL  D N TE+VLDPDFGE+AIGRVAPVDSG++
Sbjct  272  YSPGQGLMPASFKVRTVPL--DGNKTEEVLDPDFGESAIGRVAPVDSGLW  319



>ref|XP_009414162.1| PREDICTED: alkaline/neutral invertase CINV2-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  272   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  331

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + S +L+ A+N+R
Sbjct  332   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITFNDGSKNLVRAINNR  391

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++AINKFNIYP+QIP WLV+WMP KGGY 
Sbjct  392   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDAINKFNIYPEQIPSWLVEWMPDKGGYF  451

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGN W+IVSSLAT  Q+  IL+LIE KW+D+V  MPLKICYP+LE
Sbjct  452   IGNLQPAHMDFRFFSLGNFWAIVSSLATPRQAEGILNLIEDKWDDIVGRMPLKICYPSLE  511

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ VAE+R+  DK
Sbjct  512   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRSELAQRAVAVAEKRLPIDK  571

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L AK+L+ NP AA +L   ED ELL   +  L
Sbjct  572   WPEYYDTRSGRFIGKQSRLYQTWTIAGFLTAKMLLENPAAAAVLTCDEDLELLQGCACSL  631

Query  1890  SANPRRKRSRKGAVKQ  1937
             S N R K SR  A  Q
Sbjct  632   SKNARIKCSRLAAKSQ  647


 Score =   206 bits (525),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSS-ILNYDQVFIRDFIPSGIAFLLKGE  576
            + +E+EAW LL  ++V YCG PIGT+AAND   ++  +NYDQVFIRDF+PS +AFLLKGE
Sbjct  161  SEVEKEAWRLLDRAVVSYCGRPIGTVAANDVTAANQAVNYDQVFIRDFVPSALAFLLKGE  220

Query  577  YDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEA  756
             +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+
Sbjct  221  SEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGES  280

Query  757  AIGRVAPVDSGMF  795
            AIGRVAPVDSG++
Sbjct  281  AIGRVAPVDSGLW  293



>ref|XP_010914649.1| PREDICTED: LOW QUALITY PROTEIN: alkaline/neutral invertase CINV2 
[Elaeis guineensis]
Length=628

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLSDG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + S +L+ A+N+R
Sbjct  310   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGSKNLLRAINNR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+ K+NEIYRYKTEEYS +A NKFNIYP+QIP WLV+W+P KGGYL
Sbjct  370   LSALSFHIREYYWVDMNKINEIYRYKTEEYSQDATNKFNIYPEQIPSWLVNWIPEKGGYL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGN+QPAHMDFRFFSLGNLW+IVSSL+T  Q+  IL+LIE KW+DL+ NMPLKICYPALE
Sbjct  430   IGNVQPAHMDFRFFSLGNLWAIVSSLSTPRQAEGILNLIEDKWDDLLGNMPLKICYPALE  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+ VAE+R++ DK
Sbjct  490   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVAVAEKRLSNDK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+++GYL +K+L+ NPE A +L   ED ELL   +  L
Sbjct  550   WPEYYDTRTGRFIGKQARLYQTWTVSGYLTSKMLLENPEMASILTCEEDLELLEGCACSL  609

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R K SR  A  Q
Sbjct  610   TKSARTKCSRFAAKSQ  625


 Score =   209 bits (532),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW LL+ ++V YCGNP+GT+AA+DP  +  LNYDQVFIRDF+PS +AFLLKGE 
Sbjct  141  SELEKEAWRLLKRAVVNYCGNPVGTVAADDPG-AQPLNYDQVFIRDFVPSALAFLLKGES  199

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+P++    A E+VLDPDFGE+A
Sbjct  200  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTMPMDGSNEAYEEVLDPDFGESA  259

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  260  IGRVAPVDSGLW  271



>gb|EPS61872.1| neutral/alkaline invertase 2, partial [Genlisea aurea]
Length=484

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ERIDVQTG+K+IL LCL+DG
Sbjct  106   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFTLQERIDVQTGIKLILNLCLSDG  165

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+RE+L+ +E S +L+ A+N+R
Sbjct  166   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREILSTDEGSKNLVRAINNR  225

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+ W+P KGGYL
Sbjct  226   LSALSFHIREYYWVDLKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMHWIPEKGGYL  285

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ A+L+LIEAKW+DLV  MPLKICYPALE
Sbjct  286   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAVLNLIEAKWDDLVGQMPLKICYPALE  345

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWP LLWQ  +A +KM R ++A+ AI +AE R++ D 
Sbjct  346   AEEWRIITGSDPKNTPWSYHNGGSWPVLLWQFTLACMKMGRTDLAKKAIDLAEMRLSKDH  405

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+IAG+L +K+L+ NPE A +L   ED ELL      L
Sbjct  406   WPEYYDTRNGKFIGKQARLYQTWTIAGFLTSKMLLRNPEMASLLYWDEDYELLEICVCAL  465

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + R+K SR  A  Q
Sbjct  466   SNSNRKKCSRHLARSQ  481


 Score =   209 bits (531),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            EEEAW LLR ++V YC +P+GT+AANDPND   LNYDQVFIRDFIPS  AFLLKG+ +IV
Sbjct  1    EEEAWRLLRNAVVSYCRSPVGTVAANDPNDKIPLNYDQVFIRDFIPSAFAFLLKGDGEIV  60

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR V LE  +N  E+VLDPDFGE+AIGR
Sbjct  61   RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRAVALE--DNNFEEVLDPDFGESAIGR  118

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  119  VAPVDSGLW  127



>ref|NP_001169586.1| hypothetical protein [Zea mays]
 gb|ACN34188.1| unknown [Zea mays]
 gb|AFW80675.1| hypothetical protein ZEAMMB73_618506 [Zea mays]
Length=626

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/373 (70%), Positives = 304/373 (82%), Gaps = 5/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD +LLER+DVQTG+++IL LCLADG
Sbjct  250   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYSKITGDSALLERVDVQTGIQLILSLCLADG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +LI A+N+R
Sbjct  310   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVNDGSKNLIRAINNR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  370   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DL+ANMPLKICYPA+E
Sbjct  430   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLIANMPLKICYPAME  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  490   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFILACIKMGRPELARRAITVAEERLSDDK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  550   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  609

Query  1890  SANPRRKRSRKGA  1928
             S   R + SR+ A
Sbjct  610   SKK-RTRCSRRAA  621


 Score =   213 bits (541),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = +1

Query  355  APNGQTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQ  522
            A   QT   V  A P       E EAW LLR ++V YCG P+GT+AA DP  +  LNYDQ
Sbjct  121  AAAAQTDEAVAPAAPLRQETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQ  180

Query  523  VFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPL  702
            VFIRDF+PS +AFL++GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RT+PL
Sbjct  181  VFIRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTLPL  240

Query  703  ENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            + +    E+VLDPDFGEAAIGRVAPVDSG++
Sbjct  241  DENNEGFEEVLDPDFGEAAIGRVAPVDSGLW  271



>ref|XP_007031201.1| Neutral invertase isoform 1 [Theobroma cacao]
 gb|EOY11703.1| Neutral invertase isoform 1 [Theobroma cacao]
Length=669

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 313/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCLADG
Sbjct  291   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLILNLCLADG  350

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+AL C+REML   + S +L+ A+N+R
Sbjct  351   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCSREMLTVNDGSKNLVRAINNR  410

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  411   LSALSFHIREYYWVDMKKINEIYRYKTEEYSLDAINKFNIYPEQIPSWLMDWIPGEGGYL  470

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGNLWS+VSSL T  Q+ AIL+LIEAKW+D+V  MPLKICYPA+E
Sbjct  471   LGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAILNLIEAKWDDIVGQMPLKICYPAVE  530

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+A D+
Sbjct  531   NEEWRIITGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKAVSLAEKRLAIDR  590

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L ++L++ NPE A +L   ED ELL      L
Sbjct  591   WPEYYDTRAGKFIGKQSRLYQTWTIAGFLTSRLMLENPEMASLLFWEEDYELLEICVCAL  650

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  651   SKSGRKKCSR-GAAKSQILV  669


 Score =   218 bits (554),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW+LLR ++V YCG P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  185  IEKEAWNLLRGAVVTYCGTPVGTVAANDPADKLPLNYDQVFIRDFVPSALAFLLKGEGEI  244

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D+N  E+VLDPDFGE+AIG
Sbjct  245  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DDNKFEEVLDPDFGESAIG  302

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  303  RVAPVDSGLW  312



>ref|XP_004295043.1| PREDICTED: uncharacterized protein LOC101296189 [Fragaria vesca 
subsp. vesca]
Length=674

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/375 (68%), Positives = 305/375 (81%), Gaps = 4/375 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWII+LRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  299   VLDPDFGESAIGRVAPVDSGLWWIIMLRAYGKITGDYTLQERVDVQTGIRLILNLCLTDG  358

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +L+ A+N+R
Sbjct  359   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKNLVAAVNNR  418

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  419   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPDEGGYL  478

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+L+E KW+D VA MPLKICYPA+E
Sbjct  479   IGNLQPAHMDFRFFTLGNLWSIVSSLGTQQQNEGILNLMETKWDDFVAQMPLKICYPAME  538

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM + E+AE A+ +AE+R++ D 
Sbjct  539   YEEWRIITGADPKNTPWSYHNGGSWPTLLWQFTLACIKMGKTELAEKAVALAEKRLSIDH  598

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RL QTW+IAGYL +K+L+ NPE A +L   ED ELL      L
Sbjct  599   WPEYYDTKNGRFIGKQSRLHQTWTIAGYLTSKMLLENPEKASLLFWEEDYELLETCVCAL  658

Query  1890  SANPRRKRSRKGAVK  1934
             +   R+K SR+  ++
Sbjct  659   NKTSRKKCSRRSQIQ  673


 Score =   213 bits (542),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 129/174 (74%), Gaps = 9/174 (5%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNS--------IEEEAWDLLRASMVYY  453
            E GN  + ++E+ R V     N   +      L +S        IE+EAW LLR S+V Y
Sbjct  148  ETGNGDVVKEEESR-VEVNGSNVNVNIGGTEGLNDSRAERELSEIEKEAWGLLRDSVVEY  206

Query  454  CGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEK  633
            CGNP+GT+AA DP D + LNYDQVFIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEK
Sbjct  207  CGNPVGTLAAIDPADKTPLNYDQVFIRDFVPSALAFLLNGEAEIVKNFLLHTLQLQSWEK  266

Query  634  TMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            T+DCYSPGQGLMPASFKV+T PL+  +   E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  267  TVDCYSPGQGLMPASFKVKTAPLDGSDGKFEEVLDPDFGESAIGRVAPVDSGLW  320



>emb|CAP59646.1| putative neutral invertase [Vitis vinifera]
Length=674

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/377 (70%), Positives = 306/377 (81%), Gaps = 5/377 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  295   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLTDG  354

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +ASI+L+ A+N+R
Sbjct  355   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTQNDASINLVRAINNR  414

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  415   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPDQIPSWLMDWVPEEGGYL  474

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  ILD I+AKW+DLV +MPLKICYPALE
Sbjct  475   IGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQGILDTIQAKWDDLVGHMPLKICYPALE  534

Query  1530  GQEWRIITGGDPKNT-PWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGD  1706
              +EW IITG DPKNT PWSYHN GSWPTLLWQ  +A +KM RPE+A  A+  AE+R+A D
Sbjct  535   YEEWHIITGSDPKNTSPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAVADAEKRLAVD  594

Query  1707  KWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSI  1886
             +WPEYYDT+ G FIGKQ+RLFQTW+IAGYL +K+L+ NPE A +L   ED +LL      
Sbjct  595   RWPEYYDTRNGRFIGKQSRLFQTWTIAGYLTSKMLLENPEMAALLFWEEDYDLLEICVCG  654

Query  1887  LSANPRRKRSRKGAVKQ  1937
             LS   RRK SR  A  Q
Sbjct  655   LSKTGRRKCSRFAARSQ  671


 Score =   219 bits (559),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW LL+ S+V YCG+PIGT+AANDP D + LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  188  EKEAWKLLQDSVVMYCGSPIGTMAANDPGDKTPLNYDQVFIRDFVPSALAFLLKGEGEIV  247

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+ +  A E+VLDPDFGE+AIGR
Sbjct  248  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGNNEAHEEVLDPDFGESAIGR  307

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  308  VAPVDSGLW  316



>ref|XP_008370364.1| PREDICTED: alkaline/neutral invertase CINV2-like [Malus domestica]
Length=676

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  298   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  357

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA  + S +L+ A+N+R
Sbjct  358   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAVNDGSKNLVRAINNR  417

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGY 
Sbjct  418   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYF  477

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ A+L+LIEAKW+DLV +MPLKI YPALE
Sbjct  478   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDAVLNLIEAKWDDLVGHMPLKISYPALE  537

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A  +AE+R+  D+
Sbjct  538   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAAALAEKRLRSDR  597

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+IAG+L  K+L+ NPE A +L   ED ELL      L
Sbjct  598   WPEYYDTRTGKFIGKQARLYQTWTIAGFLTTKMLLENPEKAALLFWDEDYELLEICVCAL  657

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  658   SKSGRKKCSR-GAAKSQILV  676


 Score =   228 bits (580),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 134/172 (78%), Gaps = 12/172 (7%)
 Frame = +1

Query  310  ERIFEDEQ---GRSVHSIAPNGQTSATVNNALP-------NSIEEEAWDLLRASMVYYCG  459
            ERI +DE    G        +G+ S ++N A         + IE+EAW LLR S+V YCG
Sbjct  150  ERIDKDENIVGGEESRIEVGDGKKSESLNEATVVTSEREYSDIEKEAWRLLRDSVVTYCG  209

Query  460  NPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTM  639
            NP+GT+AANDP D  +LNYDQVFIRDF+PS +AFLLKGE +IVRNFLLHTLQLQSWEKT+
Sbjct  210  NPVGTVAANDPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEIVRNFLLHTLQLQSWEKTV  269

Query  640  DCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            DCYSPGQGLMPASFKVRTVPL  D N TE+VLDPDFGE+AIGRVAPVDSG++
Sbjct  270  DCYSPGQGLMPASFKVRTVPL--DGNKTEEVLDPDFGESAIGRVAPVDSGLW  319



>gb|AGX27472.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27473.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27474.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27475.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27476.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27477.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27478.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27479.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27480.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27481.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27482.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27483.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27484.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27485.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27486.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27487.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27488.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27489.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27490.1| plant neutral invertase, partial [Populus angustifolia]
 gb|AGX27491.1| plant neutral invertase, partial [Populus angustifolia]
Length=555

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++ L LCL+DG
Sbjct  177   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLGLNLCLSDG  236

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+N+R
Sbjct  237   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDETKNLVAAINNR  296

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRY TEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  297   LCALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  356

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T+ Q+  IL+LIEA+W+DL+ +MPLKICYPALE
Sbjct  357   IGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDDLMGHMPLKICYPALE  416

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +PE+A+ A+ +AE R++ D+
Sbjct  417   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQKAVALAETRLSMDE  476

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+I+G+L +K+L+ NP+ A +L   ED ELL      L
Sbjct  477   WPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLFLEEDYELLEICVCAL  536

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  537   SKTGRKKCSRFAARSQ  552


 Score =   220 bits (561),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  382  VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAF  561
            +N +  + IE+EAW LLR ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AF
Sbjct  61   INGSEVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQPLNYDQVFIRDFVPSALAF  120

Query  562  LLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDP  741
            LL GE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKV+TVPL+  +   E+VLDP
Sbjct  121  LLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTVPLDGSDGGFEEVLDP  180

Query  742  DFGEAAIGRVAPVDSGMF  795
            DFGE+AIGRVAPVDSG++
Sbjct  181  DFGESAIGRVAPVDSGLW  198



>gb|ABF50704.1| neutral invertase [Populus sp. UG-2006]
Length=296

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/291 (86%), Positives = 274/291 (94%), Gaps = 0/291 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLSL ERIDVQTG+KMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  6     SGLWWIILLRAYGKCSGDLSLQERIDVQTGIKMILRLCLADGFDMFPTLLVTDGSCMIDR  65

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+RL+ALSFHIREYYWID++K
Sbjct  66    RMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDLRK  125

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+WMP++GGYLIGNLQPAHMDFRFFSLGN
Sbjct  126   LNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWMPNQGGYLIGNLQPAHMDFRFFSLGN  185

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             +WSIVS LAT DQS+AILD IEAKW DL+A+MPLKICYPALEGQEW+IITG DP+NTPWS
Sbjct  186   IWSIVSGLATRDQSNAILDFIEAKWSDLIADMPLKICYPALEGQEWQIITGSDPENTPWS  245

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKR  1736
             YHNAGSWPTLLWQL  A +KM RPEIA  A+++AE+RIA DKWPEYYDT+R
Sbjct  246   YHNAGSWPTLLWQLTAACIKMNRPEIAARAVEIAEKRIARDKWPEYYDTRR  296



>ref|NP_001267976.1| neutral invertase [Vitis vinifera]
 gb|ABS52644.1| neutral invertase [Vitis vinifera]
Length=673

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 305/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILL AYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  294   VLDPDFGESAIGRVAPVDSGLWWIILLGAYGKITGDYALQERVDVQTGIRLILNLCLTDG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +L+ A+N+R
Sbjct  354   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGTKNLVRAINNR  413

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  414   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLVDWIPDQGGYL  473

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  474   IGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPALE  533

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWP LLWQ  +A +KM RPE+A  A+ +AE R++ D 
Sbjct  534   NEEWRIITGSDPKNTPWSYHNGGSWPALLWQFTLACIKMGRPELARKAVALAEERLSVDH  593

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED ELL      L
Sbjct  594   WPEYYDTRSGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICVCAL  653

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  654   SKTGRKKCSRSAARSQ  669


 Score =   221 bits (564),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            G     V   +P  IE+EAW LLR+++V YCGNP+GT+AANDP D   LNYDQVFIRDF+
Sbjct  173  GLNKEKVEREVP-EIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYDQVFIRDFV  231

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENAT  723
            PS +AFLLKGE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A 
Sbjct  232  PSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGGNGAF  291

Query  724  EDVLDPDFGEAAIGRVAPVDSGMF  795
            E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  292  EEVLDPDFGESAIGRVAPVDSGLW  315



>ref|XP_002519277.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF43141.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=686

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/378 (69%), Positives = 308/378 (81%), Gaps = 4/378 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ERIDVQTG+++IL LCL+DG
Sbjct  308   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERIDVQTGIRLILNLCLSDG  367

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+NSR
Sbjct  368   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDGTKNLVAAINSR  427

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+ K+NEIYRYKTEEYS  A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  428   LSALSFHIREYYWVDMMKINEIYRYKTEEYSSNAVNKFNIYPDQIPSWLVDWIPEEGGYL  487

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T  Q+  IL+LIEAKW+DLVA+MPLKI YPAL+
Sbjct  488   IGNLQPAHMDFRFFTLGNLWAIVSSLGTQKQNEGILNLIEAKWDDLVAHMPLKISYPALD  547

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +P +AE AI +AE+R++ D+
Sbjct  548   SEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPGLAEKAIALAEKRLSVDQ  607

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW++AGYL +K+L+ NPE A +L   ED +LL      L
Sbjct  608   WPEYYDTRSGRFIGKQSRLCQTWTVAGYLTSKMLLENPEKASLLFWDEDYDLLETCVCAL  667

Query  1890  SANPRRKRSRKGAVKQSY  1943
             S   R+K SR  A  Q++
Sbjct  668   SKTSRKKCSRFAARSQNH  685


 Score =   216 bits (549),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL  ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE DI
Sbjct  200  IEKEAWKLLEGAIVNYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEADI  259

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLL+TLQLQSWEKT+DCYSPGQGLMPASFKVR VPL+  + A E+VLDPDFGE+AIG
Sbjct  260  VKNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRGVPLDGSDGAFEEVLDPDFGESAIG  319

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  320  RVAPVDSGLW  329



>ref|XP_009412138.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412139.1| PREDICTED: alkaline/neutral invertase CINV1-like [Musa acuminata 
subsp. malaccensis]
Length=644

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 302/376 (80%), Gaps = 4/376 (1%)
 Frame = +3

Query  831   PNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDM  998
             P+F  S I       SGLWWIILLRAYGK SGD +L ERIDVQTG+K+IL LCL+DGFDM
Sbjct  269   PDFGESAIGRVAPVDSGLWWIILLRAYGKISGDYALQERIDVQTGIKLILNLCLSDGFDM  328

Query  999   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLA  1178
             FPTLLVTDGSCMIDRRMGIHGHPLEIQALFY AL C+REM+   + S +++ A+N+RL A
Sbjct  329   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYCALRCSREMIVASDGSKNVLRAINNRLSA  388

Query  1179  LSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGN  1358
             LSFHIREYYW D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WLVDW+P KGGY IGN
Sbjct  389   LSFHIREYYWADMKKVNEIYRYKTEEYSQDAINKFNIYPEQIPGWLVDWIPEKGGYFIGN  448

Query  1359  LQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQE  1538
             LQPAHMDFRFFSLGNLW+I+SSLAT  Q+  ILDLIE KW++LV NMPLKICYPALE +E
Sbjct  449   LQPAHMDFRFFSLGNLWAIISSLATPKQAEGILDLIEDKWDELVGNMPLKICYPALENEE  508

Query  1539  WRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPE  1718
             WRI TG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE A  AI +AE  ++ D+WPE
Sbjct  509   WRITTGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPESARKAIAIAENHLSNDRWPE  568

Query  1719  YYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSAN  1898
             YYDT  G FIGKQ+RL+QTW+IAG+L +KLL+ NPE A +L   ED ELL   +  L+ +
Sbjct  569   YYDTPTGRFIGKQSRLYQTWTIAGFLASKLLLENPELASILTFEEDLELLEGCACSLAKS  628

Query  1899  PRRKRSRKGAVKQSYI  1946
             PR K SR  A    ++
Sbjct  629   PRIKCSRHAAKSHIFV  644


 Score =   193 bits (491),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = +1

Query  373  SATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSG  552
            S      L +  E+EAW LL+ ++V YCG+P+GT+AA DP     LNYDQVFIRDF+PS 
Sbjct  149  SEVAKGRLQSESEKEAWRLLKNAVVTYCGSPVGTLAAIDPAVEP-LNYDQVFIRDFVPSA  207

Query  553  IAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDV  732
            ++FLLKGE +IVRNFLLHTL LQSWEKT+DCYSPGQGLMPASFKVR+VP +      E+ 
Sbjct  208  LSFLLKGEMEIVRNFLLHTLHLQSWEKTVDCYSPGQGLMPASFKVRSVP-QGSNGEVEEF  266

Query  733  LDPDFGEAAIGRVAPVDSGMF  795
            LDPDFGE+AIGRVAPVDSG++
Sbjct  267  LDPDFGESAIGRVAPVDSGLW  287



>gb|ABF50705.1| neutral invertase 2 [Populus sp. UG-2006]
Length=296

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 272/291 (93%), Gaps = 0/291 (0%)
 Frame = +3

Query  864   SGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDMFPTLLVTDGSCMIDR  1043
             SGLWWIILLRAYGKCSGDLS+ ER+DVQTGMKMIL+LCLADGFDMFPTLLVTDGSCMIDR
Sbjct  6     SGLWWIILLRAYGKCSGDLSVQERVDVQTGMKMILRLCLADGFDMFPTLLVTDGSCMIDR  65

Query  1044  RMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLALSFHIREYYWIDVKK  1223
             RMGIHGHPLEI+ALFYSALLCAREMLAPE+ S DLI ALN+RL+ALSFHIREYYWID+KK
Sbjct  66    RMGIHGHPLEIEALFYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDLKK  125

Query  1224  LNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGNLQPAHMDFRFFSLGN  1403
             LNEIYRY TEEYSY+A+NKFNIYPDQIPPWLV++MP+KGGYLIGNLQPAHMDFRFF+LGN
Sbjct  126   LNEIYRYTTEEYSYDAVNKFNIYPDQIPPWLVEFMPNKGGYLIGNLQPAHMDFRFFTLGN  185

Query  1404  LWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQEWRIITGGDPKNTPWS  1583
             LW  VSSLAT DQSHAILDLIEAKW +LVA MP+KICYPALEGQEWRIITG DPKNT WS
Sbjct  186   LWPTVSSLATLDQSHAILDLIEAKWAELVAEMPIKICYPALEGQEWRIITGSDPKNTAWS  245

Query  1584  YHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPEYYDTKR  1736
             YHN GSWPTLLWQL VA +KM RPEIAE A+++ ERRI+ DKWPEYYDT+R
Sbjct  246   YHNGGSWPTLLWQLTVACIKMNRPEIAERAVQLVERRISRDKWPEYYDTRR  296



>ref|XP_009587952.1| PREDICTED: alkaline/neutral invertase CINV2 [Nicotiana tomentosiformis]
Length=652

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 311/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+K+IL LCL+DG
Sbjct  274   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLILNLCLSDG  333

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML+ +E S +L+ A+N+R
Sbjct  334   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSLDEGSKNLVNAINNR  393

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  394   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWIPEEGGYL  453

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW+D+V +MPLKICYPALE
Sbjct  454   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDIVGSMPLKICYPALE  513

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A+ +AE+R+  D+
Sbjct  514   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRTDLAKKAVDLAEKRLRVDQ  573

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F GKQARL+QTW+IAG+L +K+L+ NPE A +L   ED +LL      L
Sbjct  574   WPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPEMASLLFWEEDYDLLEICVCAL  633

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
               + R+K SR GA K   +V
Sbjct  634   KKSGRKKCSR-GAAKSQILV  652


 Score =   219 bits (557),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 127/167 (76%), Gaps = 8/167 (5%)
 Frame = +1

Query  295  AERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGT  474
            A  G E +  DE      S+   G+    V     +   +EAW LL  ++V YCG+PIGT
Sbjct  137  AGAGGEHVKNDE------SLKEEGEGQVEVRGGEESEAVKEAWKLLENAVVTYCGSPIGT  190

Query  475  IAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSP  654
            +AANDPND   LNYDQVFIRDFIPS +AFLLKG+ DIV+NFLLHTLQLQSWEKT+DCYSP
Sbjct  191  LAANDPNDKLPLNYDQVFIRDFIPSALAFLLKGDKDIVKNFLLHTLQLQSWEKTVDCYSP  250

Query  655  GQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            GQGLMPASFKVRTVPL  D+N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  251  GQGLMPASFKVRTVPL--DDNKYEEVLDPDFGESAIGRVAPVDSGLW  295



>ref|XP_009373311.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=679

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  301   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  360

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  361   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLGVNDGSKNLVRAINNR  420

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  421   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYL  480

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW+DLV +MPLKI YPALE
Sbjct  481   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDAILNLIEAKWDDLVGHMPLKISYPALE  540

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A  +AE+R+  D+
Sbjct  541   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAAALAEKRLRSDR  600

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L  K+L+ NPE A +L   ED ELL      L
Sbjct  601   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKMLLENPEKAALLFWDEDYELLEICVCAL  660

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  661   SKSGRKKCSR-GAAKSQILV  679


 Score =   222 bits (566),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S+V YCGNP+GT+AAN+P D  +LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  195  IEKEAWRLLRDSVVMYCGNPVGTVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEI  254

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  255  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNKIEEVLDPDFGESAIG  312

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  313  RVAPVDSGLW  322



>ref|XP_010551013.1| PREDICTED: alkaline/neutral invertase CINV2 [Tarenaya hassleriana]
Length=625

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 306/381 (80%), Gaps = 6/381 (2%)
 Frame = +3

Query  813   CIIVICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCL  980
             C  V+ P+F  S I       SGLWWIILLRAYGK +GD +L ERIDVQTG+KMI+ LCL
Sbjct  242   CEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERIDVQTGIKMIMNLCL  301

Query  981   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITAL  1160
             ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   E+S +LI  +
Sbjct  302   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITANESSKNLIRTI  361

Query  1161  NSRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSK-  1337
             N+RL ALSFHIRE YW+D+KK+NEIYRYKTEEYS +A NKFNIYP+Q+ PWL+DW+P K 
Sbjct  362   NNRLSALSFHIRENYWLDIKKINEIYRYKTEEYSMDATNKFNIYPEQVSPWLMDWIPEKP  421

Query  1338  -GGYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKIC  1514
               G+LIGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+ AIL+LIE KW D++ +MPLKIC
Sbjct  422   GSGFLIGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNEAILNLIEEKWNDIIGHMPLKIC  481

Query  1515  YPALEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERR  1694
             YPALE  EW +ITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R
Sbjct  482   YPALEFAEWSVITGSDPKNTPWSYHNSGSWPTLLWQFTLACIKMGRPELAERAVTLAEKR  541

Query  1695  IAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSA  1874
             +  D+WPEYYDT+ G FIGKQ+RL+QTW+IAGYL +K+L+ NPE A +L   ED ELL  
Sbjct  542   LQADRWPEYYDTRSGKFIGKQSRLYQTWTIAGYLTSKMLLENPETASLLFWEEDLELLET  601

Query  1875  FSSILSANPRRKRSRKGAVKQ  1937
                 L+ + R+K SR  A  Q
Sbjct  602   CVCALTKSGRKKCSRVAAKSQ  622


 Score =   211 bits (538),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            EEEAW LL+ ++V YC  P+GT+AA DP+D++ LNYDQVFIRDF+PS +AFLLKGE +IV
Sbjct  140  EEEAWRLLKEAVVTYCDCPVGTVAAKDPSDATPLNYDQVFIRDFVPSALAFLLKGEPEIV  199

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+V LEND+   E+VLDPDFGE+AIGR
Sbjct  200  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVLLENDK--CEEVLDPDFGESAIGR  257

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  258  VAPVDSGLW  266



>ref|XP_009335501.1| PREDICTED: alkaline/neutral invertase CINV2-like [Pyrus x bretschneideri]
Length=679

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  301   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  360

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  361   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLGVNDGSKNLVRAINNR  420

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGYL
Sbjct  421   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYL  480

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ A+L+LIEAKW+DLV +MPLKI YPALE
Sbjct  481   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDAVLNLIEAKWDDLVGHMPLKISYPALE  540

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A  +AE+R+  D+
Sbjct  541   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAAALAEKRLRSDR  600

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L  K+L+ NPE A +L   ED ELL      L
Sbjct  601   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKMLLENPEKAALLFWDEDYELLEICVCAL  660

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  661   SKSGRKKCSR-GAAKSQILV  679


 Score =   223 bits (567),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S+V YCGNP+GT+AAN+P D  +LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  195  IEKEAWRLLRDSVVMYCGNPVGTVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEI  254

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  255  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNKIEEVLDPDFGESAIG  312

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  313  RVAPVDSGLW  322



>gb|EYU38407.1| hypothetical protein MIMGU_mgv1a002478mg [Erythranthe guttata]
Length=668

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 309/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  290   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQERVDVQTGIKLILNLCLSDG  349

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYS+L CAREML PEE S +L+ A+N+R
Sbjct  350   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSSLRCAREMLTPEEGSKNLVRAVNNR  409

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+ W+P +GGY+
Sbjct  410   LSALSFHIREYYWVDLKKINEIYRYKTEEYSTEATNKFNIYPEQIPDWLMHWIPEEGGYM  469

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL++IEAKW+DL+  MPLKICYPAL+
Sbjct  470   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNMIEAKWDDLIGQMPLKICYPALK  529

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ AI +AE+R++ D 
Sbjct  530   KEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMGRQDLAKKAIDLAEKRLSADH  589

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQARL+QTWSIAG+L +K+L+  PE A +L   ED +LL      L
Sbjct  590   WPEYYDTKNGKFIGKQARLYQTWSIAGFLTSKMLLEKPELASVLYWEEDYDLLENCICAL  649

Query  1890  SANPRRKRSRKGAVKQ  1937
             S++ R+K SR  A  Q
Sbjct  650   SSSTRKKCSRMLAKSQ  665


 Score =   217 bits (553),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 136/182 (75%), Gaps = 4/182 (2%)
 Frame = +1

Query  256  LEKPKLLRCYCRPAERGNERI-FEDEQGRSVHSIAPNGQT-SATVNNALPNSIEEEAWDL  429
            +EK  L     +  E G + I FE+     + +   NG+  S  V     + +E+EAW L
Sbjct  132  VEKIDLDENIVKNEEEGKKGIEFEEIGNCELKNEGLNGEIESVEVIGREESEVEKEAWRL  191

Query  430  LRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHT  609
            LR ++V YCG+P+GT+AANDPND   LNYDQVFIRDFIPS  AFLLKGE +IVRNFLLHT
Sbjct  192  LRNAVVSYCGSPVGTVAANDPNDKMPLNYDQVFIRDFIPSAFAFLLKGEGEIVRNFLLHT  251

Query  610  LQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSG  789
            LQLQSWEKT+DCYSPGQGLMPASFKVRTV L  D+N  E+VLDPDFGE+AIGRVAPVDSG
Sbjct  252  LQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DDNKFEEVLDPDFGESAIGRVAPVDSG  309

Query  790  MF  795
            ++
Sbjct  310  LW  311



>ref|XP_008794511.1| PREDICTED: alkaline/neutral invertase CINV2-like [Phoenix dactylifera]
Length=631

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 306/382 (80%), Gaps = 6/382 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+K+IL LCL+DG
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLILNLCLSDG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + + +L+ A+N+R
Sbjct  310   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGTKNLLRAINNR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WLV W+P KGGY 
Sbjct  370   LSALSFHIREYYWVDMKKINEIYRYKTEEYSQDATNKFNIYPEQIPSWLVHWIPEKGGYF  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSL+T   +  IL+LIE KW+DLV NMPLKICYPALE
Sbjct  430   IGNLQPAHMDFRFFSLGNLWAIVSSLSTPRHAEGILNLIEDKWDDLVGNMPLKICYPALE  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE+R++ DK
Sbjct  490   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAIAVAEKRLSNDK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL+QTW+++GYL +K+ + NPE A +L   ED ELL   +  L
Sbjct  550   WPEYYDTQTGRFIGKQARLYQTWTVSGYLASKMFLENPEMASILTCEEDLELLEGCACSL  609

Query  1890  --SANPRRKRSRKGAVKQSYIV  1949
               SA   RK+  + A K   +V
Sbjct  610   TKSAKSARKKCSRSAAKSQVLV  631


 Score =   208 bits (529),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            +  E+EAW LL+ ++V YCGNP+GT+AA+DP  +  LNYDQVFIRDF+PS +AFLLKGE 
Sbjct  141  SEFEKEAWRLLKRAVVNYCGNPVGTVAADDPG-AGPLNYDQVFIRDFVPSALAFLLKGES  199

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRT+P++    A E+VLDPDFGE+A
Sbjct  200  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTLPMDGSNEAYEEVLDPDFGESA  259

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  260  IGRVAPVDSGLW  271



>gb|EMT27716.1| hypothetical protein F775_26108 [Aegilops tauschii]
Length=506

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 302/379 (80%), Gaps = 7/379 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAY K +GD SL ER+DVQTG+K+IL LCL+DG
Sbjct  130   ILDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLSDG  189

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   E S  L+ A+N+R
Sbjct  190   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMIVMNEGSKHLLRAINNR  249

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+ K+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  250   LSALSFHIREYYWVDMNKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  309

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMP+KICYPA+E
Sbjct  310   IGNLQPAHMDFRFFSLGNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPVKICYPAME  369

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE +++ DK
Sbjct  370   YDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLSADK  429

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  430   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  489

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S   +R R  + A K   I
Sbjct  490   S---KRTRCSRRAAKSDII  505


 Score =   209 bits (531),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +1

Query  352  IAPNGQTSATVNNALPNSIEEE-AWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVF  528
            I+  GQ   + N A   +  E  AW LLR ++V YCG P+GT+AA DP  + +LNYDQVF
Sbjct  3    ISGKGQNGVSGNVAEEETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVF  62

Query  529  IRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLEN  708
            IRDF+PS +AFL++GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ 
Sbjct  63   IRDFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDE  122

Query  709  DENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            +  A E++LDPDFGE+AIGRVAPVDSG++
Sbjct  123  NNEAFEEILDPDFGESAIGRVAPVDSGLW  151



>gb|KHN28199.1| hypothetical protein glysoja_024017 [Glycine soja]
Length=637

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLR YGK +GD +L ER+DVQTG+++ILKLCL DG
Sbjct  259   VLDPDFGESAIGRVAPVDSGLWWIILLRVYGKLTGDYALQERVDVQTGIRLILKLCLTDG  318

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +A+  L+ A+++R
Sbjct  319   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATKSLVAAVSNR  378

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L AL FH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYP+QIP WLVDW+  +GGY 
Sbjct  379   LSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWLVDWISEEGGYF  438

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSL TT Q+  IL+LIEAKW+D+VA MPLKICYPALE
Sbjct  439   IGNLQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDIVAQMPLKICYPALE  498

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRI TG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A+ A+  AE+R++ D+
Sbjct  499   GEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQKAVDSAEKRLSADR  558

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAG++ +K+L+ NPE A +L   ED ELL      L
Sbjct  559   WPEYYDTRNGRFIGKQSRLMQTWTIAGFVTSKMLLENPEKASLLFWEEDFELLQNCVCKL  618

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  619   SKSGRRKCSRFAARSQ  634


 Score =   214 bits (545),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E+EAW  L+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE +IV
Sbjct  152  EKEAWKFLQDAVVTYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEGEIV  211

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            +NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+AIGR
Sbjct  212  KNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIGR  271

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  272  VAPVDSGLW  280



>emb|CAA76145.1| neutral invertase [Daucus carota]
Length=675

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAY K +GD  L  R+DVQTG+++IL LCL DG
Sbjct  298   ILDPDFGESAIGRVAPVDSGLWWIILLRAYTKLTGDYGLQARVDVQTGIRLILNLCLTDG  357

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +++ +L+ A+N+R
Sbjct  358   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDSTKNLVAAVNNR  417

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDWMP  GGYL
Sbjct  418   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWMPETGGYL  477

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ +IL+LIE KW+DLVA+MPLKICYPALE
Sbjct  478   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEDKWDDLVAHMPLKICYPALE  537

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWR+ITG DPKNTPWSYHN GSWPTLLWQ  +A +KMK+PE+A  A+ +AE++++ D 
Sbjct  538   YEEWRVITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMKKPELARKAVALAEKKLSEDH  597

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+RG FIGKQ+RL+QTW+IAG+L +KLL+ NPE A  L   ED ELL +    +
Sbjct  598   WPEYYDTRRGRFIGKQSRLYQTWTIAGFLTSKLLLENPEMASKLFWEEDYELLESCVCAI  657

Query  1890  SANPRRKRSRKGAVKQ  1937
               + R+K SR  A  Q
Sbjct  658   GKSGRKKCSRFAAKSQ  673


 Score =   210 bits (534),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW+LLR ++V YCGNP+GT+AA+DP DS+ LNYDQVFIRDF+PS +AFLL GE 
Sbjct  188  SEVEKEAWELLRGAVVDYCGNPVGTVAASDPADSTPLNYDQVFIRDFVPSALAFLLNGEG  247

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKV+ V ++     +ED+LDPDFGE+A
Sbjct  248  EIVKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVKNVAIDGKIGESEDILDPDFGESA  307

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  308  IGRVAPVDSGLW  319



>ref|XP_010092957.1| hypothetical protein L484_018894 [Morus notabilis]
 gb|EXB53010.1| hypothetical protein L484_018894 [Morus notabilis]
Length=622

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 304/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+KMIL LCL DG
Sbjct  244   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGLKMILNLCLTDG  303

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML+  + S +L+ A+N+R
Sbjct  304   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSVNDGSKNLVRAINNR  363

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  364   LSALSFHIREYYWVDMKKINEIYRYKTEEYSLDATNKFNIYPEQIPSWLMDWIPEEGGYL  423

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW+DLV +MPLKICYPALE
Sbjct  424   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPRQNEAILNLIEAKWDDLVGHMPLKICYPALE  483

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EW IITG DPKNTPWSYHN GSWPTLLWQ  +A +KM + E+A  A+ +AE+R+A D 
Sbjct  484   SEEWHIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELARKAVALAEKRLAKDH  543

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAGYL +K+ + NPE A +L   ED ELL      L
Sbjct  544   WPEYYDTRTGKFIGKQSRHYQTWTIAGYLTSKMFLENPEMASLLFWDEDYELLEICVCAL  603

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  604   SKTGRKKCSRGAARSQ  619


 Score =   218 bits (554),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + IE+EAW LL+ ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE 
Sbjct  136  SEIEKEAWRLLQNAVVTYCGSPVGTVAANDPGDKLPLNYDQVFIRDFVPSALAFLLKGEG  195

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  DEN  E+VLDPDFGE+A
Sbjct  196  EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DENKLEEVLDPDFGESA  253

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  254  IGRVAPVDSGLW  265



>ref|NP_001281053.1| alkaline/neutral invertase CINV2 [Malus domestica]
 gb|AFU56879.1| neutral invertase [Malus domestica]
Length=682

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 304/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER++ QTG+++IL LCL +G
Sbjct  304   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVEFQTGIRLILNLCLKNG  363

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+ A+N+R
Sbjct  364   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKDLVAAVNNR  423

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  424   LSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPEEGGYL  483

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIEAKW+D VA MPLKICYPALE
Sbjct  484   IGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIEAKWDDFVAQMPLKICYPALE  543

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R++ D 
Sbjct  544   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAQKAVALAEKRLSMDN  603

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G FIGKQ+RL QTW+IAGYL +K+L+ NP+ A +L   ED ELL      L
Sbjct  604   WPEYYDTKSGRFIGKQSRLHQTWTIAGYLTSKMLLENPDKASLLFWEEDYELLETCVCAL  663

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   R+K SR  A  Q
Sbjct  664   NKTSRKKCSRFAAKSQ  679


 Score =   210 bits (534),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S V YCG P+GT+AA DP D + LNYDQVF RDF+PS +AFLL G+ +I
Sbjct  196  IEKEAWRLLRDSAVSYCGTPVGTLAATDPADKTPLNYDQVFTRDFVPSALAFLLNGDAEI  255

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKVRTVPL+ +  A E+VLDPDFGE+AIG
Sbjct  256  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVRTVPLDGNPGAFEEVLDPDFGESAIG  315

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  316  RVAPVDSGLW  325



>ref|XP_009777348.1| PREDICTED: alkaline/neutral invertase CINV2 [Nicotiana sylvestris]
Length=665

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 311/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+K+IL LCL+DG
Sbjct  287   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLILNLCLSDG  346

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML+ +E S +L+ A+N+R
Sbjct  347   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLSLDEGSKNLVNAINNR  406

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  407   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWIPEEGGYL  466

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIEAKW+D+V +MPLKICYPALE
Sbjct  467   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIEAKWDDIVGSMPLKICYPALE  526

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A+ +AE+R+  D+
Sbjct  527   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRTDLAKKAVDLAEKRLRVDQ  586

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F GKQARL+QTW+IAG+L +K+L+ NPE A +L   ED +LL      L
Sbjct  587   WPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPEMASLLFWEEDYDLLEICVCAL  646

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
               + R+K SR GA K   +V
Sbjct  647   KKSGRKKCSR-GAAKSQILV  665


 Score =   219 bits (557),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 126/162 (78%), Gaps = 8/162 (5%)
 Frame = +1

Query  310  ERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAAND  489
            ER+  DE      S+   G+    V     +   +EAW LL  ++V YCG+PIGT+AAND
Sbjct  155  ERVKNDE------SVKEEGEGQVEVRGGEESEAVKEAWKLLENAVVTYCGSPIGTLAAND  208

Query  490  PNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLM  669
            PND   LNYDQVFIRDFIPS +AFLLKG+ DIV+NFLLHTLQLQSWEKT+DCYSPGQGLM
Sbjct  209  PNDKLPLNYDQVFIRDFIPSALAFLLKGDKDIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  268

Query  670  PASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PASFKVRTVPL  D+N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  269  PASFKVRTVPL--DDNKYEEVLDPDFGESAIGRVAPVDSGLW  308



>ref|XP_008674013.1| PREDICTED: alkaline/neutral invertase CINV1-like [Zea mays]
 tpg|DAA54480.1| TPA: hypothetical protein ZEAMMB73_144921 [Zea mays]
Length=627

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 302/370 (82%), Gaps = 8/370 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD +LLER+DVQTG+++IL LCLADG
Sbjct  248   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQTGIQLILSLCLADG  307

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML     S +LI A+N+R
Sbjct  308   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVNNGSKNLIRAINNR  367

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  368   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  427

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKIC+PA+E
Sbjct  428   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICFPAME  487

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  488   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLSDDK  547

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F+GKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  548   WPEYYDTRSGRFVGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLQGCACCL  607

Query  1890  SANPRRKRSR  1919
             S    +KR+R
Sbjct  608   S----KKRTR  613


 Score =   209 bits (532),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = +1

Query  367  QTSATVNNALP----NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIR  534
            QT   V  A+P       E EAW LLR ++V YCG P+GT+AA DP  + +LNYDQVFIR
Sbjct  123  QTDEAVAPAVPLREETETEREAWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVFIR  182

Query  535  DFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDE  714
            DF+PS +AFL++GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ + 
Sbjct  183  DFVPSALAFLMRGETEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENN  242

Query  715  NATEDVLDPDFGEAAIGRVAPVDSGMF  795
               E+VLDPDFGEAAIGRVAPVDSG++
Sbjct  243  EGFEEVLDPDFGEAAIGRVAPVDSGLW  269



>ref|XP_002455584.1| hypothetical protein SORBIDRAFT_03g013420 [Sorghum bicolor]
 gb|EES00704.1| hypothetical protein SORBIDRAFT_03g013420 [Sorghum bicolor]
Length=627

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/373 (70%), Positives = 303/373 (81%), Gaps = 5/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD +LLER+DVQTG+++IL LCLADG
Sbjct  251   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNALLERVDVQTGIQLILSLCLADG  310

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML     S +LI A+N+R
Sbjct  311   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVMNNGSKNLIRAINNR  370

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  371   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  430

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LI+ KW+DLVANMPLKICYPA+E
Sbjct  431   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIDEKWDDLVANMPLKICYPAME  490

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  491   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEERLSDDK  550

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  551   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  610

Query  1890  SANPRRKRSRKGA  1928
             S   R + SR+ A
Sbjct  611   STK-RTRCSRRAA  622


 Score =   207 bits (527),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  418  AWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNF  597
            AW LLR ++V YCG P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE +IVRNF
Sbjct  147  AWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNF  206

Query  598  LLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAP  777
            LLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ +    E+VLDPDFGEAAIGRVAP
Sbjct  207  LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEGFEEVLDPDFGEAAIGRVAP  266

Query  778  VDSGMF  795
            VDSG++
Sbjct  267  VDSGLW  272



>gb|EMS59378.1| hypothetical protein TRIUR3_23445 [Triticum urartu]
Length=517

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 302/379 (80%), Gaps = 7/379 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAY K +GD SL ER+DVQTG+K+IL LCL+DG
Sbjct  141   ILDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLSDG  200

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   E S  L+ A+N+R
Sbjct  201   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMIVMNEGSKHLLRAINNR  260

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+ K+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  261   LSALSFHIREYYWVDMNKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  320

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMP+KICYPA+E
Sbjct  321   IGNLQPAHMDFRFFSLGNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPVKICYPAME  380

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE +++ DK
Sbjct  381   YDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLSADK  440

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  441   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  500

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S   +R R  + A K   I
Sbjct  501   S---KRTRCSRRAAKSDII  516


 Score =   208 bits (530),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  418  AWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNF  597
            AW LLR ++V YCG P+GT+AA DP  + +LNYDQVFIRDF+PS +AFL++GE +IVRNF
Sbjct  37   AWRLLRRAVVSYCGEPVGTVAAEDPECTEMLNYDQVFIRDFVPSALAFLMRGETEIVRNF  96

Query  598  LLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAP  777
            LLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ +  A E++LDPDFGE+AIGRVAP
Sbjct  97   LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEAFEEILDPDFGESAIGRVAP  156

Query  778  VDSGMF  795
            VDSG++
Sbjct  157  VDSGLW  162



>gb|KDP23366.1| hypothetical protein JCGZ_23199 [Jatropha curcas]
Length=678

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 309/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER+DVQTG+K+IL LCL DG
Sbjct  300   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYSLQERVDVQTGIKLILNLCLTDG  359

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  360   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSRNLVRAINNR  419

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  420   LSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPSWLMDWIPEEGGYL  479

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWS++SSL T  Q+ AIL+LIEAKW+DLV  MP+KICYPALE
Sbjct  480   IGNLQPAHMDFRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDLVGRMPMKICYPALE  539

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE R++ D+
Sbjct  540   HEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRFELAQKAVALAEERLSVDR  599

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAG+L +K+L+ NPE A +L+  ED ELL      L
Sbjct  600   WPEYYDTRTGKFIGKQSRLHQTWTIAGFLTSKVLLENPEKASLLLWEEDYELLEICVCAL  659

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  660   SKTGRKKCSR-GAAKSQILV  678


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 127/160 (79%), Gaps = 13/160 (8%)
 Frame = +1

Query  316  IFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPN  495
            + ED +G  V  ++P  + S          IE+EAW LL  ++V YCG+P+GT+AANDP 
Sbjct  175  VLEDVKG--VEIVSPRREES---------DIEKEAWKLLNDAVVTYCGSPVGTVAANDPG  223

Query  496  DSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPA  675
            D   LNYDQVFIRDF+PS +AFLL+GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPA
Sbjct  224  DKQPLNYDQVFIRDFVPSALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPA  283

Query  676  SFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SFKVRTVPL  D+N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  284  SFKVRTVPL--DDNKFEEVLDPDFGESAIGRVAPVDSGLW  321



>ref|XP_011071359.1| PREDICTED: alkaline/neutral invertase CINV2 [Sesamum indicum]
Length=684

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/366 (71%), Positives = 304/366 (83%), Gaps = 4/366 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL+DG
Sbjct  305   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYTLQERVDVQTGIRLILNLCLSDG  364

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   +++ +L+ A+N+R
Sbjct  365   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLTVNDSTKNLVVAVNNR  424

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KK+NEIYRYKTEEYS EAINKFNIYPDQIP WLVDW+P  GGY 
Sbjct  425   LSALSFHLREYYWVDMKKINEIYRYKTEEYSTEAINKFNIYPDQIPGWLVDWIPETGGYF  484

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL+T+ QS  IL+LIE KW+DLVA MPLKICYPALE
Sbjct  485   IGNLQPAHMDFRFFTLGNLWAIVSSLSTSKQSEGILNLIEEKWDDLVAQMPLKICYPALE  544

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM+RPE+A  A+ +AE+R+  D+
Sbjct  545   HEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMERPELARKAVALAEKRLPVDQ  604

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQARL QTW+IAGYL +KLL+ NP+ A +L   ED ELL      L
Sbjct  605   WPEYYDTRYGRFIGKQARLHQTWTIAGYLTSKLLLDNPQLASILSWNEDYELLENCVCGL  664

Query  1890  SANPRR  1907
              +  R+
Sbjct  665   KSGIRK  670


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW+LLR ++V YCGNP+GT+AA DP D   LNYDQVFIRDF+PS +AFLL GE 
Sbjct  195  SEVEKEAWELLRGAVVNYCGNPVGTVAAADPADKQPLNYDQVFIRDFVPSALAFLLNGEA  254

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+      EDVLDPDFGE+A
Sbjct  255  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGRVGEFEDVLDPDFGESA  314

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  315  IGRVAPVDSGLW  326



>ref|XP_006488793.1| PREDICTED: alkaline/neutral invertase CINV2-like [Citrus sinensis]
Length=678

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  300   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  359

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML   + + +L+ A+N+R
Sbjct  360   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLIVNDGTKNLVAAINNR  419

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+ K+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P++GGYL
Sbjct  420   LSALSFHVREYYWVDMMKINEIYRYKTEEYSVDAINKFNIYPDQIPSWLVDWIPNEGGYL  479

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNL+P HMDFRFF+LGNLW+IVSSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  480   IGNLEPGHMDFRFFTLGNLWAIVSSLGTARQNEGILNLIEAKWDDLVAHMPLKICYPALE  539

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R++ D+
Sbjct  540   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVAMAEKRLSVDQ  599

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAGYL +K+L+ NP  A +L   ED ELL      L
Sbjct  600   WPEYYDTQSGRFIGKQSRLHQTWTIAGYLTSKMLLENPAKASLLFWEEDYELLENCVCAL  659

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K  R  A  Q
Sbjct  660   SKTGRKKCLRFAARSQ  675


 Score =   223 bits (568),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNAL-----PNSIEEEAWDLLRASMVYYCGN  462
            E GNE + EDE    V+    N      +N  +      ++IE+EAW LLR ++V YCGN
Sbjct  151  ENGNEVVKEDESRVQVNGSGVNLDILKDLNENVETESEASNIEKEAWKLLRDAVVNYCGN  210

Query  463  PIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMD  642
            P+GT+AAN+P D   LNYDQVFIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEKT+D
Sbjct  211  PVGTVAANNPADKQPLNYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVD  270

Query  643  CYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            CYSPGQGLMPASFKVRTVPL+  +   E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  271  CYSPGQGLMPASFKVRTVPLDGGDGTLEEVLDPDFGESAIGRVAPVDSGLW  321



>ref|XP_007208331.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica]
 gb|EMJ09530.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica]
Length=678

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 307/379 (81%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+KMIL LCL DG
Sbjct  300   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGLKMILNLCLTDG  359

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA  + S  L+ A+N+R
Sbjct  360   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLALNDGSNILVRAINNR  419

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+DW+P +GGY 
Sbjct  420   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPLWLMDWIPEEGGYF  479

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ ++L+LIEAKW+DLV +MPLKICYPALE
Sbjct  480   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDSVLNLIEAKWDDLVGHMPLKICYPALE  539

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN+GSWPTLLWQ  +A +KM R ++A+ A  +AE+R+  D+
Sbjct  540   FEEWRIITGSDPKNTPWSYHNSGSWPTLLWQFTLACLKMGRIDLAQKAADLAEKRLRSDR  599

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL  K+L+ NPE A +L   ED ELL      L
Sbjct  600   WPEYYDTRTGKFIGKQSRLYQTWTIAGYLTTKMLLENPEKAALLFWDEDYELLEICVCAL  659

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S + R+K SR  A  Q  I
Sbjct  660   SKSGRKKCSRGAAKSQILI  678


 Score =   218 bits (554),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE++AW LLR S+V YCG P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  194  IEKDAWKLLRDSVVTYCGTPVGTVAANDPGDKQTLNYDQVFIRDFVPSALAFLLKGEGEI  253

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  254  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNKYEEVLDPDFGESAIG  311

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  312  RVAPVDSGLW  321



>ref|XP_006419305.1| hypothetical protein CICLE_v10004474mg [Citrus clementina]
 gb|ESR32545.1| hypothetical protein CICLE_v10004474mg [Citrus clementina]
Length=678

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  300   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  359

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ+LFYSAL C+REML   + + +L+ A+N+R
Sbjct  360   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQSLFYSALRCSREMLIVNDGTKNLVAAINNR  419

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+ K+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P++GGYL
Sbjct  420   LSALSFHVREYYWVDMMKINEIYRYKTEEYSVDAINKFNIYPDQIPSWLVDWIPNEGGYL  479

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNL+P HMDFRFF+LGNLW+IVSSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPALE
Sbjct  480   IGNLEPGHMDFRFFTLGNLWAIVSSLGTARQNEGILNLIEAKWDDLVAHMPLKICYPALE  539

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+AE A+ +AE+R++ D+
Sbjct  540   YEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELAEKAVAMAEKRLSVDQ  599

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAGYL +K+L+ NP  A +L   ED ELL      L
Sbjct  600   WPEYYDTQSGRFIGKQSRLHQTWTIAGYLTSKMLLENPAKASLLFWEEDYELLENCVCAL  659

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K  R  A  Q
Sbjct  660   SKTGRKKCLRFAARSQ  675


 Score =   223 bits (567),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +1

Query  298  ERGNERIFEDEQGRSVHSIAPNGQTSATVNNAL-----PNSIEEEAWDLLRASMVYYCGN  462
            E GNE + EDE    V+    N      +N  +      ++IE+EAW LLR ++V YCGN
Sbjct  151  ENGNEVVKEDESRVQVNGSGVNLDILKDLNENVETESEASNIEKEAWKLLRDAVVNYCGN  210

Query  463  PIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMD  642
            P+GT+AAN+P D   LNYDQVFIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEKT+D
Sbjct  211  PVGTVAANNPADKQPLNYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVD  270

Query  643  CYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            CYSPGQGLMPASFKVRTVPL+  +   E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  271  CYSPGQGLMPASFKVRTVPLDGADGTLEEVLDPDFGESAIGRVAPVDSGLW  321



>ref|XP_009372083.1| PREDICTED: alkaline/neutral invertase CINV2 [Pyrus x bretschneideri]
Length=686

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/376 (69%), Positives = 304/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER++ QTG+++IL LCL + 
Sbjct  308   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVEFQTGIRLILHLCLKNR  367

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+TA+N+R
Sbjct  368   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKDLVTAVNNR  427

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  428   LSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPEEGGYL  487

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIE+KW+D VA MPLKICYPALE
Sbjct  488   IGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIESKWDDFVAQMPLKICYPALE  547

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI TGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+AE A+ +AE+R++ D 
Sbjct  548   YEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAEKAVALAEKRLSMDH  607

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G F+GKQ+RL QTW+IAGYL +K+L+ NPE A +L   ED ELL     +L
Sbjct  608   WPEYYDTKSGRFVGKQSRLHQTWTIAGYLSSKMLLENPEKASLLFWEEDYELLETCVCVL  667

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   R+K SR  A  Q
Sbjct  668   NKTSRKKCSRFAAKSQ  683


 Score =   213 bits (543),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW LLR S+V YCGNP+GT+AA DP D + LNYDQVF+RDF+PS +AFLL G+ +I
Sbjct  200  IEEEAWRLLRDSVVSYCGNPVGTLAATDPADKTPLNYDQVFVRDFVPSALAFLLNGDAEI  259

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKVRTVPL+      E+VLDPDFGE+AIG
Sbjct  260  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVRTVPLDGSPGEFEEVLDPDFGESAIG  319

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  320  RVAPVDSGLW  329



>ref|XP_002984705.1| hypothetical protein SELMODRAFT_181158 [Selaginella moellendorffii]
 gb|EFJ14350.1| hypothetical protein SELMODRAFT_181158 [Selaginella moellendorffii]
Length=625

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/389 (68%), Positives = 306/389 (79%), Gaps = 23/389 (6%)
 Frame = +3

Query  813   CIIVICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCL  980
             C  ++ P+F  + I       SGLWWIILLRAYGK +GDLSL ER+DVQTG++MILKLCL
Sbjct  236   CEEILDPDFGEAAIGRVAPVDSGLWWIILLRAYGKSTGDLSLQERMDVQTGIRMILKLCL  295

Query  981   ADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITAL  1160
             +DGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CA+EML P+E S  L+TA+
Sbjct  296   SDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALQCAKEMLIPDEKSHQLLTAV  355

Query  1161  NSRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKG  1340
             NSRL ALSFHIREYYW+D+ KLNEIYRYKTEEYS++A+NKFNIYP+QIP WL DWMP  G
Sbjct  356   NSRLSALSFHIREYYWLDIAKLNEIYRYKTEEYSHDAVNKFNIYPEQIPDWLADWMPDHG  415

Query  1341  GYLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYP  1520
             GY IGNLQPAHMDFRFFSLGNLW+IVSSLAT  QS  ILDLI+ +W+ LV +MPLKIC+P
Sbjct  416   GYFIGNLQPAHMDFRFFSLGNLWAIVSSLATPQQSSGILDLIQDRWKHLVGSMPLKICFP  475

Query  1521  ALEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQ-------------------LAVASVK  1643
             A E +EWRIITGGDPKNT WSYHN GSWPTL+WQ                   L    +K
Sbjct  476   AFENEEWRIITGGDPKNTAWSYHNGGSWPTLIWQARNHEKMIHGKKNSDAALLLFDTCIK  535

Query  1644  MKRPEIAENAIKVAERRIAGDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANP  1823
             M R E+A  A+++ ERRI+ D+WPEYYD++ G FIGKQ+RLFQTWSIAGYLVAK L+ANP
Sbjct  536   MGRSEVAYEALEIMERRISRDRWPEYYDSRTGKFIGKQSRLFQTWSIAGYLVAKQLLANP  595

Query  1824  EAAKMLITIEDTELLSAFSSILSANPRRK  1910
             EAA  L   ED  LL AFS  +S+   +K
Sbjct  596   EAATYLTCEEDPGLLDAFSCRISSKQPKK  624


 Score =   202 bits (514),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
             E+EAW LLRAS+V Y G P+GTIAANDP D+S LNYDQVFIRDF+PSGIAFLLKGE  I
Sbjct  133  FEQEAWRLLRASIVQYQGCPVGTIAANDPTDASALNYDQVFIRDFVPSGIAFLLKGEPAI  192

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLL TL+LQSWEKT+D YSPGQGLMPASFKV++V  E  E+  E++LDPDFGEAAIG
Sbjct  193  VRNFLLCTLRLQSWEKTVDFYSPGQGLMPASFKVQSVAAE--EDTCEEILDPDFGEAAIG  250

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  251  RVAPVDSGLW  260



>ref|XP_004968681.1| PREDICTED: alkaline/neutral invertase CINV2-like [Setaria italica]
Length=625

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 302/370 (82%), Gaps = 8/370 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAY K +GD  LLER+DVQTG+++IL LCL+DG
Sbjct  249   VLDPDFGEAAIGRVAPVDSGLWWIILLRAYCKITGDNDLLERVDVQTGIQLILSLCLSDG  308

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +LI A+N+R
Sbjct  309   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVNDGSKNLIRAVNNR  368

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  369   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  428

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKICYPA+E
Sbjct  429   IGNLQPAHMDFRFFSLGNLWAIASSLTTPKQAEGILSLIEEKWDDLVANMPLKICYPAME  488

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE R++ DK
Sbjct  489   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARKAIAVAEDRLSDDK  548

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  549   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  608

Query  1890  SANPRRKRSR  1919
             S    +KR+R
Sbjct  609   S----KKRAR  614


 Score =   207 bits (527),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  418  AWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNF  597
            AW LLR ++V YCG P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE +IVRNF
Sbjct  145  AWRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNF  204

Query  598  LLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAP  777
            LLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ +    E+VLDPDFGEAAIGRVAP
Sbjct  205  LLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEGFEEVLDPDFGEAAIGRVAP  264

Query  778  VDSGMF  795
            VDSG++
Sbjct  265  VDSGLW  270



>gb|ACX33985.1| neutral invertase [Ananas comosus]
Length=345

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/307 (83%), Positives = 278/307 (91%), Gaps = 5/307 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  + I       SGLWWIILLRAYGKCSGDLS+ ERIDVQTG+KMILKLCLADG
Sbjct  40    VLDPDFGEATIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQTGIKMILKLCLADG  99

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPE+ S DLI ALN+R
Sbjct  100   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEDGSADLIRALNNR  159

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L+ALSFHIREYYW+D++KLNEIYRYKTEEYSY+A+NKFNIYPDQ+ PWLV+WMP KGGYL
Sbjct  160   LIALSFHIREYYWVDMQKLNEIYRYKTEEYSYDAVNKFNIYPDQVSPWLVEWMPCKGGYL  219

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSLATT QSHAILDLIEAKW DLVA+MP KICYP LE
Sbjct  220   IGNLQPAHMDFRFFSLGNLWSIVSSLATTHQSHAILDLIEAKWSDLVADMPFKICYPTLE  279

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             GQEWRIITG DPKNTP +YHN GSWPTLLWQLAVA +KM RPEIA  A++VAE+RIA D+
Sbjct  280   GQEWRIITGSDPKNTP-TYHNGGSWPTLLWQLAVACIKMNRPEIAAKAVEVAEKRIATDR  338

Query  1710  WPEYYDT  1730
             WPEYYDT
Sbjct  339   WPEYYDT  345


 Score =   116 bits (291),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  613  QLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGM  792
            QLQSWEKTMDC+SPGQGLMPASFKVRTVPL+ D++ATE+VLDPDFGEA IGRVAPVDSG+
Sbjct  1    QLQSWEKTMDCHSPGQGLMPASFKVRTVPLDGDDSATEEVLDPDFGEATIGRVAPVDSGL  60

Query  793  F  795
            +
Sbjct  61   W  61



>ref|XP_003529503.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
Length=679

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLR YGK +GD +L ER+DVQTG+++ILKLCL DG
Sbjct  301   VLDPDFGESAIGRVAPVDSGLWWIILLRVYGKLTGDYALQERVDVQTGIRLILKLCLTDG  360

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +A+  L+ A+++R
Sbjct  361   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATKSLVAAVSNR  420

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L AL FH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYP+QIP WLVDW+  +GGY 
Sbjct  421   LSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWLVDWISEEGGYF  480

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSL TT Q+  IL+LIEAKW+D+VA MPLKICYPALE
Sbjct  481   IGNLQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDIVAQMPLKICYPALE  540

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRI TG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A+ A+  AE+R++ D+
Sbjct  541   GEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQKAVDSAEKRLSADR  600

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL QTW+IAG++ +K+L+ NPE A +L   ED ELL      L
Sbjct  601   WPEYYDTRNGRFIGKQSRLMQTWTIAGFVTSKMLLENPEKASLLFWEEDFELLQNCVCKL  660

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  661   SKSGRRKCSRFAARSQ  676


 Score =   217 bits (553),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE +I
Sbjct  193  IEKEAWKLLQDAVVTYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEGEI  252

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+AIG
Sbjct  253  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIG  312

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  313  RVAPVDSGLW  322



>ref|XP_002311370.2| hypothetical protein POPTR_0008s10090g [Populus trichocarpa]
 gb|EEE88737.2| hypothetical protein POPTR_0008s10090g [Populus trichocarpa]
Length=671

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++ L LCL+DG
Sbjct  293   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLGLNLCLSDG  352

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+N+R
Sbjct  353   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDETKNLVAAINNR  412

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRY TEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  413   LSALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  472

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T+ Q+  IL+LIEA+W+DL+ +MPLKICYPALE
Sbjct  473   IGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDDLMGHMPLKICYPALE  532

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +PE+A+ AI +AE R++ D+
Sbjct  533   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQKAIALAETRLSMDQ  592

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+I+G+L +K+L+ NP+ A +L   ED ELL      L
Sbjct  593   WPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLFLEEDYELLEICVCAL  652

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  653   SKTGRKKCSRFAARSQ  668


 Score =   220 bits (561),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  382  VNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAF  561
            +N +  + IE+EAW LLR ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AF
Sbjct  177  INGSEVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQPLNYDQVFIRDFVPSALAF  236

Query  562  LLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDP  741
            LL GE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKV+TVPL+  +   E+VLDP
Sbjct  237  LLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTVPLDGSDGGFEEVLDP  296

Query  742  DFGEAAIGRVAPVDSGMF  795
            DFGE+AIGRVAPVDSG++
Sbjct  297  DFGESAIGRVAPVDSGLW  314



>gb|EAY73839.1| hypothetical protein OsI_01715 [Oryza sativa Indica Group]
Length=621

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 308/380 (81%), Gaps = 7/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  244   VLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDG  303

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  304   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNR  363

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  364   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  423

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LI+ KW+DL+ANMPLKICYPA+E
Sbjct  424   IGNLQPAHMDFRFFSLGNLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAME  483

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE ++A DK
Sbjct  484   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADK  543

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  544   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCNEDLELLEGCACCL  603

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R + SR+ A  +S++V
Sbjct  604   SKK-RTRCSRRAA--KSHVV  620


 Score =   205 bits (521),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  421  WDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFL  600
            W LLR ++V YCG P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE +IVRNFL
Sbjct  141  WRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  200

Query  601  LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPV  780
            LHTLQLQSWEKT+DCYSPGQGLMPASFK+R VPL+++  A E+VLDPDFGE+AIGRVAPV
Sbjct  201  LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  260

Query  781  DSGMF  795
            DSG++
Sbjct  261  DSGLW  265



>ref|XP_002512536.1| beta-fructofuranosidase, putative [Ricinus communis]
 gb|EEF49988.1| beta-fructofuranosidase, putative [Ricinus communis]
Length=685

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 310/380 (82%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             ++ P+F  S I       SGLWWIILLRAYGK + D +L ER+DVQTG+K+IL LCLADG
Sbjct  307   ILDPDFGESAIGRVAPVDSGLWWIILLRAYGKITCDYTLQERVDVQTGIKLILNLCLADG  366

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  367   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAINNR  426

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  427   LSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPAWLMDWIPEEGGYL  486

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWS+VSSL T  Q+ AIL+LIEAKW+DLV  MPLKICYPALE
Sbjct  487   IGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAILNLIEAKWDDLVGCMPLKICYPALE  546

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A  A+ +AE+R++ D+
Sbjct  547   HEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAHRAVAMAEKRLSVDR  606

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L+  ED ELL      L
Sbjct  607   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPEMASLLLWEEDYELLEICVCAL  666

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  667   SKTGRKKCSR-GAAKSQILV  685


 Score =   218 bits (555),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            ++IE+EAW LL  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLL+GE 
Sbjct  199  SNIEKEAWKLLNDAVVRYCGSPVGTVAANDPGDKQPLNYDQVFIRDFVPSALAFLLRGEG  258

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  DEN +E++LDPDFGE+A
Sbjct  259  EIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DENKSEEILDPDFGESA  316

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  317  IGRVAPVDSGLW  328



>ref|NP_001042931.1| Os01g0332100 [Oryza sativa Japonica Group]
 dbj|BAD54740.1| putative neutral invertase [Oryza sativa Japonica Group]
 dbj|BAD53496.1| putative neutral invertase [Oryza sativa Japonica Group]
 dbj|BAF04845.1| Os01g0332100 [Oryza sativa Japonica Group]
 dbj|BAH00142.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 308/380 (81%), Gaps = 7/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  251   VLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDG  310

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  311   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNR  370

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  371   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  430

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LI+ KW+DL+ANMPLKICYPA+E
Sbjct  431   IGNLQPAHMDFRFFSLGNLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAME  490

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE ++A DK
Sbjct  491   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADK  550

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  551   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  610

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R + SR+ A  +S++V
Sbjct  611   SKK-RTRCSRRAA--KSHVV  627


 Score =   204 bits (520),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  421  WDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFL  600
            W LLR ++V YCG P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE +IVRNFL
Sbjct  148  WRLLRRAVVSYCGEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETEIVRNFL  207

Query  601  LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPV  780
            LHTLQLQSWEKT+DCYSPGQGLMPASFK+R VPL+++  A E+VLDPDFGE+AIGRVAPV
Sbjct  208  LHTLQLQSWEKTVDCYSPGQGLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  267

Query  781  DSGMF  795
            DSG++
Sbjct  268  DSGLW  272



>ref|XP_008246215.1| PREDICTED: alkaline/neutral invertase CINV2 [Prunus mume]
Length=678

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 306/379 (81%), Gaps = 4/379 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+KMIL LCL DG
Sbjct  300   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGLKMILNLCLTDG  359

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA  + S  L+ A+N+R
Sbjct  360   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLALNDGSKILVRAINNR  419

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+DW+P +GGY 
Sbjct  420   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPLWLMDWIPEEGGYF  479

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T  Q+ ++L+LIEAKW+DLV +MPLKICYPALE
Sbjct  480   IGNLQPAHMDFRFFTLGNLWAIVSSLGTPKQNDSVLNLIEAKWDDLVGHMPLKICYPALE  539

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A  +AE+R+  D+
Sbjct  540   FEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACLKMGRIDLAQKAADLAEKRLRSDR  599

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAGYL  K+L+ NPE A +L   ED ELL      L
Sbjct  600   WPEYYDTRTGKFIGKQSRLYQTWTIAGYLTTKMLLENPEKAALLFWDEDYELLEICVCAL  659

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S + R+K SR  A  Q  I
Sbjct  660   SKSGRKKCSRGAAKSQILI  678


 Score =   218 bits (554),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE++AW LLR S+V YCG P+GT+AANDP D   LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  194  IEKDAWKLLRDSVVTYCGTPVGTVAANDPGDKQTLNYDQVFIRDFVPSALAFLLKGEGEI  253

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  254  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNKYEEVLDPDFGESAIG  311

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  312  RVAPVDSGLW  321



>ref|XP_003550817.1| PREDICTED: alkaline/neutral invertase CINV2-like [Glycine max]
 gb|KHN03258.1| hypothetical protein glysoja_004284 [Glycine soja]
Length=680

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 306/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++ILKLCL DG
Sbjct  302   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIRLILKLCLTDG  361

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   +A+  L+ A+++R
Sbjct  362   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDATKSLVAAVSNR  421

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L AL FH+REYYW+D+KK+NEIYRYKTEEYS +A+NKFNIYP+QIP WLVDW+  +GGY 
Sbjct  422   LSALCFHMREYYWVDMKKINEIYRYKTEEYSTDAVNKFNIYPEQIPSWLVDWISEEGGYF  481

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+IVSSL TT Q+  IL+LIEAKW+D+V  MPLKICYPALE
Sbjct  482   IGNLQPAHMDFRFFSLGNLWAIVSSLGTTRQNQGILNLIEAKWDDIVGQMPLKICYPALE  541

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
             G+EWRI TG DPKNTPWSYHN GSWPTLLWQ  +A +KM RP++A+ A+  AE+R++ D+
Sbjct  542   GEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPDLAQKAVDSAEKRLSADR  601

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT  G FIGKQ+R+ QTW+IAG+L +K+L+ NPE A +L   ED ELL     +L
Sbjct  602   WPEYYDTPNGRFIGKQSRMVQTWTIAGFLTSKMLLENPERASLLFWEEDFELLQNCVCML  661

Query  1890  SANPRRKRSRKGAVKQ  1937
             S + RRK SR  A  Q
Sbjct  662   SKSGRRKCSRFAARSQ  677


 Score =   217 bits (553),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE +I
Sbjct  194  IEKEAWKLLQDAVVTYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEGEI  253

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A E+VLDPDFGE+AIG
Sbjct  254  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGSNEAFEEVLDPDFGESAIG  313

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  314  RVAPVDSGLW  323



>ref|XP_011019331.1| PREDICTED: alkaline/neutral invertase CINV2 [Populus euphratica]
Length=692

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++ L LCL+DG
Sbjct  314   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLGLNLCLSDG  373

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+N+R
Sbjct  374   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLIVNDETKNLVAAINNR  433

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRY TEEYS +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  434   LSALSFHIREYYWVDMRKINEIYRYNTEEYSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  493

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+IVSSL T+ Q+  IL+LIEA+W+DL+ +MPLKICYPALE
Sbjct  494   IGNLQPAHMDFRFFTLGNLWAIVSSLGTSKQNEGILNLIEARWDDLMGHMPLKICYPALE  553

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM +PE+A+ A+ +AE R++ D+
Sbjct  554   YEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKPELAQKAVALAETRLSMDQ  613

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+I+G+L +K+L+ NP+ A +L   ED ELL      L
Sbjct  614   WPEYYDTRSGRFIGKQSRLFQTWTISGFLTSKMLLENPDKASLLFLEEDYELLEICVCAL  673

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  A  Q
Sbjct  674   SKTGRKKCSRIAARSQ  689


 Score =   218 bits (556),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +1

Query  361  NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDF  540
            N  T+  V     + IE+EAW LLR ++V YCGNP+GT+AANDP D   LNYDQVFIRDF
Sbjct  191  NESTTPKVVEREVSKIEKEAWQLLRGTIVNYCGNPVGTVAANDPADRQPLNYDQVFIRDF  250

Query  541  IPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENA  720
            +PS +AFLL GE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKV+TVPL+  +  
Sbjct  251  VPSALAFLLNGEMEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTVPLDGSDGG  310

Query  721  TEDVLDPDFGEAAIGRVAPVDSGMF  795
             ++VLDPDFGE+AIGRVAPVDSG++
Sbjct  311  FDEVLDPDFGESAIGRVAPVDSGLW  335



>gb|AEP31948.1| neutral/alkaline invertase [Manihot esculenta]
Length=685

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/376 (68%), Positives = 308/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYG+ +GD +L ERIDVQTG+++IL LCL+DG
Sbjct  307   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYALQERIDVQTGIRLILNLCLSDG  366

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFY+AL CAREML   + + +L+ A+NSR
Sbjct  367   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRCAREMLIVNDGTKNLVAAVNSR  426

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEE S +A+NKFNIYPDQIP WLVDW+P +GGYL
Sbjct  427   LSALSFHIREYYWVDMKKINEIYRYKTEECSTDAVNKFNIYPDQIPSWLVDWIPEEGGYL  486

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLW+I+SSL T  Q+  IL+LIE+KW+DLVA+MPLKICYPALE
Sbjct  487   IGNLQPAHMDFRFFTLGNLWAIISSLGTVKQNEGILNLIESKWDDLVAHMPLKICYPALE  546

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTP SYHN GSWPTLLWQ  +A +KM RPE+A+ A+ +AE+R++ D+
Sbjct  547   HEEWRIITGSDPKNTPRSYHNGGSWPTLLWQFTLACIKMGRPELAQRAVSLAEKRLSLDQ  606

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RLFQTW+IAG+L +K L+ NP+ A +L   ED +LL      L
Sbjct  607   WPEYYDTRSGRFIGKQSRLFQTWTIAGFLASKKLLENPDKASLLFWDEDYDLLETCVCAL  666

Query  1890  SANPRRKRSRKGAVKQ  1937
             S   R+K SR  +  Q
Sbjct  667   SKTSRKKCSRFASRSQ  682


 Score =   216 bits (550),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDF+PS +AFLL GE +I
Sbjct  199  IEKEAWKLLQGAVVNYCGNPVGTVAANDPADKQPLNYDQVFIRDFVPSALAFLLNGEVEI  258

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLL+TLQLQSWEKT+DCYSPGQGLMPASFKVRT PL+  + A E+VLDPDFGE+AIG
Sbjct  259  VKNFLLYTLQLQSWEKTVDCYSPGQGLMPASFKVRTAPLDGSDGAFEEVLDPDFGESAIG  318

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  319  RVAPVDSGLW  328



>gb|AAO25633.1| invertase [Oryza sativa Indica Group]
Length=627

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 308/380 (81%), Gaps = 7/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD +L ER+DVQTG+K+IL LCL+DG
Sbjct  250   VLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDNALQERVDVQTGIKLILSLCLSDG  309

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  310   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVMNDGSKNLLRAINNR  369

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIRE+YW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P KGGYL
Sbjct  370   LSALSFHIREHYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEKGGYL  429

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LI+ KW+DL+ANMPLKICYPA+E
Sbjct  430   IGNLQPAHMDFRFFSLGNLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKICYPAME  489

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  AI VAE ++A DK
Sbjct  490   DDEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAIAVAEEKLAADK  549

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  550   WPEYYDTRSGRFIGKQSRSYQTWTIAGFLTSKMLLENPELASILTCNEDLELLEGCACCL  609

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R + SR+ A  +S++V
Sbjct  610   SKK-RTRCSRRAA--KSHVV  626


 Score =   197 bits (500),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  421  WDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFL  600
            W LLR ++V YC  P+GT+AA DP  +  LNYDQVFIRDF+PS +AFL++GE + VRNFL
Sbjct  147  WRLLRRAVVSYCVEPVGTVAAEDPECTETLNYDQVFIRDFVPSALAFLMRGETETVRNFL  206

Query  601  LHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPV  780
            LHTLQLQSWEKT+DCYSPGQ LMPASFK+R VPL+++  A E+VLDPDFGE+AIGRVAPV
Sbjct  207  LHTLQLQSWEKTVDCYSPGQDLMPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPV  266

Query  781  DSGMF  795
            DSG++
Sbjct  267  DSGLW  271



>gb|AFA46813.1| neutral/alkaline invertase [Manihot esculenta]
Length=682

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 307/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQ G+K+IL LCL DG
Sbjct  304   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDNTLQERVDVQIGIKLILNLCLTDG  363

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+  +N+R
Sbjct  364   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRTINNR  423

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  424   LSALSFHIREYYWVDIKKINEIYRYKTEEYSMDATNKFNIYPEQIPSWLMDWIPEEGGYL  483

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWS++SSL T  Q+ AIL+LIEAKW+DLV  MPLKICYPALE
Sbjct  484   IGNLQPAHMDFRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDLVGRMPLKICYPALE  543

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE R+A D 
Sbjct  544   DEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKAVALAEERLAVDH  603

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NP+ A ML+  ED ELL      L
Sbjct  604   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPQMASMLLWEEDYELLEICVCAL  663

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  664   SKTGRKKCSR-GAAKTQILV  682


 Score =   214 bits (546),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = +1

Query  328  EQGRSVHSIAPNGQTSATVNNAL--PNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDS  501
            ++G  V++    G     + N+    + IE+EAW LL  ++V YCG+P+GT+AAND  D 
Sbjct  170  DEGEKVNTENLEGVKGVEIGNSWREESEIEKEAWKLLNDAIVTYCGSPVGTVAANDQGDK  229

Query  502  SILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASF  681
              LNYDQVFIRDF+PS +AFLL+GE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASF
Sbjct  230  QPLNYDQVFIRDFVPSALAFLLRGEGEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASF  289

Query  682  KVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            KVRTVPL  D N +E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  290  KVRTVPL--DGNKSEEVLDPDFGESAIGRVAPVDSGLW  325



>ref|XP_010674559.1| PREDICTED: alkaline/neutral invertase CINV2 [Beta vulgaris subsp. 
vulgaris]
Length=667

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 314/380 (83%), Gaps = 6/380 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG++++L LCL+DG
Sbjct  289   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDFTLQERVDVQTGIRLVLNLCLSDG  348

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REMLA +E S +LI A+N+R
Sbjct  349   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLAEDEGSKNLIRAINNR  408

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+DVKK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+PS+GGY+
Sbjct  409   LSALSFHIREYYWVDVKKINEIYRYKTEEYSTDATNKFNIYPEQIPHWLMDWIPSEGGYM  468

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             +GNLQPAHMDFRFF+LGNLWSI+SSL T  Q+ A+L+LIE KW+DL+ +MPLKICYPA+E
Sbjct  469   LGNLQPAHMDFRFFTLGNLWSIISSLGTPKQNQAVLNLIEVKWDDLIGHMPLKICYPAVE  528

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++AE A+++AE+++  D+
Sbjct  529   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTDLAEKAVEMAEKQLRADR  588

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F+GKQARL+QTW+IAG+L +K+L+ +P  A +L   ED +LL      L
Sbjct  589   WPEYYDTRYGKFVGKQARLYQTWTIAGFLTSKMLLQDPHMASLLYWDEDYDLLEICVCAL  648

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             + + R K SR   V +S+I+
Sbjct  649   TKSSRTKCSR--GVAKSHIL  666


 Score =   214 bits (544),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + IE+EAW LLR ++V YC +P GT+AANDPND + LNYDQVF+RDFIPS +AFL+KGE 
Sbjct  179  SEIEKEAWRLLRNAVVTYCNSPCGTVAANDPNDKTPLNYDQVFLRDFIPSALAFLMKGEG  238

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKV+T+PL+ D    E+VLDPDFGE+A
Sbjct  239  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVKTLPLDGDNGKFEEVLDPDFGESA  298

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  299  IGRVAPVDSGLW  310



>ref|XP_008390412.1| PREDICTED: alkaline/neutral invertase CINV2-like, partial [Malus 
domestica]
Length=686

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 303/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER++ QTG+++IL LCL + 
Sbjct  308   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVEFQTGIRLILNLCLKNR  367

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + DL+TA+N+R
Sbjct  368   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLIVNDGTKDLVTAVNNR  427

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGYL
Sbjct  428   LSALSFHIREYYWADMKKINEIYRYKTEEYSTDAINKFNIYPDQIPSWLVDWIPEEGGYL  487

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+  IL+LIE+KW+D VA MPLKIC PALE
Sbjct  488   IGNLQPAHMDFRFFTLGNLWSIVSSLGTQKQNEGILNLIESKWDDFVAQMPLKICXPALE  547

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI TGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+AE A+ +AE+R++ D 
Sbjct  548   YEEWRITTGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELAEKAVALAEKRLSMDH  607

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK G F+GKQ+RL QTW+IAGYL +K+L+ NPE A +L   ED ELL     +L
Sbjct  608   WPEYYDTKSGRFVGKQSRLHQTWTIAGYLTSKMLLENPEKASLLFWEEDYELLETCVCVL  667

Query  1890  SANPRRKRSRKGAVKQ  1937
             +   R+K SR  A  Q
Sbjct  668   NKTSRKKCSRFAAKSQ  683


 Score =   214 bits (544),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IEEEAW LLR S+V YCGNP+GT+AA DP D + LNYDQVFIRDF+PS +AFLL G+ +I
Sbjct  200  IEEEAWRLLRDSVVSYCGNPVGTLAATDPADKTPLNYDQVFIRDFVPSALAFLLNGDAEI  259

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DC+SPGQGLMPASFKVRTVPL+      E+VLDPDFGE+AIG
Sbjct  260  VKNFLLHTLQLQSWEKTVDCHSPGQGLMPASFKVRTVPLDXSPGEFEEVLDPDFGESAIG  319

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  320  RVAPVDSGLW  329



>emb|CAP59643.1| putative neutral invertase [Vitis vinifera]
Length=676

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 307/379 (81%), Gaps = 7/379 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  294   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ-ALFYSALLCAREMLAPEEASIDLITALNS  1166
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ ALFYSAL C+REM+   + + +L+ A+N+
Sbjct  354   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQQALFYSALRCSREMITVNDGTKNLVRAINN  413

Query  1167  RLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGY  1346
             RL ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGY
Sbjct  414   RLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLVDWIPDQGGY  473

Query  1347  LIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPAL  1526
             LIGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPAL
Sbjct  474   LIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPAL  533

Query  1527  EGQEWRIITGGDPKNTPWSYHNAGSWPTLLW--QLAVASVKMKRPEIAENAIKVAERRIA  1700
             E +EWRIITG DPKNTPWSYHN GSWPTLLW  Q  +A +KM RPE+A  A+ +AE R++
Sbjct  534   ENEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFQFTLACIKMGRPELARKAVALAEERLS  593

Query  1701  GDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFS  1880
              D WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED ELL    
Sbjct  594   VDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICV  653

Query  1881  SILSANPRRKRSRKGAVKQ  1937
               LS   R+K SR  A  Q
Sbjct  654   CALSKTGRKKCSRSAARSQ  672


 Score =   221 bits (564),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            G     V   +P  IE+EAW LLR+++V YCGNP+GT+AANDP D   LNYDQVFIRDF+
Sbjct  173  GLNKEKVEREVP-EIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYDQVFIRDFV  231

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENAT  723
            PS +AFLLKGE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A 
Sbjct  232  PSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGGNGAF  291

Query  724  EDVLDPDFGEAAIGRVAPVDSGMF  795
            E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  292  EEVLDPDFGESAIGRVAPVDSGLW  315



>ref|XP_008388459.1| PREDICTED: alkaline/neutral invertase CINV2 [Malus domestica]
Length=676

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 303/380 (80%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+KMIL LCL DG
Sbjct  298   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGLKMILNLCLTDG  357

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ LFYSAL C+REML   + S +L+ A+N+R
Sbjct  358   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQTLFYSALRCSREMLGVNDGSKNLVRAINNR  417

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL+DW+P +GGY 
Sbjct  418   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPDQIPLWLMDWIPEEGGYF  477

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ A+L+ IEAKW+DLV +MPLKI YPALE
Sbjct  478   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNDAVLNFIEAKWDDLVGHMPLKISYPALE  537

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A  +AE+R+  D+
Sbjct  538   FXEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAAALAEKRLRSDR  597

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L  K+L+ NPE A +L   ED ELL      L
Sbjct  598   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTTKMLLENPEKAALLFWDEDYELLEICVCAL  657

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R+K SR GA K   +V
Sbjct  658   SKSGRKKCSR-GAAKSQILV  676


 Score =   219 bits (558),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LLR S+V YCGNP+GT+AAN+P D  +LNYDQVFIRDF+PS +AFLLKGE +I
Sbjct  192  IEKEAWRLLRDSVVTYCGNPVGTVAANEPGDKQLLNYDQVFIRDFVPSALAFLLKGEGEI  251

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKV TVPL  D N  E+VLDPDFGE+AIG
Sbjct  252  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVXTVPL--DGNKIEEVLDPDFGESAIG  309

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  310  RVAPVDSGLW  319



>ref|XP_007145019.1| hypothetical protein PHAVU_007G203100g [Phaseolus vulgaris]
 gb|ESW17013.1| hypothetical protein PHAVU_007G203100g [Phaseolus vulgaris]
Length=651

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/376 (69%), Positives = 304/376 (81%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER DVQTG+KMIL LCL DG
Sbjct  273   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDCTLQERADVQTGLKMILNLCLTDG  332

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   E + +LI A+N+R
Sbjct  333   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVVTEGTNNLIRAINNR  392

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  393   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPLWLMDWIPEEGGYL  452

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGN WSIVSSL T  Q+ AIL+L+EAKW+DLV +MPLKICYPAL+
Sbjct  453   IGNLQPAHMDFRFFTLGNFWSIVSSLGTPRQNQAILNLVEAKWDDLVGHMPLKICYPALD  512

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI TG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+  D 
Sbjct  513   NEEWRITTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVALAEKRLPVDS  572

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQAR++QTW+IAG+L +K+L+ +PE A  L   ED ELL      L
Sbjct  573   WPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKDPEMASRLFWEEDYELLDICVCGL  632

Query  1890  SANPRRKRSRKGAVKQ  1937
             S N R++ SR  A  Q
Sbjct  633   SKNGRKRCSRGAARSQ  648


 Score =   210 bits (534),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 116/130 (89%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            +E++AW LL+ ++V YCGNP+GT+AANDP D   LNYDQVF+RDFIPS +AFLL+GE +I
Sbjct  167  VEKQAWKLLQGAVVTYCGNPVGTVAANDPGDKLPLNYDQVFLRDFIPSALAFLLRGESEI  226

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVR+V L  DE+  E+VLDPDFGE+AIG
Sbjct  227  VKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRSVAL--DEDNHEEVLDPDFGESAIG  284

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  285  RVAPVDSGLW  294



>gb|EYU45478.1| hypothetical protein MIMGU_mgv1a002360mg [Erythranthe guttata]
Length=684

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/366 (69%), Positives = 299/366 (82%), Gaps = 4/366 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCL DG
Sbjct  307   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYTLQERVDVQTGIKLILNLCLTDG  366

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   E++ +L+ A+N+R
Sbjct  367   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNESTKNLVVAINNR  426

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFH+REYYW+D+KK+NEIYRYKTEEYS EA NKFNIYPDQIP WL DW+P  GGYL
Sbjct  427   LSALSFHMREYYWVDMKKINEIYRYKTEEYSAEATNKFNIYPDQIPSWLADWIPDTGGYL  486

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQP+HMDFRFF+LGNLWS++SSL+T++QS  I++L+E KW+DLVA MPLKICYPALE
Sbjct  487   IGNLQPSHMDFRFFTLGNLWSVISSLSTSEQSEGIMNLVEEKWDDLVAQMPLKICYPALE  546

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITGGDPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A  A+K+AE+R+  D 
Sbjct  547   HEEWRIITGGDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRTELARKAVKLAEKRLLVDD  606

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDTK   F+GKQARL QTW++AGYL + +L+ NPE A +L   ED E+L      L
Sbjct  607   WPEYYDTKHASFVGKQARLKQTWTVAGYLTSTILLDNPELASLLFWEEDYEVLENCVCGL  666

Query  1890  SANPRR  1907
                PR+
Sbjct  667   KNEPRK  672


 Score =   212 bits (540),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +1

Query  313  RIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAAND-  489
            ++ ED +  ++  ++ +  + +T+   + + +E+EAW LLR ++V YCGNP+GTIA+ D 
Sbjct  168  QVNEDLKNANIDQLSKSEVSESTLGGDV-SEVEKEAWKLLRGAVVNYCGNPVGTIASTDH  226

Query  490  PNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLM  669
            P D+  LNYDQVFIRDF+PS +AFLL GE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLM
Sbjct  227  PADNQPLNYDQVFIRDFVPSALAFLLNGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLM  286

Query  670  PASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            PASFKVRT+PL+  +   EDVLDPDFGE+AIGRVAPVDSG++
Sbjct  287  PASFKVRTLPLDGRDGEFEDVLDPDFGESAIGRVAPVDSGLW  328



>ref|XP_003567650.1| PREDICTED: alkaline/neutral invertase CINV1-like [Brachypodium 
distachyon]
Length=619

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/379 (67%), Positives = 302/379 (80%), Gaps = 7/379 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAY K +GD SL ER+DVQTG+K+IL LCL DG
Sbjct  243   VLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDYSLQERVDVQTGIKLILSLCLTDG  302

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REM+   + S  L+ A+N+R
Sbjct  303   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMITVNDGSKHLLRAINNR  362

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS++A NKFNIYP+QIP WLVDW+P +GGYL
Sbjct  363   LSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVDWIPEEGGYL  422

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLW+I SSL T  Q+  IL LIE KW+DLVANMPLKICYPA+E
Sbjct  423   IGNLQPAHMDFRFFSLGNLWAISSSLTTPTQAEGILSLIEEKWDDLVANMPLKICYPAME  482

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
               EWRI+TG DPKNTPWSYHN GSWPTLLWQ  +A +KM RPE+A  A+ VAE +++ DK
Sbjct  483   DNEWRIVTGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRPELARRAVAVAEEQLSADK  542

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F+GKQ+R +QTW+IAG+L +K+L+ NPE A +L   ED ELL   +  L
Sbjct  543   WPEYYDTRSGRFVGKQSRSYQTWTIAGFLTSKMLLENPELASILTCDEDLELLEGCACCL  602

Query  1890  SANPRRKRSRKGAVKQSYI  1946
             S   +R R  +   K+  +
Sbjct  603   S---KRTRCSRRVTKEDIV  618


 Score =   211 bits (538),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +1

Query  409  EEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIV  588
            E EAW LLR ++V YCG P+GT+AA DP  + + NYDQVFIRDF+PS +AFL++GE +IV
Sbjct  136  EREAWRLLRRAVVSYCGEPVGTVAAEDPECTEVANYDQVFIRDFVPSALAFLMRGETEIV  195

Query  589  RNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGR  768
            RNFLLHTLQLQSWEKT+DCYSPGQGLMPASFK+RTVPL+ +  A E+VLDPDFGE+AIGR
Sbjct  196  RNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKIRTVPLDENNEAFEEVLDPDFGESAIGR  255

Query  769  VAPVDSGMF  795
            VAPVDSG++
Sbjct  256  VAPVDSGLW  264



>gb|KDO81628.1| hypothetical protein CISIN_1g005783mg [Citrus sinensis]
Length=450

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 308/382 (81%), Gaps = 7/382 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+I+ LCLADG
Sbjct  70    VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIKLIMNLCLADG  129

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEAS--IDLITALN  1163
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+AL C+REML   + S   +L+ A+N
Sbjct  130   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYTALRCSREMLTVSDGSGSNNLVRAIN  189

Query  1164  SRLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGG  1343
             +RL ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GG
Sbjct  190   NRLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDATNKFNIYPEQIPSWLMDWIPEEGG  249

Query  1344  YLIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPA  1523
             YLIGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ +IL+LIEAKW+DLV +MPLKICYPA
Sbjct  250   YLIGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNESILNLIEAKWDDLVGHMPLKICYPA  309

Query  1524  LEGQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAG  1703
             LE ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R  +A+ A+ +AE R+  
Sbjct  310   LESEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLGLAQKAVALAENRLPL  369

Query  1704  DKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSS  1883
             D WPEYYDT+ G F GKQ+RLFQTW+IAG+L +K+LV NPE A +L   ED ELL     
Sbjct  370   DHWPEYYDTRTGRFTGKQSRLFQTWTIAGFLTSKMLVENPEMASVLFWEEDYELLEICVC  429

Query  1884  ILSANPRRKRSRKGAVKQSYIV  1949
              LS + R+K SR GA K   +V
Sbjct  430   ALSKSGRKKCSR-GAAKSQILV  450


 Score =   100 bits (250),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 2/58 (3%)
 Frame = +1

Query  622  SWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            SWEKT+DCYSPGQGLMPASFKVR VPLE+  N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  36   SWEKTVDCYSPGQGLMPASFKVRNVPLES--NKFEEVLDPDFGESAIGRVAPVDSGLW  91



>emb|CAP59644.1| putative neutral invertase [Vitis vinifera]
Length=676

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 306/379 (81%), Gaps = 7/379 (2%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+++IL LCL DG
Sbjct  294   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYALQERVDVQTGIRLILNLCLTDG  353

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQ-ALFYSALLCAREMLAPEEASIDLITALNS  1166
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQ ALFYSAL C+REML   + + +L+ A+N+
Sbjct  354   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQQALFYSALRCSREMLTVNDGTKNLVRAINN  413

Query  1167  RLLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGY  1346
             RL ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYPDQIP WLVDW+P +GGY
Sbjct  414   RLSALSFHIREYYWVDMKKINEIYRYKTEEYSTDAINKFNIYPDQIPTWLVDWIPDQGGY  473

Query  1347  LIGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPAL  1526
             LIGNLQPAHMDFRFF+LGNLWSI+SSL T  Q+  IL+LIEAKW+DLVA+MPLKICYPAL
Sbjct  474   LIGNLQPAHMDFRFFTLGNLWSIISSLGTAKQNEGILNLIEAKWDDLVAHMPLKICYPAL  533

Query  1527  EGQEWRIITGGDPKNTPWSYHNAGSWPTLLW--QLAVASVKMKRPEIAENAIKVAERRIA  1700
             E +EWRIITG DPKNTPWSYHN GSWP LLW  Q  +A +KM RPE+A  A+ +AE R++
Sbjct  534   ENEEWRIITGSDPKNTPWSYHNGGSWPALLWQFQFTLACIKMGRPELARKAVALAEERLS  593

Query  1701  GDKWPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFS  1880
              D WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NPE A +L   ED ELL    
Sbjct  594   VDHWPEYYDTRNGRFIGKQSRLYQTWTIAGFLTSKMLLENPEMASLLAWEEDYELLEICV  653

Query  1881  SILSANPRRKRSRKGAVKQ  1937
               LS   R+K SR  A  Q
Sbjct  654   CALSKTGRKKCSRSAARSQ  672


 Score =   221 bits (564),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +1

Query  364  GQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFI  543
            G     V   +P  IE+EAW LLR+++V YCGNP+GT+AANDP D   LNYDQVFIRDF+
Sbjct  173  GLNKEKVEREVP-EIEKEAWRLLRSAVVDYCGNPVGTVAANDPGDKQPLNYDQVFIRDFV  231

Query  544  PSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENAT  723
            PS +AFLLKGE +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL+    A 
Sbjct  232  PSALAFLLKGEGEIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPLDGGNGAF  291

Query  724  EDVLDPDFGEAAIGRVAPVDSGMF  795
            E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  292  EEVLDPDFGESAIGRVAPVDSGLW  315



>ref|XP_002318940.2| hypothetical protein POPTR_0013s00800g [Populus trichocarpa]
 gb|EEE94863.2| hypothetical protein POPTR_0013s00800g [Populus trichocarpa]
Length=668

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 307/376 (82%), Gaps = 4/376 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQTG+K+IL LCLADG
Sbjct  290   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYALQERVDVQTGIKLILNLCLADG  349

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL  +REML   + S +L+ A+N+R
Sbjct  350   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRSSREMLVVNDGSKNLVRAINNR  409

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D++K+NEIYRYKTEEYS EA NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  410   LSALSFHIREYYWVDMRKINEIYRYKTEEYSTEATNKFNIYPEQIPSWLMDWIPEEGGYL  469

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWS+VSSL T  Q+ A+L+LIE+KW+DLV NMPLKICYPALE
Sbjct  470   IGNLQPAHMDFRFFTLGNLWSVVSSLGTPKQNEAVLNLIESKWDDLVGNMPLKICYPALE  529

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ AI +AE+R+  D 
Sbjct  530   SEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACMKMDRMELAQKAIALAEKRLQVDH  589

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW++AG+L +K+L+ NPE A +L   ED +LL      L
Sbjct  590   WPEYYDTRSGKFIGKQSRLYQTWTVAGFLTSKVLLENPEKASLLFWDEDYDLLEFCVCGL  649

Query  1890  SANPRRKRSRKGAVKQ  1937
             + + R++ SR  A  Q
Sbjct  650   NTSGRKRCSRVAARSQ  665


 Score =   211 bits (538),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL  ++V YCG+P+GT+AANDP D   LNYDQVF+RDF+PS +AFLL+GE +I
Sbjct  184  IEKEAWKLLNDAVVMYCGSPVGTVAANDPGDKMPLNYDQVFVRDFVPSALAFLLRGEGEI  243

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            V+NFLLH LQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D+N  E+VLDPDFGE+AIG
Sbjct  244  VKNFLLHALQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DDNNLEEVLDPDFGESAIG  301

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  302  RVAPVDSGLW  311



>gb|KHG16119.1| hypothetical protein F383_01238 [Gossypium arboreum]
Length=667

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 309/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYG+ +GD SL ER+DVQTGMK+IL LCLADG
Sbjct  289   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGRITGDYSLQERVDVQTGMKLILNLCLADG  348

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFY+AL  +RE+L+  E S +L+ A+N+R
Sbjct  349   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYAALRSSREILSVNEGSKNLVRAINNR  408

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  409   LNALSFHIREYYWVDMKKINEIYRYKTEEYSMDATNKFNIYPEQIPSWLMDWVPEEGGYL  468

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL T  Q+ AIL+LIE KW+D+V +MPLKICYPA+E
Sbjct  469   IGNLQPAHMDFRFFTLGNLWSIVSSLGTPKQNEAILNLIENKWDDIVGHMPLKICYPAVE  528

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRIITG DPKNTPWSYHN GSWPTLLWQ  +A VKM R E+A+ AI +AE+R++ D 
Sbjct  529   NEEWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACVKMGRLELAQKAIALAEKRLSRDH  588

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K++V N E A +L   ED ELL      L
Sbjct  589   WPEYYDTRSGKFIGKQSRLYQTWTIAGFLTSKMMVENREMASLLFWEEDYELLEICVCAL  648

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S + R K SR GA K   +V
Sbjct  649   SKSGRVKCSR-GAAKSQILV  667


 Score =   219 bits (557),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 9/159 (6%)
 Frame = +1

Query  328  EQGRSVHSIAP---NGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPND  498
            E G +V +I      G+   ++++A    IE+EAWDLLR S+V YCG P+GT+AANDP D
Sbjct  158  EDGNNVKNIGEGLGKGKNGVSIDSA----IEKEAWDLLRDSVVSYCGFPVGTVAANDPGD  213

Query  499  SSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPAS  678
               LNYDQVFIRDF+PS +AFLLKGE  I++NFLLHTLQLQSWEKT+DCYSPGQGLMPAS
Sbjct  214  KQPLNYDQVFIRDFVPSALAFLLKGEGGILKNFLLHTLQLQSWEKTVDCYSPGQGLMPAS  273

Query  679  FKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            FKVRTVP+  D+N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  274  FKVRTVPI--DDNKFEEVLDPDFGESAIGRVAPVDSGLW  310



>ref|XP_006344790.1| PREDICTED: alkaline/neutral invertase CINV2-like [Solanum tuberosum]
Length=653

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 309/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD  L ER+DVQTG+K+I+ LCL+DG
Sbjct  275   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDYGLQERVDVQTGIKLIINLCLSDG  334

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+RE+L+ +E S +L+ A+N+R
Sbjct  335   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSRELLSLDEGSKNLVNAINNR  394

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS EA NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  395   LSALSFHIREYYWVDMKKINEIYRYKTEEYSTEATNKFNIYPEQIPHWLMDWIPEEGGYL  454

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFF+LGNLWSIVSSL+T  Q+ AIL+LIEAKW DLV  MPLKICYPALE
Sbjct  455   IGNLQPAHMDFRFFTLGNLWSIVSSLSTPKQNEAILNLIEAKWYDLVGLMPLKICYPALE  514

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R ++A+ A+  AE+R+  D+
Sbjct  515   SEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMNRLDLAKKAVDSAEKRLRVDQ  574

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G F GKQARL+QTW+IAG+L +K+L+ NPE A +L   ED +LL      L
Sbjct  575   WPEYYDTRYGKFTGKQARLYQTWTIAGFLTSKMLLENPETASLLFWEEDYDLLEICVCAL  634

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
               + R+K SR GA K   +V
Sbjct  635   KKSGRKKCSR-GAAKSQILV  653


 Score =   217 bits (552),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 121/150 (81%), Gaps = 2/150 (1%)
 Frame = +1

Query  346  HSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQV  525
            H+     +   +V     +   +EAW LL  ++V YCG+PIGT+AANDPND   LNYDQV
Sbjct  149  HAATGQHEKVESVKEGEESQTVKEAWRLLENAVVTYCGSPIGTLAANDPNDKLPLNYDQV  208

Query  526  FIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLE  705
            FIRDFIPS +AFLLKGE +IVRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL 
Sbjct  209  FIRDFIPSALAFLLKGEKEIVRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL-  267

Query  706  NDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
             D+N  E+VLDPDFGE+AIGRVAPVDSG++
Sbjct  268  -DDNKYEEVLDPDFGESAIGRVAPVDSGLW  296



>gb|AHA82519.1| neutral/alkaline invertase [Manihot esculenta]
Length=679

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/380 (67%), Positives = 308/380 (81%), Gaps = 5/380 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD +L ER+DVQ G+K+IL LCL DG
Sbjct  301   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKITGDCTLQERVDVQMGIKLILNLCLTDG  360

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + S +L+ A+N+R
Sbjct  361   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLTVNDGSKNLVRAVNNR  420

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +A NKFNIYP+QIP WL+DW+P +GGYL
Sbjct  421   LSALSFHIREYYWVDIKKINEIYRYKTEEYSLDATNKFNIYPEQIPSWLMDWIPEEGGYL  480

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMD RFF+LGNLWS++SSL T  Q+ AIL+LIEAKW+D+V  MPLKICYPA+E
Sbjct  481   IGNLQPAHMDLRFFTLGNLWSVISSLGTPKQNKAILNLIEAKWDDIVGRMPLKICYPAIE  540

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              ++WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +AE+R+A D+
Sbjct  541   DEDWRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRLELAQKAVALAEKRLAVDR  600

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQ+RL+QTW+IAG+L +K+L+ NP  A ML+  ED ELL      L
Sbjct  601   WPEYYDTRTGKFIGKQSRLYQTWTIAGFLTSKVLLENPRMASMLLWEEDYELLEICVCGL  660

Query  1890  SANPRRKRSRKGAVKQSYIV  1949
             S   R+K SR GA K   +V
Sbjct  661   SKTGRKKCSR-GAAKSQILV  679


 Score =   214 bits (545),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +1

Query  406  IEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDI  585
            IE+EAW LL  ++V YCG+P+GT+AANDP D   LNYDQVFIRDF+PS +AFLL+GE +I
Sbjct  195  IEKEAWKLLNDAIVSYCGSPVGTVAANDPGDKQPLNYDQVFIRDFVPSALAFLLRGEGEI  254

Query  586  VRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIG  765
            VRNFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTVPL  D N  E+VLDPDFGE+AIG
Sbjct  255  VRNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVPL--DGNKFEEVLDPDFGESAIG  312

Query  766  RVAPVDSGMF  795
            RVAPVDSG++
Sbjct  313  RVAPVDSGLW  322



>gb|KFK38110.1| hypothetical protein AALP_AA3G070900 [Arabis alpina]
Length=647

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/367 (68%), Positives = 300/367 (82%), Gaps = 4/367 (1%)
 Frame = +3

Query  831   PNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADGFDM  998
             P+F  S I       SGLWWIILLRAYGK +GD +L ERIDVQTG+K+ILKLCLADGFDM
Sbjct  272   PDFGGSAIGRVSPVDSGLWWIILLRAYGKLTGDYTLQERIDVQTGIKLILKLCLADGFDM  331

Query  999   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSRLLA  1178
             FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSAL CAREML   + + +L+ A+N+RL A
Sbjct  332   FPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCAREMLNVNDGTKNLVAAINNRLSA  391

Query  1179  LSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYLIGN  1358
             LSFHIREYYW+D+KK+NEIYRY TEEYS +A NKFNIYP+QIP WLVDW+P+KGGY IGN
Sbjct  392   LSFHIREYYWVDIKKINEIYRYNTEEYSADATNKFNIYPEQIPTWLVDWIPNKGGYFIGN  451

Query  1359  LQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALEGQE  1538
             LQPAHMDFRFF+LGNLW+++SSL   +Q+  ++ LIE KW+DLVANMPLKIC+PALE  E
Sbjct  452   LQPAHMDFRFFTLGNLWAVISSLGNQEQNEGVMTLIEEKWDDLVANMPLKICFPALEQDE  511

Query  1539  WRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDKWPE  1718
             WRIITG DPKNTPWSYHN GSWPTLLWQ  +A +KM + E+A+ A+ VAE+R+  D+WPE
Sbjct  512   WRIITGSDPKNTPWSYHNGGSWPTLLWQFTLACIKMGKLELAKKAVAVAEKRLKEDEWPE  571

Query  1719  YYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSILSAN  1898
             YYDTK G F+GKQ+RL+QTW+IAG+L +K L+  PE A +L   ED +LL      LS +
Sbjct  572   YYDTKSGRFVGKQSRLYQTWTIAGFLASKKLIEQPEKASLLFWEEDYQLLETCVCALSRS  631

Query  1899  PRRKRSR  1919
               RK+++
Sbjct  632   SGRKKNK  638


 Score =   206 bits (523),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 149/227 (66%), Gaps = 9/227 (4%)
 Frame = +1

Query  127  CSSNSLLLLKDHFKGKSFRV----KCSKDLGKITSSSKLCAVRDFYGLEKPKLLRCYCRP  294
            C S+S++L     KG+   V    + + D    +SSS    V +   LE   +     + 
Sbjct  69   CDSDSMVLRARGSKGRGRGVLVIPRVASDFRNHSSSSLGSHVNNDKRLESIFVKPLVFKE  128

Query  295  AERGNERIFEDEQGRSVHSIAPNGQTSATVNNALPNSIEEEAWDLLRASMVYYCGNPIGT  474
             E+  E I + E G +V   A  G+    ++ +     E+EAW LLR ++V YCG P+GT
Sbjct  129  LEK-TEEITKKESG-NVGEDAKFGEKEGVLSQS---EAEKEAWKLLRGAVVNYCGFPVGT  183

Query  475  IAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEYDIVRNFLLHTLQLQSWEKTMDCYSP  654
            +AANDP D   LNYDQVFIRDF+PS  AFLL GE +IVRNFLLHTLQLQSWEKT+DC+SP
Sbjct  184  VAANDPGDKQTLNYDQVFIRDFVPSAYAFLLDGEGEIVRNFLLHTLQLQSWEKTVDCHSP  243

Query  655  GQGLMPASFKVRTVPLENDENATEDVLDPDFGEAAIGRVAPVDSGMF  795
            G GLMPASFKV++ PLE ++ + E+ LDPDFG +AIGRV+PVDSG++
Sbjct  244  GPGLMPASFKVKSAPLEGNDGSFEEFLDPDFGGSAIGRVSPVDSGLW  290



>gb|KHN02814.1| Cell cycle checkpoint protein RAD1 [Glycine soja]
Length=955

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/373 (70%), Positives = 307/373 (82%), Gaps = 4/373 (1%)
 Frame = +3

Query  822   VICPNFWISQIS----CHSGLWWIILLRAYGKCSGDLSLLERIDVQTGMKMILKLCLADG  989
             V+ P+F  S I       SGLWWIILLRAYGK +GD SL ER DVQTG+KMIL LCL DG
Sbjct  263   VLDPDFGESAIGRVAPVDSGLWWIILLRAYGKLTGDYSLQERADVQTGLKMILNLCLTDG  322

Query  990   FDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLAPEEASIDLITALNSR  1169
             FDMFP+LLVTDGSCMIDRRMGIHGHPLEIQALFYSAL C+REML   + + +LI A+N+R
Sbjct  323   FDMFPSLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVATDGTKNLIRAINNR  382

Query  1170  LLALSFHIREYYWIDVKKLNEIYRYKTEEYSYEAINKFNIYPDQIPPWLVDWMPSKGGYL  1349
             L ALSFHIREYYW+D+KK+NEIYRYKTEEYS +AINKFNIYP+QIP WL+DW+P +GGYL
Sbjct  383   LSALSFHIREYYWVDMKKMNEIYRYKTEEYSMDAINKFNIYPEQIPLWLMDWIPEEGGYL  442

Query  1350  IGNLQPAHMDFRFFSLGNLWSIVSSLATTDQSHAILDLIEAKWEDLVANMPLKICYPALE  1529
             IGNLQPAHMDFRFFSLGNLWSIVSSL T  Q+HAIL+LIEAKW+DLV +MPLKICYPAL+
Sbjct  443   IGNLQPAHMDFRFFSLGNLWSIVSSLGTPRQNHAILNLIEAKWDDLVGHMPLKICYPALD  502

Query  1530  GQEWRIITGGDPKNTPWSYHNAGSWPTLLWQLAVASVKMKRPEIAENAIKVAERRIAGDK  1709
              +EWRI+TG DPKNTPWSYHN GSWPTLLWQ  +A +KM R E+A+ A+ +A++R+  D 
Sbjct  503   NEEWRIVTGCDPKNTPWSYHNGGSWPTLLWQFTLACIKMGRIELAQKAVALADKRLPVDS  562

Query  1710  WPEYYDTKRGGFIGKQARLFQTWSIAGYLVAKLLVANPEAAKMLITIEDTELLSAFSSIL  1889
             WPEYYDT+ G FIGKQAR++QTW+IAG+L +K+L+ NPE A ML   ED ELL      L
Sbjct  563   WPEYYDTRTGKFIGKQARMYQTWTIAGFLTSKMLLKNPEMASMLFWEEDYELLDICVCGL  622

Query  1890  SANPRRKRSRKGA  1928
             S + R++ SR  A
Sbjct  623   SKSGRKRCSRGAA  635


 Score =   214 bits (544),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  400  NSIEEEAWDLLRASMVYYCGNPIGTIAANDPNDSSILNYDQVFIRDFIPSGIAFLLKGEY  579
            + +E+EAW LL+ ++V YCGNP+GT+AANDP D   LNYDQVFIRDFIPS +AFLL+GE 
Sbjct  155  SEVEKEAWKLLQGAVVTYCGNPVGTMAANDPGDKLPLNYDQVFIRDFIPSALAFLLRGES  214

Query  580  DIVRNFLLHTLQLQSWEKTMDCYSPGQGLMPASFKVRTVPLENDENATEDVLDPDFGEAA  759
            +IV+NFLLHTLQLQSWEKT+DCYSPGQGLMPASFKVRTV L  DE+  E+VLDPDFGE+A
Sbjct  215  EIVKNFLLHTLQLQSWEKTVDCYSPGQGLMPASFKVRTVAL--DEDNHEEVLDPDFGESA  272

Query  760  IGRVAPVDSGMF  795
            IGRVAPVDSG++
Sbjct  273  IGRVAPVDSGLW  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7052722543570