BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20525_g1_i2 len=1737 path=[1:0-1170 1172:1171-1736]

Length=1737
                                                                      Score     E

ref|XP_006339040.1|  PREDICTED: uncharacterized protein LOC102599...    291   4e-89   
ref|XP_009781876.1|  PREDICTED: uncharacterized protein LOC104230707    284   2e-86   
ref|XP_011094800.1|  PREDICTED: stress-induced-phosphoprotein 1-like    277   8e-84   
ref|XP_009609524.1|  PREDICTED: uncharacterized protein LOC104103331    276   3e-83   
ref|XP_004246742.1|  PREDICTED: uncharacterized protein LOC101245980    275   4e-83   
emb|CDP06661.1|  unnamed protein product                                267   9e-80   
ref|XP_006345667.1|  PREDICTED: uncharacterized protein LOC102590982    259   4e-77   
ref|XP_010670016.1|  PREDICTED: uncharacterized protein LOC104887120    256   7e-76   
gb|EYU41672.1|  hypothetical protein MIMGU_mgv1a008905mg                253   2e-74   
ref|XP_010047317.1|  PREDICTED: uncharacterized protein LOC104436284    244   4e-71   
ref|XP_002277967.1|  PREDICTED: uncharacterized protein LOC100267054    243   8e-71   Vitis vinifera
gb|EPS58056.1|  hypothetical protein M569_16759                         242   3e-70   
emb|CBI32668.3|  unnamed protein product                                239   1e-69   
ref|XP_009409535.1|  PREDICTED: uncharacterized protein LOC103991725    240   1e-69   
gb|KDO44112.1|  hypothetical protein CISIN_1g040440mg                   239   2e-69   
ref|XP_010920729.1|  PREDICTED: uncharacterized protein LOC105044501    239   2e-69   
ref|XP_010260033.1|  PREDICTED: uncharacterized protein LOC104599263    237   1e-68   
ref|XP_010529866.1|  PREDICTED: uncharacterized protein LOC104806590    236   2e-68   
ref|XP_006429002.1|  hypothetical protein CICLE_v10012060mg             236   5e-68   
ref|XP_006410923.1|  hypothetical protein EUTSA_v10017513mg             234   9e-68   
ref|XP_008794537.1|  PREDICTED: uncharacterized protein LOC103710546    234   2e-67   
ref|XP_011019250.1|  PREDICTED: uncharacterized protein LOC105122045    233   2e-67   
gb|AAM66986.1|  unknown                                                 233   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565860.1|  tetratricopeptide repeat domain-containing protein    233   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322830.2|  chloroplast lumen common family protein            233   6e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002308480.2|  hypothetical protein POPTR_0006s23010g             232   6e-67   Populus trichocarpa [western balsam poplar]
gb|KFK36629.1|  hypothetical protein AALP_AA4G149000                    232   6e-67   
ref|XP_011015949.1|  PREDICTED: uncharacterized protein LOC105119503    232   8e-67   
ref|XP_011007307.1|  PREDICTED: uncharacterized protein LOC105113025    232   9e-67   
ref|XP_002881505.1|  hypothetical protein ARALYDRAFT_482732             231   2e-66   
emb|CDY46775.1|  BnaA03g17190D                                          228   1e-65   
ref|XP_009800384.1|  PREDICTED: ras guanine nucleotide exchange f...    229   1e-65   
ref|XP_010253347.1|  PREDICTED: uncharacterized protein LOC104594653    228   1e-65   
ref|XP_006292273.1|  hypothetical protein CARUB_v10018483mg             229   2e-65   
ref|XP_009133150.1|  PREDICTED: uncharacterized protein LOC103857677    228   2e-65   
gb|KDP35578.1|  hypothetical protein JCGZ_09016                         228   2e-65   
ref|XP_008241614.1|  PREDICTED: uncharacterized protein LOC103340025    228   3e-65   
ref|NP_566986.1|  tetratricopeptide repeat domain-containing protein    227   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205429.1|  hypothetical protein PRUPE_ppa007747mg             228   5e-65   
ref|XP_006844252.1|  hypothetical protein AMTR_s00145p00019890          228   9e-65   
ref|XP_006294547.1|  hypothetical protein CARUB_v10023581mg             226   1e-64   
ref|XP_002877926.1|  chloroplast lumen common family protein            226   1e-64   
ref|XP_006398717.1|  hypothetical protein EUTSA_v10015638mg             226   2e-64   
gb|KEH24003.1|  TPR superfamily protein                                 226   2e-64   
emb|CAB67663.1|  putative protein                                       227   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302797.1|  PREDICTED: uncharacterized protein LOC101311390    225   3e-64   
emb|CDY11220.1|  BnaA03g00560D                                          224   3e-64   
ref|XP_009130751.1|  PREDICTED: uncharacterized protein LOC103855512    224   4e-64   
emb|CDX80831.1|  BnaC03g00850D                                          223   8e-64   
emb|CDX93382.1|  BnaC04g45140D                                          223   1e-63   
ref|XP_002533008.1|  conserved hypothetical protein                     223   2e-63   Ricinus communis
emb|CDY18448.1|  BnaA04g21390D                                          220   2e-62   
ref|XP_010504124.1|  PREDICTED: uncharacterized protein LOC104781214    221   2e-62   
ref|XP_010427008.1|  PREDICTED: uncharacterized protein LOC104711924    221   2e-62   
ref|XP_004493905.1|  PREDICTED: uncharacterized protein LOC101501574    221   2e-62   
ref|XP_009141655.1|  PREDICTED: uncharacterized protein LOC103865595    219   3e-62   
ref|XP_010515851.1|  PREDICTED: uncharacterized protein LOC104791622    220   4e-62   
ref|XP_009631496.1|  PREDICTED: uncharacterized protein LOC104121251    220   4e-62   
ref|XP_007027123.1|  Tetratricopeptide repeat (TPR)-like superfam...    219   7e-62   
ref|XP_010097377.1|  hypothetical protein L484_008900                   219   7e-62   
ref|XP_010553027.1|  PREDICTED: uncharacterized protein LOC104823250    218   1e-61   
ref|XP_008369840.1|  PREDICTED: uncharacterized protein LOC103433367    218   2e-61   
gb|KFK34608.1|  hypothetical protein AALP_AA5G167700                    218   2e-61   
ref|XP_009377114.1|  PREDICTED: uncharacterized protein LOC103965763    218   2e-61   
ref|XP_008447473.1|  PREDICTED: uncharacterized protein LOC103489908    216   6e-61   
ref|XP_009103870.1|  PREDICTED: uncharacterized protein LOC103829939    216   7e-61   
ref|XP_004142089.1|  PREDICTED: uncharacterized protein LOC101218...    216   8e-61   
ref|XP_004168689.1|  PREDICTED: uncharacterized protein LOC101226...    216   8e-61   
ref|XP_010509341.1|  PREDICTED: uncharacterized protein LOC104785771    216   8e-61   
ref|XP_008350418.1|  PREDICTED: uncharacterized protein LOC103413758    216   1e-60   
ref|NP_568104.1|  tetratricopeptide repeat domain-containing protein    215   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009374643.1|  PREDICTED: uncharacterized protein LOC103963542    216   2e-60   
ref|XP_009341592.1|  PREDICTED: uncharacterized protein LOC103933625    216   2e-60   
ref|XP_010517010.1|  PREDICTED: uncharacterized protein LOC104792528    214   4e-60   
ref|XP_008350416.1|  PREDICTED: uncharacterized protein LOC103413756    214   6e-60   
ref|XP_008788995.1|  PREDICTED: uncharacterized protein LOC103706623    214   7e-60   
ref|XP_006403675.1|  hypothetical protein EUTSA_v10010528mg             212   2e-59   
emb|CAB85996.1|  putative protein                                       214   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505323.1|  PREDICTED: uncharacterized protein LOC104782...    211   7e-59   
ref|XP_008442587.1|  PREDICTED: uncharacterized protein LOC103486414    211   7e-59   
ref|XP_010505324.1|  PREDICTED: uncharacterized protein LOC104782...    210   1e-58   
ref|XP_004137782.1|  PREDICTED: uncharacterized protein LOC101207402    209   3e-58   
emb|CDY52749.1|  BnaA07g37640D                                          217   1e-57   
ref|XP_010452105.1|  PREDICTED: uncharacterized protein LOC104734270    207   2e-57   
ref|XP_007162682.1|  hypothetical protein PHAVU_001G171200g             207   2e-57   
ref|XP_010937725.1|  PREDICTED: uncharacterized protein LOC105057003    207   2e-57   
emb|CDY07581.1|  BnaC06g14830D                                          216   5e-57   
ref|XP_006288190.1|  hypothetical protein CARUB_v10001425mg             201   2e-55   
ref|XP_002870981.1|  hypothetical protein ARALYDRAFT_487037             201   4e-55   
gb|KHN09442.1|  hypothetical protein glysoja_016541                     195   1e-54   
ref|XP_010423842.1|  PREDICTED: uncharacterized protein LOC104708884    196   1e-53   
ref|XP_010490721.1|  PREDICTED: uncharacterized protein LOC104768428    196   2e-53   
gb|KFK24716.1|  hypothetical protein AALP_AA8G015500                    195   2e-53   
ref|XP_003542471.1|  PREDICTED: uncharacterized protein LOC100812214    187   4e-50   
ref|XP_009116051.1|  PREDICTED: uncharacterized protein LOC103841282    182   2e-48   
ref|XP_003553529.1|  PREDICTED: uncharacterized protein LOC100778644    182   5e-48   
emb|CDX78187.1|  BnaA09g33820D                                          171   1e-44   
ref|XP_004495267.1|  PREDICTED: anaphase-promoting complex subuni...    171   7e-44   
gb|KHN02406.1|  hypothetical protein glysoja_002430                     164   2e-43   
gb|KEH42339.1|  hypothetical protein MTR_1g067600                       168   3e-43   
gb|KHN49002.1|  hypothetical protein glysoja_025379                     165   3e-42   
ref|XP_007144477.1|  hypothetical protein PHAVU_007G159400g             159   1e-39   
ref|XP_009402908.1|  PREDICTED: uncharacterized protein LOC103986601    158   1e-39   
ref|XP_011100082.1|  PREDICTED: general transcriptional corepress...    156   6e-39   
gb|KDP35273.1|  hypothetical protein JCGZ_09432                         153   8e-39   
ref|XP_008786598.1|  PREDICTED: uncharacterized protein LOC103704888    156   1e-38   
ref|XP_002310040.1|  hypothetical protein POPTR_0007s06800g             154   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009758286.1|  PREDICTED: uncharacterized protein LOC104210999    152   1e-37   
emb|CDP12879.1|  unnamed protein product                                152   2e-37   
ref|XP_011025581.1|  PREDICTED: uncharacterized protein LOC105126...    151   3e-37   
ref|XP_010263841.1|  PREDICTED: uncharacterized protein LOC104602006    151   4e-37   
ref|XP_010925351.1|  PREDICTED: uncharacterized protein LOC105047915    151   4e-37   
ref|XP_006427954.1|  hypothetical protein CICLE_v10025951mg             150   6e-37   
ref|XP_009612405.1|  PREDICTED: uncharacterized protein LOC104105725    150   8e-37   
ref|XP_006367386.1|  PREDICTED: uncharacterized protein LOC102593...    149   2e-36   
emb|CBI21527.3|  unnamed protein product                                146   2e-36   
gb|EYU31102.1|  hypothetical protein MIMGU_mgv1a009308mg                148   3e-36   
ref|XP_004237470.1|  PREDICTED: uncharacterized protein LOC101259237    148   4e-36   
ref|XP_003523253.1|  PREDICTED: transmembrane and TPR repeat-cont...    148   5e-36   
ref|XP_003526837.1|  PREDICTED: transmembrane and TPR repeat-cont...    148   5e-36   
ref|XP_010652867.1|  PREDICTED: uncharacterized protein LOC100254208    148   5e-36   
ref|XP_010025521.1|  PREDICTED: uncharacterized protein LOC104415...    148   6e-36   
ref|XP_008440127.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    147   6e-36   
ref|XP_004141968.1|  PREDICTED: uncharacterized protein LOC101208394    147   6e-36   
gb|KHN09558.1|  hypothetical protein glysoja_011832                     147   8e-36   
ref|NP_187560.1|  tetratricopeptide repeat domain-containing protein    147   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101400.1|  hypothetical protein L484_002458                   144   1e-35   
ref|XP_007048154.1|  Tetratricopeptide repeat-like superfamily pr...    147   1e-35   
ref|XP_004502875.1|  PREDICTED: uncharacterized protein LOC101495...    145   2e-35   
emb|CDY53183.1|  BnaA06g40620D                                          145   4e-35   
gb|KHN48602.1|  hypothetical protein glysoja_015750                     141   5e-35   
ref|XP_002530261.1|  conserved hypothetical protein                     145   5e-35   Ricinus communis
ref|XP_004164944.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   9e-35   
ref|XP_010681057.1|  PREDICTED: uncharacterized protein LOC104896066    144   1e-34   
ref|NP_568061.1|  tetratricopeptide repeat domain-containing protein    143   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437067.1|  PREDICTED: uncharacterized protein LOC104720867    144   1e-34   
ref|XP_002868907.1|  chloroplast lumen common family protein            143   1e-34   
ref|XP_009101872.1|  PREDICTED: uncharacterized protein LOC103828042    143   2e-34   
ref|XP_010446493.1|  PREDICTED: uncharacterized protein LOC104729259    143   2e-34   
ref|XP_010431919.1|  PREDICTED: uncharacterized protein LOC104716227    142   2e-34   
ref|XP_008466719.1|  PREDICTED: uncharacterized protein LOC103504062    142   3e-34   
ref|XP_010464596.1|  PREDICTED: uncharacterized protein LOC104745120    142   3e-34   
ref|XP_007205389.1|  hypothetical protein PRUPE_ppa007407mg             142   4e-34   
ref|XP_008232396.1|  PREDICTED: uncharacterized protein LOC103331539    142   6e-34   
ref|XP_007045336.1|  Prenylyltransferase superfamily protein            141   7e-34   
ref|XP_006284058.1|  hypothetical protein CARUB_v10005184mg             141   7e-34   
ref|XP_007223753.1|  hypothetical protein PRUPE_ppa010540mg             139   7e-34   
gb|KFK30511.1|  hypothetical protein AALP_AA7G271400                    141   9e-34   
ref|XP_006842190.1|  hypothetical protein AMTR_s00078p00160770          137   1e-33   
ref|XP_002306358.2|  hypothetical protein POPTR_0005s08770g             140   1e-33   Populus trichocarpa [western balsam poplar]
gb|KGN49762.1|  hypothetical protein Csa_5G114590                       139   2e-33   
ref|XP_004288112.1|  PREDICTED: uncharacterized protein LOC101294595    140   2e-33   
ref|XP_004149472.1|  PREDICTED: uncharacterized protein LOC101212982    140   2e-33   
ref|XP_008220992.1|  PREDICTED: transmembrane and TPR repeat-cont...    139   3e-33   
dbj|BAJ95417.1|  predicted protein                                      140   3e-33   
gb|EPS66599.1|  hypothetical protein M569_08177                         139   3e-33   
gb|EPS71235.1|  hypothetical protein M569_03527                         137   5e-33   
ref|XP_006411747.1|  hypothetical protein EUTSA_v10025635mg             139   6e-33   
ref|XP_003602501.1|  hypothetical protein MTR_3g095070                  138   8e-33   
dbj|BAJ90223.1|  predicted protein                                      139   9e-33   
ref|XP_011100083.1|  PREDICTED: uncharacterized protein LOC105178...    137   2e-32   
ref|XP_008340511.1|  PREDICTED: uncharacterized protein LOC103403446    137   2e-32   
emb|CDX72699.1|  BnaC07g47210D                                          137   3e-32   
ref|XP_010246008.1|  PREDICTED: uncharacterized protein LOC104589394    136   3e-32   
ref|XP_010555328.1|  PREDICTED: uncharacterized protein LOC104824851    136   3e-32   
ref|XP_009351651.1|  PREDICTED: uncharacterized protein LOC103943159    136   5e-32   
ref|XP_006298112.1|  hypothetical protein CARUB_v10014153mg             135   9e-32   
ref|XP_003568801.1|  PREDICTED: uncharacterized protein LOC100837...    136   9e-32   
gb|KHG06422.1|  Transmembrane and TPR repeat-containing 1               135   1e-31   
ref|XP_010486521.1|  PREDICTED: uncharacterized protein LOC104764...    134   2e-31   
ref|XP_002882621.1|  hypothetical protein ARALYDRAFT_341089             136   2e-31   
ref|XP_002312501.2|  hypothetical protein POPTR_0008s14270g             134   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_008389114.1|  PREDICTED: transmembrane and TPR repeat-cont...    134   2e-31   
ref|XP_004297781.1|  PREDICTED: uncharacterized protein LOC101303898    133   4e-31   
gb|EEC78638.1|  hypothetical protein OsI_18722                          134   5e-31   Oryza sativa Indica Group [Indian rice]
ref|NP_001054818.1|  Os05g0182100                                       134   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010549130.1|  PREDICTED: uncharacterized protein LOC104820397    132   7e-31   
gb|KFK28759.1|  hypothetical protein AALP_AA7G043100                    132   8e-31   
ref|XP_006406607.1|  hypothetical protein EUTSA_v10021135mg             131   1e-30   
gb|KDP23019.1|  hypothetical protein JCGZ_01682                         132   1e-30   
ref|XP_008809016.1|  PREDICTED: uncharacterized protein LOC103720851    132   1e-30   
ref|XP_008338635.1|  PREDICTED: uncharacterized protein LOC103401...    132   2e-30   
ref|XP_002439391.1|  hypothetical protein SORBIDRAFT_09g005640          131   2e-30   Sorghum bicolor [broomcorn]
ref|XP_010908520.1|  PREDICTED: uncharacterized protein LOC105034899    131   2e-30   
emb|CDX92236.1|  BnaA05g21710D                                          130   3e-30   
emb|CDY54811.1|  BnaA08g29970D                                          130   3e-30   
ref|XP_011025227.1|  PREDICTED: uncharacterized protein LOC105126151    130   3e-30   
ref|XP_008361510.1|  PREDICTED: uncharacterized protein LOC103425207    132   3e-30   
ref|XP_009336370.1|  PREDICTED: uncharacterized protein LOC103928...    131   3e-30   
ref|XP_009400311.1|  PREDICTED: uncharacterized protein LOC103984524    130   3e-30   
ref|XP_004960865.1|  PREDICTED: uncharacterized protein LOC101775089    131   5e-30   
ref|XP_010506898.1|  PREDICTED: uncharacterized protein LOC104783436    130   5e-30   
ref|XP_010043882.1|  PREDICTED: uncharacterized protein LOC104432976    129   9e-30   
ref|XP_009145892.1|  PREDICTED: uncharacterized protein LOC103869563    130   1e-29   
ref|XP_002518801.1|  conserved hypothetical protein                     129   1e-29   Ricinus communis
gb|ACG36692.1|  hypothetical protein                                    128   3e-29   Zea mays [maize]
ref|XP_010465942.1|  PREDICTED: uncharacterized protein LOC104746214    127   5e-29   
ref|XP_010487768.1|  PREDICTED: uncharacterized protein LOC104765704    127   7e-29   
ref|NP_566609.1|  protein prenylyltransferase superfamily protein       126   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299864.1|  hypothetical protein CARUB_v10016068mg             126   1e-28   
ref|NP_001131681.1|  uncharacterized protein LOC100193041               127   1e-28   Zea mays [maize]
emb|CDP07952.1|  unnamed protein product                                126   1e-28   
ref|XP_002885256.1|  tetratricopeptide repeat-containing protein        125   2e-28   
ref|XP_003631345.1|  PREDICTED: uncharacterized protein LOC100852583    125   2e-28   
gb|EEE62561.1|  hypothetical protein OsJ_17360                          127   2e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KFK38333.1|  hypothetical protein AALP_AA3G100600                    125   2e-28   
ref|XP_009623000.1|  PREDICTED: uncharacterized protein LOC104114300    125   2e-28   
ref|XP_009791853.1|  PREDICTED: uncharacterized protein LOC104239016    124   3e-28   
ref|XP_006580644.1|  PREDICTED: stress-induced-phosphoprotein 1-like    120   4e-28   
ref|XP_003524830.1|  PREDICTED: uncharacterized protein LOC100808986    122   9e-28   
ref|XP_001756346.1|  predicted protein                                  122   9e-28   
ref|XP_010473601.1|  PREDICTED: uncharacterized protein LOC104752...    123   1e-27   
ref|XP_010672029.1|  PREDICTED: uncharacterized protein LOC104888692    122   3e-27   
ref|XP_011090677.1|  PREDICTED: uncharacterized protein LOC105171306    121   6e-27   
ref|XP_006847993.1|  hypothetical protein AMTR_s00029p00161320          120   8e-27   
ref|XP_011021679.1|  PREDICTED: uncharacterized protein LOC105123685    120   1e-26   
emb|CAN72842.1|  hypothetical protein VITISV_000983                     122   1e-26   Vitis vinifera
ref|XP_002314740.2|  tetratricopeptide repeat-containing family p...    120   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010086922.1|  hypothetical protein L484_005182                   121   2e-26   
ref|XP_003531119.1|  PREDICTED: uncharacterized protein LOC100780000    118   3e-26   
ref|XP_004504629.1|  PREDICTED: uncharacterized protein LOC101499708    118   5e-26   
ref|XP_006348542.1|  PREDICTED: uncharacterized protein LOC102603168    118   5e-26   
ref|XP_004228536.1|  PREDICTED: uncharacterized protein LOC101245871    118   5e-26   
ref|XP_006470900.1|  PREDICTED: uncharacterized protein LOC102617544    118   6e-26   
ref|XP_011025582.1|  PREDICTED: uncharacterized protein LOC105126...    117   9e-26   
ref|XP_006420680.1|  hypothetical protein CICLE_v10005482mg             116   2e-25   
ref|XP_007158849.1|  hypothetical protein PHAVU_002G187000g             116   3e-25   
emb|CAB44682.1|  putative protein                                       110   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486522.1|  PREDICTED: uncharacterized protein LOC104764...    109   5e-23   
gb|EPS65396.1|  hypothetical protein M569_09382                         110   5e-23   
ref|XP_007137586.1|  hypothetical protein PHAVU_009G138700g             106   5e-22   
gb|ABR17131.1|  unknown                                                 108   5e-22   Picea sitchensis
ref|XP_006388357.1|  hypothetical protein POPTR_0211s00200g             105   6e-22   
ref|XP_007048155.1|  Tetratricopeptide repeat-like superfamily pr...    106   6e-22   
ref|XP_010025522.1|  PREDICTED: uncharacterized protein LOC104415...    105   3e-21   
ref|XP_010473672.1|  PREDICTED: uncharacterized protein LOC104752...    101   3e-20   
ref|XP_008338636.1|  PREDICTED: uncharacterized protein LOC103401...    100   6e-20   
ref|XP_006655059.1|  PREDICTED: uncharacterized protein LOC102711534  98.6    7e-19   
ref|XP_010098547.1|  hypothetical protein L484_025987                 94.0    2e-18   
ref|XP_002965387.1|  hypothetical protein SELMODRAFT_406722           94.7    1e-17   
ref|XP_002977234.1|  hypothetical protein SELMODRAFT_417125           94.4    1e-17   
ref|WP_015174664.1|  Tetratricopeptide TPR_2 repeat-containing pr...  91.7    6e-17   
gb|KDO57815.1|  hypothetical protein CISIN_1g031170mg                 89.4    6e-17   
ref|WP_006633208.1|  hypothetical protein                             90.9    1e-16   
ref|XP_009336371.1|  PREDICTED: uncharacterized protein LOC103928...  90.1    2e-16   
ref|XP_002322835.1|  chloroplast lumen common family protein          83.6    1e-15   Populus trichocarpa [western balsam poplar]
emb|CDP12694.1|  unnamed protein product                              84.3    2e-15   
ref|WP_006104328.1|  hypothetical protein                             87.0    2e-15   
gb|KFK23283.1|  hypothetical protein AALP_AAs68826U000100             84.7    6e-15   
ref|WP_024124501.1|  photosynthetic pigment/protein complex forma...  84.0    2e-14   
ref|WP_011611980.1|  hypothetical protein                             84.0    2e-14   
ref|WP_015202266.1|  hypothetical protein                             83.2    3e-14   
ref|WP_015194118.1|  Tetratricopeptide TPR_1 repeat-containing pr...  82.4    5e-14   
ref|WP_027268841.1|  hypothetical protein                             82.4    7e-14   
gb|KCW62223.1|  hypothetical protein EUGRSUZ_H04883                   81.3    2e-13   
ref|WP_015117434.1|  Tfp pilus assembly protein PilF                  80.9    2e-13   
ref|WP_015150158.1|  hypothetical protein                             80.9    2e-13   
ref|WP_035493676.1|  Tfp pilus assembly protein PilF                  80.9    2e-13   
gb|EMT27160.1|  hypothetical protein F775_01349                       82.8    2e-13   
ref|WP_011057037.1|  hypothetical protein                             79.7    4e-13   
ref|WP_013320375.1|  hypothetical protein                             79.0    8e-13   
ref|WP_012165900.1|  hypothetical protein                             78.2    2e-12   
ref|WP_017715587.1|  hypothetical protein                             78.2    2e-12   
ref|WP_010475212.1|  hypothetical protein                             78.2    2e-12   
ref|WP_015188769.1|  tetratricopeptide repeat-containing protein      77.0    3e-12   
gb|EMS55895.1|  hypothetical protein TRIUR3_10581                     76.6    4e-12   
ref|WP_017714011.1|  hypothetical protein                             77.4    4e-12   
ref|WP_009555784.1|  hypothetical protein                             76.3    6e-12   
ref|XP_007048156.1|  Tetratricopeptide repeat-like superfamily pr...  75.9    7e-12   
ref|WP_008179297.1|  hypothetical protein                             76.3    8e-12   
ref|WP_015124171.1|  hypothetical protein                             75.9    1e-11   
ref|WP_015227337.1|  hypothetical protein                             75.5    1e-11   
ref|WP_006616431.1|  hypothetical protein                             75.5    1e-11   
ref|WP_006625256.1|  MULTISPECIES: hypothetical protein               74.3    3e-11   
ref|WP_039727178.1|  Tfp pilus assembly protein PilF                  74.3    3e-11   
gb|AIE74817.1|  hypothetical protein D082_22890                       74.3    3e-11   
ref|WP_008051324.1|  hypothetical protein                             74.3    3e-11   
ref|XP_006379807.1|  hypothetical protein POPTR_0008s14255g           72.0    3e-11   
ref|XP_010100599.1|  hypothetical protein L484_011530                 71.2    4e-11   
ref|WP_015185846.1|  hypothetical protein                             74.3    5e-11   
ref|WP_015144160.1|  hypothetical protein                             73.2    5e-11   
ref|WP_016879352.1|  hypothetical protein                             73.2    7e-11   
ref|WP_010873081.1|  hypothetical protein                             72.8    1e-10   
ref|WP_012626362.1|  hypothetical protein                             72.4    2e-10   
ref|WP_002767209.1|  hypothetical protein                             71.2    2e-10   
ref|WP_015229487.1|  hypothetical protein                             71.6    2e-10   
ref|WP_017288632.1|  hypothetical protein                             72.0    2e-10   
ref|WP_002789236.1|  hypothetical protein                             71.2    2e-10   
gb|KHN25946.1|  hypothetical protein glysoja_018800                   68.2    2e-10   
ref|WP_016859818.1|  hypothetical protein                             70.9    3e-10   
ref|WP_002780399.1|  hypothetical protein                             70.9    3e-10   
dbj|GAL91957.1|  TPR repeat protein                                   70.5    4e-10   
ref|WP_009787646.1|  hypothetical protein                             70.9    4e-10   
ref|WP_028085210.1|  hypothetical protein                             70.5    5e-10   
gb|KDO50466.1|  hypothetical protein CISIN_1g026642mg                 69.7    5e-10   
ref|WP_026736515.1|  hypothetical protein                             70.5    5e-10   
ref|WP_016867020.1|  hypothetical protein                             70.5    6e-10   
ref|WP_007353693.1|  MULTISPECIES: hypothetical protein               70.5    6e-10   
ref|WP_035998823.1|  Tfp pilus assembly protein PilF                  70.1    8e-10   
ref|WP_028090346.1|  hypothetical protein                             70.1    8e-10   
ref|WP_009631970.1|  tetratricopeptide repeat protein                 70.1    9e-10   
ref|WP_017313062.1|  hypothetical protein                             69.7    9e-10   
ref|WP_023069266.1|  TPR repeat family protein                        69.7    1e-09   
ref|WP_004268061.1|  hypothetical protein                             69.3    1e-09   
ref|WP_026719966.1|  hypothetical protein                             68.9    2e-09   
ref|WP_015112833.1|  hypothetical protein                             68.9    2e-09   
ref|WP_026079618.1|  hypothetical protein                             68.9    2e-09   
ref|WP_006194790.1|  hypothetical protein                             68.9    2e-09   
ref|WP_012409290.1|  hypothetical protein                             69.3    2e-09   
emb|CDY53407.1|  BnaCnng25100D                                        67.0    2e-09   
ref|WP_035987193.1|  Tfp pilus assembly protein PilF                  68.6    2e-09   
gb|AHJ27851.1|  TPR repeat protein                                    67.8    2e-09   
ref|WP_029634935.1|  hypothetical protein [                           68.2    3e-09   
ref|WP_009459442.1|  MULTISPECIES: hypothetical protein               67.8    3e-09   
ref|WP_002792755.1|  hypothetical protein                             67.4    4e-09   
ref|XP_006603357.1|  PREDICTED: uncharacterized protein LOC102668084  67.0    5e-09   
ref|WP_015214783.1|  Tetratricopeptide TPR_1 repeat-containing pr...  67.8    6e-09   
ref|WP_012265638.1|  hypothetical protein                             67.0    6e-09   
ref|WP_026101575.1|  hypothetical protein                             67.4    6e-09   
ref|WP_002757059.1|  hypothetical protein                             67.0    6e-09   
ref|WP_008205883.1|  hypothetical protein                             67.0    7e-09   
ref|WP_006514046.1|  hypothetical protein                             67.8    7e-09   
emb|CDX73544.1|  BnaC08g24590D                                        66.6    7e-09   
ref|WP_015129225.1|  hypothetical protein                             67.4    7e-09   
ref|WP_038083497.1|  Tfp pilus assembly protein PilF                  67.0    8e-09   
ref|WP_002739366.1|  tetratricopeptide repeat family protein          66.2    1e-08   
ref|WP_015138618.1|  Tfp pilus assembly protein PilF                  66.6    1e-08   
emb|CDX95523.1|  BnaC01g34150D                                        63.2    1e-08   
ref|WP_002799055.1|  hypothetical protein                             66.2    1e-08   
ref|WP_009543988.1|  MULTISPECIES: hypothetical protein               66.2    1e-08   
gb|KHN09918.1|  hypothetical protein glysoja_046058                   63.9    2e-08   
gb|KFK23112.1|  hypothetical protein AALP_AAs53647U000100             63.5    2e-08   
ref|WP_017655088.1|  hypothetical protein                             66.2    2e-08   
emb|CAO90730.1|  unnamed protein product                              65.5    2e-08   
ref|WP_026082566.1|  hypothetical protein                             65.5    3e-08   
ref|WP_026135220.1|  hypothetical protein                             64.7    4e-08   
ref|WP_039742037.1|  Tfp pilus assembly protein PilF                  64.7    4e-08   
ref|WP_023075990.1|  tfp pilus assembly protein                       65.1    4e-08   
ref|WP_013191674.1|  hypothetical protein                             64.7    4e-08   
ref|WP_015173401.1|  hypothetical protein                             63.5    1e-07   
ref|WP_018396891.1|  hypothetical protein                             63.5    1e-07   
ref|WP_015133279.1|  hypothetical protein                             63.5    1e-07   
gb|KEI68932.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...  63.5    1e-07   
ref|WP_002755487.1|  hypothetical protein                             63.2    1e-07   
ref|WP_015208969.1|  Tfp pilus assembly protein PilF                  63.9    1e-07   
ref|WP_002778188.1|  hypothetical protein                             63.2    1e-07   
ref|WP_024970600.1|  hypothetical protein                             63.2    1e-07   
ref|WP_015200027.1|  hypothetical protein                             63.2    1e-07   
ref|XP_003074616.1|  unnamed protein product                          63.9    2e-07   
ref|WP_036535123.1|  Tfp pilus assembly protein PilF                  62.8    2e-07   
ref|WP_036798976.1|  cellulose synthase subunit BcsC                  62.8    2e-07   
emb|CDN14946.1|  FOG: TPR repeat                                      62.4    2e-07   
ref|WP_038083499.1|  Tfp pilus assembly protein PilF                  61.6    2e-07   
ref|XP_002500489.1|  predicted protein                                63.5    3e-07   
ref|WP_015162878.1|  hypothetical protein                             62.0    3e-07   
ref|WP_016514685.1|  cellulose synthase subunit BcsC                  62.0    3e-07   
ref|WP_037222241.1|  Tfp pilus assembly protein PilF                  62.0    4e-07   
emb|CEF96866.1|  Tetratricopeptide repeat                             62.8    4e-07   
ref|WP_009627878.1|  Tetratricopeptide TPR_1 repeat-containing pr...  61.6    5e-07   
ref|WP_015956446.1|  hypothetical protein                             61.2    5e-07   
ref|XP_010231642.1|  PREDICTED: uncharacterized protein LOC100837...  61.6    7e-07   
ref|WP_026787596.1|  MULTISPECIES: hypothetical protein               61.2    7e-07   
ref|WP_006279106.1|  hypothetical protein                             60.5    9e-07   
ref|WP_038016595.1|  Tfp pilus assembly protein PilF                  60.5    1e-06   
gb|EDX87468.1|  tetratricopeptide repeat domain protein               60.1    2e-06   
ref|WP_026104036.1|  hypothetical protein                             59.7    2e-06   
gb|EHJ13142.1|  hypothetical protein CWATWH0003_2141                  58.5    3e-06   
ref|WP_010995868.1|  hypothetical protein                             58.9    4e-06   
ref|WP_011317537.1|  hypothetical protein                             58.9    4e-06   
ref|WP_009343860.1|  hypothetical protein                             58.5    4e-06   
ref|WP_021833797.1|  hypothetical protein                             58.2    5e-06   
gb|EMT27161.1|  hypothetical protein F775_01350                       55.8    7e-06   
ref|WP_010880520.1|  hypothetical protein                             58.9    9e-06   
ref|WP_019491167.1|  hypothetical protein                             57.4    1e-05   
ref|WP_008273857.1|  hypothetical protein                             57.4    1e-05   
ref|WP_006510599.1|  hypothetical protein                             56.6    2e-05   
ref|WP_022608013.1|  hypothetical protein                             57.4    2e-05   
ref|WP_008227509.1|  TPR repeat                                       56.6    2e-05   
ref|WP_027404249.1|  hypothetical protein                             56.6    2e-05   
ref|WP_006530766.1|  hypothetical protein                             55.8    2e-05   
ref|WP_008234463.1|  TPR repeat                                       55.8    3e-05   
ref|WP_017327901.1|  hypothetical protein                             55.5    5e-05   
ref|WP_035122125.1|  hypothetical protein                             56.6    6e-05   
ref|WP_039202368.1|  Tfp pilus assembly protein PilF                  55.5    6e-05   
ref|NP_001142930.1|  uncharacterized protein LOC100275367             54.3    6e-05   
ref|WP_015164120.1|  hypothetical protein                             54.7    1e-04   
emb|CBX30770.1|  hypothetical protein N47_E42820                      55.5    1e-04   
ref|XP_001415991.1|  predicted protein                                54.7    1e-04   
gb|AFW72825.1|  hypothetical protein ZEAMMB73_712860                  53.1    1e-04   
ref|WP_036487794.1|  cellulose synthase subunit BcsC                  53.5    2e-04   
ref|NP_001159009.1|  uncharacterized protein LOC100304002             53.1    2e-04   
ref|WP_014426589.1|  TPR repeat protein                               54.7    2e-04   
ref|XP_004953467.1|  PREDICTED: uncharacterized protein LOC101765449  52.4    3e-04   
ref|WP_019502202.1|  hypothetical protein                             52.8    4e-04   
ref|XP_002454468.1|  hypothetical protein SORBIDRAFT_04g031670        52.0    4e-04   



>ref|XP_006339040.1| PREDICTED: uncharacterized protein LOC102599314 isoform X1 [Solanum 
tuberosum]
 ref|XP_006339041.1| PREDICTED: uncharacterized protein LOC102599314 isoform X2 [Solanum 
tuberosum]
 ref|XP_006339042.1| PREDICTED: uncharacterized protein LOC102599314 isoform X3 [Solanum 
tuberosum]
Length=344

 Score =   291 bits (744),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 167/358 (47%), Positives = 232/358 (65%), Gaps = 37/358 (10%)
 Frame = +2

Query  134   MNAFTHFSAKP---NLNFLPSLNNHRPVLVRPLSSLSFTTQ--PQHVPIKASSSFSPEFS  298
             MN    FSAK    +     SL++HRP+L +P SSL F T   P  +PIKASSS S  F 
Sbjct  1     MNTINPFSAKTIQIDKKINHSLHHHRPILSKPFSSLCFRTPLFPSFLPIKASSSLS--FQ  58

Query  299   VPKPAKQETAKS---------SPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRV  451
              P+  K    ++          P I+ T+T +                   FL RF    
Sbjct  59    NPETPKSINPQNPFSVLLSVLKPTIIATITATSL-----------------FLTRFYFNP  101

Query  452   NP----SIaapvsapataeaavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGD  619
              P    S+++P +  A  + + SD E EKAL+  L +NPNDV+AL++L+E +I+N+ + D
Sbjct  102   KPAFAVSLSSPHTTEANVKDSASDEENEKALESFLLSNPNDVDALRNLMEIQIKNRKLVD  161

Query  620   AISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAV  799
             AIS +++L+ELEP+ETEWPLL++HL+V  GE E A+ GF+EIL K+P  VEAYHGL+   
Sbjct  162   AISTIDKLIELEPNETEWPLLKSHLYVYNGELELAKIGFSEILKKDPFRVEAYHGLVMVA  221

Query  800   SEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELV  979
             S++D VEELK I++++ + +K+C  E KKG++RDF LLLAQI  IE  YE+ALKVYQELV
Sbjct  222   SQEDSVEELKEIKKKVEEGIKMCDKESKKGEMRDFMLLLAQIWVIESKYEDALKVYQELV  281

Query  980   KEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             KEEP DFRPYL Q I++T+L K  EA+K F+ YR L+P+GHPY+ + D+ +IA+KLF+
Sbjct  282   KEEPKDFRPYLCQGIIHTLLRKKDEAEKSFEEYRRLVPQGHPYARYFDDNLIATKLFS  339



>ref|XP_009781876.1| PREDICTED: uncharacterized protein LOC104230707 [Nicotiana sylvestris]
Length=350

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 221/337 (66%), Gaps = 32/337 (9%)
 Frame = +2

Query  188   LNNHRPVLVRPLSSLSFTTQP-----QHVPIKASSSFSPEFSVPKPAKQETAKS----SP  340
             L+N RP+  +P+S LSF T P         IKASSS +P+  +P+   +++        P
Sbjct  19    LHNQRPIYAKPISCLSFRTPPPPFSTSFFSIKASSSQNPKPIIPQNPNEKSQNPFSFLKP  78

Query  341   GILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaa------pvsapataeaa  502
              ++ T+T +                      RF     PSI+A        +       A
Sbjct  79    TLVATVTATAL-----------------IFSRFYFFPKPSISAQNFAPPAAAVETDVREA  121

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
             VS+ E E+A++E L +NP+DVEAL++L+E KI+N+ I DAISI+++L+E+EP+E+EWPL+
Sbjct  122   VSEEEKERAIEEHLVSNPDDVEALRNLMEIKIKNKKILDAISIIDKLIEVEPNESEWPLM  181

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMK  862
             ++HL+V  GE E A+ GFNEIL K+P  VEAYHGL+ A S+D+ + +LKGIE+ I + MK
Sbjct  182   KSHLYVNIGEVELAKVGFNEILQKDPFRVEAYHGLVMAASQDESIADLKGIEKMIEEGMK  241

Query  863   LCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLG  1042
             LCK E+KK  LRDFKLLLAQIR IE  YE+ALKVY ELVKEEP DFRPYL Q I+YT+L 
Sbjct  242   LCKKENKKSDLRDFKLLLAQIRVIEGKYEDALKVYGELVKEEPRDFRPYLCQGIIYTLLR  301

Query  1043  KDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K  EA+K F+ YR L+P+GHPY+ + D  MIA+K+FA
Sbjct  302   KSSEAEKCFEKYRRLVPQGHPYARYFDENMIATKVFA  338



>ref|XP_011094800.1| PREDICTED: stress-induced-phosphoprotein 1-like [Sesamum indicum]
Length=360

 Score =   277 bits (709),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 232/351 (66%), Gaps = 14/351 (4%)
 Frame = +2

Query  134   MNAFTHFSAKP---NLNFLPSLNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVP  304
             MN     +AKP   +L  +PSL+ +RP  ++P SSLSF   P  +  +  S    + S+ 
Sbjct  1     MNTLNLVAAKPTGGHLPLIPSLHPYRPSFLKPFSSLSFRFPPPPL--RPLSLSPTKASLQ  58

Query  305   KPAKQETAKSSPGILETLTQSHFQTP----FSCavvatvaaaavFLGRFSLRVNPSIaap  472
              P  + T+ + P + +    +   TP        VV T+ AAA+F   F     P IA P
Sbjct  59    DPNGKNTS-TPPELFKFQVSNQNATPGISSLRATVVTTITAAALFFTGFGFNFKPCIAEP  117

Query  473   v----sapataeaavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNR  640
             +    +     + A+ D E EK+L+E L +NP DV+ L++L+E K++++ I +AI I+++
Sbjct  118   ISPPPTVETAEKDAIVDEEREKSLEEHLLSNPCDVDGLKNLMEIKVKSKKIPEAIEILDK  177

Query  641   LMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVE  820
             LMELEP E EWP++R HL+   GE E A+ GFNE+L K+P  VEAYHGL+T  S+++  +
Sbjct  178   LMELEPEEVEWPMMRAHLYAYNGELELAKNGFNELLMKDPFRVEAYHGLVTVASQEESSK  237

Query  821   ELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDF  1000
             EL  IE+RI +AMKLCK E+KK  LRDFKLLLAQIR +E  Y+EALKVYQELVKEEP DF
Sbjct  238   ELGDIEKRIEEAMKLCKKENKKSDLRDFKLLLAQIRVLEGRYDEALKVYQELVKEEPRDF  297

Query  1001  RPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             RPYL Q I+YT+L K+ EA+K+F+ YR L+P+GHPY+S+ D+ MIA+KLFA
Sbjct  298   RPYLCQGIIYTLLRKNGEAEKNFEKYRRLVPKGHPYASYFDDNMIATKLFA  348



>ref|XP_009609524.1| PREDICTED: uncharacterized protein LOC104103331 [Nicotiana tomentosiformis]
 ref|XP_009609525.1| PREDICTED: uncharacterized protein LOC104103331 [Nicotiana tomentosiformis]
 ref|XP_009609526.1| PREDICTED: uncharacterized protein LOC104103331 [Nicotiana tomentosiformis]
Length=351

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 226/338 (67%), Gaps = 32/338 (9%)
 Frame = +2

Query  188   LNNH--RPVLVRPLSSLSFTTQP-----QHVPIKASSSFSPEFSVPKPAKQETAKSSPGI  346
              N+H  RP+  +P+S LSF T P         +KASSS +P+  +P+   +++       
Sbjct  18    FNHHFNRPIYAKPISCLSFRTPPPPFSTSFFSMKASSSQNPKPLIPQNPNEKS-------  70

Query  347   LETLTQSHFQTPFS---CavvatvaaaavFLGRFSLRVNPSIaap------vsapataea  499
                      Q PFS     +VATV A A+   RF     PSI+A        +       
Sbjct  71    ---------QNPFSFLKLTLVATVTATALIFSRFYFFPKPSISAQNFAPPPAAVETDTRE  121

Query  500   avsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPL  679
             AVS+ E E+A++E L +NP+DV AL++L+E KI+N+ + DAI I+++L+E+EP+E+EWPL
Sbjct  122   AVSEEEKERAIEEHLVSNPDDVVALRNLMEIKIKNKKMLDAIGIIDKLIEVEPNESEWPL  181

Query  680   LRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAM  859
             +++HL+V  GE E A+ GFNEIL  +P  VEAYHGL+ AVS+D+ +E+LKGIE++I + M
Sbjct  182   MKSHLYVNIGEVELAKVGFNEILKNDPFRVEAYHGLVMAVSQDESIEDLKGIEKKIEQGM  241

Query  860   KLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTML  1039
             K+CK E+KK  LRDFKLLLAQIR I+  YE+ALKVY ELVKEEP DFRPYL Q I+YT+L
Sbjct  242   KMCKKENKKSDLRDFKLLLAQIRVIQGKYEDALKVYGELVKEEPRDFRPYLCQGIIYTLL  301

Query  1040  GKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              K  EA+K F+ YR L+P+GHPY+ + D  MIA+K+FA
Sbjct  302   RKSNEAEKCFEKYRRLVPQGHPYARYFDENMIATKVFA  339



>ref|XP_004246742.1| PREDICTED: uncharacterized protein LOC101245980 [Solanum lycopersicum]
Length=354

 Score =   275 bits (704),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 164/346 (47%), Positives = 220/346 (64%), Gaps = 10/346 (3%)
 Frame = +2

Query  134   MNAFTHFSAKPNLNFLPSLNNHRPVLVRPLSSLSFTTQPQHV---PIKASSSFSPEF---  295
             M     F ++ N  F   L+NHRP+  + +S L+F T P       IKA S  S      
Sbjct  1     MATLNPFGSRTN-PFQKKLHNHRPIYAKSISCLTFRTSPPPFYPSTIKACSFSSSSSQNS  59

Query  296   SVPKPAKQETAKSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapv  475
              +PKP   +T    P  L +  +    T  +     T+  A  F+       N +     
Sbjct  60    KIPKPLIPQTPNEQPHNLFSFVKP---TLIATVTATTLLFARYFVFPKPALANQAFTPTA  116

Query  476   sapataeaavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELE  655
                     AVS+ E E+A++E L  NPNDVEAL++L+E +I+N+ I DAISI++RL+ELE
Sbjct  117   METDVVRDAVSEEERERAIEEHLVNNPNDVEALRNLMEIRIKNKKILDAISIIDRLIELE  176

Query  656   PSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGI  835
             P+E EWPLL++HL+V  GE E A+ GFNEIL K+P  VEAYHGL+ A S+D+ ++EL  I
Sbjct  177   PNENEWPLLKSHLYVNFGEIELAKVGFNEILKKDPFRVEAYHGLVMAASQDESIDELMEI  236

Query  836   EERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLY  1015
             E++I + +KLCK E+KK  LRDFKLLLAQIR IE  YE+ALKVYQELVKEEP DFRPYL 
Sbjct  237   EKKIEEGIKLCKKENKKTDLRDFKLLLAQIRVIEGKYEDALKVYQELVKEEPRDFRPYLC  296

Query  1016  QAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             Q I+YT++ K  EA+K F+ YR L+P+GHPY+ + D  MIA+K+FA
Sbjct  297   QGIIYTLMRKTNEAEKCFEKYRRLVPQGHPYARYFDENMIATKVFA  342



>emb|CDP06661.1| unnamed protein product [Coffea canephora]
Length=379

 Score =   267 bits (683),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 168/211 (80%), Gaps = 0/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EKA++E L ++PNDVEAL++L+E +I+N+ + +AI IV +L+ELEP+E EWPL+++HL V
Sbjct  157   EKAIEEHLLSHPNDVEALRNLMEIRIKNRKMLEAIMIVEKLIELEPNEVEWPLMKSHLHV  216

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +GE E A+ GF+ I+SK+P  VEAYHGL+ A S+DD  EELK IE +I  AMKLCK E+
Sbjct  217   YSGELEFAKNGFSGIISKDPFRVEAYHGLVMAASQDDSTEELKDIERKIEDAMKLCKKEN  276

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  LRDFKLLLAQIR IE  Y++ALK YQ+LV+EEP DFRPYL Q I+YT+L K  EA+
Sbjct  277   KKSDLRDFKLLLAQIRVIEGKYDDALKFYQDLVREEPRDFRPYLCQGIIYTLLRKKDEAE  336

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ YR L+P+GHPY+ + ++ MIA+K+FA
Sbjct  337   KSFEKYRRLVPKGHPYARYFEDNMIATKVFA  367



>ref|XP_006345667.1| PREDICTED: uncharacterized protein LOC102590982 [Solanum tuberosum]
Length=350

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 215/337 (64%), Gaps = 23/337 (7%)
 Frame = +2

Query  176   FLPSLNNHRPVLVRPLSSLSFTTQPQHV---PIKASSSFSPEFSVPKPAKQETAKSSPGI  346
             F   L++HRP+  +P+S L+F T P       IKA SS S    +PKP   +T    P  
Sbjct  14    FQKQLHHHRPIYAKPISCLTFRTSPPPFYPSTIKAYSS-SQNSKIPKPLIPQTPNEQP--  70

Query  347   LETLTQSHFQTPFSCavvatvaaaavFLGRFSLRV--------NPSIaapvsapataeaa  502
                        PFS      +A        F+           N +  +          A
Sbjct  71    ---------HNPFSFVKPTLIATITATTLLFARYFVFPKPALSNQAFTSSAMETDVVRDA  121

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
             +S+ E E+ ++E L  +P+DVEAL+ L+E +I+N+ + DAISI++RL+ELEP+ETEWPLL
Sbjct  122   ISEEERERTIEEHLVTHPDDVEALRILMEIRIKNKKMLDAISIIDRLIELEPNETEWPLL  181

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMK  862
             ++HL+V +GE E A+ GFNEIL K+P  VEAYHGL+ A S+D+ +EEL  IE+++ + +K
Sbjct  182   KSHLYVNSGEIELAKVGFNEILKKDPFRVEAYHGLVMAASQDESIEELAEIEKKVEEGIK  241

Query  863   LCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLG  1042
             LCK E KK  LRDFKLLLAQIR IE  YE+ALKVYQEL+KEEP DFRPYL Q I+YT+L 
Sbjct  242   LCKKEKKKSDLRDFKLLLAQIRVIEGKYEDALKVYQELIKEEPRDFRPYLCQGIIYTLLR  301

Query  1043  KDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K+ EA+K F+ YR L+P+GHPY+ + D  MIA+K+FA
Sbjct  302   KNNEAEKCFEKYRRLVPQGHPYARYFDENMIATKVFA  338



>ref|XP_010670016.1| PREDICTED: uncharacterized protein LOC104887120 [Beta vulgaris 
subsp. vulgaris]
Length=350

 Score =   256 bits (654),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 224/352 (64%), Gaps = 28/352 (8%)
 Frame = +2

Query  134   MNAFTHFSAK-PNLNFLPSLNNH-RPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPK  307
             M + T  + K P  +   SL  H RP    P+SS+SF TQ               FS P 
Sbjct  1     MESLTKLNYKQPQHSLTFSLRYHNRPSFSTPISSISFKTQ---------------FSRPF  45

Query  308   PAKQETAKSSPGILETLTQSHFQTPFSCavv---atvaaaavFLGRF------SLRVNPS  460
             P K  ++ SS   L++ T+   + PFS         VA+ A+F   F      + R  P+
Sbjct  46    PLKIRSSSSSNSPLKSSTKPKTENPFSLLKTPLTIAVASTAIFFSVFGQKHHSAARAEPT  105

Query  461   IaapvsapataeaavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNR  640
              +  +      E  VS+ E EK ++E LA+NP+DVE L+SL+E+KI+N+ +G+A+ ++NR
Sbjct  106   -SPAMVEEREEEDVVSNEEREKKVEEFLASNPDDVEGLKSLMEAKIKNKKLGEAVEVLNR  164

Query  641   LMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQV-  817
             L+ELEP + EWPLLR H++   GE E A+ GF EI++KEPL VEA+HGL+ AVS+ ++  
Sbjct  165   LIELEPDDGEWPLLRCHMYSYMGESEKAKSGFEEIIAKEPLRVEAFHGLVMAVSQGEKGG  224

Query  818   EELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTD  997
             +EL+ + +R ++AM+ C+ E K  ++RDFKLL+AQIR IE +Y EALKVYQELVK+EP D
Sbjct  225   KELEEVTKRTVEAMERCRREKKNDEMRDFKLLIAQIRVIEGNYMEALKVYQELVKDEPRD  284

Query  998   FRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             FRPYL Q I+YT+L K  EA+K F  Y+ L+P+GHPY+ F D  M+A+K+F+
Sbjct  285   FRPYLCQGIIYTLLRKKDEAQKQFDKYKRLVPKGHPYARFFDENMLATKVFS  336



>gb|EYU41672.1| hypothetical protein MIMGU_mgv1a008905mg [Erythranthe guttata]
Length=359

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  548   ANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETAR  727
             +NP++V+ L++L+E+KI+++ + +AI I+++L+ELEP E EWP+++ HL+   G FE+A+
Sbjct  146   SNPDNVDVLKNLMEAKIKSRKLPEAIEIMDKLIELEPDEVEWPMMKAHLYAYDGNFESAK  205

Query  728   RGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFK  907
              GFNE+L K+P  VEAYHGL+T  S+++  E+L  IE R+ +AMKLCK E+K   LRDFK
Sbjct  206   NGFNELLEKDPARVEAYHGLVTVASQEESSEDLVNIETRVEEAMKLCKEENKGSDLRDFK  265

Query  908   LLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYREL  1087
             LL+AQI+ ++ +YE+AL VYQ+LVKEEP DFRPYL Q I+YT+L K+ EA+K+F+ YR L
Sbjct  266   LLIAQIKVLDGNYEDALIVYQDLVKEEPRDFRPYLCQGIIYTLLKKNGEAEKNFEKYRRL  325

Query  1088  LPEGHPYSSFLDNTMIASKLFA  1153
             +P+GHPY+S+ D+ MIA+KLFA
Sbjct  326   VPKGHPYASYFDDNMIATKLFA  347



>ref|XP_010047317.1| PREDICTED: uncharacterized protein LOC104436284 [Eucalyptus grandis]
 gb|KCW88898.1| hypothetical protein EUGRSUZ_A01225 [Eucalyptus grandis]
Length=343

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 159/210 (76%), Gaps = 2/210 (1%)
 Frame = +2

Query  524   KALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVL  703
             +A++E L+   +DVEAL+SL+E+KI+++ + +AI I+ RL+ELEP E EWPLL+ +++  
Sbjct  124   RAIEEHLSQYGDDVEALRSLMEAKIKSRKLQEAIGILGRLIELEPEEREWPLLKANIYSY  183

Query  704   TGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             +GEFE+A+R F EIL K+PL VEAYHGL+ A SE    +ELK + ERI  AM+ CK E K
Sbjct  184   SGEFESAKRTFEEILDKDPLRVEAYHGLVMAASEAG--DELKELLERIKVAMQRCKKEKK  241

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
             K ++RDFKLL+AQ+R IE  Y EAL VYQELVKEEP DFRPYL Q I+YT+L K  EA+K
Sbjct  242   KSEVRDFKLLVAQVRVIEGKYNEALSVYQELVKEEPRDFRPYLCQGILYTLLRKQDEAEK  301

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F+ YR L+P+ HPY+ + D+ M A+K FA
Sbjct  302   QFKQYRRLVPKNHPYAEYFDDNMFATKFFA  331



>ref|XP_002277967.1| PREDICTED: uncharacterized protein LOC100267054 [Vitis vinifera]
Length=351

 Score =   243 bits (620),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ ++E + ++P+DVE L+SL+E KI+N+ + +A+ ++ RL++LEP + EWPLL+ HL+ 
Sbjct  129   ERTVEEYVESHPDDVEGLKSLMEVKIKNRKLQEAVDVIERLIQLEPDDKEWPLLKAHLYS  188

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +GE E A+ GF EILS  PL VEAYHGL+ AVS+ D  +EL  + +RI  AM+ CK E 
Sbjct  189   YSGESELAKLGFEEILSANPLTVEAYHGLVMAVSQSDSGDELNQVLKRIEAAMERCKKEK  248

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  LRDFKLL+AQIR IE  Y +ALKVYQELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  249   KKEDLRDFKLLVAQIRVIEGKYNDALKVYQELVKEEPRDFRPYLCQGIIYTLLRKKDEAE  308

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K FQ YR L+P+GHPY+ + D+ MIA+++F+
Sbjct  309   KQFQKYRRLVPKGHPYARYFDDNMIATRVFS  339



>gb|EPS58056.1| hypothetical protein M569_16759 [Genlisea aurea]
Length=357

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/325 (43%), Positives = 212/325 (65%), Gaps = 5/325 (2%)
 Frame = +2

Query  194   NHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSSPGILET-LTQSH  370
             ++RP   +PLSSL F   P    ++ S+  S   S  + A +    S   + E  ++ S 
Sbjct  21    SNRPFCSKPLSSLCFRFSPPPRSLQLSAKASLGDSSHETANRRRNGSELHVSERPVSYSP  80

Query  371   FQTPFSCavvatvaaaavFLGRFSLRVNP----SIaapvsapataeaavsdaetEKALQE  538
                      V  VA AA+F   F L +NP    + ++P +A    E +V   ETEK L++
Sbjct  81    ISASLKAIAVTAVAGAAIFFSGFGLSLNPPPALANSSPPTAERAEEDSVMVEETEKFLED  140

Query  539   RLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             +  ++  D+E L+ L+E KI+N+ I +AI ++++L+EL+P ++EWP+L+ HL     +FE
Sbjct  141   QFHSDQCDLEGLKMLMEIKIKNKKIPEAIQVIDKLIELQPDDSEWPMLKFHLHSYNEDFE  200

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLR  898
              A+ GF ++L K+P  VEAYHGL+T  ++ D VEEL  +EE+I +A+KLCK ++K+   R
Sbjct  201   LAKNGFAQLLQKDPARVEAYHGLVTVAAQQDSVEELTILEEKIHEAIKLCKRDNKRDDAR  260

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             DFKLLLAQI+ ++  YE+ALK Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+K+F  Y
Sbjct  261   DFKLLLAQIKVVQSRYEDALKQYEELVKEEPRDFRPYLCQGIIYTLLKKNNEAEKNFDKY  320

Query  1079  RELLPEGHPYSSFLDNTMIASKLFA  1153
             R L+P+GHPY+++ ++ M+A+KLFA
Sbjct  321   RRLIPKGHPYANYFNDNMVATKLFA  345



>emb|CBI32668.3| unnamed protein product [Vitis vinifera]
Length=314

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 157/208 (75%), Gaps = 0/208 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ ++E + ++P+DVE L+SL+E KI+N+ + +A+ ++ RL++LEP + EWPLL+ HL+ 
Sbjct  98    ERTVEEYVESHPDDVEGLKSLMEVKIKNRKLQEAVDVIERLIQLEPDDKEWPLLKAHLYS  157

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +GE E A+ GF EILS  PL VEAYHGL+ AVS+ D  +EL  + +RI  AM+ CK E 
Sbjct  158   YSGESELAKLGFEEILSANPLTVEAYHGLVMAVSQSDSGDELNQVLKRIEAAMERCKKEK  217

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  LRDFKLL+AQIR IE  Y +ALKVYQELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  218   KKEDLRDFKLLVAQIRVIEGKYNDALKVYQELVKEEPRDFRPYLCQGIIYTLLRKKDEAE  277

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             K FQ YR L+P+GHPY+ + D+ MIA++
Sbjct  278   KQFQKYRRLVPKGHPYARYFDDNMIATR  305



>ref|XP_009409535.1| PREDICTED: uncharacterized protein LOC103991725 [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+ERL ++P+DV +L++L+E K++   + +AI IV+RL+ LEP+E + PLL+ HL  
Sbjct  123   ERILEERLDSHPDDVRSLRALMELKVKAGKLAEAIGIVDRLIALEPAEKDLPLLKAHLQS  182

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G  ETA+RGF E+L K+P LVEAYHGLI A S+ +   +L  I +R+  AM+LCK   
Sbjct  183   YDGNTETAKRGFEELLEKDPFLVEAYHGLIMATSQSEDDGDLDAILKRVEDAMELCKKAR  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +K  LRDFKLL+AQIR IE  YE++LK+Y+ELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  243   RKEDLRDFKLLMAQIRVIEGRYEDSLKIYKELVKEEPRDFRPYLCQGIIYTLLRKKDEAE  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K FQ YR L+P+GHPY+ + D+ MIA K+F 
Sbjct  303   KQFQTYRRLVPKGHPYAQYFDDNMIAMKVFG  333



>gb|KDO44112.1| hypothetical protein CISIN_1g040440mg [Citrus sinensis]
Length=355

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 200/337 (59%), Gaps = 24/337 (7%)
 Frame = +2

Query  185   SLNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSSPGILETLTQ  364
             S N+HRP   + +S +S  T P   P K    FS   +   PA Q+  K  P +L TLT 
Sbjct  17    SFNHHRPSFPKSISFISLRTPPSSSPFK----FSCIRASSSPASQQNPK--PSLLRTLTP  70

Query  365   SHFQTPFSCavvatvaaaavFLGRFSLR--------------VNPSIaapvsapataeaa  502
                 +P       TVAAAA+   R                     S         +A   
Sbjct  71    --LSSPLIKITSVTVAAAALLFMRLPFHSIKPAIAAPVAAAATVESTNESTKDTTSARED  128

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
             VS  E EK +++ LAANPND+EALQ+L+E +I++Q + +A+ +++RL+ELEP+E EW LL
Sbjct  129   VSYEEKEKEIEQHLAANPNDIEALQTLMEVRIKSQKLVEAVDVIDRLIELEPNEFEWQLL  188

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMK  862
             +  +    GE E A +GF EIL K+PL VEAYHGL+ A    D+  +L  +E+RI KAM+
Sbjct  189   KAQVQSYAGESEAAIKGFEEILRKDPLRVEAYHGLVMAYDGSDK--KLNEVEKRIEKAME  246

Query  863   LCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLG  1042
              CK E KK  LRDFKLL+AQI+ +E  + EAL+VY+ELVKEEP DFRPYL Q I+YT+L 
Sbjct  247   RCKKEKKKSDLRDFKLLIAQIKVMESKHSEALRVYEELVKEEPRDFRPYLCQGIIYTLLR  306

Query  1043  KDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K  EA+K F+ +R L+P  HPY  +  + M+A+K+F 
Sbjct  307   KKDEAEKQFEKFRRLVPRNHPYREYFVDNMVATKIFG  343



>ref|XP_010920729.1| PREDICTED: uncharacterized protein LOC105044501 [Elaeis guineensis]
Length=334

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 158/212 (75%), Gaps = 1/212 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E L ++P+D+ +L++L+E K+++Q + +AI IV+RL+ LEP E + PLL+ H   
Sbjct  110   ERTLEEYLDSHPDDIRSLRALMELKVRSQKLPEAIDIVDRLIALEPDEGDLPLLKAHFQN  169

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQV-EELKGIEERILKAMKLCKTE  877
              +G+ ETA++GF EIL ++P  VEAYHGL+ A S+ D   EEL GI +R+ +AM++CK  
Sbjct  170   YSGDAETAKKGFQEILERDPFCVEAYHGLVMAASQSDSSHEELDGILKRVEEAMEMCKKA  229

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              KK  LRDFKLL+AQIR IE  Y+EALK+Y ELVKEEP DFRPYL Q I+YT+L K  EA
Sbjct  230   KKKEDLRDFKLLVAQIRVIEGKYDEALKIYDELVKEEPRDFRPYLCQGIIYTLLRKKDEA  289

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             +KHFQ YR L+P+GHPY+ + +  M+A K+F 
Sbjct  290   EKHFQKYRRLVPKGHPYARYFEENMMAIKIFG  321



>ref|XP_010260033.1| PREDICTED: uncharacterized protein LOC104599263 [Nelumbo nucifera]
Length=346

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 206/339 (61%), Gaps = 31/339 (9%)
 Frame = +2

Query  191   NNHRPV---------LVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSSPG  343
             +NH+P+         L  P+SS+SF+  P   P   S   S   S P+P   + +  S  
Sbjct  9     HNHQPLHLSFHRRLSLSIPVSSISFSKIPSSKPKPKSVQAS---SAPRPLNPQQSHHSEL  65

Query  344   ILETLTQSHFQTPFSCavvatvaaaav---FLGRFSLRVNPSIaa------pvsapatae  496
              LE L       PFS  +  T         F  RFS    PS AA        S      
Sbjct  66    PLEILK------PFSSVLKTTCLVIGAGVLFFNRFS---KPSYAAPIPTPTVESTSRETT  116

Query  497   aavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWP  676
                +  E E  ++E L ++P+DVEAL+SL+E KI+ + + +AI+I++RL+E+EPSE EWP
Sbjct  117   ETFNGEEKESTIEEYLESHPDDVEALRSLMEVKIKARKLQEAIAIIDRLIEIEPSEREWP  176

Query  677   LLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKA  856
             LL+ HL   +G+ E A+ GF EILSK+PL VEAYHGL+ A S+ +  + L+ + +RI  A
Sbjct  177   LLKAHLQNYSGDAELAKLGFEEILSKDPLFVEAYHGLVMATSQSESAD-LENVLKRIENA  235

Query  857   MKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTM  1036
             M+ CK E KK  LRDFKLL+AQ+R IE +Y +ALKVYQELVKEEP DFRPYL Q I+YT+
Sbjct  236   MERCKKEKKKENLRDFKLLVAQVRVIEGNYMDALKVYQELVKEEPRDFRPYLCQGIIYTL  295

Query  1037  LGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             L K  EA+K FQ YR L+P+ HPY+ + D+ M A+K+F+
Sbjct  296   LRKKDEAEKQFQKYRRLVPKEHPYARYFDDNMFATKVFS  334



>ref|XP_010529866.1| PREDICTED: uncharacterized protein LOC104806590 [Tarenaya hassleriana]
 ref|XP_010529867.1| PREDICTED: uncharacterized protein LOC104806590 [Tarenaya hassleriana]
Length=342

 Score =   236 bits (603),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 159/211 (75%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+A++E LA++P DV+AL+SL+E +I+++ + +AI +++RL+ELEP E EWP+L+ ++F 
Sbjct  122   ERAIEEHLASHPTDVDALRSLMEVRIKSKKLVEAIEVIDRLIELEPDEKEWPVLKANIFS  181

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A++GF EIL K+PL VEAYHGL+ A S  D   +LK +E+RI +AM+ CK E 
Sbjct  182   YSGDLESAKQGFEEILEKDPLRVEAYHGLVMAYS--DSGRDLKEVEKRIQEAMEECKKEK  239

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                  RDFKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  240   NLKDFRDFKLLVAQIRVIEGKHNEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDEAE  299

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F  +R+L+P  HPY  +  + M+A+KLFA
Sbjct  300   KQFDKFRKLVPRNHPYREYFMDNMVATKLFA  330



>ref|XP_006429002.1| hypothetical protein CICLE_v10012060mg [Citrus clementina]
 ref|XP_006480730.1| PREDICTED: uncharacterized protein LOC102617396 [Citrus sinensis]
 gb|ESR42242.1| hypothetical protein CICLE_v10012060mg [Citrus clementina]
Length=355

 Score =   236 bits (601),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 198/337 (59%), Gaps = 24/337 (7%)
 Frame = +2

Query  185   SLNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSSPGILETLTQ  364
             S N+HRP   + +S +S  T P   P K    FS   +   PA Q+  K  P +L TLT 
Sbjct  17    SFNHHRPSFPKSISFISLRTPPSSSPFK----FSCIRASSSPASQQNPK--PSLLRTLTP  70

Query  365   SHFQTPFSCavvatvaaaavFLGRFSLR--------------VNPSIaapvsapataeaa  502
                 +P       TVAAAA+   R                     S         +A   
Sbjct  71    --LSSPLIKITSVTVAAAALLFMRLPFHSIKPAIAAPVAAAATVESTNESTKDTTSARED  128

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
             VS  E EK +++ LAANPND+EALQ+L+E +I++  + +A+ +++RL+ELEP+E EW LL
Sbjct  129   VSYEEKEKEIEQHLAANPNDIEALQTLMEVRIKSHKLVEAVDVIDRLIELEPNEFEWQLL  188

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMK  862
             +  +    GE E A +GF EIL K+PL VEAYHGL+ A    D+  +L  +E+RI  AM+
Sbjct  189   KAQVQSYAGESEAAIKGFEEILRKDPLRVEAYHGLVMAYDGSDK--KLNEVEKRIENAME  246

Query  863   LCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLG  1042
              CK E KK  LRDFKLL+AQI+ +E  + EAL+VY+ELVKEEP DFRPYL Q I+YT+L 
Sbjct  247   RCKKEKKKSDLRDFKLLIAQIKVMESKHSEALRVYEELVKEEPRDFRPYLCQGIIYTLLR  306

Query  1043  KDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K  EA+K F+ +R L+P  HPY  +  + M+A+K+F 
Sbjct  307   KKDEAEKQFEKFRRLVPRNHPYREYFVDNMVATKIFG  343



>ref|XP_006410923.1| hypothetical protein EUTSA_v10017513mg [Eutrema salsugineum]
 gb|ESQ52376.1| hypothetical protein EUTSA_v10017513mg [Eutrema salsugineum]
Length=344

 Score =   234 bits (598),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             LA++P DVEAL+SL+E +I+++ + +AI +++RL+ELEP E EWP+L+ ++F  +G+ E+
Sbjct  131   LASHPEDVEALRSLMEVRIKSRKLIEAIEVIDRLIELEPEEKEWPVLKANIFSHSGDLES  190

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+ GF EI++K+PL VEAYHGL+ A S  D  ++L  +E+RI +AM+ CK E  +  LRD
Sbjct  191   AKSGFEEIIAKDPLRVEAYHGLVMACS--DSGDDLIAVEKRIQEAMERCKKEKNRKDLRD  248

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K +EA+K F+ +R
Sbjct  249   FKLLVAQIRVIEGKHNEALKLYQELVKEEPRDFRPYLCQGIIYTVLKKQEEAEKQFEKFR  308

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
             +L+P  HPY  +  + M+A+KLFA
Sbjct  309   KLVPRNHPYREYFMDNMVATKLFA  332



>ref|XP_008794537.1| PREDICTED: uncharacterized protein LOC103710546 [Phoenix dactylifera]
Length=334

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 159/212 (75%), Gaps = 1/212 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E L ++P+DV +L++L+E K++++ + +AI IV+RL+ LEP E + PLL+ HL  
Sbjct  110   ERTLEEYLDSHPDDVRSLRALMELKVKSRKLPEAIDIVDRLIALEPGERDLPLLKAHLRN  169

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVE-ELKGIEERILKAMKLCKTE  877
              +G+ ETA++GF E+L ++P  VEAYHGL+ A S+ ++   EL GI +R+  A+++CK  
Sbjct  170   YSGDAETAKQGFEEVLQQDPFCVEAYHGLVMAASQSEESHAELDGILKRVEGALEMCKKA  229

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              KK  LRDFKLL+AQIR IE  YE+ALK+Y+ELVKEEP DFRPYL Q I+YT+L K  EA
Sbjct  230   KKKEDLRDFKLLVAQIRVIEGKYEDALKIYEELVKEEPRDFRPYLCQGIIYTLLRKKDEA  289

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             +KHFQ YR L+P+GHPY+ + +  M+A K+F 
Sbjct  290   EKHFQKYRRLVPKGHPYARYFEENMMAMKIFG  321



>ref|XP_011019250.1| PREDICTED: uncharacterized protein LOC105122045 [Populus euphratica]
Length=329

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 207/338 (61%), Gaps = 24/338 (7%)
 Frame = +2

Query  158   AKPNLNFLPSLNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSS  337
             AK  LN   SLN HRP    P+ SLSF T P         S SP F +    +  ++   
Sbjct  5     AKQPLNL--SLNPHRPSFPNPIISLSFKTPP--------PSSSP-FKLSTSIRASSSSRI  53

Query  338   PGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLR------VNPSIaapvsapataea  499
               + ++LT     T      +A  AAA +F  RF+ +      V  S +        ++ 
Sbjct  54    TQLNQSLT-----TIIKTTSIALTAAAVLFFTRFNSKPAIASPVAASSSTADPTKEPSKE  108

Query  500   avsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPL  679
              +S  E E+ALQ+ LA NP+DVEAL+SL+E +I+++ + +AI +V+RL+ELEP+E EWPL
Sbjct  109   NLSFEEQERALQDHLAQNPSDVEALRSLMEVRIKSKKLQEAIEVVDRLIELEPNEDEWPL  168

Query  680   LRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAM  859
             L++ ++  +G+FE+A+ GF  +L K+PL VEAYHGL+ A SE      L+ + +RI  AM
Sbjct  169   LKSQIYTYSGDFESAKDGFEAVLQKDPLRVEAYHGLVMANSESGG--SLEVVLKRIESAM  226

Query  860   KLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTML  1039
               CK E K   LRDFKLL+AQ+R +E  Y +ALKVY+ELVKEEP DFRPYL Q ++YT+L
Sbjct  227   NKCKKEKKNSDLRDFKLLIAQVRVMEEKYFDALKVYEELVKEEPRDFRPYLCQGMIYTLL  286

Query  1040  GKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              K  EA+K F+ +++L+P+ HPY  +L   M A+  F+
Sbjct  287   RKKDEAEKKFEQFKKLVPKNHPYREYLIENMFATNFFS  324



>gb|AAM66986.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             LA++P+DVEAL+SL+E +I+++ + +AI +++RL+ELEP E EWP+L+ ++F  +G+ E+
Sbjct  123   LASHPDDVEALRSLMEVRIKSRKLLEAIELIDRLIELEPEEKEWPMLKANIFSYSGDLES  182

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+ GF EIL K+PL VEAYHGL+ A S  D  ++L  +E+RI +AM  CK E  +  LRD
Sbjct  183   AKTGFEEILVKDPLRVEAYHGLVMAYS--DSGDDLNAVEQRIEEAMVRCKKEKNRKDLRD  240

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR IE  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+K F+ +R
Sbjct  241   FKLLVAQIRVIEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKENEAEKQFEKFR  300

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P+ HPY  +  + M+ASKLFA
Sbjct  301   RLVPKNHPYREYFMDNMVASKLFA  324



>ref|NP_565860.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC98059.1| chloroplast lumen common protein family [Arabidopsis thaliana]
 gb|ABI49479.1| At2g37400 [Arabidopsis thaliana]
 gb|AEC09393.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=333

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             LA++P+DVEAL+SL+E +I+++ + +AI +++RL+ELEP E EWP+L+ ++F  +G+ E+
Sbjct  123   LASHPDDVEALRSLMEVRIKSRKLLEAIELIDRLIELEPEEKEWPMLKANIFSYSGDLES  182

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+ GF EIL K+PL VEAYHGL+ A S  D  ++L  +E+RI +AM  CK E  +  LRD
Sbjct  183   AKTGFEEILVKDPLRVEAYHGLVMAYS--DSGDDLNAVEKRIEEAMVRCKKEKNRKDLRD  240

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR IE  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+K F+ +R
Sbjct  241   FKLLVAQIRVIEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKENEAEKQFEKFR  300

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P+ HPY  +  + M+ASKLFA
Sbjct  301   RLVPKNHPYREYFMDNMVASKLFA  324



>ref|XP_002322830.2| chloroplast lumen common family protein [Populus trichocarpa]
 gb|EEF04591.2| chloroplast lumen common family protein [Populus trichocarpa]
Length=340

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 158/211 (75%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ALQ+ L+ NPND+EAL+SL+E +I+++ + +AI +V+RL+ELEP+E EWPLL++ ++ 
Sbjct  124   ERALQDYLSQNPNDIEALRSLMEVRIKSKKLVEAIEVVDRLIELEPNEDEWPLLKSQIYT  183

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+FE+A+ GF  IL K+PL VEAYHGL+ A SE      L+ + +RI  AM  CK E 
Sbjct  184   YSGDFESAKDGFEAILKKDPLRVEAYHGLVMANSESGG--SLEVVLKRIESAMDKCKKEK  241

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K   LRDFKLL+AQ+R +E  Y +ALKVY+ELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  242   KTSDLRDFKLLVAQVRVMEEKYLDALKVYEELVKEEPRDFRPYLCQGIIYTLLRKKDEAE  301

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +++L+P+ HPY  +L + M A+K F+
Sbjct  302   KMFEQFKKLVPKNHPYREYLVDNMFATKFFS  332



>ref|XP_002308480.2| hypothetical protein POPTR_0006s23010g [Populus trichocarpa]
 gb|EEE92003.2| hypothetical protein POPTR_0006s23010g [Populus trichocarpa]
Length=329

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ALQ+ LA NP+DVEAL+SL+E +I+++ + +AI +V+RL+ELEP+E EWPLLR+ ++ 
Sbjct  116   ERALQDHLAQNPSDVEALRSLMEVRIKSKKLQEAIEVVDRLIELEPNEDEWPLLRSQIYT  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+FE+A+ GF  +L K+PL VEAYHGL+ A SE      L+ + +RI  AM  CK E 
Sbjct  176   YSGDFESAKDGFEAVLQKDPLRVEAYHGLVMANSESGG--SLEVVLKRIESAMNKCKKEK  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K   LRDFKLL+AQ+R +E  Y +ALKVY+ELVKEEP DFRPYL Q ++YT+L K  EA+
Sbjct  234   KNSDLRDFKLLIAQVRVMEEKYFDALKVYEELVKEEPRDFRPYLCQGMIYTLLRKKDEAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +++L+P+ HPY  +L   M A+  F+
Sbjct  294   KKFEQFKKLVPKNHPYREYLVENMFATNFFS  324



>gb|KFK36629.1| hypothetical protein AALP_AA4G149000 [Arabis alpina]
Length=340

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
              +NP DV++L+SL+E KI+++ + +A+ +++RL+ELEP E EWP+L+ ++F  +G+ E+A
Sbjct  128   VSNPKDVDSLRSLMEVKIKSRKLIEAVEVIDRLIELEPEEKEWPILKANIFSHSGDLESA  187

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
             + GF EIL+K+PL VEAYHGL+  VSE    EEL  +E+RI +AM+ CK E  +  LRDF
Sbjct  188   KNGFEEILAKDPLRVEAYHGLVMVVSESG--EELNVVEKRIHEAMEKCKKEKNRKDLRDF  245

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  EA K F+ +R 
Sbjct  246   KLLVAQIRVIEGKHNEALKLYQELVKEEPRDFRPYLCQGIIYTVLKKQDEADKQFEKFRR  305

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+P+ HPY  +  + M+A+KLFA
Sbjct  306   LVPKNHPYREYFMDNMVATKLFA  328



>ref|XP_011015949.1| PREDICTED: uncharacterized protein LOC105119503 [Populus euphratica]
 ref|XP_011015950.1| PREDICTED: uncharacterized protein LOC105119503 [Populus euphratica]
Length=329

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ALQ+ LA NP+DVEAL+SL+E +I+++ + +AI +V+RL+ELEP+E EWPLL++ ++ 
Sbjct  116   ERALQDHLAQNPSDVEALRSLMEVRIKSKKLQEAIEVVDRLIELEPNEDEWPLLKSQIYT  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+FE+A+ GF  +L K+PL VEAYHGL+ A SE      L+ + +RI  AM  CK E 
Sbjct  176   YSGDFESAKDGFEAVLQKDPLRVEAYHGLVMANSESGG--SLEVVLKRIESAMNKCKKEK  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K   LRDFKLL+AQ+R IE  Y +ALKVY+ELVKEEP DFRPYL Q ++YT+L K  EA+
Sbjct  234   KNSDLRDFKLLIAQVRVIEEKYFDALKVYEELVKEEPRDFRPYLCQGMIYTLLRKKDEAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +++L+P+ HPY  +L   M A+  F+
Sbjct  294   KKFEQFKKLVPKNHPYREYLVENMFATNFFS  324



>ref|XP_011007307.1| PREDICTED: uncharacterized protein LOC105113025 [Populus euphratica]
Length=340

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ LQ+ L+ NPND+EAL+SL+E +I+++ + +AI +V+RL+ELEP+E EWPLL++ +++
Sbjct  124   ERTLQDYLSQNPNDIEALRSLMEVRIKSKKLLEAIEVVDRLIELEPNEDEWPLLKSQIYI  183

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+FE+A+ GF  I+ K+PL VEAYHGL+ A SE      L+ + +RI  AM  CK E 
Sbjct  184   YSGDFESAKDGFEAIVQKDPLRVEAYHGLVMANSESGG--SLEVVLKRIESAMDKCKKEK  241

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K   LRDFKLL+AQ+R IE  Y +ALKVY+ELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  242   KNSDLRDFKLLVAQVRVIEEKYLDALKVYEELVKEEPRDFRPYLCQGIIYTLLRKKDEAE  301

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F  +++L+P+ HPY  +L + M A+K F+
Sbjct  302   KKFDQFKKLVPKNHPYREYLVDNMFATKFFS  332



>ref|XP_002881505.1| hypothetical protein ARALYDRAFT_482732 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57764.1| hypothetical protein ARALYDRAFT_482732 [Arabidopsis lyrata subsp. 
lyrata]
Length=334

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             + LA++P DVEAL+SL+E +I+++ + +AI +++RL+ELEP E EWP+L+ ++F  +G+ 
Sbjct  122   DHLASHPEDVEALRSLMEVRIKSRKLIEAIELIDRLIELEPEEKEWPILKANIFSYSGDL  181

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             E+A+ GF EIL K+PL V+AYHGL+ A S  D   +L  +EERI +AM  CK E  +  L
Sbjct  182   ESAKTGFEEILVKDPLRVDAYHGLVMAYS--DSGADLNAVEERIEEAMVRCKKEKNRKDL  239

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             RDFKLL+AQIR IE  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K  EA+K F+ 
Sbjct  240   RDFKLLVAQIRVIEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKQDEAEKQFEK  299

Query  1076  YRELLPEGHPYSSFLDNTMIASKLFA  1153
             +R L+P+ HPY  +  + M+A+KLFA
Sbjct  300   FRRLVPKNHPYREYFMDNMVATKLFA  325



>emb|CDY46775.1| BnaA03g17190D [Brassica napus]
Length=330

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             LA++P DV AL+SL+E KI+++ + +AI I+NRL+ELEP E EWP+L+ ++F  +G+ E+
Sbjct  117   LASHPEDVAALRSLMEVKIKSRKLLEAIEIINRLIELEPEEKEWPILKANIFTHSGDLES  176

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EIL+K+PL VEAYHGL  A SE    ++L  IE+RI ++M+ CK E     LRD
Sbjct  177   AKSVFEEILAKDPLRVEAYHGLAMAYSESG--DDLNVIEKRIHESMERCKKEKNVKDLRD  234

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR IE  +EEALK+YQELVKEEP DFRPYL Q I+YT+L K  EA+K F+ +R
Sbjct  235   FKLLVAQIRVIEGKHEEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKGDEAEKQFEKFR  294

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
             +L+P  HPY  +  + M+A+KLFA
Sbjct  295   KLVPRNHPYREYFMDNMVATKLFA  318



>ref|XP_009800384.1| PREDICTED: ras guanine nucleotide exchange factor G-like [Nicotiana 
sylvestris]
Length=356

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 216/360 (60%), Gaps = 42/360 (12%)
 Frame = +2

Query  134   MNAFTHFSAKPNL---NFLPSLNNHRPVLVR-PLS-SLSFTTQPQHVPIKASSSFSPEFS  298
             MN    F+AK N     F+PS + H  VL + PL+ SL F TQ       +        S
Sbjct  1     MNTLNPFAAKRNNFHNQFIPSFDQHCSVLTKQPLNNSLYFRTQLPLSLSSSYLPIKSSSS  60

Query  299   VPKPAKQETAKSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaap--  472
             +PK     T  S P   ++LT   F  P    +++T+ A A+FL  F L   P+I+ P  
Sbjct  61    IPK-----TPNSQP--FKSLTPLSFLKP---TLISTITATALFLTGFYLNPKPAISTPLS  110

Query  473   ------------------------vsapataeaavsdaetEKALQERLAANPNDVEALQS  580
                                          TA   VS+  TE AL + L +NPNDVE L++
Sbjct  111   PPPTDDTTTVNEENALKEELVSNPNDVDTTANEPVSEDNTENALVDELLSNPNDVEILRN  170

Query  581   LVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEP  760
             L+E+ I+N+ + DA+SI+N+L+ELEP+ETEW  L++HL+V  GE E A+ GF E++SK+P
Sbjct  171   LLENHIKNRELVDALSILNKLIELEPNETEWCFLKSHLYVHNGELELAKLGFREVISKDP  230

Query  761   LLVEAYHGLIT-AVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIE  937
               VEAY GL+  A SEDD +EE+K IE+++ + +K+C+ E+ K ++RDFKLLLAQI  IE
Sbjct  231   YHVEAYRGLVVVAGSEDDSLEEMKEIEKKVEEGIKMCEEENIKDEMRDFKLLLAQIWVIE  290

Query  938   YDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSF  1117
               Y+EALKVY ELV EEP+DFRPYL Q ++YTML K+ +A+K+F+ YR L+P  +P + F
Sbjct  291   GKYDEALKVYHELVAEEPSDFRPYLCQGMIYTMLKKNDKAEKYFEKYRGLVPRENPNARF  350



>ref|XP_010253347.1| PREDICTED: uncharacterized protein LOC104594653 [Nelumbo nucifera]
Length=335

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ ++E L ++P+DV+AL+SL++ KI+ + + +AI+I+ RL+++EPSE EWPLL+ HL  
Sbjct  114   ERTIEEYLDSHPDDVKALRSLMDVKIKARKLQEAIAIIYRLIQIEPSEKEWPLLKAHLQN  173

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E A+ GF EILS +PL VEAYHGL+ A S+ +  +EL  + +RI  AM+ CK E 
Sbjct  174   YSGDVELAKLGFEEILSNDPLFVEAYHGLVMATSQSES-DELGAVLKRIENAMERCKKEK  232

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  LRDFKLL+AQ+RAIE +Y +ALKVYQELVKEEP DFRPYL Q I+YT+L K  E++
Sbjct  233   KKEGLRDFKLLVAQVRAIEGNYVDALKVYQELVKEEPRDFRPYLCQGIIYTLLRKKDESE  292

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+MYR L+P+ HPY  + D+ M A+K+ +
Sbjct  293   KQFRMYRRLVPKEHPYVRYFDDNMFATKVLS  323



>ref|XP_006292273.1| hypothetical protein CARUB_v10018483mg [Capsella rubella]
 gb|EOA25171.1| hypothetical protein CARUB_v10018483mg [Capsella rubella]
Length=343

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L ++P DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  117   ERALDEHLVSHPADVDALRSLMEVKIRSRKLTEAVEVIDRLIKLEPDEKEWPVLKANIFT  176

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E 
Sbjct  177   YSGDLDLAKTGFEEILAKDPLRVEAYHGLLMAYS--DAGLDLKDVENRIEEAMLKCKKES  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 LRDFKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  +A+
Sbjct  235   NDNDLRDFKLLVAQIRVIEGKHSEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDKAE  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  295   EQFDQFRKLVPKNHPYREYFMDNMIATKLFS  325



>ref|XP_009133150.1| PREDICTED: uncharacterized protein LOC103857677 [Brassica rapa]
Length=334

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+++P DV AL+SL+E KI+++ + +AI I+NRL+ELEP E EWP+L+ ++F  +G+ E+
Sbjct  121   LSSHPEDVAALRSLMEVKIKSRKLLEAIEIINRLIELEPEEKEWPILKANIFTHSGDLES  180

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EIL+K+PL VEAYHGL  A SE    ++L  IE+RI ++M+ CK E     LRD
Sbjct  181   AKSVFEEILAKDPLRVEAYHGLAMAYSESG--DDLNVIEKRIHESMERCKKEKNVKDLRD  238

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR IE  +EEALK+YQELVKEEP DFRPYL Q I+YT+L K  EA+K F+ +R
Sbjct  239   FKLLVAQIRVIEGKHEEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKGDEAEKQFEKFR  298

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
             +L+P  HPY  +  + M+A+KLFA
Sbjct  299   KLVPRNHPYREYFMDNMVATKLFA  322



>gb|KDP35578.1| hypothetical protein JCGZ_09016 [Jatropha curcas]
Length=346

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 204/330 (62%), Gaps = 6/330 (2%)
 Frame = +2

Query  164   PNLNFLPSLNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETAKSSPG  343
             PN +F  SLN +RP   +PL SLSF TQ    P K SS  +     P     +T +  P 
Sbjct  11    PNQSFNLSLNCNRPSFSKPLFSLSFKTQSS--PFKFSSVRASSSRAPLYKISQTHQ--PS  66

Query  344   ILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaavsdaetE  523
             +L+TL      T  +    A +  + +           + A    A  ++   +S  E E
Sbjct  67    LLQTLNPLLKTTCITLTAAAALFFSRLCNKPAIAAPATAPATVEPAKQSSNENLSFEEQE  126

Query  524   KALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVL  703
             +AL+E L+ NP D EAL+SL+E +I+++ +  AI +V+RL+ELEP+E EWPLL+  ++  
Sbjct  127   RALEEHLSRNPEDTEALRSLMEVRIKSRKLLGAIEVVDRLIELEPNEDEWPLLKAQIYSY  186

Query  704   TGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             +GEFE+AR+GF EIL K+PL VEAYHGL+ A SE    + L  + +RI  AM  CK E K
Sbjct  187   SGEFESARKGFEEILEKDPLRVEAYHGLVMANSESG--DSLDEVLKRIEGAMDKCKKEKK  244

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
             K  LRDFKLL+AQIR +E  Y +ALKVY+ELVKEEP DFRPYL Q I+YT++ K  EA+K
Sbjct  245   KSDLRDFKLLIAQIRVMEEKYIDALKVYEELVKEEPRDFRPYLCQGIIYTLMRKKDEAEK  304

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F+ +R+L+P+ HPY  F  + M A+K F+
Sbjct  305   KFEQFRKLVPKNHPYREFFLDNMFATKFFS  334



>ref|XP_008241614.1| PREDICTED: uncharacterized protein LOC103340025 [Prunus mume]
Length=357

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ ++E+L+ NP+DVEAL+SL+E +I+   + +AI +++RL+ELEP + EW LL+ ++  
Sbjct  137   ERLIEEQLSQNPDDVEALRSLMEVRIKAHKLTEAIQVLDRLIELEPEDYEWQLLKANVHS  196

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GEFE A   F EIL+K+PL VEAYHGL+ + S+    E+L+ +  R+ KAM+ CK   
Sbjct  197   YMGEFELATSEFEEILAKDPLRVEAYHGLVMSASQSP--EKLENVVTRVEKAMEGCKKLG  254

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K  +RDFKLL+AQIR +E +Y EALK+YQELV+EEP DFRPYL Q I+YTML K+KEA+
Sbjct  255   NKSDVRDFKLLIAQIRVMESNYSEALKLYQELVREEPRDFRPYLCQGIIYTMLRKNKEAE  314

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  315   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  345



>ref|NP_566986.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAM20593.1| putative protein [Arabidopsis thaliana]
 gb|AAN15593.1| putative protein [Arabidopsis thaliana]
 gb|AEE79108.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=340

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L  +P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  116   ERALDEHLITHPSDVDALRSLMEVKIKSRKLTEAVEVIDRLIKLEPEEKEWPVLKANIFT  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E+
Sbjct  176   YSGDLDLAKTGFEEILAKDPLRVEAYHGLLMAYS--DAGLDLKEVESRIEEAMLKCKKEN  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              +   RDFKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  +A+
Sbjct  234   NQNDFRDFKLLVAQIRVIEGKHSEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDKAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  294   EQFDNFRKLVPKNHPYREYFMDNMIATKLFS  324



>ref|XP_007205429.1| hypothetical protein PRUPE_ppa007747mg [Prunus persica]
 gb|EMJ06628.1| hypothetical protein PRUPE_ppa007747mg [Prunus persica]
Length=357

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ ++E+L+ NP+DVEAL+SL+E +I+   +  AI +++RL+ELEP + EW LL+ ++  
Sbjct  137   ERLIEEQLSQNPDDVEALRSLMEVRIKAHKLTAAIQVLDRLIELEPEDYEWQLLKANVHS  196

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GEFE A   F EIL+K+PL VEAYHGL+ + S+    E+L+ +  R+ KAM+ CK + 
Sbjct  197   YMGEFELATSEFEEILAKDPLRVEAYHGLVMSASQSP--EKLENVVTRVEKAMEGCKKQG  254

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K  +RDFKLL+AQIR +E +Y EALK+YQELV+EEP DFRPYL Q I+YT+L K+KEA+
Sbjct  255   NKSDVRDFKLLIAQIRVMESNYSEALKLYQELVREEPRDFRPYLCQGIIYTVLRKNKEAE  314

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  315   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  345



>ref|XP_006844252.1| hypothetical protein AMTR_s00145p00019890 [Amborella trichopoda]
 gb|ERN05927.1| hypothetical protein AMTR_s00145p00019890 [Amborella trichopoda]
Length=391

 Score =   228 bits (582),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 148/204 (73%), Gaps = 3/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P+D+ +L++L+E KI    I +AI ++ +LM LEP E EWP+L+ HL    GE E 
Sbjct  179   LDTHPDDIASLRALMEIKIMASKIPEAILVIEKLMALEPEEIEWPMLKAHLKSYAGESEA  238

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A RGF +ILSK+PL VEAYHGL+   S+   +EE   I +RI KAM++CK E +K  +RD
Sbjct  239   AWRGFEDILSKDPLYVEAYHGLVIVASQSGGMEE---ICQRIKKAMEICKKEKRKEDMRD  295

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQI  +E +YE+ALK+YQEL KEEP DFRPYL Q I+YT+L K  EA+K F+ YR
Sbjct  296   FKLLMAQIHVLESNYEDALKIYQELAKEEPRDFRPYLCQGIIYTLLEKKDEAEKQFEKYR  355

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P+GHPY+ F D+ ++A+ +F+
Sbjct  356   RLVPKGHPYARFFDDNVLATNVFS  379



>ref|XP_006294547.1| hypothetical protein CARUB_v10023581mg [Capsella rubella]
 gb|EOA27445.1| hypothetical protein CARUB_v10023581mg [Capsella rubella]
Length=336

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E++L+E L + P DVE L+ L+E KI+++ + +AI +++RL+ELEP E EWP+L+ ++F 
Sbjct  116   ERSLEEHLVSQPEDVEVLRGLMEIKIKSRKLPEAIELIDRLIELEPEEKEWPILKANIFS  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ ++A+ GF EI++K+PL VEAYHGL+   S  D   +L  +E+RI +AM  CK E 
Sbjct  176   YSGDLDSAKAGFEEIIAKDPLRVEAYHGLVMVYS--DSGSDLNAMEKRIEEAMVRCKKEK  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              +  LRDFKLL+AQIR +E  + EALK+Y ELVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  234   NRKDLRDFKLLVAQIRVVEGKHNEALKLYGELVKEEPRDFRPYLCQGIIYTVLKKQDEAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R L+P+ HPY  +  + M+A+KLFA
Sbjct  294   KQFEKFRRLVPKNHPYREYFMDNMVATKLFA  324



>ref|XP_002877926.1| chloroplast lumen common family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54185.1| chloroplast lumen common family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L  +P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  116   ERALDEHLITHPSDVDALRSLMEVKIRSRKLSEAVEVIDRLIKLEPEEKEWPVLKANIFT  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E+
Sbjct  176   YSGDLDLAKTGFEEILAKDPLRVEAYHGLLMAYS--DAGLDLKEVESRIEEAMLKCKKEN  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                  RDFKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  +A+
Sbjct  234   NHNDFRDFKLLVAQIRVIEGKHSEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDKAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  294   EQFDNFRKLVPKNHPYREYFMDNMIATKLFS  324



>ref|XP_006398717.1| hypothetical protein EUTSA_v10015638mg [Eutrema salsugineum]
 gb|ESQ40170.1| hypothetical protein EUTSA_v10015638mg [Eutrema salsugineum]
Length=330

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 155/212 (73%), Gaps = 3/212 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E AL++ LA++PNDVEALQSL++ K+Q++NI  A+ I+NRL+E++P E EW +L+  +  
Sbjct  118   EAALEKHLASHPNDVEALQSLMKIKLQSKNIEHALEILNRLIEIDPEEQEWQILKAQMQT  177

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF EIL K+P  VEAYHGL+ A S  D   +L  +E RI +AM+ CK ED
Sbjct  178   YGGDFDSATKGFEEILMKDPFRVEAYHGLVMAYS--DSELKLSELESRISEAMEKCKKED  235

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +K   RDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+
Sbjct  236   RKKDFRDFMLLIAQIRVIQGNPIEALRVYQELVKDEPRDFRPYLCQGLIYTLMKKKDEAE  295

Query  1061  KHFQMYRELLPEGHPYSSFLD-NTMIASKLFA  1153
             KHF+ +R L+PE HPY  + D N +  +KLFA
Sbjct  296   KHFEQFRRLVPENHPYKEYFDANVLNTNKLFA  327



>gb|KEH24003.1| TPR superfamily protein [Medicago truncatula]
Length=351

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK +QE+L  NPND EAL++L+E KI+ + I +AI +++RL+E+EP E EW LL+ ++++
Sbjct  127   EKVIQEKLTENPNDAEALRALMEVKIKAREIDEAIGVIDRLIEIEPEEMEWRLLKANMYI  186

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQV--EELKGIEERILKAMKLCKT  874
                + E+A++ F EIL K+PL VEA+HGL+ A SE ++   E LKG+ +R+ KAM+LCK 
Sbjct  187   YNDDHESAKKLFEEILKKDPLRVEAFHGLVMASSESNEQSDEPLKGLLKRVEKAMELCKK  246

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
             + K   +RDF+LL+AQI+ +E ++ EALK YQ+LVKEEP DFRPYL Q I+YT+L K  E
Sbjct  247   QKKVSDVRDFRLLVAQIKVMEGNFSEALKAYQDLVKEEPRDFRPYLCQGIIYTLLRKKDE  306

Query  1055  AKKHFQMYRELLPEGHPYSSFLDNTMIASKLF  1150
             A+K F  +R+L+P+ HPY  + D+ M  +  F
Sbjct  307   AEKQFDQFRKLVPKNHPYKEYFDDNMNGTNFF  338



>emb|CAB67663.1| putative protein [Arabidopsis thaliana]
Length=388

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L  +P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  164   ERALDEHLITHPSDVDALRSLMEVKIKSRKLTEAVEVIDRLIKLEPEEKEWPVLKANIFT  223

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E+
Sbjct  224   YSGDLDLAKTGFEEILAKDPLRVEAYHGLLMAYS--DAGLDLKEVESRIEEAMLKCKKEN  281

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              +   RDFKLL+AQIR IE  + EALK+YQELVKEEP DFRPYL Q I+YT+L K  +A+
Sbjct  282   NQNDFRDFKLLVAQIRVIEGKHSEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDKAE  341

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  342   EQFDNFRKLVPKNHPYREYFMDNMIATKLFS  372



>ref|XP_004302797.1| PREDICTED: uncharacterized protein LOC101311390 [Fragaria vesca 
subsp. vesca]
Length=331

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/343 (41%), Positives = 216/343 (63%), Gaps = 37/343 (11%)
 Frame = +2

Query  158   AKPNLNFLP---SLNNHRPVLV------RPLSSLSFTTQPQHVPIKASSSFSPEFSVPKP  310
             +K NL   P   S+N HRP  +      RPL S SF++    + I+ASS+         P
Sbjct  5     SKLNLRHQPLHLSINPHRPSSLIPISSFRPLRSSSFSS----LKIRASSA--------DP  52

Query  311   AKQETAKSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapat  490
               Q      P  L+TL+      P +CA VA  A        F++R +P+  A  +  +T
Sbjct  53    PHQAPQNPKPSFLQTLS------PLACAAVAAAAF-------FTMRFHPTKPAFAAPTST  99

Query  491   ae-aavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSET  667
              E A V+  + E+ ++E+L+ +PNDVEAL+SL+E +I+   + +A+ +++RL+E+EP + 
Sbjct  100   VEPAKVTYEDEERQIEEQLSRDPNDVEALRSLMEVRIKAHKLTEAVQVLDRLIEVEPEDF  159

Query  668   EWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERI  847
             EW LL+ ++    GE++ A   F +IL+K+PL VEAYHGL+ + S+ +  E+L+ + +R+
Sbjct  160   EWQLLKANVHTYMGEYDLATSEFEDILAKDPLRVEAYHGLVMSASQSE--EKLELVLKRV  217

Query  848   LKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIM  1027
              KAM+ CK +     +RDFKLL+AQIR +E +Y++AL++YQELVKEEP DFRPYL Q I+
Sbjct  218   EKAMEACKKQGNTSDVRDFKLLIAQIRVMEAEYKDALELYQELVKEEPRDFRPYLCQGII  277

Query  1028  YTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
             YT+L K  EA+KHF  +R+L+P+ HPY  + D+ M A+KLF A
Sbjct  278   YTLLRKKNEAEKHFATFRKLVPKNHPYKEYFDDNMFATKLFGA  320



>emb|CDY11220.1| BnaA03g00560D [Brassica napus]
Length=313

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 156/214 (73%), Gaps = 3/214 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E +L++ LA NPND EALQSL++ K+Q++N+  A+ I+NRL+ L+P E EW +L+  +  
Sbjct  102   ESSLEKHLATNPNDSEALQSLMKIKLQSKNLDQALEILNRLISLDPEEQEWRILKAQVQT  161

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF EIL+K+PL VEAYHGL+ A SE +   +L  +E RI +A++ CK ED
Sbjct  162   YGGDFDSATKGFEEILAKDPLRVEAYHGLVMAYSESES--KLSELEGRIGEAIERCKRED  219

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK   RDF LL+AQIR +E +  EAL+VY+ELVK+EP DFRPYL Q ++YT+L K  EA+
Sbjct  220   KKKDFRDFMLLIAQIRVMEGNPSEALRVYEELVKDEPRDFRPYLCQGLIYTLLKKKDEAE  279

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMI-ASKLFAAA  1159
             K F+ +R L+PE HPY  + D+ M+  +KLFA +
Sbjct  280   KQFEQFRRLVPENHPYKEYFDSNMLNTNKLFAKS  313



>ref|XP_009130751.1| PREDICTED: uncharacterized protein LOC103855512 [Brassica rapa]
Length=313

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 156/214 (73%), Gaps = 3/214 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E +L++ LA NPND EALQSL++ K+Q++N+  A+ I+NRL+ L+P E EW +L+  +  
Sbjct  102   ESSLEKHLATNPNDSEALQSLMKIKLQSKNLDQALEILNRLISLDPEEQEWRILKAQVQT  161

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF EIL+K+PL VEAYHGL+ A SE +   +L  +E RI +A++ CK ED
Sbjct  162   YGGDFDSATKGFEEILAKDPLRVEAYHGLVMAYSESES--KLSELEGRIGEAIERCKRED  219

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK   RDF LL+AQIR +E +  EAL+VY+ELVK+EP DFRPYL Q ++YT+L K  EA+
Sbjct  220   KKKDFRDFMLLIAQIRVMEGNPSEALRVYEELVKDEPRDFRPYLCQGLIYTLLKKKDEAE  279

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMI-ASKLFAAA  1159
             K F+ +R L+PE HPY  + D+ M+  +KLFA +
Sbjct  280   KQFEQFRRLVPENHPYKEYFDSNMLNTNKLFAKS  313



>emb|CDX80831.1| BnaC03g00850D [Brassica napus]
Length=313

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 154/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  527   ALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLT  706
             +L++ +A NPND EALQSL++ K+Q++N+  A+ I+NRL+ L+P E EW +L+  +    
Sbjct  104   SLEKHIATNPNDSEALQSLMKIKLQSKNLDQALEILNRLISLDPEEQEWRILKAQVQTYG  163

Query  707   GEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKK  886
             G+F++A +GF EIL+K+PL VEAYHGL+ A S  D   +L  +E RI +A++ CK EDKK
Sbjct  164   GDFDSATKGFEEILAKDPLRVEAYHGLVMAYS--DSESKLSELEGRIGEAIERCKREDKK  221

Query  887   GQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKH  1066
                RDF LL+AQIR +E +  EAL+VYQELVK+EP DFRPYL Q ++YT+L K +EA+K 
Sbjct  222   KDFRDFMLLIAQIRVMEGNPSEALRVYQELVKDEPRDFRPYLCQGLIYTLLKKKEEAEKQ  281

Query  1067  FQMYRELLPEGHPYSSFLDNTMI-ASKLFA  1153
             F+ +R L+PE HPY  + D+ M+  +KLFA
Sbjct  282   FEQFRRLVPENHPYKDYFDSNMLKTNKLFA  311



>emb|CDX93382.1| BnaC04g45140D [Brassica napus]
Length=327

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 151/204 (74%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+++P+DV AL+SL+E +I+++ + +AI ++NRL++LEP E EWP+L+ ++   +G+ E+
Sbjct  114   LSSHPDDVSALRSLMEVRIKSRKLLEAIDLINRLIDLEPEEKEWPILKANILSHSGDSES  173

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EI+SK+PL VEAYHGL  A S  D  ++LK +E RI +AM  CK E     LRD
Sbjct  174   AKNAFEEIISKDPLRVEAYHGLAMAYS--DSGDDLKAVEGRIREAMVRCKKERNVKDLRD  231

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR +E  +EEALK+YQELVKEEP DFRPYL Q I+YT+L K  EA+K F+ +R
Sbjct  232   FKLLVAQIRVLEGKHEEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKGGEAEKQFEKFR  291

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P  HPY  +  + M+A+KLFA
Sbjct  292   RLVPRNHPYREYFMDNMVATKLFA  315



>ref|XP_002533008.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29383.1| conserved hypothetical protein [Ricinus communis]
Length=341

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL++RLA NPND++ L+SL+E +I+++ +  AI +V+RL+ELEP E EWPLL++ +F 
Sbjct  121   ERALEDRLARNPNDIDTLRSLMEVRIKSRKLLQAIEVVDRLIELEPDEDEWPLLKSQIFS  180

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSED-DQVEELKGIEERILKAMKLCKTE  877
              +G+FE+AR+GF EIL K+PL VEAYHGL+ A +E  D V++   + +RI  AM  C+ E
Sbjct  181   YSGDFESARKGFEEILEKDPLRVEAYHGLVMAHAESGDSVDK---VLKRIESAMDKCRKE  237

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              KK  LRDFKLL+AQIR +E  Y +AL VY+ELVKEEP DFRPYL Q I+YT+L K +EA
Sbjct  238   KKKSDLRDFKLLIAQIRVMEEKYVDALNVYEELVKEEPRDFRPYLCQGIIYTLLRKKEEA  297

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             +K F+ +R+L+P+ HPY  F  + M A+  F+
Sbjct  298   EKKFEQFRKLVPKNHPYREFFLDNMFATTFFS  329



>emb|CDY18448.1| BnaA04g21390D [Brassica napus]
Length=326

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+++P+DV AL+SL+E +I+++ + +AI ++NRL++LEP E EWP+L+ ++   +G+ ++
Sbjct  115   LSSHPDDVSALRSLMEVRIKSRKLLEAIDLINRLIDLEPDEKEWPILKANVLSHSGDSDS  174

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EI++K+PL VEAYHGL  A S  D  ++LK +EERI +AM  CK + K   LRD
Sbjct  175   AKTAFEEIIAKDPLRVEAYHGLAMAYS--DSGDDLKAVEERIREAMVRCKKDVK--DLRD  230

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR +E  +EEAL++YQELVKEEP DFRPYL Q I+YT+L K  EA+K F+ +R
Sbjct  231   FKLLVAQIRVLEGKHEEALRLYQELVKEEPRDFRPYLCQGIIYTLLKKGGEAEKQFEKFR  290

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P  HPY  +  + M+A+KLFA
Sbjct  291   RLVPRNHPYREYFMDNMVATKLFA  314



>ref|XP_010504124.1| PREDICTED: uncharacterized protein LOC104781214 [Camelina sativa]
Length=343

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L  +P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  119   ERALDEHLVTHPSDVDALRSLMEVKIRSRKLTEAVEVIDRLIKLEPDEKEWPVLKANIFT  178

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E 
Sbjct  179   YSGDLDLAKTGFEEILAKDPLHVEAYHGLLMAYS--DAGLDLKDVETRIEEAMLKCKKEG  236

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                  RDFKLL+AQIR IE  + EAL++YQEL KEEP DFRPYL Q ++YT+L K  +A+
Sbjct  237   NDNDFRDFKLLVAQIRVIEGKHSEALELYQELEKEEPRDFRPYLCQGMIYTLLKKKDKAE  296

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  297   EQFDKFRKLVPKNHPYREYFMDNMIATKLFS  327



>ref|XP_010427008.1| PREDICTED: uncharacterized protein LOC104711924 [Camelina sativa]
Length=342

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 155/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L ++P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  118   ERALDEHLISHPSDVDALRSLMEVKIRSRKLTEAVKVIDRLIKLEPDEKEWPVLKANIFT  177

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E 
Sbjct  178   YSGDLDLAKTGFEEILAKDPLRVEAYHGLLMAYS--DAGLDLKDVENRIEEAMLKCKKEG  235

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                  RDFKLL+AQIR IE  + EAL++YQEL KEEP DFRPYL Q +++T+L K  +A+
Sbjct  236   NDNDFRDFKLLVAQIRVIEGKHSEALELYQELEKEEPRDFRPYLCQGMVFTLLKKKDKAE  295

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  296   EQFDKFRKLVPKNHPYREYFMDNMIATKLFS  326



>ref|XP_004493905.1| PREDICTED: uncharacterized protein LOC101501574 [Cicer arietinum]
Length=354

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 150/209 (72%), Gaps = 2/209 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EKA++ RL+ NPND EAL++L+E K + + + ++I +++RL+E+EP E EWPLL+ ++++
Sbjct  134   EKAIEARLSQNPNDAEALRALMEVKFRARKVDESIGVIDRLIEIEPEEMEWPLLKANMYI  193

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
                + E+A+  F +IL K+PL VEA+HGL+ A  E    E LKG+ +R+ KAM+LCK + 
Sbjct  194   YNDDHESAKTLFEDILKKDPLRVEAFHGLVMATLESH--EPLKGLLKRVEKAMELCKKQK  251

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +   +RDF+LL+ QI+ IE ++ EALK YQ+LVKEEP DFRPYL Q I+YT+L K  EA+
Sbjct  252   RVSDVRDFRLLVGQIKVIEGNFSEALKAYQDLVKEEPRDFRPYLCQGIIYTLLRKKDEAE  311

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKL  1147
             K F  +R L+P+ HPY  + D+ M  +K 
Sbjct  312   KQFDQFRRLVPKNHPYKEYFDDNMYGTKF  340



>ref|XP_009141655.1| PREDICTED: uncharacterized protein LOC103865595 [Brassica rapa]
Length=322

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+++P+DV AL+SL+E +I+++ + +AI ++NRL++LEP+E EWP+L+ ++   +G+ ++
Sbjct  111   LSSHPDDVSALRSLMEVRIKSRKLLEAIDLINRLIDLEPNEKEWPILKANVLSHSGDSDS  170

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EI++K+PL VEAYHGL  A S  D  ++LK +EERI +AM  CK + K   LRD
Sbjct  171   AKTAFEEIIAKDPLRVEAYHGLAMAYS--DSGDDLKAVEERIREAMVRCKKDVK--DLRD  226

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             FKLL+AQIR +E  +EEALK+YQELVKEEP DFRPYL Q I+YT+L K  EA+K F+ +R
Sbjct  227   FKLLVAQIRVLEGKHEEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKGGEAEKQFEKFR  286

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
              L+P  HPY  +  + M+A KLFA
Sbjct  287   RLVPRNHPYREYFMDNMVAKKLFA  310



>ref|XP_010515851.1| PREDICTED: uncharacterized protein LOC104791622 [Camelina sativa]
Length=342

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 154/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+AL E L  +P+DV+AL+SL+E KI+++ + +A+ +++RL++LEP E EWP+L+ ++F 
Sbjct  118   ERALDEHLITHPSDVDALRSLMEVKIRSRKLTEAVEVIDRLIKLEPDEKEWPVLKANIFT  177

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ + A+ GF EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E 
Sbjct  178   YSGDLDLAKTGFEEILAKDPLHVEAYHGLLMAYS--DAGLDLKDVETRIEEAMLKCKKEG  235

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                  RDFKLL+AQIR IE  + EAL++YQEL KEEP DFRPYL Q ++YT+L K  +A+
Sbjct  236   NDNDFRDFKLLVAQIRVIEGKHSEALELYQELEKEEPRDFRPYLCQGMIYTLLKKKDKAE  295

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  +R+L+P+ HPY  +  + MIA+KLF+
Sbjct  296   EQFDKFRKLVPKNHPYREYFMDNMIATKLFS  326



>ref|XP_009631496.1| PREDICTED: uncharacterized protein LOC104121251 [Nicotiana tomentosiformis]
Length=359

 Score =   220 bits (561),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/359 (41%), Positives = 215/359 (60%), Gaps = 37/359 (10%)
 Frame = +2

Query  134   MNAFTHFSAKPNL---NFLPSLNNHRPVLVR-PLS-SLSFTT------QPQHVPIKASSS  280
             MN    F+AK N     F+PS + H  +L + PL+ SLSF T         ++PIK+SSS
Sbjct  1     MNTLNPFAAKTNHFHNQFIPSFHQHCSLLTKQPLNNSLSFRTPLPPSLSSSYLPIKSSSS  60

Query  281   FSPEFSVPKPAKQETAKS--SPGILETLT-------------QSHFQTPFS----Cavva  403
              +P+   PK  K  T  S   P ++ T+T             +S   TP S        +
Sbjct  61    -NPKAPKPKTFKSLTPLSFLKPTLISTITATALFFTGFYLNPKSAISTPLSPPPSADTTS  119

Query  404   tvaaaavFLGRFSLRVNPSIaapvsapataeaavsdaetEKALQERLAANPNDVEALQSL  583
                       +  L  NP          TA  AVSD+ TE AL+  + +NP  VE L+++
Sbjct  120   VNEENTEDALKEELLSNPD-----DVDTTANEAVSDSNTENALEGEVLSNPKGVEVLRNM  174

Query  584   VESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPL  763
             +E+ I+N+ + DA+SI+N+L+ELEP+ETEW  L++HL+V  GE E A+ GF E++ K+P 
Sbjct  175   LENHIKNRELVDALSILNKLIELEPNETEWHFLKSHLYVHNGELELAKIGFREVILKDPY  234

Query  764   LVEAYHGLIT-AVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEY  940
              VEAY GL+  A SED   +E+K IE+++ + +K+C+ E++K ++RDFKLLLAQI  IE 
Sbjct  235   HVEAYRGLVVVAGSEDKSTKEMKEIEKKVAEGIKICEEENRKDEMRDFKLLLAQIWVIEG  294

Query  941   DYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSF  1117
              Y++ALKVY ELV EEP+DFRPYL Q ++YTML K+ EA+K+F+ YR L+   +P + F
Sbjct  295   KYDDALKVYHELVDEEPSDFRPYLCQGMIYTMLKKNDEAEKYFEKYRGLVLRENPNARF  353



>ref|XP_007027123.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
 gb|EOY07625.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative 
[Theobroma cacao]
Length=340

 Score =   219 bits (558),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 192/331 (58%), Gaps = 26/331 (8%)
 Frame = +2

Query  185   SLNNHRPVLVRPLSSLSFTTQP-----QHVPIKASSSFSPEFSVPKPAKQETAK---SSP  340
             S N++RP   +P+SSLSF T P           +SSS +P    PKP+  +T      + 
Sbjct  17    SFNHNRPSFPKPISSLSFRTSPIKLSSIRASSSSSSSSAPLCQNPKPSLFQTLTPLLKTT  76

Query  341   GILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaavsdaet  520
              I  T+  + F T F              +   S   N S+                   
Sbjct  77    CIAVTVAAALFSTRFHQKPALAAPIVTPTVESTSTDTNISLEDQ----------------  120

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK ++E L   PND EAL+SL+E +I+ + +  AI +++RL+ELEP +TEWP+L+  +  
Sbjct  121   EKTIEEHLTQYPNDAEALRSLMEVRIKAKKLQQAIEVIDRLIELEPEDTEWPMLKAQIHS  180

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+FE A++ F EIL+K+P+ VEAYHGL+ A SE  Q  ++K +E+RI  AM+ CK E 
Sbjct  181   YGGDFELAKKEFEEILAKDPVRVEAYHGLVMAYSESGQ--KMKELEKRIEGAMEKCKKEK  238

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K    RDFKLL+AQIR IE ++ EALKVY+ LVKEEP DFRPYL   I+YT+L K  EA+
Sbjct  239   KYKDFRDFKLLIAQIRVIEGNHWEALKVYEALVKEEPRDFRPYLCMGILYTLLKKKDEAE  298

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P  HPY  +  + M+A+K+F 
Sbjct  299   KQFEKFRKLVPRNHPYREYFVDNMVATKIFG  329



>ref|XP_010097377.1| hypothetical protein L484_008900 [Morus notabilis]
 gb|EXB67883.1| hypothetical protein L484_008900 [Morus notabilis]
Length=330

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+A +E+++ +P+D EAL+SL+E+KI+   + +A+ +++RL+ELEP + EWPLL+ ++  
Sbjct  112   ERASEEQVSRDPDDAEALRSLMEAKIKANKLDEAVQVLDRLIELEPEDLEWPLLKANIHS  171

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A   F  IL K+PL VEAYHGL+ A S+    E+L G+  R+ +AMK C+ + 
Sbjct  172   HNGELELAESEFEAILEKDPLRVEAYHGLVMAASQSG--EKLNGMVRRVEEAMKRCEKQR  229

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K + RDFKLL+AQI+ +E +Y +ALK+YQEL K+EP DFRPYL Q I+YT+L K  EA+
Sbjct  230   NKSEARDFKLLIAQIKVMESNYSDALKLYQELAKDEPRDFRPYLCQGIIYTLLRKKNEAE  289

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F  +R L+P+ HPY  + D+ M A+KLFA
Sbjct  290   KQFDKFRRLVPKNHPYREYFDDNMFATKLFA  320



>ref|XP_010553027.1| PREDICTED: uncharacterized protein LOC104823250 [Tarenaya hassleriana]
Length=327

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 155/212 (73%), Gaps = 3/212 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E AL++ LA+NPNDVEALQSLV+ K Q+Q +  AI+I++RL+E+EP E EWP+L+  L  
Sbjct  115   EAALEQHLASNPNDVEALQSLVKIKFQSQKLRQAITILDRLIEIEPDEHEWPVLKAQLQT  174

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G++++A RGF EIL+K+P  VEAYHGL+ A S+ D   +L  +E RI   ++ CK E 
Sbjct  175   YNGDYDSATRGFEEILAKDPFRVEAYHGLVMAYSDSDS--KLSELENRINGVVEKCKEEK  232

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K+  LRDF LL+AQIR IE +  EAL+VY+ELVK+EP DFRPYL Q ++YT++ K  EA+
Sbjct  233   KQKDLRDFMLLIAQIRVIEGNPMEALRVYEELVKDEPEDFRPYLCQGLIYTLMKKKDEAE  292

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIAS-KLFA  1153
             K F+ +R L+PE HPY  + D+ MI + KLF+
Sbjct  293   KQFEQFRRLVPENHPYMEYFDSNMINTQKLFS  324



>ref|XP_008369840.1| PREDICTED: uncharacterized protein LOC103433367 [Malus domestica]
Length=358

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 149/211 (71%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E LA NP+DVEAL++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  138   ERVLEEHLARNPDDVEALRNLMEVRIKSHKLTEAIQVLERLIELEPEDFEWQLLKANVHS  197

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A   F +IL+K+P  VEA+HGL+   S+    E+LK + +R+ +AM  CK E 
Sbjct  198   YMGEVELANAEFEDILAKDPFKVEAFHGLVMCASQPP--EKLKSVTKRVEEAMMKCKKEG  255

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E  Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  256   NMSDVRDFKLLVAQIRVMESKYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  315

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  316   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  346



>gb|KFK34608.1| hypothetical protein AALP_AA5G167700 [Arabis alpina]
Length=328

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 153/204 (75%), Gaps = 2/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L +NP+D++AL+SL+E +I+++ + +AI +++RL++LEP E+EWP+L+ +++  +G+ ++
Sbjct  115   LVSNPSDIDALRSLMEVRIKSRKLVEAIEVIDRLIKLEPEESEWPILKANVYTYSGDLDS  174

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+ GF EIL K+PL VEAYHGL+  ++ +D   +LK +E+RI +AM  CKT+      RD
Sbjct  175   AKTGFEEILDKDPLSVEAYHGLV--MTYNDSGLDLKDVEKRIEEAMFKCKTDKNDNDFRD  232

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              KLL+AQIR IE  + EALK+YQEL KEEP DFRPYL Q I+YT+L K  +A++ F  +R
Sbjct  233   LKLLVAQIRVIEGKHSEALKLYQELSKEEPRDFRPYLCQGIIYTLLKKKDKAEEQFDKFR  292

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
             +L+PE HPY  +  + MIA+KLF+
Sbjct  293   KLVPENHPYREYFMDNMIATKLFS  316



>ref|XP_009377114.1| PREDICTED: uncharacterized protein LOC103965763 [Pyrus x bretschneideri]
Length=358

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 150/211 (71%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E+LA NP+DVE+L++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  138   ERVLEEQLAQNPDDVESLRNLMEVRIKSHKLNEAIQVLERLIELEPEDFEWQLLKANVHS  197

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A   F +IL+K+P  VEA+HGL+   S+    E+LK + +R+ +AM  CK E 
Sbjct  198   YMGEVELANAEFEDILAKDPFKVEAFHGLVMCASQSP--EKLKSVTKRVEEAMVKCKKEG  255

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E  Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  256   NMSDVRDFKLLVAQIRVMESRYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  315

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  316   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  346



>ref|XP_008447473.1| PREDICTED: uncharacterized protein LOC103489908 [Cucumis melo]
Length=345

 Score =   216 bits (551),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 149/211 (71%), Gaps = 1/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  ++E+ A + NDVEAL+SLVE  +++  + +A+  +NRL+ELEP++ E P+LR +   
Sbjct  124   ESVVEEKRADDSNDVEALRSLVEESVKSGKLPEAVEALNRLIELEPNDVELPMLRANFHS  183

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A+  F EIL+K+PL VEAYHGL   V+E      LK + +RI +AM+ CK + 
Sbjct  184   YMGELELAKNEFEEILAKDPLRVEAYHGL-AMVAEQLNDNSLKDVTKRIEEAMEKCKNQK  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K  +RDFKLL+AQI+ +E  Y +ALK YQELV+EEP DFRPYL Q I+YT+L K +EA+
Sbjct  243   DKSDIRDFKLLVAQIKVMEGSYLDALKAYQELVREEPRDFRPYLCQGIIYTLLRKSEEAE  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             KHF+ +R L+P+ HPY  +LD+ M A+K FA
Sbjct  303   KHFEKFRRLVPKNHPYKEYLDDNMYATKFFA  333



>ref|XP_009103870.1| PREDICTED: uncharacterized protein LOC103829939 [Brassica rapa]
Length=328

 Score =   216 bits (549),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
             A +P DV++L+SL+E KI+++ + +A+ +V+RL++LEP E EWP+L+ ++F  +GE ++A
Sbjct  116   ATHPPDVDSLRSLMEVKIRSRKLTEAVEVVDRLIKLEPEEPEWPVLKANIFTYSGEIDSA  175

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
                F EIL+K+PL VEAYHGL+ A S  D   +LK +E RI +AM  CK E+     RDF
Sbjct  176   TASFEEILAKDPLRVEAYHGLVMAYS--DAGLDLKEVESRIEEAMLGCKKENNHNDFRDF  233

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KLLLAQIR IE  + EALK+Y+ELVKEEP DFRPYL Q ++Y +L K  +A++ F  +RE
Sbjct  234   KLLLAQIRVIEGKHSEALKLYRELVKEEPGDFRPYLCQGVIYMLLKKKDKAEEQFDKFRE  293

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+PE HPY  +  + +IASKLF+
Sbjct  294   LVPENHPYREYFMDNLIASKLFS  316



>ref|XP_004142089.1| PREDICTED: uncharacterized protein LOC101218852 isoform 1 [Cucumis 
sativus]
 ref|XP_004142090.1| PREDICTED: uncharacterized protein LOC101218852 isoform 2 [Cucumis 
sativus]
 gb|KGN54218.1| hypothetical protein Csa_4G293280 [Cucumis sativus]
Length=345

 Score =   216 bits (551),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  ++E+ A + NDVEAL+SLVE  +++  + +AI  +NRL+ELEP++ E PLL+ + + 
Sbjct  124   ESVVEEKRADDSNDVEALRSLVEENVKSGKLPEAIEALNRLIELEPNDPELPLLKANFYS  183

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A+  F +IL+++P +VEAYHGL T V+E      LK + +RI +AMK CK + 
Sbjct  184   YMGELELAKNEFEDILARDPFVVEAYHGLAT-VAEQLNDNSLKDVAKRIEEAMKKCKNQK  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K  +RDFKLL+AQI+ +E  Y EALK Y+ELV+EEP DFRPYL Q I+YT+L K +EA+
Sbjct  243   DKSDIRDFKLLVAQIKVMEGSYHEALKAYKELVREEPRDFRPYLCQGIIYTLLSKSEEAE  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K+F+ +R L+P+ HPY  +LD  M A+KL A
Sbjct  303   KYFEKFRRLVPKNHPYKEYLDENMFATKLIA  333



>ref|XP_004168689.1| PREDICTED: uncharacterized protein LOC101226779 isoform 1 [Cucumis 
sativus]
 ref|XP_004168690.1| PREDICTED: uncharacterized protein LOC101226779 isoform 2 [Cucumis 
sativus]
Length=345

 Score =   216 bits (551),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  ++E+ A + NDVEAL+SLVE  +++  + +AI  +NRL+ELEP++ E PLL+ + + 
Sbjct  124   ESVVEEKRADDSNDVEALRSLVEENVKSGKLPEAIEALNRLIELEPNDPELPLLKANFYS  183

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE E A+  F +IL+++P +VEAYHGL T V+E      LK + +RI +AMK CK + 
Sbjct  184   YMGELELAKNEFEDILARDPFVVEAYHGLAT-VAEQLNDNSLKDVAKRIEEAMKKCKNQK  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K  +RDFKLL+AQI+ +E  Y EALK Y+ELV+EEP DFRPYL Q I+YT+L K +EA+
Sbjct  243   DKSDIRDFKLLVAQIKVMEGSYHEALKAYKELVREEPRDFRPYLCQGIIYTLLSKSEEAE  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K+F+ +R L+P+ HPY  +LD  M A+KL A
Sbjct  303   KYFEKFRRLVPKNHPYKEYLDENMFATKLIA  333



>ref|XP_010509341.1| PREDICTED: uncharacterized protein LOC104785771 [Camelina sativa]
Length=337

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 159/211 (75%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E++++E L ++P DV+ L+ LVE KI++Q + +AI +++RL+ELEP E EWP+L+ ++F+
Sbjct  117   ERSIEEHLVSHPEDVQCLRGLVEIKIKSQKLTEAIELIDRLLELEPEEKEWPILKANIFI  176

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+F++A+ GF EI++KEPL VEAYHGL+ A S  D  +EL  +E+RI +AM  CK E 
Sbjct  177   HSGDFDSAKNGFEEIIAKEPLRVEAYHGLVMAYS--DSGDELSSVEKRIEEAMVRCKKEK  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 LRDFKLL+AQIR +E  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+
Sbjct  235   NLKDLRDFKLLVAQIRVVEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKEDEAE  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R L+P+ HPY  +  + + A+KL+A
Sbjct  295   KKFEKFRRLVPKNHPYRQYFMDNVGATKLYA  325



>ref|XP_008350418.1| PREDICTED: uncharacterized protein LOC103413758 [Malus domestica]
Length=359

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 150/211 (71%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E+L+ NP+DVEAL++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  139   ERVLEEQLSQNPDDVEALRNLMEVRIKSNKLAEAIQVLERLIELEPEDFEWQLLKANVHS  198

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE + A   F +ILSK P  VEA+HGL+ + S+    E+LK + +R+ +AM  CK + 
Sbjct  199   YMGEVDLANSEFEDILSKNPFKVEAFHGLVMSASQSP--EKLKSVMKRVEEAMVKCKKDG  256

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E  Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  257   NMSDVRDFKLLVAQIRVMESKYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  316

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  317   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  347



>ref|NP_568104.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAM62453.1| unknown [Arabidopsis thaliana]
 gb|AED90494.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=326

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 147/205 (72%), Gaps = 4/205 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NPNDVEALQSL++ K Q +NI  A+ I+NRL+E++P E EW +L+  +    G+F++
Sbjct  122   LTKNPNDVEALQSLMKIKFQTKNIDHALEILNRLIEIQPEEQEWRILKAQVQTYGGDFDS  181

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A +GF E+LSK+P  VEAYHGL+ A SE +   +L  IE RI +A++ CK E+KK   RD
Sbjct  182   ATKGFEEVLSKDPFRVEAYHGLVMAYSESES--KLSEIESRINEAIEKCKKENKKD-FRD  238

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
             F LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+K F  +R
Sbjct  239   FMLLIAQIRVIKGNPIEALRVYQELVKDEPKDFRPYLCQGLIYTLMKKKDEAEKQFAEFR  298

Query  1082  ELLPEGHPYSSFLD-NTMIASKLFA  1153
              L+PE HPY  +LD N +  +KLFA
Sbjct  299   RLVPENHPYKEYLDANVLNTNKLFA  323



>ref|XP_009374643.1| PREDICTED: uncharacterized protein LOC103963542 [Pyrus x bretschneideri]
Length=358

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E+L+ NP+DVEAL++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  138   ERVLEEQLSQNPDDVEALRNLMEVRIKSNKLAEAIQVLERLIELEPEDFEWQLLKANVHS  197

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE + A   F +ILSK+P  VEA+HGL+ + S+    E+L  + +R+ +AM  CK + 
Sbjct  198   YMGEVDLANAEFEDILSKDPFKVEAFHGLVMSASQSP--EKLNSVMKRVEEAMVKCKKDG  255

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E +Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  256   NMSDVRDFKLLVAQIRVMESEYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  315

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  316   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  346



>ref|XP_009341592.1| PREDICTED: uncharacterized protein LOC103933625 [Pyrus x bretschneideri]
Length=358

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E+L+ NP+DVEAL++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  138   ERVLEEQLSQNPDDVEALRNLMEVRIKSNKLAEAIQVLERLIELEPEDFEWQLLKANVHS  197

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE + A   F +ILSK+P  VEA+HGL+ + S+    E+L  + +R+ +AM  CK + 
Sbjct  198   YMGEVDLANAEFEDILSKDPFKVEAFHGLVMSASQSP--EKLNSVMKRVEEAMVKCKKDG  255

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E +Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  256   NMSDVRDFKLLVAQIRVMESEYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  315

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  316   KRFEKFRKLVPKNHPYKEYFDDNMFATKLFG  346



>ref|XP_010517010.1| PREDICTED: uncharacterized protein LOC104792528 [Camelina sativa]
Length=337

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E++++E L ++P DV+ L+ LVE KI++Q + +AI +++RL+ELEP E EWP+L+ ++F 
Sbjct  117   ERSIEEYLVSHPEDVKCLRGLVEIKIKSQKLTEAIELIDRLLELEPEEKEWPILKANIFS  176

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A+ GF EI++KEPL VEAYHGL+ A S  D   EL  +E+RI +AM  CK E 
Sbjct  177   HSGDLESAKNGFEEIIAKEPLRVEAYHGLVMAYS--DSGAELSAVEKRIEEAMVRCKKEK  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 LRDFKLL+AQIR +E  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+
Sbjct  235   NLKDLRDFKLLVAQIRVVEGKHYEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKEDEAE  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R L+P+ HPY  +  + M+A+KL+A
Sbjct  295   KKFEKFRRLVPKNHPYREYFMDNMVATKLYA  325



>ref|XP_008350416.1| PREDICTED: uncharacterized protein LOC103413756 [Malus domestica]
Length=359

 Score =   214 bits (545),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 149/211 (71%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+ L+E+L+ NP+D EAL++L+E +I++  + +AI ++ RL+ELEP + EW LL+ ++  
Sbjct  139   ERVLEEQLSQNPDDXEALRNLMEVRIKSNKLAEAIQVLERLIELEPEDFEWQLLKANVHS  198

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE + A   F +ILSK P  VEA+HGL+ + S+    E+LK + +R+ +AM  CK + 
Sbjct  199   YMGEVDLANSEFEDILSKNPFKVEAFHGLVMSASQSP--EKLKSVMKRVEEAMVKCKKDG  256

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 +RDFKLL+AQIR +E  Y +ALK+YQELV+EEP DFRPYL Q I+YTML K  EA+
Sbjct  257   NMSDVRDFKLLVAQIRVMESKYSDALKLYQELVREEPRDFRPYLCQGIIYTMLRKTNEAE  316

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R+L+P+ HPY  + D+ M A+KLF 
Sbjct  317   KQFEKFRKLVPKNHPYKEYFDDNMFATKLFG  347



>ref|XP_008788995.1| PREDICTED: uncharacterized protein LOC103706623 [Phoenix dactylifera]
Length=342

 Score =   214 bits (544),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 153/205 (75%), Gaps = 1/205 (0%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L ++P+DV +L++L+E K+++Q + +AI IV+RL+ LEP E + PLL+ HL   +G+ ET
Sbjct  125   LDSHPDDVRSLRALMELKVKSQKLPEAIDIVDRLVALEPGEKDLPLLKAHLQSYSGDAET  184

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQV-EELKGIEERILKAMKLCKTEDKKGQLR  898
             A++GF EIL + P  VEAYHGL+   S+ ++  EEL GI +R+ +AM++CK E KK +LR
Sbjct  185   AKQGFEEILQQNPFCVEAYHGLVMVASQSEESDEELDGILKRVEEAMEMCKKEKKKEELR  244

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             DF+LL+AQIR  +  YEEALK+Y+ELVKEEP DFRPYL Q I+YT+L K   A+K FQ Y
Sbjct  245   DFELLVAQIRVTKGKYEEALKLYEELVKEEPGDFRPYLCQGIIYTLLRKKDAAEKQFQKY  304

Query  1079  RELLPEGHPYSSFLDNTMIASKLFA  1153
             + L+P+GHPY+ + +  M+A K+F 
Sbjct  305   QRLVPKGHPYARYFEENMMAMKIFG  329



>ref|XP_006403675.1| hypothetical protein EUTSA_v10010528mg [Eutrema salsugineum]
 gb|ESQ45128.1| hypothetical protein EUTSA_v10010528mg [Eutrema salsugineum]
Length=334

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
             A +P DV++L+SL+E KI+++ + +A+ +++RL++LEP E+EWP+L+ ++F  +G+ ++A
Sbjct  122   ATHPPDVDSLRSLMEVKIKSRKLTEAVEVIDRLIKLEPEESEWPVLKANIFTYSGDLDSA  181

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
             + GF EIL+K+P  +EAYHGL+ A S  D   +LK +E+RI +AM  CK E      RDF
Sbjct  182   KTGFEEILAKDPRSLEAYHGLLMAYS--DAGLDLKELEKRIEEAMLRCKQEKNDNDFRDF  239

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KLL+AQIR IE  + EALK+YQEL KEEP DFRPYL Q I+YT++ K  +A++ F  +R+
Sbjct  240   KLLVAQIRVIEGRHSEALKLYQELAKEEPRDFRPYLCQGILYTLMKKKDKAEEQFDKFRK  299

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+PE HP+  +  + M+A+KLF+
Sbjct  300   LVPENHPFREYFMDNMLATKLFS  322



>emb|CAB85996.1| putative protein [Arabidopsis thaliana]
Length=407

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 148/207 (71%), Gaps = 4/207 (2%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             + L  NPNDVEALQSL++ K Q +NI  A+ I+NRL+E++P E EW +L+  +    G+F
Sbjct  120   KHLTKNPNDVEALQSLMKIKFQTKNIDHALEILNRLIEIQPEEQEWRILKAQVQTYGGDF  179

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             ++A +GF E+LSK+P  VEAYHGL+ A SE +   +L  IE RI +A++ CK E+KK   
Sbjct  180   DSATKGFEEVLSKDPFRVEAYHGLVMAYSESES--KLSEIESRINEAIEKCKKENKK-DF  236

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             RDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+K F  
Sbjct  237   RDFMLLIAQIRVIKGNPIEALRVYQELVKDEPKDFRPYLCQGLIYTLMKKKDEAEKQFAE  296

Query  1076  YRELLPEGHPYSSFLD-NTMIASKLFA  1153
             +R L+PE HPY  +LD N +  +KLFA
Sbjct  297   FRRLVPENHPYKEYLDANVLNTNKLFA  323



>ref|XP_010505323.1| PREDICTED: uncharacterized protein LOC104782163 isoform X1 [Camelina 
sativa]
 ref|XP_010505325.1| PREDICTED: uncharacterized protein LOC104782163 isoform X3 [Camelina 
sativa]
Length=337

 Score =   211 bits (536),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 157/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E++++E L ++P DV+ L+ LVE KI++Q + +AI +++RL+ELEP E EWP+L+ ++F 
Sbjct  117   ERSIEEYLVSHPEDVQCLRGLVEIKIKSQKLTEAIELIDRLLELEPEEKEWPILKANIFS  176

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A+ GF EI++KEPL VEAYHGL+ A S  D  +EL  +E+RI +AM  CK E 
Sbjct  177   HSGDLESAKNGFEEIIAKEPLRVEAYHGLVMAYS--DSGDELSSVEKRIEEAMVRCKKEK  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 LRDFKLL+AQIR +E  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+
Sbjct  235   NLKDLRDFKLLVAQIRVVEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKEDEAE  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R L+P+ HPY  +  + + A++L+A
Sbjct  295   KKFEKFRRLVPKNHPYRQYFMDNIGATRLYA  325



>ref|XP_008442587.1| PREDICTED: uncharacterized protein LOC103486414 [Cucumis melo]
Length=348

 Score =   211 bits (537),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 186/328 (57%), Gaps = 16/328 (5%)
 Frame = +2

Query  194   NHRPVLVRPLSSLSFTTQ-----------PQHVPIKASSSFSPEFSVPKPAKQETAKSSP  340
             +H P   +PLSSLSF T+            +  P   SSS    F  P+  +     S  
Sbjct  11    HHLPSFSKPLSSLSFRTRLSIPSPSSKSSSRAFPSFLSSSLDSVFQTPRRPRS----SLT  66

Query  341   GILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaavsdaet  520
              IL+ ++ S  +T       A       F G+ ++          S   + +   S  E 
Sbjct  67    QILDPISSSVLKTTCVTLTTAAALFFMRFCGKPAIAAPIPPPTVESVEESTKDEASRGEK  126

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  L+E L  N NDVEALQSL+E  ++ +   +AI I++RL++LEP++ EW +L+ ++  
Sbjct  127   ETVLEEELVNNSNDVEALQSLIEVNVKARKFPEAIKILDRLIKLEPNDLEWLVLKANVHS  186

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+ E AR+ F +IL K+P  VEAYHGL+  ++E   ++ LK I  R+ +A++ CK   
Sbjct  187   HVGDSELARKEFQKILEKDPFQVEAYHGLVM-LTETSDIDSLKAILIRVEEALEHCKKYK  245

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
              K + RDFKLL+AQI+ +E  Y EALK YQEL +EEP DFRPYL Q I+YT+L K+ EA+
Sbjct  246   GKSEERDFKLLIAQIKVMEGSYSEALKDYQELEREEPRDFRPYLCQGILYTLLKKNDEAE  305

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             K F+++R L+P+ HPY  + D  M A+K
Sbjct  306   KQFEVFRRLVPKNHPYKEYFDENMFATK  333



>ref|XP_010505324.1| PREDICTED: uncharacterized protein LOC104782163 isoform X2 [Camelina 
sativa]
Length=337

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 156/211 (74%), Gaps = 2/211 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E++++E L ++P DV+ L+ LVE KI++Q + +AI +++RL+ELEP E EWP+L+ ++F 
Sbjct  117   ERSIEEYLVSHPEDVQCLRGLVEIKIKSQKLTEAIELIDRLLELEPEEKEWPILKANIFS  176

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A+ GF EI++KEPL VEAYHGL+ A S  D   EL  +E+RI +AM  CK E 
Sbjct  177   HSGDLESAKNGFEEIIAKEPLRVEAYHGLVMAYS--DSGAELSAVEKRIEEAMVRCKKEK  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 LRDFKLL+AQIR +E  + EALK+Y+ELVKEEP DFRPYL Q I+YT+L K+ EA+
Sbjct  235   NLKDLRDFKLLVAQIRVVEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKEDEAE  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             K F+ +R L+P+ HPY  +  + + A++L+A
Sbjct  295   KKFEKFRRLVPKNHPYRQYFMDNIGATRLYA  325



>ref|XP_004137782.1| PREDICTED: uncharacterized protein LOC101207402 [Cucumis sativus]
 ref|XP_004172265.1| PREDICTED: uncharacterized LOC101207402 [Cucumis sativus]
 gb|KGN58898.1| hypothetical protein Csa_3G734980 [Cucumis sativus]
Length=346

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 187/332 (56%), Gaps = 20/332 (6%)
 Frame = +2

Query  194   NHRPVLVRPLSSLSFTTQ-----------PQHVPIKASSSFSPEFSVPKPAKQETAKSSP  340
             +H P   RPLSSLSF T+            +  P   SSSF   F  P    Q    S P
Sbjct  11    HHLPSFSRPLSSLSFRTRLSVPSSSSKSSSRAFPSFQSSSFDSVFRTP----QRPRSSLP  66

Query  341   GILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaavsdaet  520
              IL+ ++ S  +T       A       F G+ ++          S   + +   S  E 
Sbjct  67    LILDPISSSILKTTSVTLTAAAALFFMRFCGKPAIAAPIPPPTVDSVKESMKDEGSRGEK  126

Query  521   EKALQERLAANPND-VEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E  L+E L    ND VEAL+SL+E K++ +   +AI I++RL+ELEP++ EW +L+ +++
Sbjct  127   ETVLEEELV---NDSVEALRSLIEVKVKARKFPEAIKILDRLIELEPNDLEWLVLKANVY  183

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
                G  E AR  F +IL K+P  VEAYHGL+  ++E   ++ LK I  R+ +A++ CK  
Sbjct  184   SHVGNSELARNEFQKILEKDPFQVEAYHGLVM-LTETSDIDSLKAILNRVEEALEHCKKH  242

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
               K + RDFKLL+AQI+ +E  Y EALK YQEL +EEP DFRPYL Q I+YT+L ++ EA
Sbjct  243   KGKSEERDFKLLIAQIKVMEGSYSEALKDYQELKREEPRDFRPYLCQGILYTLLKRNDEA  302

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             +K F+++R L+P+ HPY  + D  M A+K F 
Sbjct  303   EKQFEIFRRLVPKNHPYKEYFDENMFAAKHFV  334



>emb|CDY52749.1| BnaA07g37640D [Brassica napus]
Length=812

 Score =   217 bits (553),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
             A +P DV++L+SL+E KI+++ + +A+ +V+RL++LEP E EWP+L+ ++F  +GE ++A
Sbjct  600   ATHPPDVDSLRSLMEVKIRSRKLTEAVEVVDRLIKLEPEEPEWPVLKANIFTYSGEIDSA  659

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
                F EIL+K+PL VEAYHGL+ A S  D   +LK +E RI  AM  CK E+     RDF
Sbjct  660   TASFEEILAKDPLRVEAYHGLVMAYS--DAGLDLKDVESRIEDAMLRCKEENNHNDFRDF  717

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KLLLAQIR IE  + EALK+Y+ELVKEEP DFRPYL Q ++YT+L K  +A++ F  +RE
Sbjct  718   KLLLAQIRVIEGKHSEALKLYRELVKEEPGDFRPYLCQGVIYTLLKKKDKAEEQFDKFRE  777

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+PE HPY  +  + +IASKLF+
Sbjct  778   LVPENHPYREYFMDNLIASKLFS  800



>ref|XP_010452105.1| PREDICTED: uncharacterized protein LOC104734270 [Camelina sativa]
Length=323

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E AL++RL+ NPNDVEALQSL++ K Q +N+  A+ I+NRL+E+EP E EW +L+  +  
Sbjct  116   EAALEKRLSNNPNDVEALQSLMKIKFQTKNLQHALEILNRLIEIEPEEQEWRILKAQVQT  175

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF E+L+K+P  VEAYHGL+ A SE +   +L  +E RI +A++ CK E+
Sbjct  176   YGGDFDSATKGFEEVLAKDPFRVEAYHGLVMAYSESES--KLSEVESRINEAIEKCKKEN  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  LRDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+
Sbjct  234   KKKDLRDFMLLIAQIRVIKGNPIEALRVYQELVKDEPRDFRPYLCQGLIYTLMKKKDEAE  293

Query  1061  KHFQMYRELLPEGHPYSSFLD-NTMIASKL  1147
             K F+ +R L+PE HPY  + D N +  +KL
Sbjct  294   KQFEEFRRLVPENHPYKEYFDANVLNTNKL  323



>ref|XP_007162682.1| hypothetical protein PHAVU_001G171200g [Phaseolus vulgaris]
 gb|ESW34676.1| hypothetical protein PHAVU_001G171200g [Phaseolus vulgaris]
Length=363

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 145/205 (71%), Gaps = 2/205 (1%)
 Frame = +2

Query  539   RLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             RL+ANP DV+AL++L+E KI+ + + +A ++++RL+EL+P E EWPLL+ ++ +   E  
Sbjct  149   RLSANPADVDALRALMECKIKARKLDEAFAVLDRLIELQPEEYEWPLLKANMHIYNDEHA  208

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLR  898
              AR  F E+L K+PL VEA+HGL+ A S+ +  E L+ + +R+  A + CK + +   +R
Sbjct  209   AARELFEEMLKKDPLRVEAFHGLVMATSQLN--EPLRALLKRVQAATETCKKQKRDSDVR  266

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             DF+LL+AQI+ +E D+ EALK YQ+LVKEEP DFRPYL Q I+YT+L K  EA K F  +
Sbjct  267   DFRLLIAQIKVMEGDFPEALKAYQDLVKEEPRDFRPYLCQGIIYTLLRKKDEADKQFDKF  326

Query  1079  RELLPEGHPYSSFLDNTMIASKLFA  1153
             R L+P+ HPY  + ++ M A+K F+
Sbjct  327   RRLVPKDHPYMEYFEDNMFATKFFS  351



>ref|XP_010937725.1| PREDICTED: uncharacterized protein LOC105057003 [Elaeis guineensis]
Length=342

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 152/205 (74%), Gaps = 1/205 (0%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L ++P+D+ +L++L+E K+++  + +AI IV+RL+ LEP E + PLL+ H+   +G+ ET
Sbjct  125   LHSHPDDIRSLRALMELKVKSWKLPEAIDIVDRLVALEPRERDLPLLKAHIQSYSGDAET  184

Query  722   ARRGFNEILSKEPLLVEAYHGLI-TAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLR  898
             A++GF EIL ++P  VEAYHGL+ TA    +  EE+ GI +R+ +AM+ CK E+K+  LR
Sbjct  185   AKQGFEEILQRDPFCVEAYHGLVMTASQSKESNEEMNGILKRVEEAMEKCKKEEKREDLR  244

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             DFKLL+AQIR I+  YEEALK+Y+ELVKEEP DFRPYL Q I+YT+L K  EA+K FQ Y
Sbjct  245   DFKLLVAQIRVIKGKYEEALKIYEELVKEEPEDFRPYLCQGIIYTLLRKKDEAEKKFQNY  304

Query  1079  RELLPEGHPYSSFLDNTMIASKLFA  1153
             R L+P GHPY+ + +  MIA K+F 
Sbjct  305   RRLVPMGHPYARYFEENMIAMKIFG  329



>emb|CDY07581.1| BnaC06g14830D [Brassica napus]
Length=839

 Score =   216 bits (549),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
             A +P DV++L+SL+E KI+++ + +A+ +V+RL++LEP E EWP+L+ ++F  +GE ++A
Sbjct  627   ATHPPDVDSLRSLMEVKIRSRKLTEAVEVVDRLIKLEPEEPEWPVLKANIFTYSGEIDSA  686

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
             +  F +IL+K+PL VEAYHGL+ A S  D   +L  +E RI +AM  CK E+     RDF
Sbjct  687   KASFEDILAKDPLRVEAYHGLVMAYS--DAGLDLNEVESRIEEAMLRCKKENNHNDFRDF  744

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KLLLAQIR IE  + EALK+Y+ELVKEEP DFRPYL Q ++YT+L K  +A++ F  +RE
Sbjct  745   KLLLAQIRVIEGKHGEALKLYRELVKEEPADFRPYLCQGVIYTLLKKKDKAEEQFDKFRE  804

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+PE HPY  +  + +IASKLF+
Sbjct  805   LVPENHPYREYFMDNLIASKLFS  827



>ref|XP_006288190.1| hypothetical protein CARUB_v10001425mg [Capsella rubella]
 gb|EOA21088.1| hypothetical protein CARUB_v10001425mg [Capsella rubella]
Length=328

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 146/205 (71%), Gaps = 2/205 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E AL++ LA NPNDV+ALQSL++ K Q +N+  A+ I+NRL+E+EP E EW + +  +  
Sbjct  121   EAALEKHLAENPNDVKALQSLMKIKFQTKNLEHALEILNRLIEIEPEEQEWRIFKAQVQT  180

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF E+LSK+P  VEAYHGL+ A SE +   +L  +E RI +A++ CK E+
Sbjct  181   YGGDFDSATKGFEEVLSKDPFRVEAYHGLVMAYSESES--KLSEVESRINEAIEKCKKEN  238

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK   RDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA 
Sbjct  239   KKKDFRDFMLLIAQIRVIKGNPTEALRVYQELVKDEPRDFRPYLCQGLIYTLMKKKDEAA  298

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMI  1135
             K F+ +R L+P+ HPY  + D  ++
Sbjct  299   KQFEEFRRLVPDDHPYKDYFDANVL  323



>ref|XP_002870981.1| hypothetical protein ARALYDRAFT_487037 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47240.1| hypothetical protein ARALYDRAFT_487037 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score =   201 bits (510),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             + L  NPNDVEALQSL++ K Q +N+  A+ I+NRL+E+EP E EW +L+  +    G+F
Sbjct  124   KHLTNNPNDVEALQSLMKIKFQTKNLDHALEILNRLIEIEPGEQEWRILKAQVQTYGGDF  183

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             E+A +GF EIL+K+P  VEAYHGL+ A SE +   +L  IE RI +A++ CK E+KK   
Sbjct  184   ESATKGFEEILAKDPFRVEAYHGLVMAYSESES--KLSEIESRINEAIEKCKKENKKKDF  241

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             RDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+K F+ 
Sbjct  242   RDFMLLIAQIRVIKGNPIEALRVYQELVKDEPKDFRPYLCQGLIYTLMKKKDEAEKQFEE  301

Query  1076  YRELLPEGHPYSSFLD-NTMIASKL  1147
             +R L+PE HPY  + D N +  +KL
Sbjct  302   FRRLVPENHPYKDYFDANVLNTNKL  326



>gb|KHN09442.1| hypothetical protein glysoja_016541 [Glycine soja]
Length=200

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 135/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  584   VESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPL  763
             +E KI+ + + +A  ++NRL+ELEP E EWPLL+ ++ +   +  +AR+ F EIL K+PL
Sbjct  1     MEVKIKARKMDEAFEVLNRLIELEPEEQEWPLLKANMHIYNDDHASARKLFEEILKKDPL  60

Query  764   LVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYD  943
              VEA+HGL+ A ++ +  E LK + +R+ +A+++CK + K   +RDF+LL+AQI+ +E D
Sbjct  61    RVEAFHGLVMATAQSN--EPLKSLLKRVEEAIEVCKKQKKDSDVRDFRLLIAQIKVMEGD  118

Query  944   YEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLD  1123
             Y EALK YQELVKEEP DFRPYL Q I+YT+L K  EA K F  +R L+P+ HPY  + +
Sbjct  119   YTEALKAYQELVKEEPRDFRPYLCQGIIYTLLRKKDEADKQFNKFRRLVPKDHPYKDYFE  178

Query  1124  NTMIASKLFA  1153
             + M A+K F+
Sbjct  179   DNMFATKFFS  188



>ref|XP_010423842.1| PREDICTED: uncharacterized protein LOC104708884 [Camelina sativa]
Length=330

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = +2

Query  539   RLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             RLA NPNDVEAL SL++ K Q +N+  A+ I+NRL+E+EP E EW +L+  +    G+F+
Sbjct  129   RLANNPNDVEALHSLMKIKFQTKNLQHALEILNRLIEIEPEEQEWRILKAQVQTYGGDFD  188

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLR  898
             +A +GF E+L+K+P  VEAY GL+ A SE +   +L  +E RI +A++ CK E+KK  LR
Sbjct  189   SATKGFEEVLAKDPFRVEAYQGLVMAYSESNS--KLAEVESRINEAIEKCKKENKKKDLR  246

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             DF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++Y ++ K  EA+K F+ +
Sbjct  247   DFMLLIAQIRVIKGNLIEALRVYQELVKDEPKDFRPYLCQGLIYKLMKKKDEAEKQFEEF  306

Query  1079  RELLPEGHPYSSFLD-NTMIASKL  1147
             R L+PE HPY+ + D N +  +KL
Sbjct  307   RRLVPENHPYTEYFDANVLNTNKL  330



>ref|XP_010490721.1| PREDICTED: uncharacterized protein LOC104768428 [Camelina sativa]
Length=320

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 149/210 (71%), Gaps = 3/210 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E AL+ RLA NPNDVEALQSL++ K Q ++    + I+NRL+E+EP E EW +L+  +  
Sbjct  113   EAALEMRLANNPNDVEALQSLMKIKFQTKHHQHGLEILNRLIEIEPEEQEWRILKAQVQT  172

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A +GF E+L+K+P  VEAY GL+ A +E +   +L  +E RI +A++ CK E+
Sbjct  173   YGGDFDSATKGFEEVLAKDPFRVEAYQGLVMAYTESES--KLSEVESRINEAIEKCKKEN  230

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             KK  +RDF LL+AQIR I+ +  EAL+VYQELVK+EP DFRPYL Q ++YT++ K  EA+
Sbjct  231   KKKDVRDFMLLIAQIRVIKGNPIEALRVYQELVKDEPRDFRPYLCQGLIYTLMKKKDEAE  290

Query  1061  KHFQMYRELLPEGHPYSSFLD-NTMIASKL  1147
             K F+ +R L+PE HPY  + D N +  +KL
Sbjct  291   KQFEEFRRLVPENHPYKEYFDANVLNTNKL  320



>gb|KFK24716.1| hypothetical protein AALP_AA8G015500 [Arabis alpina]
Length=313

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 144/212 (68%), Gaps = 5/212 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E +L+  L  N NDVEALQSL++ K Q +   +A+SI+NRL+E EP + EW +L+  +  
Sbjct  103   EASLENHLITNQNDVEALQSLMKLKFQTKKFEEALSILNRLIETEPEKQEWRILKAQVQS  162

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+F++A + F EIL+ +P  +EAYHGL+   S  D   +L  +E RI +A++ CK ED
Sbjct  163   HNGDFDSAAKSFEEILTNDPFRIEAYHGLVMVYS--DSESKLLELEVRINEAIEKCKKED  220

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K    R+F LL+AQI+ IE    EA++VYQELVK+EP+DFRPYL Q ++YT++ K  EA+
Sbjct  221   KG--FREFMLLIAQIKVIEGKPSEAIRVYQELVKDEPSDFRPYLCQGLIYTLMKKKDEAE  278

Query  1061  KHFQMYRELLPEGHPYSSFLD-NTMIASKLFA  1153
             K F+ +R L+PE HPY  + D N +  +KLFA
Sbjct  279   KQFEEFRRLVPENHPYKEYFDANVLDFNKLFA  310



>ref|XP_003542471.1| PREDICTED: uncharacterized protein LOC100812214 [Glycine max]
Length=329

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 139/206 (67%), Gaps = 8/206 (4%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E A +E+L     D +ALQSL+++KI+   I +AI +++RL ELEP E+E+PLL+ HL +
Sbjct  116   ESATEEQL--RTTDTDALQSLLQTKIRALEINEAIRVLDRLTELEPEESEYPLLKAHLHM  173

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEE--LKGIEERILKAMKLCKT  874
               GE E A   F E+L ++P  VEAY GL+   SE ++  E  LK IEE    A K+C+ 
Sbjct  174   RYGEHELAANVFEELLHRDPFHVEAYRGLLMLTSETNKPTEELLKRIEE---AAAKVCEE  230

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
             +++   +RD KLL+AQI+ I  D  EALKVY+ELVKEEP DFRPYL Q I+Y+ML K  E
Sbjct  231   QERDSDVRDLKLLIAQIKVINGDLSEALKVYEELVKEEPKDFRPYLCQGIVYSMLRKKDE  290

Query  1055  AKKHFQMYRELLPEGHPYS-SFLDNT  1129
             A+K F+ YR L+PE HPY   F +NT
Sbjct  291   AEKQFEKYRALVPEDHPYKHHFEENT  316



>ref|XP_009116051.1| PREDICTED: uncharacterized protein LOC103841282 [Brassica rapa]
Length=323

 Score =   182 bits (462),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 152/222 (68%), Gaps = 3/222 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EKAL+E+LAA+P+DV+ L+SL+E+K ++    DAI + +RL++LEP E +WP+ +   F+
Sbjct  104   EKALEEQLAAHPHDVDTLRSLMEAKFRSGEFTDAIKLTDRLIKLEPDEPKWPVQKAKCFL  163

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A+  + EIL+K+PL  EA+HGL  A S  D+  + K +E  I +AM  C+ E+
Sbjct  164   YSGDKESAKSVYQEILAKDPLRPEAHHGLCMASS--DEGLDWKKVESIIEEAMLSCRKEN  221

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R FKLL+AQIR +   + EALK+Y+EL +EEP DF PY  Q  +YT+L K+ +A+
Sbjct  222   RHKEYRGFKLLMAQIRVVRGKHGEALKLYEELAEEEPGDFWPYFCQGAIYTLLNKEDKAE  281

Query  1061  KHFQMYRELLPEGHPY-SSFLDNTMIASKLFAAAK*KMVSKT  1183
             + +  +++L+PE + Y   FL + + A +LF+A + +  SK+
Sbjct  282   EQYLKFKKLVPENYNYIEDFLVSNLFAGELFSAMERRSGSKS  323



>ref|XP_003553529.1| PREDICTED: uncharacterized protein LOC100778644 [Glycine max]
Length=351

 Score =   182 bits (461),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = +2

Query  545   AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETA  724
             + NP D +AL +L+E KI+ + + +A  +++RL+ELEP E EWPLL+ ++ +   +  +A
Sbjct  139   STNPRDTDALHALMEVKIRARKMDEAFGVLDRLIELEPEELEWPLLKANMHIYNDDHASA  198

Query  725   RRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
             R  F EIL K+PL VEA+HGL+ A S+ +  E LKG+ +R+ +A+++CK + +   +RDF
Sbjct  199   RELFEEILKKDPLRVEAFHGLVMATSQSN--EPLKGLLKRVEEAIEVCKKQKRDSDVRDF  256

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             +LL+AQ++ +E D+ EALK YQELVKEEP DFRPYL Q I+YT+L K  EA K F  +R 
Sbjct  257   RLLIAQVKVMEGDFSEALKAYQELVKEEPRDFRPYLCQGIIYTLLRKKDEADKQFDKFRR  316

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L+P+ HPY  + ++ M A+K F+
Sbjct  317   LVPKDHPYKDYFEDNMFATKFFS  339



>emb|CDX78187.1| BnaA09g33820D [Brassica napus]
Length=320

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 147/222 (66%), Gaps = 6/222 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EKAL+E+LAA   DV+ L+SL+E K ++    DA  + +RL++LEP E +WP+ +   F+
Sbjct  104   EKALEEQLAA---DVDTLRSLMEVKFRSGEFTDATKLTDRLIKLEPDEPKWPVQKAKCFL  160

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
              +G+ E+A+  + EIL+K+PL  EA+HGL  A S  D+  + K +E  I +AM  C+ E+
Sbjct  161   YSGDKESAKSVYQEILAKDPLRPEAHHGLCMASS--DEGLDWKKVESIIEEAMLSCRKEN  218

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R FKLL+AQIR +   + EALK+YQEL +EEP DF PY  Q  +YT+L K+ +A+
Sbjct  219   RDKEYRGFKLLMAQIRVVRGKHGEALKLYQELAEEEPGDFWPYFCQGAIYTLLNKEDKAE  278

Query  1061  KHFQMYRELLPEGHPY-SSFLDNTMIASKLFAAAK*KMVSKT  1183
             + +  +++L+PE + Y   FL + + A +LF+A + +  SK+
Sbjct  279   EQYLKFKKLVPENYNYIEDFLVSNLFAGELFSAMERRSGSKS  320



>ref|XP_004495267.1| PREDICTED: anaphase-promoting complex subunit 7-like [Cicer arietinum]
Length=379

 Score =   171 bits (433),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 137/209 (66%), Gaps = 5/209 (2%)
 Frame = +2

Query  527   ALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLT  706
             A++E+L  N ND  AL+SLVE  ++   + +AI  ++RL+ELEP + +  LL+ HL    
Sbjct  138   AIEEQLKNNSNDANALRSLVEENVRALKLSEAIRFLDRLIELEPEDFDLHLLKAHLHRHN  197

Query  707   GEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKK  886
             GE E A+  F  +L +EP+ +EAY GL+    E +  E ++    R+ + +K  + +   
Sbjct  198   GEHELAKISFELVLKQEPVNIEAYRGLLMTNLELN--EPMESFLNRVDQVVKFFEEQKMD  255

Query  887   GQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKH  1066
              ++R+FKLL+AQ++ +E DY  ALKVY+E+VK+EP DFRPYL Q ++YT+L K+ EA+K 
Sbjct  256   SEVREFKLLIAQVKVMEEDYSGALKVYEEIVKQEPRDFRPYLCQGVVYTLLRKNDEAEKQ  315

Query  1067  FQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             F+ YR L+PE HPY  + +N    +K+F+
Sbjct  316   FEEYRRLVPENHPYKEYFENN---TKIFS  341



>gb|KHN02406.1| hypothetical protein glysoja_002430 [Glycine soja]
Length=200

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 135/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  584   VESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPL  763
             +E KI+ + + +A  +++RL+ELEP E EWPLL+ ++ +   +  +AR  F EIL K+PL
Sbjct  1     MEVKIRARKMDEAFGVLDRLIELEPEELEWPLLKANMHIYNDDHASARELFEEILKKDPL  60

Query  764   LVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYD  943
              VEA+HGL+ A S+ +  E LKG+ +R+ +A+++CK + +   +RDF+LL+AQ++ +E D
Sbjct  61    RVEAFHGLVMATSQSN--EPLKGLLKRVEEAIEVCKKQKRDSDVRDFRLLIAQVKVMEGD  118

Query  944   YEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLD  1123
             + EALK YQELVKEEP DFRPYL Q I+YT+L K  EA K F  +R L+P+ HPY  + +
Sbjct  119   FSEALKAYQELVKEEPRDFRPYLCQGIIYTLLRKKDEADKQFDKFRRLVPKDHPYKDYFE  178

Query  1124  NTMIASKLFA  1153
             + M A+K F+
Sbjct  179   DNMFATKFFS  188



>gb|KEH42339.1| hypothetical protein MTR_1g067600 [Medicago truncatula]
Length=355

 Score =   168 bits (426),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 138/207 (67%), Gaps = 3/207 (1%)
 Frame = +2

Query  527   ALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLT  706
              + ++L  N ND  AL+SL+E  ++ + + +AI  V RLMELEP E +  LL++HL    
Sbjct  139   TIDDKLIENSNDANALRSLIEENVKARKLSEAIRAVERLMELEPEEFDLLLLKSHLHSHN  198

Query  707   GEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKK  886
             GE E A++GF   L ++P   EAY GL+ A SE    E ++G   R+ + +K  + +  +
Sbjct  199   GEHELAKKGFEFTLQQDPFNSEAYRGLLMANSELK--EPMEGFLNRVDEVVKFFEEKKME  256

Query  887   GQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKH  1066
              + R+FKLL+AQ++ +E DY  ALKVY+E+VKEEP+DFRPYL Q+++Y++L K+ EA+K 
Sbjct  257   SEAREFKLLIAQVKVMEEDYSGALKVYEEIVKEEPSDFRPYLCQSVVYSLLRKNDEAQKQ  316

Query  1067  FQMYRELLPEGHPYSSFL-DNTMIASK  1144
             F+ +R ++PE HPY  +  DNT + SK
Sbjct  317   FEEFRRIVPENHPYKKYFEDNTKVLSK  343



>gb|KHN49002.1| hypothetical protein glysoja_025379 [Glycine soja]
Length=329

 Score =   165 bits (417),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 139/206 (67%), Gaps = 8/206 (4%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E A +E+L     D +ALQSL+++KI+   I +AI +++RL ELEP E+E+PLL+ HL +
Sbjct  116   ESATEEQL--RTTDTDALQSLLQTKIRALEINEAIRVLDRLSELEPEESEYPLLKAHLHM  173

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEE--LKGIEERILKAMKLCKT  874
               GE E A   F E+L ++P  VEAY GL+   SE ++  E  LK IEE    A K+C+ 
Sbjct  174   RYGEHELAANVFEELLHRDPFHVEAYRGLLMLTSETNKPTEELLKRIEE---AAAKVCEE  230

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
             +++   +RD KLL+AQI+ I  D  EALKVY+ELVKEEP DFRPYL Q I+Y+ML K  E
Sbjct  231   QERDSDVRDLKLLIAQIKVINGDLSEALKVYEELVKEEPKDFRPYLCQGIVYSMLRKKDE  290

Query  1055  AKKHFQMYRELLPEGHPYS-SFLDNT  1129
             A+K F+ YR L+PE HPY   F +NT
Sbjct  291   AEKQFEKYRALVPEDHPYKHHFEENT  316



>ref|XP_007144477.1| hypothetical protein PHAVU_007G159400g [Phaseolus vulgaris]
 ref|XP_007144478.1| hypothetical protein PHAVU_007G159400g [Phaseolus vulgaris]
 gb|ESW16471.1| hypothetical protein PHAVU_007G159400g [Phaseolus vulgaris]
 gb|ESW16472.1| hypothetical protein PHAVU_007G159400g [Phaseolus vulgaris]
Length=369

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 132/196 (67%), Gaps = 7/196 (4%)
 Frame = +2

Query  557   NDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGF  736
             +DV  L+SL+ +KI+   I +A+ +++RL+ELEP E E+P ++ HL +L GE E A + F
Sbjct  168   DDVLELESLLRTKIKASEINEALLVLDRLIELEPEELEYPFVKAHLRLLNGENELAAKEF  227

Query  737   NEILSKEPLLVEAYHGLITAVSEDDQ--VEELKGIEERILKAMKLCKTEDKKGQLRDFKL  910
              ++L ++P  VE Y  L+  +SE     +E LK IEE    A+K+C  + K  ++RDFKL
Sbjct  228   EDLLQRDPFHVETYRCLLMLISETKAPTMELLKKIEE----AVKVCAEQGKDSEVRDFKL  283

Query  911   LLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELL  1090
             L+AQI+ I  D  +A+KVY+EL KEEP DFRPYL Q I+YTML K+ EA+K F+ +R L 
Sbjct  284   LIAQIKVINGDLSDAMKVYEELEKEEPQDFRPYLGQGIVYTMLKKNDEAEKQFEKFRTLA  343

Query  1091  PEGHPYSSFL-DNTMI  1135
             P+ HPY  +  DN+ I
Sbjct  344   PDNHPYKQYFEDNSSI  359



>ref|XP_009402908.1| PREDICTED: uncharacterized protein LOC103986601 [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP DVEAL+ ++  K++     +A+ +V RL+ELEP + EW LL+   + L G+ + 
Sbjct  142   LQKNPKDVEALKVVLYGKLKKGKREEAVRLVERLIELEPDDVEWRLLQGLCYELMGKLDK  201

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F +IL + PLL+ A HGL  A+ +     E     E + KA+ L + E++    R+
Sbjct  202   AKRLFKDILKERPLLIRALHGLALAMHKS---RESATAFEMLHKALDLARRENRVTDQRN  258

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+ AI  D E A + +Q+LV E+P DFRPYL Q ++Y++L K KEA + F++YR
Sbjct  259   IKILIAQMHAIVGDLEGASQHFQDLVNEDPRDFRPYLCQGVIYSLLDKTKEADEQFEIYR  318

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              LLP+  P  SF+D+ ++ +K
Sbjct  319   SLLPDEFPQRSFIDDVILTAK  339



>ref|XP_011100082.1| PREDICTED: general transcriptional corepressor ssn6 isoform X1 
[Sesamum indicum]
Length=345

 Score =   156 bits (394),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 130/207 (63%), Gaps = 7/207 (3%)
 Frame = +2

Query  524   KALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVL  703
             K LQE    NP DVEAL+ +V  K++     +A+  V RL+EL+P+E EW LL+   + +
Sbjct  133   KLLQE----NPRDVEALKMVVNVKMKKGKTSEAVEYVERLIELQPNEMEWRLLQALCYEM  188

Query  704   TGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
              G    A+  F  IL ++PLL+ A HGL   + ++    E   + E + +A+++ + + K
Sbjct  189   MGNLSKAKSLFKNILKQKPLLLRALHGLAMVMHKN---HEGPAVFEMLERALEVARRQKK  245

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + R+ ++L+AQ+  I+ D+EEAL+ +Q L+ E P DFRPYL Q I+Y++L K KEA  
Sbjct  246   VNEERNIRILVAQMHIIKGDFEEALEKFQALIDENPRDFRPYLCQGIVYSLLDKRKEADA  305

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASK  1144
             +F++YR L+PE  P   FLD+ ++A+K
Sbjct  306   NFEIYRSLVPEEFPQRGFLDDVVLAAK  332



>gb|KDP35273.1| hypothetical protein JCGZ_09432 [Jatropha curcas]
Length=262

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E   +E L   P +VEAL+ LV  K++ +   +A+  V+RL+++EP E EW LL    + 
Sbjct  39    EAMYEELLVKEPRNVEALKVLVYGKMRKRKTKEALKYVDRLIKIEPEEIEWRLLEALCYE  98

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKT  874
             + GE   A+R F EIL + PLL+ A HGL   + ++     L G  + E + KA+++   
Sbjct  99    MMGELSKAKRLFKEILEERPLLLRALHGLAMVMHKN-----LDGPAVFEMLNKALEVACR  153

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
             E++  + R+ ++L+AQ+  ++   EE LK +Q+LV E P DFRPYL Q I+Y++L + KE
Sbjct  154   ENRVIEERNIRILIAQMHVVKGQLEEGLKRFQDLVNENPRDFRPYLCQGIVYSLLDRKKE  213

Query  1055  AKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             A + F+MYR L+PE  P   FLD+ ++A+K
Sbjct  214   AAEQFEMYRSLVPEEFPQRGFLDDVVLAAK  243



>ref|XP_008786598.1| PREDICTED: uncharacterized protein LOC103704888 [Phoenix dactylifera]
Length=369

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 128/201 (64%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P DVEAL+ ++  K++     +A+  V RL+ LEP E EW LL+   + L G+   
Sbjct  153   LERDPTDVEALKVVLYGKMRKGKTKEAVEYVERLIALEPDEVEWRLLQALSYELMGKLAK  212

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL  A+ ++    E   + E + KA++L + E++  + R+
Sbjct  213   AKRLFKEILKERPLLLRALHGLALAMYKN---REGPAVFEMLNKALELARRENRVTEERN  269

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ D E A K +Q+L+KE P DFRPYL Q I+Y +L + KEA + F++YR
Sbjct  270   IKILIAQMHVVKGDLEGASKQFQDLIKENPRDFRPYLCQGIIYGLLDRKKEADEQFEIYR  329

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P  SF+D+ ++A+K
Sbjct  330   SLIPDEFPQRSFIDDAILAAK  350



>ref|XP_002310040.1| hypothetical protein POPTR_0007s06800g [Populus trichocarpa]
 gb|EEE90490.1| hypothetical protein POPTR_0007s06800g [Populus trichocarpa]
Length=345

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 150/266 (56%), Gaps = 19/266 (7%)
 Frame = +2

Query  425   FLGRFSLRVNPSIaapvsapataeaavsdaetEKALQERLAANPNDVEALQSLVESKIQN  604
             F+G F L    S+A P    A  E +  +   EK L++     P +VEAL+ ++  K++ 
Sbjct  94    FIGSFGLNTRQSLALPAQTNAQMEKSEDEEMYEKVLEK----EPRNVEALKVVLHGKMRR  149

Query  605   QNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHG  784
                 +A+  V RL+E+EP E EW LL    + + G+   A+R FNEIL + PLL+ A HG
Sbjct  150   GQTKEAVKYVGRLIEIEPEEVEWRLLEALCYEMMGQLNKAKRLFNEILEERPLLLRALHG  209

Query  785   LITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEAL  958
             L   + ++     L+G  + E + KA+++   E +  + R+ ++L+AQ+  ++ D+EEAL
Sbjct  210   LALVMHKN-----LEGPAVFEMLNKALEVAHREKRVTEERNIRILIAQMHVVKGDFEEAL  264

Query  959   KVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIA  1138
             K +Q LV + P DFRPYL Q I+Y++L + +EA + F+ YR L+PE  P   FLD+ ++ 
Sbjct  265   KKFQGLVSDNPRDFRPYLCQGIIYSLLDRKEEAAEQFETYRSLVPEEFPQRIFLDDVVLE  324

Query  1139  SKLFAAAK*KMVSKTSFWLHFQPSFA  1216
             +        K  S+  F   FQ  F+
Sbjct  325   A--------KTKSRERFQKEFQAEFS  342



>ref|XP_009758286.1| PREDICTED: uncharacterized protein LOC104210999 [Nicotiana sylvestris]
Length=348

 Score =   152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  N  DVEAL+++V  K++     +A+  V +L+E++P E EW LL+   + +TG+   
Sbjct  132   LEKNERDVEALKTIVNVKMRKGKTKEALKYVEKLIEVQPREMEWRLLQALCYEMTGQLSK  191

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EIL + PLL+ A HGL   + ++    E   + E +  A+++ + E +    R+
Sbjct  192   AKSLFKEILKQRPLLLRALHGLAMVMHKNF---EGPAVFEMLSDALEVARREKRVNVERN  248

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ + EEAL+ +Q LVKE P DFRPYL Q I+Y++L K KEA + F++YR
Sbjct  249   IKILVAQMHVVKGELEEALQKFQHLVKENPRDFRPYLCQGIVYSLLDKKKEANEQFEIYR  308

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+ ++A+K
Sbjct  309   SLVPEEFPQRGFLDDVVLAAK  329



>emb|CDP12879.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 127/201 (63%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP DVEAL+ +V  K++      A+  V RL++++P+E EW LL+   +   G+F  
Sbjct  150   LEQNPRDVEALKIVVNVKMKKGKTKGAVEYVERLIKVQPNEMEWRLLQALCYERMGQFSM  209

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             ARR F +IL + PLL+ A HGL   + ++    E   + E + +A++L ++E K  + R+
Sbjct  210   ARRLFKDILKQRPLLLRALHGLAMVMHKN---HEGPAVFEMLDRALELARSEKKVNEERN  266

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L AQ+  ++ + EEAL+ +Q L+ E P DFRPYL Q I+Y++L K+KEA + F++Y+
Sbjct  267   IRILTAQMHVVKGELEEALEKFQALINENPRDFRPYLCQGIVYSLLDKEKEALEQFEIYQ  326

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+ ++ ++
Sbjct  327   SLVPEEFPQKKFLDDVILLAR  347



>ref|XP_011025581.1| PREDICTED: uncharacterized protein LOC105126414 isoform X1 [Populus 
euphratica]
Length=357

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 133/223 (60%), Gaps = 15/223 (7%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRG  733
             P +VEAL+ ++  K++     +A+  V RL+E+EP E EW LL    + + G+   A+R 
Sbjct  145   PRNVEALKVVLHGKMRRGQTKEAVKYVERLIEIEPEEVEWRLLEALCYEMLGQLNKAKRL  204

Query  734   FNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKGQLRDFK  907
             FNEIL + PLL+ A HGL   + ++     L+G  + E + KA+++   E +  + R+ +
Sbjct  205   FNEILEERPLLLRALHGLALVMHKN-----LEGPAVFEMLNKALEVAHREKRVTEKRNIR  259

Query  908   LLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYREL  1087
             +L+AQ+  ++ D+EEALK +Q LV + P DFRPYL Q I+Y++L + +EA + F+ YR L
Sbjct  260   ILIAQMHVVKGDFEEALKKFQGLVSDNPRDFRPYLCQGIIYSLLDRKEEAAEQFETYRSL  319

Query  1088  LPEGHPYSSFLDNTMIASKLFAAAK*KMVSKTSFWLHFQPSFA  1216
             +PE  P   FLD+ ++ +        K  S+  F   FQ +F+
Sbjct  320   VPEEFPQRIFLDDVVLEA--------KTKSRERFQKEFQAAFS  354



>ref|XP_010263841.1| PREDICTED: uncharacterized protein LOC104602006 [Nelumbo nucifera]
Length=374

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 125/201 (62%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP DV+AL+ ++  K++     +A+  V RL+++EP E EW LL+   + + G    
Sbjct  158   LEKNPRDVQALKVVLYGKMRKGKTKEALEHVERLIDIEPDEVEWRLLQALSYEMMGHLSR  217

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL   + ++    E   + E + KA+ L +   +  + R+
Sbjct  218   AKRLFKEILEERPLLLRALHGLAMVMHKN---HEGSAVFEMLDKALLLSQRGKRVTEERN  274

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ D EEALK +Q+LV + P DFRPYL + I+Y++LGK KEA + F+ YR
Sbjct  275   IRILIAQMHVVKGDLEEALKRFQDLVNDNPRDFRPYLCEGIIYSLLGKKKEADEQFETYR  334

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P   FLD+ ++A+K
Sbjct  335   SLVPQEFPQRGFLDDVVLAAK  355



>ref|XP_010925351.1| PREDICTED: uncharacterized protein LOC105047915 [Elaeis guineensis]
Length=368

 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P DVEAL+ ++  K++     +A+  V RL+ LEP E EW LL+   + L G    
Sbjct  152   LERDPTDVEALKVVLYGKMRKGKTKEAVEYVERLIALEPDEVEWRLLQALSYELMGNLAK  211

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL  A+ ++    E   + + + KA++L + E +  + R+
Sbjct  212   AKRLFKEILKERPLLLRALHGLALAMHKN---HEGPAVFDMLNKALELARREKRVTEERN  268

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ D E A K +Q+L+ E P DFRPYL Q I+Y++L + KEA + F++Y+
Sbjct  269   IKILIAQMHVVKGDLEGASKQFQDLINENPRDFRPYLCQGIIYSLLDRKKEADEQFEIYQ  328

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P  SF+D+ ++A+K
Sbjct  329   SLIPDEFPQRSFIDDVILAAK  349



>ref|XP_006427954.1| hypothetical protein CICLE_v10025951mg [Citrus clementina]
 ref|XP_006464506.1| PREDICTED: uncharacterized protein LOC102625755 [Citrus sinensis]
 gb|ESR41194.1| hypothetical protein CICLE_v10025951mg [Citrus clementina]
Length=356

 Score =   150 bits (379),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 147/246 (60%), Gaps = 9/246 (4%)
 Frame = +2

Query  425   FLGRFSLRVNPSIa------apvsapataeaavsdaetEKALQERLAANPNDVEALQSLV  586
             FLG F   + PS+A      A  +     +A +  +E E+  ++ L   P +VEAL+ ++
Sbjct  95    FLGSFGSNLRPSVALPGKMRASENLKEKRDALMGKSEVEEMFEKLLEKEPRNVEALKVVM  154

Query  587   ESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLL  766
             +  ++     +A+  V RL+++EP+E EW LL+   + L G+  TA+R F +IL + PLL
Sbjct  155   QGNMRRGRNKEALEFVKRLIDIEPNEVEWKLLQALCYELMGKLSTAKRLFKDILKERPLL  214

Query  767   VEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDY  946
             + A HGL   + ++    E   + + + KA+++ + E +  + R+ ++L+AQ+  +E + 
Sbjct  215   LRALHGLALVMHKN---HEGPAVFQMLSKALEVAQREKRVTEERNIRILIAQMHVVEGEL  271

Query  947   EEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDN  1126
             EE LK +Q+LVKE P DFRPYL Q I+Y++L K KEA + F++Y  L+P+  P   FLD+
Sbjct  272   EEGLKKFQDLVKENPRDFRPYLCQGIIYSLLDKKKEATEQFEIYWSLVPDEFPQRGFLDD  331

Query  1127  TMIASK  1144
              ++ +K
Sbjct  332   VVLTAK  337



>ref|XP_009612405.1| PREDICTED: uncharacterized protein LOC104105725 [Nicotiana tomentosiformis]
Length=348

 Score =   150 bits (378),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 126/201 (63%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  N  DVEAL+++V  K++     +A+  V +L++++P E EW LL+   + + G+   
Sbjct  132   LEKNERDVEALKTIVNVKMRKGKTKEALKYVEKLIDVQPREMEWRLLQALCYEMMGQLSK  191

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F EIL + PLL+ A HGL   + ++    E   + E +  A+++ + E +  + R+
Sbjct  192   AKMLFKEILKQRPLLLRALHGLAMVMHKNF---EGPAVFEMLNDALEVARREKRVNEERN  248

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ + EEAL+ +Q LVKE P DFRPYL Q I+Y++L K KEA + F++YR
Sbjct  249   IKILVAQMHVVKGELEEALQKFQRLVKENPRDFRPYLCQGIVYSLLDKKKEANEQFEIYR  308

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+ ++A+K
Sbjct  309   SLVPEEFPQRGFLDDVVLAAK  329



>ref|XP_006367386.1| PREDICTED: uncharacterized protein LOC102593671 isoform X1 [Solanum 
tuberosum]
 ref|XP_006367387.1| PREDICTED: uncharacterized protein LOC102593671 isoform X2 [Solanum 
tuberosum]
Length=345

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 128/201 (64%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP DV+AL+++V  K++     +A+  V +L+E++P E EW LL    + + G+   
Sbjct  129   LEKNPRDVDALKTIVNVKMRKGKTKEALKYVEKLIEVQPREMEWRLLEALCYEMMGQLSK  188

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL ++PLL+ A HGL   + ++    E   + E +  A+++ + E +  + R+
Sbjct  189   AKRLFKEILKQKPLLLRALHGLAMVMHKNF---EGPTVFEMLNGALEVARQEKRVNEERN  245

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ + EEAL+ ++ LV+E P DFRPYL Q I+Y++L K KEA + F++YR
Sbjct  246   IKILVAQMHVVKGELEEALQKFKLLVQENPRDFRPYLCQGIVYSLLDKKKEADEQFEIYR  305

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P   FLD+ ++A+K
Sbjct  306   SLVPKEFPQRGFLDDVVLAAK  326



>emb|CBI21527.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 135/226 (60%), Gaps = 10/226 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+ ++  K++     +A+  V RL+++EP E EW LL+   + + G    
Sbjct  35    LEKDPRNVEALKVVLYGKMRRGKTKEAVEYVERLIDIEPDEVEWRLLQALSYEIMGHLSK  94

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL   + ++ +  +   + E +  A+++ + + +  + R 
Sbjct  95    AKRLFKEILKERPLLLRALHGLALVMHKNHEGPD--AVFEMLNNALEVARHQKRVTEERS  152

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ D EE LK +Q+LV E P DFRPYL Q I+Y++L K KEA++ F++YR
Sbjct  153   IRILIAQMHVVQGDLEEGLKKFQDLVDENPRDFRPYLCQGIIYSLLDKKKEAQEQFEIYR  212

Query  1082  ELLPEGHPYSSFLDNTMIASKLFAAAK*KMVSKTSFWLHFQPSFAS  1219
              L+PE  P   FL++ + A+K    AK    S+  F   FQ  F++
Sbjct  213   TLVPEEFPQRGFLNDVVSAAK----AK----SRERFHKEFQAEFSN  250



>gb|EYU31102.1| hypothetical protein MIMGU_mgv1a009308mg [Erythranthe guttata]
Length=346

 Score =   148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 128/201 (64%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP ++E L+ +V  K++    G+A+  V RL+EL+P+E EW LL+   + + G    
Sbjct  136   LEENPRNIETLKMVVNVKMRKGKTGEAVDYVERLIELQPNEMEWRLLQALCYEMKGNLSK  195

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  F  +L ++PLL+ A HGL   + ++    E   + E + KA+++ + E +  + R+
Sbjct  196   AKSLFKNVLKQKPLLLRALHGLAMVMHKNH---EGPAVFEMLEKALQIAQREKRVNEERN  252

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  +E + +EAL+ +Q L+ E P DFRPYL Q I+Y++L K KEA+++F++YR
Sbjct  253   IRILVAQMHIVEGNLKEALENFQALIDENPRDFRPYLCQGIVYSLLEKTKEAEENFEIYR  312

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FL++ ++A+K
Sbjct  313   SLVPEEFPERGFLNDVVLAAK  333



>ref|XP_004237470.1| PREDICTED: uncharacterized protein LOC101259237 [Solanum lycopersicum]
Length=345

 Score =   148 bits (373),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 128/201 (64%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP DV+AL+++V  K++     +A+  V +L++++P E EW LL    + + G+   
Sbjct  129   LEKNPRDVDALKTIVNVKMRKGKTKEALKYVEKLIKVQPREMEWRLLEALCYEMMGQLSK  188

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL ++PLL+ A HGL   + ++    E   + E +  A+++ + E +  + R+
Sbjct  189   AKRLFKEILKQKPLLLRALHGLAMVMHKNV---EGPAVFEMLNGALEVARQEKRVNEERN  245

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L+AQ+  ++ + EEAL+ ++ LV+E P DFRPYL Q I+Y++L K KEA + F++YR
Sbjct  246   IKILVAQMYVVKGELEEALQKFKLLVQENPRDFRPYLCQGIVYSLLDKKKEADEQFEIYR  305

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P   FLD+ ++A+K
Sbjct  306   SLVPKEFPQRGFLDDVVLAAK  326



>ref|XP_003523253.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like 
[Glycine max]
Length=356

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+ ++  KI+     +A+  V  L+  EP+E EW LL    +   G+   
Sbjct  140   LEKDPKNVEALKVVLYGKIRKGKSKEAVKFVEDLIAAEPNEVEWRLLLALCYETMGQLSK  199

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A++ F EIL K PLLV A HGL  A+ ++    E   + E +  A +L   E++  + R+
Sbjct  200   AKKLFREILKKRPLLVRALHGLAMAMHKN---HEGPAVFEMLNNAQELASRENRVTEERN  256

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ + EE LK +QEL+ + P DFRPY+ Q I+Y++LGK++EA + F+ Y+
Sbjct  257   IRILIAQMHVVQGNLEEGLKRFQELIDQNPRDFRPYICQGIIYSLLGKNEEAAQQFETYQ  316

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+  IA+K
Sbjct  317   TLVPEEFPQRGFLDDVAIAAK  337



>ref|XP_003526837.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like 
[Glycine max]
Length=356

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+ ++  KI+     +A+ +V  L+  EP+E EW LL    +   G+   
Sbjct  140   LEKDPKNVEALKVVLYGKIRRGKSKEAVKVVEDLIAAEPNEVEWRLLLALCYETMGQLSK  199

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL K PLLV A HGL  A+    ++ E   + E +  A +L   E++  + R+
Sbjct  200   AKRLFREILKKRPLLVRALHGLAMAM---HKIHEGPAVFEMLNNAQELASRENRVTEERN  256

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ + EE LK +QEL+ +   DFRPY+ Q I+Y++LGK++EA + F+ Y+
Sbjct  257   IRILIAQMHVVQGNLEEGLKRFQELIDQNRRDFRPYICQGIIYSLLGKNEEAAQQFETYQ  316

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+  IA+K
Sbjct  317   TLVPEEFPQRRFLDDVAIAAK  337



>ref|XP_010652867.1| PREDICTED: uncharacterized protein LOC100254208 [Vitis vinifera]
Length=365

 Score =   148 bits (373),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 135/226 (60%), Gaps = 10/226 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+ ++  K++     +A+  V RL+++EP E EW LL+   + + G    
Sbjct  148   LEKDPRNVEALKVVLYGKMRRGKTKEAVEYVERLIDIEPDEVEWRLLQALSYEIMGHLSK  207

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL   + ++ +  +   + E +  A+++ + + +  + R 
Sbjct  208   AKRLFKEILKERPLLLRALHGLALVMHKNHEGPD--AVFEMLNNALEVARHQKRVTEERS  265

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ D EE LK +Q+LV E P DFRPYL Q I+Y++L K KEA++ F++YR
Sbjct  266   IRILIAQMHVVQGDLEEGLKKFQDLVDENPRDFRPYLCQGIIYSLLDKKKEAQEQFEIYR  325

Query  1082  ELLPEGHPYSSFLDNTMIASKLFAAAK*KMVSKTSFWLHFQPSFAS  1219
              L+PE  P   FL++ + A+K    AK    S+  F   FQ  F++
Sbjct  326   TLVPEEFPQRGFLNDVVSAAK----AK----SRERFHKEFQAEFSN  363



>ref|XP_010025521.1| PREDICTED: uncharacterized protein LOC104415841 isoform X1 [Eucalyptus 
grandis]
 gb|KCW62222.1| hypothetical protein EUGRSUZ_H04883 [Eucalyptus grandis]
Length=379

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 127/209 (61%), Gaps = 4/209 (2%)
 Frame = +2

Query  521   EKALQERL-AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E+ + ERL   +P +VEAL+ ++  K++     +A+  V RL + EP E EW LL     
Sbjct  152   EEEMSERLLETDPTNVEALKVVLYGKMRRGKTKEAVKYVQRLADAEPDEVEWKLLLALCH  211

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
                G+  TA+R F EIL + PL++ A HGL   + ++   +E   I E + KA++L + E
Sbjct  212   ETMGQISTAKRLFREILEETPLMLRALHGLAMVMHKN---QEGPAIFEMLNKALELARRE  268

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
             ++  + RD ++L+AQ+  +  +   ALK +Q+LV + P DFRPYL Q I+Y++L K KEA
Sbjct  269   NRVTEDRDIRILIAQMHVVVGNLNAALKDFQDLVSDNPRDFRPYLCQGIIYSLLDKKKEA  328

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             ++  + YR L+PE  P   FLD+ ++A+K
Sbjct  329   QEQLETYRSLVPEEFPQRGFLDDVVLAAK  357



>ref|XP_008440127.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103484686 
[Cucumis melo]
Length=360

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 130/207 (63%), Gaps = 3/207 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+  +  L  +P++V+ L++++  K+++    +AI  V RL++LEP E EW LL    + 
Sbjct  137   EEMWERILEHDPSNVDTLKAVLYGKMRSGKTEEAIKYVKRLIDLEPDEVEWRLLLALCYE  196

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE  TA+R F EIL ++PLLV A HGL   + ++++ E    + E + KA+ + + E 
Sbjct  197   TLGELGTAKRLFMEILKQKPLLVRALHGLALVMHKNNEGE---SVFEMLNKALDIARDEK  253

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K  + R   +L+AQ+  ++ + EE LK +Q LV+E P DFRP+L Q I+Y++L K KEA 
Sbjct  254   KLAEHRSIGILIAQMHVVKGELEEGLKKFQNLVEENPRDFRPHLCQGIIYSLLDKKKEAA  313

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIAS  1141
             + F++Y+ L+P+  P   F+D+ M+++
Sbjct  314   EQFEIYQALVPDEFPQREFIDDIMLSA  340



>ref|XP_004141968.1| PREDICTED: uncharacterized protein LOC101208394 [Cucumis sativus]
 gb|KGN48419.1| hypothetical protein Csa_6G486920 [Cucumis sativus]
Length=362

 Score =   147 bits (372),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 132/208 (63%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQER-LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E+ + ER L  +P++V+ L++++  K+++    +A+  V RL++LEP E EW +L    +
Sbjct  138   EEVMWERILEHDPSNVDTLKAVLYGKMRSGKTENAVKYVKRLIDLEPDEVEWRILLALCY  197

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
              + GE  TA+R F EIL ++PLLV A HGL   + ++++ E    + E + KA+ + + E
Sbjct  198   EILGELGTAKRLFMEILKQKPLLVRALHGLALVMHKNNEGE---SVFEMLNKALDIARDE  254

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              K  + R   +L+AQ+  ++ + EE LK +Q LV+E P DFRP+L Q I+Y++L K KEA
Sbjct  255   KKLTEHRSIGILIAQMHVVKGELEEGLKKFQNLVEENPRDFRPHLCQGIIYSLLDKKKEA  314

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIAS  1141
              + F+ Y+ L+P+  P   F+D+ M+++
Sbjct  315   AEQFETYQALVPDEFPQREFIDDVMLSA  342



>gb|KHN09558.1| hypothetical protein glysoja_011832 [Glycine soja]
Length=356

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 122/201 (61%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+ ++  KI+     +A+ +V  L+  EP+E EW LL    +   G+   
Sbjct  140   LEKDPKNVEALKVVLYGKIRRGKSKEAVKVVEDLIAAEPNEVEWRLLLALCYETMGQLSK  199

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL K PLLV A HGL  A+ ++    E   + E +  A +L   E++  + R+
Sbjct  200   AKRLFREILKKRPLLVRALHGLAMAMHKN---HEGPAVFEMLNNAQELASRENRVTEERN  256

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++ + EE LK +QEL+ +   DFRPY+ Q I+Y++LGK++EA + F+ Y+
Sbjct  257   IRILIAQMHVVQGNLEEGLKRFQELIDQNRRDFRPYICQGIIYSLLGKNEEAAQQFETYQ  316

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+  IA+K
Sbjct  317   TLVPEEFPQRRFLDDVAIAAK  337



>ref|NP_187560.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF23281.1|AC016661_6 hypothetical protein [Arabidopsis thaliana]
 gb|ABL66775.1| At3g09490 [Arabidopsis thaliana]
 gb|AEE74773.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=334

 Score =   147 bits (370),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/195 (39%), Positives = 117/195 (60%), Gaps = 2/195 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  L++ L    NDV AL  L E K ++     AI  ++RL+E+EP E +WP ++  +  
Sbjct  99    ETTLEKHLETQSNDVNALSLLTEIKFKSDKHEQAIVFLDRLIEIEPYERKWPAMKARILS  158

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+ E+A   F EIL K+P+ V+AYH L+          +L  IE+RI K ++ CK E 
Sbjct  159   YHGKSESAIEAFEEILEKDPIRVDAYHYLVMEYYNSKP--KLTEIEKRINKVIRRCKKEK  216

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K  ++  F++L+AQIR IE    EA+++ +ELVKE+P DF  YL+Q ++YT++ K +EA 
Sbjct  217   KTKEILGFRMLIAQIRFIEGKSVEAIRICEELVKEDPNDFTIYLFQGVVYTLMNKGEEAA  276

Query  1061  KHFQMYRELLPEGHP  1105
             K F+    ++P  HP
Sbjct  277   KQFEHVARVIPRNHP  291



>ref|XP_010101400.1| hypothetical protein L484_002458 [Morus notabilis]
 gb|EXB88357.1| hypothetical protein L484_002458 [Morus notabilis]
Length=245

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L +N   +EAL+SL++ K++     +A++I+ RL+  +P+E EW  L   L   +G
Sbjct  37    LSEFLESNSEAIEALKSLLQQKLEGGEDDEALTILKRLVAAQPAENEWKFLMARLLAESG  96

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E ++AR+ F EIL+  PL  EA   + L+      D+  E + +  R+ +A+++ + E+K
Sbjct  97    EIQSARQVFEEILAANPLSFEALFENALLM-----DRNGEGQAVIGRLEEALRIAEDENK  151

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + EEAL++YQEL KE+PTDFRPY  + ++Y++L ++ EA++
Sbjct  152   AKEARDVKLIMAQIQFLQKNVEEALRIYQELTKEDPTDFRPYFCRGMIYSLLDRNAEARE  211

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P       +L + +   KLF 
Sbjct  212   QFGKYRELSPNKFEVEGYLRSPLSRMKLFG  241



>ref|XP_007048154.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX92311.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=363

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 172/338 (51%), Gaps = 37/338 (11%)
 Frame = +2

Query  182   PSLNNHRP------VLVRPL-----SSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQETA  328
             P   NHRP      +   PL     +SL F T   ++ +  +S F  + S   P  Q   
Sbjct  20    PKFPNHRPCKTLNPLFTNPLPFHKPNSLPFRTTKLYISLNPTSIFRTKTSSVSPKNQFFK  79

Query  329   KSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLR------VNPSIaapvsapat  490
               S  I+  L  S                   F+G F+ R         + ++  +    
Sbjct  80    SLSEKIVVFLVGSFI-----------------FMGCFNARPCLALPAQTTTSSRANLEGE  122

Query  491   aeaavsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETE  670
              E     +E E+  ++ L   P +VEAL+ ++  K++     +A+  V +L+++EP+E E
Sbjct  123   KETQKGKSEEEERYEKVLEKEPGNVEALKVVLYGKMRRGKTKEAVECVEKLIDIEPNEFE  182

Query  671   WPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERIL  850
             W LL+   + + G+   A+R F EIL + PLL+ A HGL   + ++    E   + ER+ 
Sbjct  183   WRLLQALCYEMMGQLSKAKRLFKEILEERPLLLRALHGLAVVMHKNH---EGPAVFERLN  239

Query  851   KAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMY  1030
             +A+++   E +  + R+ ++L+AQ+  ++ + EE LK +Q+L+ + P DFRPYL Q I+Y
Sbjct  240   EALEVALREKRVTEERNIRILIAQMHVVKGELEEGLKKFQDLMNDNPRDFRPYLCQGIIY  299

Query  1031  TMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             ++L K KEA + F++Y+ L+PE  P   FLD+ ++A+K
Sbjct  300   SLLDKKKEAAEQFEIYQSLVPEEFPQRCFLDDVVLAAK  337



>ref|XP_004502875.1| PREDICTED: uncharacterized protein LOC101495350 isoform X1 [Cicer 
arietinum]
 ref|XP_004502876.1| PREDICTED: uncharacterized protein LOC101495350 isoform X2 [Cicer 
arietinum]
Length=338

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 124/209 (59%), Gaps = 4/209 (2%)
 Frame = +2

Query  521   EKALQER-LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E A+ ER L  +P +VE L+ +V  KI+     +A   V RL+++EP+E EW LL    +
Sbjct  114   EDAMNERILEKDPRNVEGLKVIVYGKIRRGKCKEAEKFVKRLIDVEPNEVEWRLLLALCY  173

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
                G    A+  ++EIL   PLLV A H L   + +++   E   + E + KA++L  +E
Sbjct  174   ETMGYLSKAKTLYSEILEHRPLLVRALHSLAMVMHKNN---EGPAVFEMLNKALELAISE  230

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
             DK  + R+ ++L AQ+  ++ D EE LK +Q+L+ + P DFRPYL Q I+Y++L K +EA
Sbjct  231   DKVTEERNIRILTAQMLVVQGDLEEGLKRFQDLIDQNPRDFRPYLCQGIIYSLLDKKEEA  290

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
              K F+ Y+ L+PE  P   FLD+  I +K
Sbjct  291   AKQFETYQALVPEEFPQRGFLDDITIQAK  319



>emb|CDY53183.1| BnaA06g40620D [Brassica napus]
Length=343

 Score =   145 bits (365),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/336 (31%), Positives = 173/336 (51%), Gaps = 42/336 (13%)
 Frame = +2

Query  146   THFSAKPNLNFLPS-LNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQE  322
             THF   PN N  PS     RP   +   SL+F +   H+P+  SS               
Sbjct  28    THF---PNPNGFPSPWRKSRPFAPKLSQSLNFASPSPHLPLIRSS---------------  69

Query  323   TAKSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaa  502
             T  SS   L+ L +              +  + VFLG  S +  P++A P +  ++    
Sbjct  70    TPPSSKDFLQILARK---------AAIVLVGSFVFLGFCSSK--PALALPTATASSQTEL  118

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
               +   EK L+    + P ++EA+++++  K++     DA+  V +LM+LEP E EW LL
Sbjct  119   EDEEMFEKVLE----SEPENMEAMKAVLYKKMRRGKPEDAVKYVEKLMKLEPREVEWKLL  174

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKA  856
                 +   G+   A+R F +IL   PLL+ A HGL   +  S D  V ++      + +A
Sbjct  175   EALCYETMGQLSKAKRLFKDILRDNPLLIRALHGLAMVMHKSHDSSVFDM------LNEA  228

Query  857   MKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTM  1036
             M++ +  ++  + R+ ++L+ Q+  ++  +EEALK++QE+VK+ P DFRPYL Q I+Y++
Sbjct  229   MEVARQGNRVTEERNIQVLIGQMHIVKGQFEEALKIFQEMVKDNPRDFRPYLCQGIVYSL  288

Query  1037  LGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + K +EA + F++Y  L PE  P   FLD+  +A++
Sbjct  289   MDKKEEADQQFEIYWSLAPEEFPQKGFLDDVALAAQ  324



>gb|KHN48602.1| hypothetical protein glysoja_015750 [Glycine soja]
Length=219

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/202 (41%), Positives = 129/202 (64%), Gaps = 4/202 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             ++ L+ERL+ NP D  AL  L+E KI+   + +   +++ L+ELEP E EW LL+ ++ +
Sbjct  20    KRLLEERLSTNPCDTNALHMLMEVKIRVHKMEEPFRVLDHLIELEPEELEWLLLKANMHI  79

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
                     R+ F EIL K+ L  E +HGL+ A    +++  LKG+ +R+ +A K+CK + 
Sbjct  80    YNNNHTNMRKLFEEILKKDLLREEVFHGLVMATLRSNEL--LKGLLKRVEEANKVCKKQK  137

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +   +RDF+LL+AQ++ ++ D+ +ALK YQELVK+EP DFRPYL Q I+YT+L K  EA 
Sbjct  138   RDSDVRDFRLLIAQVKVMKGDFSKALKAYQELVKDEPRDFRPYLCQGIIYTILRKKDEAD  197

Query  1061  KHFQMYRELLPEG--HPYSSFL  1120
             K F  +  L+P+   HPY  + 
Sbjct  198   KQFNKFCRLVPKDRYHPYKEYF  219



>ref|XP_002530261.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32131.1| conserved hypothetical protein [Ricinus communis]
Length=352

 Score =   145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 136/244 (56%), Gaps = 7/244 (3%)
 Frame = +2

Query  425   FLGRFSLRVNPSIa----apvsapataeaavsdaetEKALQERLAANPNDVEALQSLVES  592
             F+G F     PS+A             +  + + E E+  ++ L   P ++EAL+ +V  
Sbjct  93    FMGSFGFNARPSLALPAQESAYTEEMRDTQMKNNEDEEMYEKFLEKEPRNMEALKVVVYG  152

Query  593   KIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVE  772
             KI+     +A+  V RL++ EP E EW LL    + + G+   A+R F EIL + PLL+ 
Sbjct  153   KIRKGKTKEALKYVERLIKTEPDEVEWRLLEALCWEMMGQLSKAKRLFKEILEERPLLLR  212

Query  773   AYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEE  952
             A HGL   + ++    E   + E + KA+++   E +  + R+ K+L+AQ+  +    EE
Sbjct  213   ALHGLAMVMHKNF---EGPAVFEMLNKALEVAYHEKRIMEERNIKILIAQMHVVMGRLEE  269

Query  953   ALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTM  1132
              LK +Q+LV E P DFRPYL Q I+Y++L K +EA + F+ YR LLPE  P   FLD+ +
Sbjct  270   GLKNFQDLVNENPRDFRPYLCQGIIYSLLDKKEEAAEQFETYRSLLPEDFPQRGFLDDVV  329

Query  1133  IASK  1144
             +A+K
Sbjct  330   LAAK  333



>ref|XP_004164944.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101230878 
[Cucumis sativus]
Length=362

 Score =   144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 131/208 (63%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQER-LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E+ + ER L  +P++V+ L++++  K+++    +A+  V RL++LEP E EW +L    +
Sbjct  138   EEVMWERILEHDPSNVDTLKAVLYGKMRSGKTENAVKYVKRLIDLEPDEVEWRILLALCY  197

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
              + GE  TA+R F EIL ++PLLV A HGL   + ++++ E    + E + KA+ + +  
Sbjct  198   EILGELGTAKRLFMEILKQKPLLVRALHGLALVMHKNNEGE---SVFEMLNKALDIARDX  254

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
             +K  + R   +L+AQ+  ++ + EE LK +Q LV+E P DFRP+L Q I+Y++L K  EA
Sbjct  255   EKLTEHRSIGILIAQMHVVKGELEEGLKKFQNLVEENPRDFRPHLCQGIIYSLLDKKXEA  314

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIAS  1141
              + F+ Y+ L+P+  P   F+D+ M+++
Sbjct  315   AEQFETYQALVPDEFPQREFIDDVMLSA  342



>ref|XP_010681057.1| PREDICTED: uncharacterized protein LOC104896066 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010681058.1| PREDICTED: uncharacterized protein LOC104896066 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010681059.1| PREDICTED: uncharacterized protein LOC104896066 [Beta vulgaris 
subsp. vulgaris]
Length=349

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 126/208 (61%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+  ++ L   P ++EAL+ LV  K++     +A+  V +L+++EP E EW LL+   + 
Sbjct  127   EEMYEKLLEQEPRNLEALKVLVNGKMKKGKTKEAVKYVEKLIDIEPDEVEWRLLQALCYE  186

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G    A+R F EIL + PL++ A HGL   + ++ +      + + + +A++L   E 
Sbjct  187   MMGHLSKAKRLFKEILKERPLMLRALHGLAMVMHKNHE----GPVFDMLNQALELASREK  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ K+L+AQ+  ++ D  EALK Y EL+ E P DFRPYL Q I+Y++  K KEA 
Sbjct  243   RVTEERNIKILIAQMHLVKGDLNEALKKYGELIDENPRDFRPYLCQGIIYSLQDKRKEAN  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F++YR L+PE  P   FL++ ++A+K
Sbjct  303   EQFEIYRSLVPEEFPQRGFLEDVVLAAK  330



>ref|NP_568061.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK91373.1| AT4g39470/F23K16_100 [Arabidopsis thaliana]
 gb|AAO42760.1| At4g39470/F23K16_100 [Arabidopsis thaliana]
 gb|AEE87076.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=341

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/208 (33%), Positives = 126/208 (61%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK  ++ L   P ++EA++++V  K++     DA+  V +LM+LEP E EW LL    + 
Sbjct  119   EKMFEKLLENEPENMEAMKAVVYKKMRRGKNEDAVKYVEKLMKLEPHEVEWKLLEALCYE  178

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE   A+R + +IL ++PLL+ A HGL   + +         + + +++AM++ +  +
Sbjct  179   TMGELSKAKRLYKDILKEQPLLIRALHGLAMVMHKTHDT----SVFDMLIEAMEVARQGN  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+ Q+  +E  +EE LK++Q++V + P DFRPYL Q I+Y+++ K +EA 
Sbjct  235   RVTEERNIQVLIGQMHIVEGQFEEGLKIFQQMVNDNPRDFRPYLCQGIVYSLMDKKEEAA  294

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F++Y  L+P   P   FLD+  +A++
Sbjct  295   QQFEIYWSLVPGEFPQKGFLDDVALAAQ  322



>ref|XP_010437067.1| PREDICTED: uncharacterized protein LOC104720867 [Camelina sativa]
Length=347

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 126/203 (62%), Gaps = 8/203 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L + P ++EAL++++  K++     DA+  V +LM+LEP E EW LL    +   G+   
Sbjct  132   LESEPENMEALKAVLYKKMRRGKTEDAVKFVEKLMKLEPHEIEWKLLEALCYETMGQLSR  191

Query  722   ARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             A+R F +IL ++PLL+ A HGL   +  + D  V ++      +++AM++ +  ++  + 
Sbjct  192   AKRLFKDILKEQPLLIRALHGLAMVMHKTHDSSVFDM------LMEAMEVARQGNRVTEE  245

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ ++L+ Q+  ++  +EE LKV+Q++V + P DFRPYL Q I+Y+++ K +EA + F++
Sbjct  246   RNIQVLIGQMHIVKGQFEEGLKVFQQMVNDNPRDFRPYLCQGIVYSLMEKKEEAAQQFEI  305

Query  1076  YRELLPEGHPYSSFLDNTMIASK  1144
             Y  L+PE  P   FLD+  +A++
Sbjct  306   YWSLVPEEFPQKGFLDDVALAAQ  328



>ref|XP_002868907.1| chloroplast lumen common family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45166.1| chloroplast lumen common family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=340

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 127/208 (61%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK  ++ L + P ++EA++++V  K++     DA+  V +LM+LEP E EW LL    + 
Sbjct  118   EKMFEKLLESEPENMEAMKAVVYKKMRRGKNEDAVKYVEKLMKLEPHEVEWKLLEALCYE  177

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+   A+R + +IL ++PLL+ A HGL   + +         + + +++AM++ +  +
Sbjct  178   TMGQLSKAKRLYKDILKEQPLLIRALHGLAMVMHKTHDT----SVFDMLMEAMEVARQGN  233

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+ Q+  ++  +EE LK++Q++V + P DFRPYL Q I+Y+++ K +EA 
Sbjct  234   RVTEERNIQVLIGQMHIVQGQFEEGLKIFQQMVNDNPRDFRPYLCQGIVYSLMDKKEEAA  293

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F+ Y  L+PE  P   FLD+  +A++
Sbjct  294   QQFENYWSLVPEEFPQKGFLDDVALAAQ  321



>ref|XP_009101872.1| PREDICTED: uncharacterized protein LOC103828042 [Brassica rapa]
Length=343

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/336 (31%), Positives = 174/336 (52%), Gaps = 42/336 (13%)
 Frame = +2

Query  146   THFSAKPNLNFLPS-LNNHRPVLVRPLSSLSFTTQPQHVPIKASSSFSPEFSVPKPAKQE  322
             THF   PN N  PS     RP   +   SL+F +   H+P+  SS               
Sbjct  28    THF---PNPNGFPSPWRKSRPFAPKLSQSLNFASPSPHLPLIRSS---------------  69

Query  323   TAKSSPGILETLTQSHFQTPFSCavvatvaaaavFLGRFSLRVNPSIaapvsapataeaa  502
             T+ SS   L+ L +              +  + VFLG  S +  P++A P +  ++    
Sbjct  70    TSPSSKDFLQILARK---------AAIFLVGSFVFLGFCSSK--PALALPTATASSQTEL  118

Query  503   vsdaetEKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLL  682
               +A  EK  +    + P ++EA+++++  K++     DA+  V +LM+LEP E EW LL
Sbjct  119   EDEALFEKVRE----SEPENMEAMKAVLYKKMRRGKPEDAVKYVEKLMKLEPREVEWKLL  174

Query  683   RNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKA  856
                 +   G+   A+R F +IL   PLL+ A HGL   +  S D  V ++      + +A
Sbjct  175   EALCYETMGQLSKAKRLFKDILRDNPLLIRALHGLAMVMHKSHDSSVFDM------LNEA  228

Query  857   MKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTM  1036
             M++ +  ++  + R+ ++L+ Q+  ++  +EEALK++QE+VK+ P DFRPYL Q I+Y++
Sbjct  229   MEVARQGNRVTEERNIQVLIGQMHIVKGQFEEALKIFQEMVKDNPRDFRPYLCQGIVYSL  288

Query  1037  LGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + K +EA + F++Y  L PE  P   FLD+  +A++
Sbjct  289   MDKKEEADQQFEIYWSLAPEEFPQKGFLDDVALAAQ  324



>ref|XP_010446493.1| PREDICTED: uncharacterized protein LOC104729259 [Camelina sativa]
Length=347

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 124/203 (61%), Gaps = 8/203 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L   P ++EAL++++  K++     DA+  V +LM+LEP E EW LL    +   G+   
Sbjct  132   LEGEPENMEALKAVLYKKMRRGRTEDAVKYVEKLMKLEPREIEWKLLEALCYETMGQLSR  191

Query  722   ARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             A+R F +IL ++PLL+ A HGL   +  S D  V ++      + +AM++ +  ++  + 
Sbjct  192   AKRLFKDILKEQPLLIRALHGLAMVMHKSHDSSVFDM------LTEAMEVARQGNRVTEE  245

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ ++L+ Q+  ++  +EE LKV+Q++V + P DFRPYL Q I+Y+++ K +EA + F++
Sbjct  246   RNIQVLIGQMHIVKGQFEEGLKVFQQMVNDNPRDFRPYLCQGIVYSLMEKKEEAAQQFEI  305

Query  1076  YRELLPEGHPYSSFLDNTMIASK  1144
             Y  L+PE  P   FLD+  +A++
Sbjct  306   YWSLVPEEFPQKGFLDDVALAAQ  328



>ref|XP_010431919.1| PREDICTED: uncharacterized protein LOC104716227 [Camelina sativa]
Length=348

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 126/203 (62%), Gaps = 8/203 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L + P ++EAL++++  K++     DA+  V +LM+LEP E EW LL    +   G+   
Sbjct  133   LESEPENMEALKAVLYKKMRRGKTEDAVKYVEKLMKLEPHEIEWKLLEALCYETMGQLSR  192

Query  722   ARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             A+R F +IL ++PLL+ A HGL   +  + D  V ++      +++AM++ +  ++  + 
Sbjct  193   AKRLFKDILKEQPLLIRALHGLAMVMHKTHDSSVFDM------LMEAMEVARQGNRVTEE  246

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ ++L+ Q+  ++  +EE LKV+Q++V + P DFRPYL Q I+Y+++ K +EA + F++
Sbjct  247   RNIQVLIGQMHIVKGQFEEGLKVFQQMVNDNPRDFRPYLCQGIVYSLMEKKEEAAQQFEI  306

Query  1076  YRELLPEGHPYSSFLDNTMIASK  1144
             Y  L+PE  P   FLD+  +A++
Sbjct  307   YWSLVPEEFPQKGFLDDVALAAQ  329



>ref|XP_008466719.1| PREDICTED: uncharacterized protein LOC103504062 [Cucumis melo]
Length=343

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 125/209 (60%), Gaps = 3/209 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   VEAL+SL++ K++N    +A+ I+ +L+   PS TEW  L   L    G
Sbjct  135   LNDFLESNSEAVEALKSLLQQKLENGEDEEALKILKQLVSALPSVTEWKFLMARLLAEMG  194

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + E AR  F EIL+ +PL   +Y  L       D+  E + +  R+ +A+++ + E K  
Sbjct  195   KTENAREVFEEILAVDPL---SYEALFENALLMDRCGEGEAVLRRLEEALRIAEKERKAK  251

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD KL++AQI+ ++ + EEALK Y+ELVKE+P+DFRPY  Q ++Y++L K+ EAK+ F
Sbjct  252   EARDVKLIMAQIQFLQKNVEEALKSYKELVKEDPSDFRPYFCQGMIYSLLDKNTEAKQQF  311

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
               YREL P+      +L   +   K+F +
Sbjct  312   AKYRELSPKKFEVDGYLRTPLSRMKIFGS  340



>ref|XP_010464596.1| PREDICTED: uncharacterized protein LOC104745120 [Camelina sativa]
Length=339

 Score =   142 bits (358),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 125/202 (62%), Gaps = 6/202 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L++ L  + NDVEAL SL + K ++     AI I+NRL+++EP E +WP+++  +     
Sbjct  108   LKKHLETHSNDVEALISLAKIKFESDKCDQAIEIMNRLIDVEPQEQKWPVMKARILSFFN  167

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + + A + F EIL  +P+ V+A H L+      D   +L   E+RI  A++ CK   KK 
Sbjct  168   KNKLAIKAFEEILLTDPIRVDALHYLVMEYY--DSKPKLLQAEKRIKYAIRRCKEMKKKT  225

Query  890   -QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKH  1066
              ++R  ++L+AQIR +E +  EAL++ +ELVKE+P D++ YL+Q ++YT+L K+ EAKK 
Sbjct  226   KEIRGLRMLIAQIRVLEGNTVEALRICEELVKEDPEDYKVYLFQGLVYTLLKKEDEAKKQ  285

Query  1067  FQMYRELLPEGHPYSSFLDNTM  1132
             F+    +LPE H Y   LD  M
Sbjct  286   FEQVARILPENHWY---LDTPM  304



>ref|XP_007205389.1| hypothetical protein PRUPE_ppa007407mg [Prunus persica]
 gb|EMJ06588.1| hypothetical protein PRUPE_ppa007407mg [Prunus persica]
Length=369

 Score =   142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK L+E    +P +V AL+ ++   ++  N   A++ V +L+++EP E EW LL    + 
Sbjct  150   EKILEE----DPTNVGALKVVLYGAMRRGNTKQAVNYVEKLIDVEPDEVEWRLLMALCYE  205

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G+  TA+R F EIL + PLL+ A HGL   + ++    E   +   + KA+++ + E 
Sbjct  206   IMGQLSTAKRLFQEILEERPLLLRALHGLALVMHKN---HEGPAVFVMLNKALEIAQREK  262

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+AQ+  ++ + EE L  +Q+LVK +P DFRPYL Q I+Y++L + KEA 
Sbjct  263   RVIEERNIRILIAQMHVVKGELEEGLNKFQDLVKADPRDFRPYLCQGIIYSLLDQKKEAA  322

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F+ YR L PE  P   FLD+ ++A+K
Sbjct  323   EQFETYRALAPEEFPQRGFLDDVVLAAK  350



>ref|XP_008232396.1| PREDICTED: uncharacterized protein LOC103331539 [Prunus mume]
Length=369

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK L+E    +P +V AL+ ++   ++  N   A++ V +L+++EP E EW LL    + 
Sbjct  150   EKILEE----DPTNVGALKVVLYGAMRRGNTKQAVNYVEKLIDVEPDEVEWRLLMALCYE  205

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G+  TA+R F EIL + PLL+ A HGL   + ++    E   +   + KA+++ + E 
Sbjct  206   IMGQLSTAKRLFQEILEERPLLLRALHGLALVMHKN---HEGPAVFVMLNKALEIAQREK  262

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+AQ+  ++ + EE L  +Q+LVK +P DFRPYL Q I+Y++L + KEA 
Sbjct  263   RVIEERNIRILIAQMHVVKGELEEGLNKFQDLVKADPRDFRPYLCQGIIYSLLDQKKEAA  322

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F+ YR L PE  P   FLD+ ++A+K
Sbjct  323   EQFETYRALAPEEFPQRGFLDDVVLAAK  350



>ref|XP_007045336.1| Prenylyltransferase superfamily protein [Theobroma cacao]
 gb|EOY01168.1| Prenylyltransferase superfamily protein [Theobroma cacao]
Length=335

 Score =   141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 126/210 (60%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L +N   +EAL+ L+E K++N    +A++I+NRL+  +P  T+W  L   L    G
Sbjct  127   LSEFLGSNNEAIEALKYLLEQKLENGEDEEALTILNRLVSAQPQVTDWKFLLARLLSEMG  186

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + E AR+ F EIL   PL  EA   + L+      D+  E + + +R+ +A+ + + E K
Sbjct  187   QTENARKVFEEILRTNPLSFEALFENALLM-----DRCGEGEAVIKRLEEALTIAQDEKK  241

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI+ ++ + EEAL+ YQ+L KE+P+DFRPY  Q ++Y++L ++ EAK+
Sbjct  242   VKEARDVRLIMAQIQFLQKNVEEALRSYQQLAKEDPSDFRPYFCQGMIYSLLDRNAEAKE  301

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L  ++   KLF 
Sbjct  302   QFAKYRELSPKKFEVEGYLRTSLSRMKLFG  331



>ref|XP_006284058.1| hypothetical protein CARUB_v10005184mg [Capsella rubella]
 gb|EOA16956.1| hypothetical protein CARUB_v10005184mg [Capsella rubella]
Length=342

 Score =   141 bits (356),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 123/201 (61%), Gaps = 4/201 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L + P ++EA+++++  K++     DA+  V +LM+LEP E EW LL    +   G+   
Sbjct  127   LESEPENMEAMKAVLYKKMRRGKTEDAVKYVEKLMKLEPHEIEWKLLEALCYETMGQLSK  186

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F +IL ++PLL+ A HGL   + +         + + ++ AM++ +  ++  + R+
Sbjct  187   AKRLFKDILKEQPLLIRALHGLAMVMHKTHD----SSLFDMLMDAMEVARRGNRVTEERN  242

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+ Q+  ++  +EE LK++Q++V + P DFRPYL Q I+Y+++ K +EA + F++Y 
Sbjct  243   IQVLIGQMHIVKGQFEEGLKIFQQMVNDNPRDFRPYLCQGIVYSLMDKKEEAAQQFEIYW  302

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+  +A++
Sbjct  303   SLVPEEFPQKGFLDDVALAAQ  323



>ref|XP_007223753.1| hypothetical protein PRUPE_ppa010540mg [Prunus persica]
 gb|EMJ24952.1| hypothetical protein PRUPE_ppa010540mg [Prunus persica]
Length=245

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 126/210 (60%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   +EAL+SL++ K++N   G+A+ I+ RL   +PS TEW  +   +    G
Sbjct  37    LSDFLGSNSEAIEALKSLLQQKLENGEDGEALKILQRLASAQPSATEWKFMMARVLSEMG  96

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E E AR+ F EIL+ +PL  EA   + L+      D+  E + + +R+  A+++ + E+K
Sbjct  97    ENENARQVFEEILAADPLSFEALFENALLM-----DRSGEGEAVMKRLEDALQIAEEENK  151

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + E+AL  Y EL KE+P DFRPY  + ++Y++L ++ EA++
Sbjct  152   AKEARDVKLIMAQIQFLQKNVEDALNSYNELAKEDPKDFRPYFCRGMIYSLLDRNAEARE  211

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F+ YR+L P+      +L   +   KLF 
Sbjct  212   QFEKYRQLSPKKFEVDGYLRTPLSRVKLFG  241



>gb|KFK30511.1| hypothetical protein AALP_AA7G271400 [Arabis alpina]
Length=342

 Score =   141 bits (355),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 125/203 (62%), Gaps = 8/203 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L + P ++EA+++++  K++     DA+  V +LM+LE +E EW LL    +   G+   
Sbjct  127   LESEPENMEAMKAVLYKKMKRGKTEDALKYVEKLMKLESNEVEWKLLEAFCYETLGQLSK  186

Query  722   ARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             A+R F +IL ++PLL+ A HGL   +  S D  V ++      + +AM++ +  ++  + 
Sbjct  187   AKRLFQDILIEQPLLIRALHGLAMVMHKSHDSSVFDM------LNEAMEVARQGNRVTEE  240

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ ++L+ Q+  ++  +EE LK++Q++VK+ P DFRPYL Q I+Y ++ K +EA K F++
Sbjct  241   RNIQVLMGQMHIVKGQFEEGLKIFQQMVKDNPRDFRPYLCQGIVYGLMDKKEEAAKQFEI  300

Query  1076  YRELLPEGHPYSSFLDNTMIASK  1144
             Y  L+PE  P   FLD+  +A++
Sbjct  301   YWSLVPEEFPQKGFLDDVAMAAQ  323



>ref|XP_006842190.1| hypothetical protein AMTR_s00078p00160770 [Amborella trichopoda]
 gb|ERN03865.1| hypothetical protein AMTR_s00078p00160770 [Amborella trichopoda]
Length=199

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 110/176 (63%), Gaps = 3/176 (2%)
 Frame = +2

Query  617   DAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITA  796
             +AI  V RL E+EP E EW L++   + L G+   A+R F EIL + PLL+ A HGL   
Sbjct  8     EAIKYVERLREVEPGEVEWRLIQALSYELMGQLSKAKRLFKEILEENPLLLRALHGLALV  67

Query  797   VSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQEL  976
             +       E     E + KA+   + E++  + R+ K+L+AQ+  ++ + EE LK +Q+L
Sbjct  68    LHRKG---EGPAASEMLDKALVQARRENRVTEERNIKILIAQMHVVKGELEEGLKKFQDL  124

Query  977   VKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             V E+P DFRPYL Q I+Y++L K KEA++ F+ Y+ L+P+  P  SFLD+ M+A+K
Sbjct  125   VNEDPRDFRPYLCQGIIYSLLDKKKEAEEQFENYQSLVPQEFPQRSFLDDVMVAAK  180



>ref|XP_002306358.2| hypothetical protein POPTR_0005s08770g [Populus trichocarpa]
 gb|EEE93354.2| hypothetical protein POPTR_0005s08770g [Populus trichocarpa]
Length=356

 Score =   140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 128/210 (61%), Gaps = 7/210 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+  ++ L   P +VEAL+ +V  K++     +A+  V RL+++EP + EW LL    + 
Sbjct  133   EEMFEKVLEMEPRNVEALKVVVHGKMRRGQTKEAVKYVERLIDIEPEQVEWRLLEALCYE  192

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKT  874
             + G+   A+  F EIL + PLL+ A HGL   + +      L+G  + E + KA+++ + 
Sbjct  193   MMGQLSKAKTLFKEILIERPLLLRALHGLALVMHKS-----LEGPAVFEMLNKALEVARR  247

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
             E +  + R+ ++L+AQ+  ++ + EEALK +Q LV + P DFRPYL Q I+Y++LG+ + 
Sbjct  248   EKRVTEERNIRILIAQMLVVKGELEEALKKFQGLVSDNPRDFRPYLCQGIIYSLLGRKEA  307

Query  1055  AKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             A +HF+ Y+ L+P+  P   FLD+ ++ +K
Sbjct  308   AAEHFETYQSLVPDEFPQRMFLDDVVLEAK  337



>gb|KGN49762.1| hypothetical protein Csa_5G114590 [Cucumis sativus]
Length=317

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   VEAL+SL++ K++N    +A+ I+ +L+   PS TEW  L   L    G
Sbjct  109   LNDFLESNSEAVEALKSLLQQKLENGEDEEALKILKQLVSALPSVTEWKFLMARLLGEMG  168

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + E AR  F EIL+  PL  EA   + L+      D+  E + +  R+ +A+++ + E+K
Sbjct  169   KTEHAREVFEEILAVNPLSFEALFENALLM-----DRCGEGEAVIRRLEEALRIAENENK  223

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + EEALK Y+ELVKE+P+DFRPY  Q ++Y++L K+ EAK+
Sbjct  224   AKEARDVKLIMAQIQFLQKNVEEALKSYKELVKEDPSDFRPYFCQGMIYSLLDKNIEAKQ  283

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F  YREL P+      +L   +   K+F +
Sbjct  284   QFAKYRELSPKKFEVDGYLRTPLSRMKIFGS  314



>ref|XP_004288112.1| PREDICTED: uncharacterized protein LOC101294595 [Fragaria vesca 
subsp. vesca]
Length=357

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 126/210 (60%), Gaps = 4/210 (2%)
 Frame = +2

Query  521   EKALQER-LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E+ + ER L  +P + EAL+ LV  K++     +A+  V +L+ +EP E EW LL     
Sbjct  131   EEEMYERVLEGDPRNFEALKVLVYGKMRRGETKEAVKYVEKLIGVEPDEVEWRLLLALCH  190

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
              + GE  TA++ F EIL + PLL+ A HGL   + +     E   +   + KA+K+   E
Sbjct  191   EIMGELGTAKKLFQEILEERPLLLRALHGLALVMHKR---REGPAVFVMLDKALKIAHRE  247

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              +  + R+ ++L+AQ+  ++   EE L ++Q+LV E+P DFRPYL Q I+Y++L + KEA
Sbjct  248   KRVIEERNIRILIAQMHVVKGQLEEGLNLFQDLVTEDPRDFRPYLCQGIIYSLLDQKKEA  307

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASKL  1147
              + F++YR L+PE      FLD+ ++A+K+
Sbjct  308   AEKFEIYRALVPEEVSQKGFLDDVVLAAKM  337



>ref|XP_004149472.1| PREDICTED: uncharacterized protein LOC101212982 [Cucumis sativus]
 ref|XP_004170061.1| PREDICTED: uncharacterized LOC101212982 [Cucumis sativus]
Length=345

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   VEAL+SL++ K++N    +A+ I+ +L+   PS TEW  L   L    G
Sbjct  137   LNDFLESNSEAVEALKSLLQQKLENGEDEEALKILKQLVSALPSVTEWKFLMARLLGEMG  196

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + E AR  F EIL+  PL  EA   + L+      D+  E + +  R+ +A+++ + E+K
Sbjct  197   KTEHAREVFEEILAVNPLSFEALFENALLM-----DRCGEGEAVIRRLEEALRIAENENK  251

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + EEALK Y+ELVKE+P+DFRPY  Q ++Y++L K+ EAK+
Sbjct  252   AKEARDVKLIMAQIQFLQKNVEEALKSYKELVKEDPSDFRPYFCQGMIYSLLDKNIEAKQ  311

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F  YREL P+      +L   +   K+F +
Sbjct  312   QFAKYRELSPKKFEVDGYLRTPLSRMKIFGS  342



>ref|XP_008220992.1| PREDICTED: transmembrane and TPR repeat-containing protein 1 
[Prunus mume]
Length=336

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 127/210 (60%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   +EAL+SL++ K++N   G+A+ I+ RL   +PS TEW  +   +    G
Sbjct  128   LSDFLGSNSEAIEALKSLLQQKLENGEDGEALKILQRLALAQPSATEWKFMMARVLAEMG  187

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E E+AR+ F EIL+ +PL  EA   + L+      D+  E + + +R+  A+++ + E+K
Sbjct  188   ENESARQVFEEILAADPLSFEALFENALLM-----DRSGEGEAVMKRLEDALQIAEEENK  242

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + E+AL  Y EL KE+P DFRPY  + ++Y++L ++ EA++
Sbjct  243   AKEARDVKLIMAQIQFLQKNVEDALNSYNELAKEDPKDFRPYFCRGMIYSLLDRNAEARE  302

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F+ YR+L P+      +L   +   KLF 
Sbjct  303   QFEKYRQLSPKKFEVDGYLRTPLSRVKLFG  332



>dbj|BAJ95417.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88527.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 131/206 (64%), Gaps = 7/206 (3%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV+AL+ ++ ++++ ++ G A+    +L E EP E EW L+   L  L G+ 
Sbjct  172   EVLSEDPGDVDALKCVLFARMRRKDWGGALRYAAQLREAEPGEVEWRLMEALLHELKGDI  231

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKG  889
              TA R F E+L+++PLLV A HGL   + +      L+G  + E + KA++L ++E++  
Sbjct  232   ATAERLFQEVLAEKPLLVRALHGLALCMHK-----RLEGPTVFEMLEKALQLAESEERVP  286

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + R+ KLL+AQ+  ++ D + A +  + L+ E+P DFRP+L Q I+Y +L K +EA + F
Sbjct  287   EERNIKLLIAQMHVVKGDLDVASEKLRTLINEDPRDFRPHLCQGIVYALLDKKEEADEQF  346

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKL  1147
              +YR L+P+  P  SF+++ ++++K+
Sbjct  347   DVYRSLVPDEFPDKSFINDVILSAKV  372



>gb|EPS66599.1| hypothetical protein M569_08177 [Genlisea aurea]
Length=346

 Score =   139 bits (351),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 124/198 (63%), Gaps = 0/198 (0%)
 Frame = +2

Query  548   ANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETAR  727
             A  ND+  L+ L E +   + + +AI ++N+L+ L+P E  W +L+       GE + AR
Sbjct  127   AQSNDLAGLKRLREVETDRRKLPEAIGVLNKLILLQPEEPSWRILKAQFHDYNGEADAAR  186

Query  728   RGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFK  907
               F+E+L + P  +E YHGLI+ +  +  + +LK +E R  +A++LC+  + +  + DFK
Sbjct  187   YLFDEMLRENPTRIEPYHGLISTIFYNKSIGDLKYVERRAEEAIELCRERNSEKGVVDFK  246

Query  908   LLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYREL  1087
             LL+A IR +E +++ AL++Y+EL     +DFR YL + I+Y+++ +  EA+++F+ Y +L
Sbjct  247   LLIADIRTLEKEFDSALRIYEELEALNGSDFRVYLGKGIVYSLMKRVNEAEQNFEKYWDL  306

Query  1088  LPEGHPYSSFLDNTMIAS  1141
             +P  +P++ + +  +++ 
Sbjct  307   VPGDYPHAKYFERDVVSG  324



>gb|EPS71235.1| hypothetical protein M569_03527, partial [Genlisea aurea]
Length=257

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 122/201 (61%), Gaps = 7/201 (3%)
 Frame = +2

Query  548   ANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETAR  727
              +P ++E L+ +V  K++     +A+  V +L+ L+P+E EW LL+   + L G+   A+
Sbjct  60    GDPTNLETLKMVVNVKMRKGKTKEAVEYVEKLIRLQPNEMEWRLLQAFCYELIGDLSRAK  119

Query  728   RGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKGQLRD  901
               F +IL + PLL+ A HGL   + +     +L+G  + + + KA++L + E +  + R 
Sbjct  120   SLFKDILKQNPLLLRALHGLAMVMHK-----KLEGPAVFQMLDKAVELARVEKRVNEERS  174

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
               +L+AQ+  ++ + EEAL   Q LV + P DFRPYL Q I+Y +LGK KEA + F++YR
Sbjct  175   IVILIAQMHILKGELEEALSKLQSLVADNPRDFRPYLCQGIVYGLLGKSKEADESFEIYR  234

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P  S+LD+  +A++
Sbjct  235   SLVPEEFPQKSYLDHVYLAAR  255



>ref|XP_006411747.1| hypothetical protein EUTSA_v10025635mg [Eutrema salsugineum]
 gb|ESQ53200.1| hypothetical protein EUTSA_v10025635mg [Eutrema salsugineum]
Length=343

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 124/208 (60%), Gaps = 4/208 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E   ++ L + P ++EA+++++  K++     DA+  V +LM+LEP E EW LL    + 
Sbjct  121   ETMFEKLLESEPENMEAMKAVLYKKMRRGKTEDAVKYVEKLMKLEPREVEWKLLEALCYE  180

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               G+   A+R + +IL + PLL+ A HGL   + +         ++E    AM++ +  +
Sbjct  181   TMGQLSKAKRLYKDILKENPLLIRALHGLAMVMHKTHDSSVFDMLKE----AMEVARLGN  236

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+ Q+  ++  +EE LKV+Q++V + P DFRPYL Q I+Y+++ + +EA 
Sbjct  237   RVTEERNIQVLIGQMHIVKGQFEEGLKVFQQMVNDNPRDFRPYLCQGIVYSLMDRKEEAA  296

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             + F++Y  L+PE  P   FLD+  +A++
Sbjct  297   QQFEVYWSLVPEEFPQKGFLDDVALAAQ  324



>ref|XP_003602501.1| hypothetical protein MTR_3g095070 [Medicago truncatula]
 gb|AES72752.1| TPR superfamily protein [Medicago truncatula]
Length=333

 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 117/201 (58%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +  +VEAL+ +V  KI+     +A   V RL++ EP+E EW LL    +   G    
Sbjct  117   LEKDSRNVEALKVIVYGKIRRGKCKEAEKFVKRLIDEEPNEVEWRLLLALCYETMGYLSK  176

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  + EIL   PL V A HGL   + ++   +E   + E + KA++L   E+K  + R+
Sbjct  177   AKGLYLEILENWPLFVRALHGLAMVMHKN---KEGPAVFEMLNKAVELAINENKVTEERN  233

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              K+L AQ+R ++ D EE LK  Q+L+ + P DFRPYL Q I+Y++L K +EA K F+ Y+
Sbjct  234   IKILTAQMRVVQGDLEEGLKRCQDLIDQNPRDFRPYLCQGIIYSLLDKKEEAAKQFETYQ  293

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+  +A+K
Sbjct  294   ALVPEEFPQRGFLDDITLAAK  314



>dbj|BAJ90223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   139 bits (350),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 130/206 (63%), Gaps = 7/206 (3%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV+AL+ ++ ++++ ++ G A+    +L E EP E EW L+   L  L G+ 
Sbjct  168   EVLSEDPGDVDALKCVLFARMRRKDWGGALRYAAQLREAEPGEVEWRLMEALLHELKGDI  227

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKG  889
              TA R F E+L+++PLLV A HGL   + +      L+G  + E + KA++L ++E++  
Sbjct  228   ATAERLFQEVLAEKPLLVRALHGLALCMHK-----RLEGPTVFEMLEKALQLAESEERVP  282

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + R+ KLL+AQ+  ++ D + A +  +  + E+P DFRP+L Q I+Y +L K +EA + F
Sbjct  283   EERNIKLLIAQMHVVKGDLDVASEKLRTFINEDPRDFRPHLCQGIVYALLDKKEEADEQF  342

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKL  1147
              +YR L+P+  P  SF+++ ++++K+
Sbjct  343   DVYRSLVPDEFPDKSFINDVILSAKV  368



>ref|XP_011100083.1| PREDICTED: uncharacterized protein LOC105178317 isoform X2 [Sesamum 
indicum]
Length=327

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 117/207 (57%), Gaps = 25/207 (12%)
 Frame = +2

Query  524   KALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVL  703
             K LQE    NP DVEAL+ +V  K++     +A+  V RL+EL+P+E EW LL+   + +
Sbjct  133   KLLQE----NPRDVEALKMVVNVKMKKGKTSEAVEYVERLIELQPNEMEWRLLQALCYEM  188

Query  704   TGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
              G    A+  F  IL ++PLL+ A HGL   + ++ +   +  + ER L+  +      K
Sbjct  189   MGNLSKAKSLFKNILKQKPLLLRALHGLAMVMHKNHEGPAVFEMLERALEVAR----RQK  244

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
             KG                 D+EEAL+ +Q L+ E P DFRPYL Q I+Y++L K KEA  
Sbjct  245   KG-----------------DFEEALEKFQALIDENPRDFRPYLCQGIVYSLLDKRKEADA  287

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASK  1144
             +F++YR L+PE  P   FLD+ ++A+K
Sbjct  288   NFEIYRSLVPEEFPQRGFLDDVVLAAK  314



>ref|XP_008340511.1| PREDICTED: uncharacterized protein LOC103403446 [Malus domestica]
Length=342

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 127/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   + AL+SL++ K++N    +A+ I+ RL+  +PS TEW  +   L    G
Sbjct  134   LSDFLGSNSEAISALKSLLQQKLENGEDDEALKILQRLVAAQPSNTEWKFMMARLLSEMG  193

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E ++AR+ F EIL+  PL  EA   + L+      D+  E + + +R+  A+++ + E+K
Sbjct  194   ENKSARQVFEEILAANPLSFEALFENALLM-----DRCGEGEAVIKRLEDALQVAEEENK  248

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQ++ ++ + E+ALK Y ELVKE+P DFRPY  + ++Y++L ++ EA +
Sbjct  249   AKEARDVKLIMAQVQFLQKNVEDALKSYNELVKEDPKDFRPYFCRGMIYSLLDRNAEATE  308

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F+ YR+L P+      +L   +   KLF +
Sbjct  309   QFEKYRQLSPKKFEVDGYLRKPLSRVKLFGS  339



>emb|CDX72699.1| BnaC07g47210D [Brassica napus]
Length=343

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 127/210 (60%), Gaps = 8/210 (4%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+  ++ L + P ++EA+++++  K++     DA+  V +L++LEP E EW LL    + 
Sbjct  121   EEMFEKVLESEPENMEAMKAVLYKKMRRGKPEDAVKYVEKLIKLEPREVEWKLLEALCYE  180

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAV--SEDDQVEELKGIEERILKAMKLCKT  874
                +   A+R F +IL   PLL+ A HGL   +  S D  V ++      + +AM++ + 
Sbjct  181   TMEQLSKAKRLFKDILRDNPLLIRALHGLAMVMHKSHDSSVFDM------LNEAMEVARQ  234

Query  875   EDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKE  1054
              ++  + R+ ++L+ Q+  ++  +EEALK++Q++V + P DFRPYL Q I+Y+++ K +E
Sbjct  235   GNRVTEERNIQVLIGQMHIVKGQFEEALKIFQQMVNDNPRDFRPYLCQGIVYSLMDKKEE  294

Query  1055  AKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             A + F++Y  L+PE  P   FLD+  +A++
Sbjct  295   ADQQFEIYWSLVPEEFPQKGFLDDVALAAQ  324



>ref|XP_010246008.1| PREDICTED: uncharacterized protein LOC104589394 [Nelumbo nucifera]
Length=335

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 127/210 (60%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L ++ + ++AL+SL++ K+++    +A+ I+ RL+  +PSE EW  L   L    G
Sbjct  126   LSQFLESHSDAIDALKSLLQRKLEDGEDEEALKILERLVSAQPSEVEWKFLVARLLNEMG  185

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + + AR+ F  IL+  PL  EA   + L+      D+  E + +  R+ +A+KL + E+K
Sbjct  186   KVDEARQVFEAILAVNPLSFEALFENALLM-----DRCGEGEAVLNRLQEALKLAEEENK  240

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI+ ++ + +EAL+ YQEL KE+P DFRPY  Q ++Y++L ++KEA++
Sbjct  241   VKEARDVRLIMAQIQYLQKNVDEALRSYQELAKEDPKDFRPYFCQGVIYSLLDRNKEARE  300

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F+ Y EL P+      FL   +   KLF 
Sbjct  301   QFKKYHELCPKKFEVEGFLQTPLSRMKLFG  330



>ref|XP_010555328.1| PREDICTED: uncharacterized protein LOC104824851 [Tarenaya hassleriana]
 ref|XP_010555329.1| PREDICTED: uncharacterized protein LOC104824851 [Tarenaya hassleriana]
Length=349

 Score =   136 bits (343),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 121/197 (61%), Gaps = 3/197 (2%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRG  733
             PN++EA++ +V  K++     +A+  + +L  ++P ETEW LL    + + G+   A+R 
Sbjct  137   PNNMEAMKVVVYGKMRRGKTAEAVKYIKKLKRIQPQETEWKLLEALCYEMMGQLTKAKRL  196

Query  734   FNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLL  913
             F+++L + PLL+ A HGL   + +     E   + + + +A+++ + E +  + R+ ++L
Sbjct  197   FSDVLKENPLLIRALHGLAMVMHKS---HEGSAVFDMLNEALEVARQEQRVTEERNIQVL  253

Query  914   LAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLP  1093
             + Q+  +    E  LK+++E+V E P DFRPYL Q I+Y+++ K++EA++ F++Y  L+P
Sbjct  254   IGQMHIVMGQLEAGLKIFREMVDENPRDFRPYLCQGIIYSLMDKEEEAEQQFEIYWSLVP  313

Query  1094  EGHPYSSFLDNTMIASK  1144
             E  P   FLD+  +A++
Sbjct  314   EEFPERGFLDDVAMAAQ  330



>ref|XP_009351651.1| PREDICTED: uncharacterized protein LOC103943159 [Pyrus x bretschneideri]
Length=342

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/211 (35%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   + AL+SL++ K++N    +A+ I+ RL+E +PS TEW  +   +    G
Sbjct  134   LSDFLGSNSEAIGALKSLLQQKLENSEDDEALKILQRLVEAQPSNTEWKFMMARVLSEMG  193

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E E+AR+ F EIL+  PL  EA   + L+      D+  E + + +R+  A+++ + E+K
Sbjct  194   ENESARQVFEEILAANPLSFEALFENALLM-----DRCGEGEAVIKRLEDALQVAEEENK  248

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQ++ ++ + E AL  Y ELVKE+P DFRPY  + ++Y++L ++ EA +
Sbjct  249   AKEARDVKLIMAQVQFLQKNVEGALNSYNELVKEDPKDFRPYFCRGMIYSLLDRNAEATE  308

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F+ YR+L P+      +L   +   KLF +
Sbjct  309   QFERYRQLSPKKFEVDGYLRKPLSRVKLFGS  339



>ref|XP_006298112.1| hypothetical protein CARUB_v10014153mg [Capsella rubella]
 gb|EOA31010.1| hypothetical protein CARUB_v10014153mg [Capsella rubella]
Length=331

 Score =   135 bits (339),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 121/204 (59%), Gaps = 3/204 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E  L++ L    NDVEAL SL + K ++    + I  +NRL+E+EP E  WP+++  +  
Sbjct  96    EATLEKHLETQSNDVEALLSLAKIKFKSDKYEETIETMNRLIEIEPYEQRWPVMKARILS  155

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
                + E A + F EIL  +P  V+A H L+    E     +L  +E+RI  A++ CK  +
Sbjct  156   YFSKSELAIQAFEEILLSDPTRVDALHYLVMEFYESKP--KLLEVEKRIKYAIRRCKNNN  213

Query  881   KKG-QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
              K   +R  ++L+AQI+ +E +  EA+++ +ELVK++P DF+ YL+Q ++YT++GK  EA
Sbjct  214   NKKKDIRGLRMLIAQIKVMEGNTAEAIRICEELVKDDPEDFKIYLFQGLVYTLIGKGDEA  273

Query  1058  KKHFQMYRELLPEGHPYSSFLDNT  1129
              K F+    +LPE  PY   + NT
Sbjct  274   AKQFERVGRILPENSPYLETMVNT  297



>ref|XP_003568801.1| PREDICTED: uncharacterized protein LOC100837872 isoform X1 [Brachypodium 
distachyon]
Length=386

 Score =   136 bits (342),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/206 (35%), Positives = 125/206 (61%), Gaps = 7/206 (3%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV AL+ L+ ++++ ++   A+    +L E +P E EW L+   L  L G+ 
Sbjct  168   EVLSTDPGDVSALKCLLFARMRRKDWAGALRYAAQLREADPGEVEWRLMEALLHELKGDL  227

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKG  889
               A R F E+L+++PLLV A HGL   + +      L+G  + E + KA++L  +E++  
Sbjct  228   AEAERLFQEVLAEKPLLVRALHGLALCMHK-----RLEGPTVFEMLEKALQLAISEERVP  282

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + R+ KLL+AQ+  ++ D + A +  Q L+ E+P DFRP+L Q I+Y +L K +EA   F
Sbjct  283   EERNIKLLIAQMHVVKGDLDVASEKLQSLINEDPRDFRPHLCQGIVYALLDKKEEADVQF  342

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKL  1147
               YR L+P+  P  SF+++ ++++K+
Sbjct  343   DTYRSLVPDEFPDKSFINDVILSAKM  368



>gb|KHG06422.1| Transmembrane and TPR repeat-containing 1 [Gossypium arboreum]
Length=328

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 122/201 (61%), Gaps = 7/201 (3%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L   P +V+AL+ L+  KI+     +A+  V +L+++EP E EW LL+   + + G+   
Sbjct  116   LEKEPRNVDALKVLLYGKIRRGKTQEAVECVEKLIDIEPDEVEWRLLQALCYEMMGQLSK  175

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL + PLL+ A HGL   + ++    E   + E + +A+++   E +  + R+
Sbjct  176   AKRLFKEILEETPLLLRALHGLAMVMHKN---HEGPAVFEMLNEALEVAVREKRVTEERN  232

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  ++    E +K +Q+L+ + P DFRPYL Q I+Y++L K KEA + F++Y+
Sbjct  233   IRVLIAQMHVVK----EGMKKFQDLINDNPRDFRPYLCQGIIYSLLDKKKEAAEQFEIYQ  288

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+PE  P   FLD+ ++ +K
Sbjct  289   SLVPEEFPQRRFLDDVVLEAK  309



>ref|XP_010486521.1| PREDICTED: uncharacterized protein LOC104764647 isoform X1 [Camelina 
sativa]
Length=334

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 123/203 (61%), Gaps = 7/203 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L++ L  + NDVE+L SL + K ++     AI  +NRL+E+EP E +WP ++  +     
Sbjct  101   LEKHLETHSNDVESLVSLAKIKFESDKCDQAIETMNRLIEIEPQEQKWPGMKARILSFFC  160

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + + A   F EILS +P+ V+A H L+      D   +L   E+RI  A++ CK   KK 
Sbjct  161   KNKLAIEAFEEILSTDPIRVDALHYLVMEYY--DSKPKLLEAEKRIKYAIRRCKDMKKKK  218

Query  890   --QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++R  ++L+AQIR +E +  EA+++ +ELVKE+P D++ YL+Q ++YT+L K  EAKK
Sbjct  219   TKEIRGLRMLIAQIRVLEGNTVEAIRICEELVKEDPEDYKVYLFQGLVYTLLKKGDEAKK  278

Query  1064  HFQMYRELLPEGHPYSSFLDNTM  1132
              F+    +LPE H   S+LD  M
Sbjct  279   QFEQVARILPENH---SYLDTPM  298



>ref|XP_002882621.1| hypothetical protein ARALYDRAFT_341089 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58880.1| hypothetical protein ARALYDRAFT_341089 [Arabidopsis lyrata subsp. 
lyrata]
Length=433

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 117/193 (61%), Gaps = 2/193 (1%)
 Frame = +2

Query  527   ALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLT  706
              ++E L    NDV+AL  L E K ++     AI +++RL+E+EP E +WP ++  +    
Sbjct  65    VVEETLEILSNDVKALSLLTEIKFKSDRHEQAIEVLDRLIEIEPDERKWPAMKARILSYH  124

Query  707   GEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKK  886
             G+ E A   F  IL K+P+ V+AYH L+          +L  +E+RI K ++ CK E K 
Sbjct  125   GKSELAIEAFERILEKDPIRVDAYHYLVMEYYNSK--PKLTELEKRINKVIRRCKKEKKA  182

Query  887   GQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKH  1066
              ++  F++L+AQI+ I+ +  EA+++ +ELVK++P DF  YL+Q I+Y ++ K++EA K 
Sbjct  183   KEICGFRMLIAQIKFIQGNSLEAIRICEELVKDDPEDFTIYLFQGIVYILMNKEEEAAKQ  242

Query  1067  FQMYRELLPEGHP  1105
             F+    ++P  HP
Sbjct  243   FEQVARVMPMNHP  255



>ref|XP_002312501.2| hypothetical protein POPTR_0008s14270g [Populus trichocarpa]
 gb|EEE89868.2| hypothetical protein POPTR_0008s14270g [Populus trichocarpa]
Length=328

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 122/211 (58%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             LQ  L +N   +E+L+SL++ K++N    +A+ I+  L+  +P  TEW  L   L   TG
Sbjct  119   LQAFLESNAEAIESLKSLLQQKLENGQDEEALKIIKLLVSAQPEVTEWKFLMARLLNETG  178

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               + AR  F EIL   PL  EA   + L+      D+  E + +  R+  A+ + + E+K
Sbjct  179   RAQDARNVFEEILVANPLSFEALFENALLM-----DRCGEGEAVIRRLQGALDIAEEENK  233

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI  ++ + EEALK YQEL KE+P DFRPY  + ++Y++L +++EAK+
Sbjct  234   VKEARDVRLIMAQIHFLQKNVEEALKSYQELSKEDPEDFRPYFCRGMIYSLLDRNEEAKE  293

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F  YREL P+      +L  ++   KLF +
Sbjct  294   QFAKYRELSPKKFEVEGYLRTSLSRMKLFGS  324



>ref|XP_008389114.1| PREDICTED: transmembrane and TPR repeat-containing protein 1-like 
[Malus domestica]
Length=337

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/211 (34%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   ++AL+SL++ K++N    +A+ I+ RL+  +PS TEW  +   +    G
Sbjct  129   LSDFLGSNSEAIDALKSLLQQKLENGEDDEALKILQRLVAAQPSATEWKFMMARVLSEMG  188

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E E+ARR F EIL+  PL  EA   + L+      D+  E + + +R+  A+++ + E+K
Sbjct  189   ENESARRVFEEILASNPLSFEALFENALLM-----DRCGEGEAVIKRLEDALQVAEEENK  243

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQ++ ++ + E+AL  Y ELVKE+P D RPY  + ++Y++L ++ EA +
Sbjct  244   AKEARDVKLIMAQVQFLQKNVEDALNSYNELVKEDPKDXRPYFCRGMIYSLLDRNAEATE  303

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F+ YR+L P+      +L   +   K+F +
Sbjct  304   QFEKYRQLSPKKFEVDGYLRKPLSRVKVFGS  334



>ref|XP_004297781.1| PREDICTED: uncharacterized protein LOC101303898 [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N + V AL+SL++ K+++    +A+ I+ RL E +P+ TEW  L   L    G
Sbjct  111   LSDFLGSNADAVAALKSLLQQKLESGEDDEALKILQRLAEAQPAVTEWKFLTARLLSEMG  170

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             E  +AR+ F EIL   PL  EA   + L+      D+  E   +  R+ +A+++ + E+K
Sbjct  171   ETGSARQVFEEILETNPLSFEALFENALLM-----DRSGEGHAVIRRLEEALRVAEEENK  225

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + E+AL  Y ELVKE+P DFRPY  + ++Y++L ++ EAK+
Sbjct  226   VKEARDVKLIMAQIQFLQKNVEDALSSYNELVKEDPKDFRPYFCRGMIYSLLERNDEAKE  285

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F+ YR+L P+      +L + +   KLF +
Sbjct  286   QFEKYRQLSPKKFEVDGYLRSPLSRIKLFGS  316



>gb|EEC78638.1| hypothetical protein OsI_18722 [Oryza sativa Indica Group]
Length=396

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV+AL+  + +K++    G A+    RL E EP E EW  +   L  L G+ 
Sbjct  178   EILSRDPGDVDALKCALFAKMRRAEWGGALGFARRLREAEPGEVEWRFMEALLHELKGDL  237

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
               A R FNE+L+++PLLV A HGL   + +     E   + E + KA++L  +E++  + 
Sbjct  238   AEAERLFNEVLAEKPLLVRALHGLALCMHKRS---EGPTVFEMLEKALQLAISEERVPEE  294

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ KLL+AQ+  ++   + A +  Q L+ E+P DFRP+L Q I+Y +L K +EA + F  
Sbjct  295   RNIKLLIAQMHVVKGQLDVASEKLQNLINEDPRDFRPHLCQGIVYALLDKKEEADELFDT  354

Query  1076  YRELLPEGHPYSSFLDNTMIASKL  1147
             YR L+P+  P  SF+ + + A+++
Sbjct  355   YRSLVPDEFPDKSFISDVIQAARV  378



>ref|NP_001054818.1| Os05g0182100 [Oryza sativa Japonica Group]
 gb|AAW57819.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF16732.1| Os05g0182100 [Oryza sativa Japonica Group]
 dbj|BAG92308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97512.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score =   134 bits (337),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV+AL+  + +K++    G A+    RL E EP E EW L+   L  L G+ 
Sbjct  178   EILSRDPGDVDALKCALFAKMRRAEWGGALGFARRLREAEPGEVEWRLMEALLHELKGDL  237

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
               A R FNE+L+++PLLV A HGL   + +     E   + E + KA++L  + ++  + 
Sbjct  238   AEAERLFNEVLAEKPLLVRALHGLALCMHKRS---EGPTVFEMLEKALQLAISGERVPEE  294

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ KLL+AQ+  ++   + A +  Q L+ E+P DFRP+L Q I+Y +L K +EA + F  
Sbjct  295   RNIKLLIAQMHVVKGQLDVASEKLQNLINEDPRDFRPHLCQGIVYALLDKKEEADELFDT  354

Query  1076  YRELLPEGHPYSSFLDNTMIASKL  1147
             YR L+P+  P  SF+ + + A+++
Sbjct  355   YRSLVPDEFPDKSFISDVIQAARV  378



>ref|XP_010549130.1| PREDICTED: uncharacterized protein LOC104820397 [Tarenaya hassleriana]
Length=320

 Score =   132 bits (332),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 117/203 (58%), Gaps = 7/203 (3%)
 Frame = +2

Query  551   NPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARR  730
             N   VE L+SL++ K++N    +A+ ++ RL+  +P ETEW  L   +    G  E AR+
Sbjct  118   NGEAVEKLRSLLQQKLENGEDEEALKLLERLVAAQPEETEWKFLMARVLSEMGRLEDARK  177

Query  731   GFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDF  904
              F+EIL + PL  EA   + L+      D+  E + + +R+  A+ + + E K  + RD 
Sbjct  178   VFDEILDRNPLSFEALFENALLM-----DRCGEGESVMKRLEDALSMAEAEKKVKEARDV  232

Query  905   KLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRE  1084
             KL++AQ++ ++   EEALK Y+EL KE+P DFRPY  + ++Y++L K+ EAK+ F  YRE
Sbjct  233   KLIMAQMQFLQKKVEEALKSYEELTKEDPKDFRPYFCRGMIYSLLDKNAEAKEQFAKYRE  292

Query  1085  LLPEGHPYSSFLDNTMIASKLFA  1153
             L P+      +L   +    LF 
Sbjct  293   LSPKKFEVEGYLRTPLSRMNLFG  315



>gb|KFK28759.1| hypothetical protein AALP_AA7G043100 [Arabis alpina]
Length=313

 Score =   132 bits (331),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 124/213 (58%), Gaps = 7/213 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  V+ L+SL++ K++N    +A+ ++ +L+  +P ETEW  L   L    G
Sbjct  104   LYELLDSTPEAVQTLRSLLQQKLENGEDEEALKLLEQLVAAQPEETEWKFLMARLLGEMG  163

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL + PL  EA   + L+      D+  E   + +R+  A+ + ++E+ 
Sbjct  164   RSENARQVFEEILKRNPLSFEALFENALLM-----DRSGEGDAVLQRLEDALAIAESENM  218

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++RD +L++AQI+ ++ + +EALK Y+EL KE+P DFRPY  + ++Y++L K+ EAK+
Sbjct  219   VKEIRDVRLIIAQIQFLQKNVDEALKSYEELTKEDPKDFRPYFCRGMIYSLLDKNVEAKE  278

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
              F  YREL P+      +L   +   KLF   +
Sbjct  279   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGGGE  311



>ref|XP_006406607.1| hypothetical protein EUTSA_v10021135mg [Eutrema salsugineum]
 gb|ESQ48060.1| hypothetical protein EUTSA_v10021135mg [Eutrema salsugineum]
Length=324

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 123/213 (58%), Gaps = 7/213 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  V+ L+SL++ K++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  115   LSELLDSTPEAVQTLRSLLQQKLEKGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  174

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL + PL  EA   + L+      D+  E   + +R+  A+ + + E+ 
Sbjct  175   RPENARQMFEEILRRNPLCFEALFENALLM-----DRSGEGDAVMQRLEDALAVAQAENM  229

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++RD +L++AQI+ ++ + ++ALK Y+EL KE+P DFRPY  + ++Y++L K+ EAK+
Sbjct  230   VKEMRDVRLIIAQIQFLQKNVDDALKSYEELTKEDPKDFRPYFCRGMIYSLLDKNVEAKE  289

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
              F  YREL P+      +L   +   KLF + +
Sbjct  290   QFAKYRELSPKKFEVEGYLRTPLSRMKLFGSGE  322



>gb|KDP23019.1| hypothetical protein JCGZ_01682 [Jatropha curcas]
Length=336

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 122/202 (60%), Gaps = 7/202 (3%)
 Frame = +2

Query  557   NDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGF  736
             ++VE+L+SL++ K++N     A+ I+  L+ ++PS TEW  L   L    G+ + AR+ F
Sbjct  136   SNVESLKSLLQEKLENGEDEAALKILKSLISVQPSATEWKFLMARLLNEMGQTQDARKVF  195

Query  737   NEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKL  910
              EIL + PL  EA   + L+      D+  E + +  R+  A+ + + E+K  + RD KL
Sbjct  196   EEILRENPLSFEALFENALLM-----DRCGEGEAVLSRLQGALDIAEEENKVKEARDVKL  250

Query  911   LLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELL  1090
             ++AQI+ ++ + EEALK YQEL KE+P DFRPY  + ++Y++L +++EA++ F  YREL 
Sbjct  251   IMAQIQFLQKNVEEALKSYQELSKEDPKDFRPYFCRGMIYSLLDRNEEAREQFAKYRELS  310

Query  1091  PEGHPYSSFLDNTMIASKLFAA  1156
             P+      +L   +   K+F +
Sbjct  311   PKKFEVEGYLRTPLSRMKIFGS  332



>ref|XP_008809016.1| PREDICTED: uncharacterized protein LOC103720851 [Phoenix dactylifera]
Length=334

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 119/210 (57%), Gaps = 3/210 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   V AL++ +  K++     +A+ I+ RLM  +P ETEW  L   L    G
Sbjct  124   LSQYLESNSEAVGALRTTLYKKLEEGEDSEALEILKRLMAAQPVETEWKFLAARLLNEMG  183

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             E   +RR F EIL+ +PL  EA   L       D+  E   + ER+ +A+ L + E K+ 
Sbjct  184   EATESRRLFEEILAVDPLSFEA---LFENAVLMDRCGEGNAVIERLERALDLARAEQKEK  240

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
               RD +L++AQI+ ++ + +EAL  Y+EL +++P D+RPY  Q ++Y++L ++KEA++ F
Sbjct  241   AARDVRLIMAQIQFLQKNVDEALSTYEELARQDPKDYRPYFCQGVIYSLLDRNKEAREKF  300

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
               Y EL P+     ++L + +   KLF   
Sbjct  301   SKYHELSPKKFEVDAYLQSPLSRVKLFGTG  330



>ref|XP_008338635.1| PREDICTED: uncharacterized protein LOC103401697 isoform X1 [Malus 
domestica]
Length=368

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 117/200 (59%), Gaps = 3/200 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +V AL+ ++  K++     +A+S V RL+ELEP E EW L+    + + G+   
Sbjct  151   LVGDPKNVGALKVVLYGKLRRGKAEEAVSYVERLIELEPHELEWRLMLPLCYEIMGQLTC  210

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  + +IL   PLL+ A HGL   + ++    E   +   +  A+++ + E +  + R+
Sbjct  211   AKTLYQQILEDRPLLLRALHGLALVMHKN---HEGPAVFSMLNNALEIARHEKRVVEERN  267

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  I  + EE L  + +LV  +P DFRPYL Q I+Y++L + KEA + F+ YR
Sbjct  268   IRILIAQMHVIMGELEEGLNKFHDLVNADPRDFRPYLCQGIIYSLLDQKKEAAEQFETYR  327

Query  1082  ELLPEGHPYSSFLDNTMIAS  1141
              L+PE  P   FLD+ ++A+
Sbjct  328   ALVPEESPQRGFLDDVVLAA  347



>ref|XP_002439391.1| hypothetical protein SORBIDRAFT_09g005640 [Sorghum bicolor]
 gb|EES17821.1| hypothetical protein SORBIDRAFT_09g005640 [Sorghum bicolor]
Length=345

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 122/204 (60%), Gaps = 7/204 (3%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+ +P DV+AL+  + +K++  + G A+    RL + EPSE EW L+   L  L G+   
Sbjct  129   LSRSPGDVDALKGALYAKMRRADWGGALRYARRLRDAEPSEVEWRLMVAQLNELKGDLAE  188

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG--IEERILKAMKLCKTEDKKGQL  895
             A   F E+L++EPLLV+A HGL   + +     +L+G  + E +  A++L  +E +  + 
Sbjct  189   AECQFRELLAQEPLLVQALHGLALCMQK-----KLEGPTVFEMLENALQLATSEKRVPEE  243

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             R+ KLL+AQ+  +    + A +  Q L+ E+P DFR +L Q I+Y +L + ++A K F +
Sbjct  244   RNIKLLIAQMHVVMGQLDVASEKLQNLINEDPRDFRSHLCQGIVYALLDRKEDADKQFDI  303

Query  1076  YRELLPEGHPYSSFLDNTMIASKL  1147
             YR L+P+  P  SF+ + ++A+++
Sbjct  304   YRSLVPDEFPDKSFISDVILAARM  327



>ref|XP_010908520.1| PREDICTED: uncharacterized protein LOC105034899 [Elaeis guineensis]
Length=334

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/210 (34%), Positives = 121/210 (58%), Gaps = 3/210 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   V AL++ +  K++     +A+ I+ RLM  +P+ETEW  L   +    G
Sbjct  124   LTQFLESNSEAVGALRTTLYKKLEEGEDSEAMEILKRLMAAQPAETEWKFLAARILNEMG  183

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             E   +RR F +IL+ +PL  EA   L       D+  E   + ER+ +A++L + E K+ 
Sbjct  184   EAAESRRLFEDILAVDPLSFEA---LFENAVLMDRCGEGNSVIERLERALELARDEQKEK  240

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
               RD +L++AQI+ ++ + +EAL  Y+EL +E+P D+RPY  Q ++Y++L ++KEA++ F
Sbjct  241   AARDVRLIMAQIQFLQKNVDEALSTYEELAREDPKDYRPYFCQGVIYSLLDRNKEAREKF  300

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
               Y EL P+     ++L + +   KLF   
Sbjct  301   SKYHELSPKKFEVDAYLQSPLSRVKLFGTG  330



>emb|CDX92236.1| BnaA05g21710D [Brassica napus]
Length=319

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 124/213 (58%), Gaps = 7/213 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  V+ L+SL++ K++N    +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  110   LTELLESTPEAVKTLRSLLQQKLENGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  169

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL + PL  EA   + L+      D+  E   + +R+  A+ + + E+ 
Sbjct  170   RTENARQVFEEILQRNPLSFEALFENALLM-----DRSGEGDAVLQRLEDALAVAEAENM  224

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++RD +L++AQI+ ++ + +EAL+ Y++L +E+P DFRPY  + ++Y++L K+ EAK+
Sbjct  225   VKEIRDVRLIIAQIQFLQKNVDEALRSYEQLTREDPKDFRPYFCRGMIYSLLDKNVEAKE  284

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
              F  YREL P+      +L   +   KLF + +
Sbjct  285   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGSGE  317



>emb|CDY54811.1| BnaA08g29970D [Brassica napus]
 emb|CDX92326.1| BnaA05g20810D [Brassica napus]
Length=319

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/213 (34%), Positives = 124/213 (58%), Gaps = 7/213 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  V+ L+SL++ K++N    +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  110   LTELLESTPEAVKTLRSLLQQKLENGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  169

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL + PL  EA   + L+      D+  E   + +R+  A+ + + E+ 
Sbjct  170   RTENARQVFEEILQRNPLSFEALFENALLM-----DRSGEGDAVLQRLEDALAVAEAENM  224

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++RD +L++AQI+ ++ + +EAL+ Y++L +E+P DFRPY  + ++Y++L K+ EAK+
Sbjct  225   VKEIRDVRLIIAQIQFLQKNVDEALRSYEQLTREDPKDFRPYFCRGMIYSLLDKNVEAKE  284

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
              F  YREL P+      +L   +   KLF + +
Sbjct  285   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGSGE  317



>ref|XP_011025227.1| PREDICTED: uncharacterized protein LOC105126151 [Populus euphratica]
Length=334

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 122/211 (58%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             LQ  L +N   +E+L+SL++ K++N    +A+ I+  L+  +P  TEW  L   L    G
Sbjct  125   LQAFLESNAEAIESLKSLLQQKLENGQDEEALKIIKLLVSAQPEVTEWKFLMARLLNEMG  184

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               + AR  F EIL   PL  EA   + L+      D+  E + +  R+ +A+ + + E+K
Sbjct  185   RAQDARNVFEEILVANPLSFEALFENALLM-----DRCGEGEAVIRRLQEALDIAEEENK  239

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI+  + + EEALK YQEL KE+P DFRPY  + ++Y++L +++EAK+
Sbjct  240   VKEARDVRLIVAQIQFRQKNVEEALKSYQELSKEDPKDFRPYFCRGMIYSLLDRNEEAKE  299

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F  YREL P+      +L  ++   KLF +
Sbjct  300   QFAKYRELSPKKFEVEGYLRTSLSRMKLFGS  330



>ref|XP_008361510.1| PREDICTED: uncharacterized protein LOC103425207 [Malus domestica]
Length=397

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 117/200 (59%), Gaps = 3/200 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +V AL+ ++  K++     +A+S V RL+ELEP E EW L+    + + G+   
Sbjct  180   LVGDPKNVGALKVVLYGKLRRGKAEEAVSYVERLIELEPHELEWRLMLPLCYEIMGQLTC  239

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  + +IL   PLL+ A HGL   + ++    E   +   +  A+++ + E +  + R+
Sbjct  240   AKTLYQQILEDRPLLLRALHGLALVMHKN---HEGPAVFSMLNNALEIARHEKRVVEERN  296

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              ++L+AQ+  I  + EE L  + +LV  +P DFRPYL Q I+Y++L + KEA + F+ YR
Sbjct  297   IRILIAQMHVIMGELEEGLNKFHDLVNADPRDFRPYLCQGIIYSLLDQKKEAAEQFETYR  356

Query  1082  ELLPEGHPYSSFLDNTMIAS  1141
              L+PE  P   FLD+ ++A+
Sbjct  357   ALVPEESPQRGFLDDVVLAA  376



>ref|XP_009336370.1| PREDICTED: uncharacterized protein LOC103928963 isoform X1 [Pyrus 
x bretschneideri]
Length=361

 Score =   131 bits (329),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 122/207 (59%), Gaps = 3/207 (1%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+   + L  +P +V AL+ ++  K++     +A+S V RL+ELEP E EW L+    + 
Sbjct  137   EQMYHKILVDDPKNVGALKVVLYGKLRRGKAEEAVSYVERLIELEPHELEWRLMLPLCYE  196

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G+   A+  + +IL   PLL+ A HGL   + ++    E   +   + KA+++ + E 
Sbjct  197   IMGQLTCAKTLYQQILEDRPLLLRALHGLALVMHKN---HEGPAVFSMLNKALEIARREK  253

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             +  + R+ ++L+AQ+  I  + EE L  +Q+LV  +P DFRPYL + I+Y++L + KEA 
Sbjct  254   RVVEERNIRILIAQMHVIMGELEEGLNKFQDLVNADPRDFRPYLCRGIIYSLLDQKKEAA  313

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIAS  1141
             + F+ YR L+PE  P   FL++ ++A+
Sbjct  314   EQFETYRALVPEEFPQRGFLNDVVLAA  340



>ref|XP_009400311.1| PREDICTED: uncharacterized protein LOC103984524 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 122/204 (60%), Gaps = 3/204 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L ++ + V+AL+SL+  K++  +  + ++I+ RL+  +P+ETEW  L   L    GE   
Sbjct  114   LDSSSDGVDALRSLLYQKLEAGDDTEGLAILQRLIAAQPAETEWKFLAARLLNEMGEASE  173

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             +RR + EIL+ +PL  EA   L       D+  E   + +R+ +A++L K E K+   RD
Sbjct  174   SRRLYEEILAVDPLSFEA---LFDNAVLMDRCGEGDAVIQRLEQALELAKAEQKEKAARD  230

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              +L++AQI+ ++ + +EAL  Y+ L +E+P D+RPY  Q ++Y++LGK+K+A++ F  Y 
Sbjct  231   VRLIMAQIQFLQKNVDEALSSYEGLAQEDPKDYRPYFCQGVIYSLLGKNKQAREKFSKYH  290

Query  1082  ELLPEGHPYSSFLDNTMIASKLFA  1153
             EL P     +++L   +    LF+
Sbjct  291   ELSPRKFEVNAYLQTPLSRMNLFS  314



>ref|XP_004960865.1| PREDICTED: uncharacterized protein LOC101775089 [Setaria italica]
Length=391

 Score =   131 bits (329),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 118/202 (58%), Gaps = 3/202 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+ +P DV+ L+  + +K++  + G A+    RL + EP E EW L+   L  L G+   
Sbjct  175   LSRDPGDVDTLKCALYAKMRRADWGGALRYTRRLRDAEPGEVEWRLMEAQLHELKGDLAE  234

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A R F  +L++EPLL+ A HGL  A+    + E   G E  +  A++L  ++ +  + R+
Sbjct  235   AERQFRGVLAEEPLLIRALHGL--AICMQKKHEGPAGFE-MLDNALQLAASDKRVPEERN  291

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              KLL+AQ+  +      A +  Q L+ E+P DFRP+L Q I+Y +L + ++A K F +YR
Sbjct  292   IKLLIAQMHVVMGQLGIASEKLQNLINEDPRDFRPHLCQGIVYALLDRKEDADKQFDIYR  351

Query  1082  ELLPEGHPYSSFLDNTMIASKL  1147
              L+P+  P  SF+++ ++A+++
Sbjct  352   SLVPDEFPDKSFINDVILAARM  373



>ref|XP_010506898.1| PREDICTED: uncharacterized protein LOC104783436 [Camelina sativa]
Length=320

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 118/210 (56%), Gaps = 3/210 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VEAL+SL++ K++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  111   LSELLDSTPEAVEALRSLLQQKLEKGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  170

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
               E AR+ F EIL ++PL   ++  L       D+  E   + +R+  A+ + + E    
Sbjct  171   RVENARQVFEEILQRKPL---SFEALFENALLMDRSGEGNAVLQRLEDALAVAEAEYLVK  227

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD +L++AQI  ++ + +EALK Y++L KE+P DFRPY  + ++Y++L K+ EAK+ F
Sbjct  228   EARDVRLIIAQIHFLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKEQF  287

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
               YREL P+      +L   +   KLF   
Sbjct  288   AKYRELSPKKFEVEGYLRTPLSKMKLFGGG  317



>ref|XP_010043882.1| PREDICTED: uncharacterized protein LOC104432976 [Eucalyptus grandis]
 gb|KCW85900.1| hypothetical protein EUGRSUZ_B02617 [Eucalyptus grandis]
Length=343

 Score =   129 bits (325),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 124/210 (59%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L ++P  V+A++ L++ K++N    +A+  + RL+  +P   EW  L   L+   G
Sbjct  134   LTELLGSDPESVDAMRKLLQQKLENGEDQEALKTLRRLVAAQPEVAEWKFLLARLYGEMG  193

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + E AR  F EIL+  PL  EA   + L+      D+  E + + +R+ +A+++ + E+K
Sbjct  194   DTENARNVFEEILAANPLSFEALFENALLM-----DRCGEGEAVIKRLEEALRIAEEENK  248

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
             + + RD +L++AQI+ ++ + E ALK YQ+L KE+P DFRPY  Q ++Y++L K+ EAK+
Sbjct  249   EKEARDVRLIMAQIQFLQKNVEGALKSYQDLAKEDPNDFRPYFCQGMIYSLLDKNAEAKE  308

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L   +   KLF 
Sbjct  309   QFAKYRELSPKKFEVEGYLRTPLSRMKLFG  338



>ref|XP_009145892.1| PREDICTED: uncharacterized protein LOC103869563 [Brassica rapa]
Length=362

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 124/213 (58%), Gaps = 7/213 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  V+ L+SL++ K++N    +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  153   LTELLESTPEAVKTLRSLLQQKLENGEDEEALKLLERLVTAQPEETEWKFLMARLLGEMG  212

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               + AR+ F EIL + PL  EA   + L+      D+  E   + +R+  A+ + + E+ 
Sbjct  213   RTQNARQVFEEILQRNPLSFEALFENALLM-----DRSGEGDAVLQRLEDALAVAEAENM  267

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++RD +L++AQI+ ++ + +EAL+ Y++L +E+P DFRPY  + ++Y++L K+ EAK+
Sbjct  268   VKEIRDVRLIIAQIQFLQKNVDEALRSYEQLTREDPKDFRPYFCRGMIYSLLDKNVEAKE  327

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
              F  YREL P+      +L   +   KLF + +
Sbjct  328   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGSGE  360



>ref|XP_002518801.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43726.1| conserved hypothetical protein [Ricinus communis]
Length=331

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 122/211 (58%), Gaps = 7/211 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L +N   +E+L+SL++ K++N    +A+  +N L+E +P  TEW  L   L    G
Sbjct  122   LSEFLESNAEAIESLKSLLQQKLENGEDEEALKTLNHLVEAQPLVTEWKFLMARLLNEMG  181

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               + AR  F EIL   PL  EA   + L+      D+  E   +  R+ +A+ + + E+K
Sbjct  182   RTQDARNLFEEILQMNPLSFEALFENALLM-----DRCGEGDAVIRRLQEALDIAEEENK  236

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI+ ++ + EEALK YQEL KE+P+DFRPY  Q ++Y++L +++EA++
Sbjct  237   VKEARDVKLIMAQIQFLQKNVEEALKSYQELSKEDPSDFRPYFCQGMIYSLLDRNEEARE  296

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
              F  YR+L  +      +L   +   K+F +
Sbjct  297   QFAKYRQLSRKKFEVEGYLRTPLSRMKVFGS  327



>gb|ACG36692.1| hypothetical protein [Zea mays]
Length=369

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 115/201 (57%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+ N  DV+AL+  + +K++  + G A+    RL + EPSE EW L+   L  L G+   
Sbjct  153   LSRNSGDVDALKCALYAKMRRADWGGALRYARRLRDAEPSELEWRLMVAQLHELKGDLAE  212

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A R F E+L++EPL V A HGL   + +     E   + E +  A++L  +E +  + R+
Sbjct  213   AERHFRELLAEEPLFVRALHGLALCMQKK---PEGPAVFEMLENALQLATSERRVPEERN  269

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              KLL+AQ+  +    + A +  Q L+ E+P DFR +L Q I+Y +L + ++A   F +YR
Sbjct  270   IKLLIAQMHVVMGQLDVASEKLQNLINEDPRDFRSHLCQGIVYALLDRKEDADMQFDIYR  329

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P  SF+ + ++A++
Sbjct  330   SLVPDEFPDKSFISDVILAAR  350



>ref|XP_010465942.1| PREDICTED: uncharacterized protein LOC104746214 [Camelina sativa]
Length=320

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 120/212 (57%), Gaps = 7/212 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VE L+SL++ K++     +A+ ++ +L+  +P ETEW  L   L    G
Sbjct  111   LSELLDSTPEAVEKLRSLLQQKLEKGEDEEALKLLEKLVTAQPDETEWKFLMARLLGEMG  170

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL ++PL +EA   + L+      D+  E   + +R+  A+ + + E  
Sbjct  171   RVENARQVFEEILQRKPLSLEALFENALLM-----DRSGEGNAVLQRLEDALSVAEAEYL  225

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI  ++ + +EALK Y++L KE+P DFRPY  + ++Y++L K+ EAK+
Sbjct  226   VKEARDVRLIIAQIHFLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKE  285

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
              F  YREL P+      +L   +   KLF   
Sbjct  286   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGGG  317



>ref|XP_010487768.1| PREDICTED: uncharacterized protein LOC104765704 [Camelina sativa]
Length=320

 Score =   127 bits (318),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 119/212 (56%), Gaps = 7/212 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VE L+SL++ +++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  111   LSELLDSTPEAVETLRSLLQQQLEKGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  170

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL ++PL  EA   + L+      D+  E   + +R+  A+ + + E  
Sbjct  171   RVENARQVFEEILQRKPLSFEALFENALLM-----DRSGEGNAVLQRLEDALSVAEAEYL  225

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI  ++ + +EALK Y++L KE+P DFRPY  + ++Y++L K+ EAK+
Sbjct  226   VKEARDVRLIIAQIHFLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKE  285

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
              F  YREL P+      +L   +   KLF   
Sbjct  286   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGGG  317



>ref|NP_566609.1| protein prenylyltransferase superfamily protein [Arabidopsis 
thaliana]
 sp|Q9LS48.1|SG1_ARATH RecName: Full=protein SLOW GREEN 1, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB01108.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59859.1| AT3g18420/MYF24_13 [Arabidopsis thaliana]
 gb|AAL76143.1| AT3g18420/MYF24_13 [Arabidopsis thaliana]
 gb|AAM64381.1| unknown [Arabidopsis thaliana]
 gb|AEE76095.1| protein prenylyltransferase superfamily protein [Arabidopsis 
thaliana]
Length=316

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 118/211 (56%), Gaps = 3/211 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VE L+SL++ K++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  107   LSELLDSTPEAVETLRSLLQQKLEKGEDEEALKLLERLVAAQPEETEWKFLMARLLGEMG  166

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
               E AR+ F EIL + PL   ++  L       D+  E   + +R+  A+ + + E    
Sbjct  167   RPENARQMFEEILQRNPL---SFEALFENALLMDRSGEGNAVLQRLEDALAVAEAEYLVK  223

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD +L++AQI  ++ + +EALK Y++L KE+P DFRPY  + ++Y++L K+ EAK+ F
Sbjct  224   EARDVRLIIAQIHFLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKEQF  283

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAAAK  1162
               YREL P+      +L   +   KLF  ++
Sbjct  284   AKYRELSPKKFEVEGYLRTPLSKMKLFGGSE  314



>ref|XP_006299864.1| hypothetical protein CARUB_v10016068mg [Capsella rubella]
 gb|EOA32762.1| hypothetical protein CARUB_v10016068mg [Capsella rubella]
Length=323

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 119/212 (56%), Gaps = 7/212 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VE L+SL++ K++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  114   LSELLDSTPEAVETLRSLLQQKLEKGEDEEALKLLERLVTAQPEETEWKFLMARLLGEMG  173

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
               E AR+ F EIL ++PL  EA   + L+      D+  E   + +R+  A+ + + E  
Sbjct  174   RVENARQMFEEILRQKPLSFEALFENALLM-----DRSGEGNAVLQRLEDALAVAEAEYL  228

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI  ++ + +EALK Y++L +E+P DFRPY  + ++Y++L K+ EAK+
Sbjct  229   VKEARDVRLIIAQIHFLQKNVDEALKSYEQLTREDPKDFRPYFCRGMIYSLLDKNVEAKE  288

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFAAA  1159
              F  YREL P+      +L   +   KLF   
Sbjct  289   QFAKYRELSPKKFEVEGYLRTPLSKMKLFGGG  320



>ref|NP_001131681.1| uncharacterized protein LOC100193041 [Zea mays]
 gb|ACF80200.1| unknown [Zea mays]
 gb|AFW77298.1| hypothetical protein ZEAMMB73_253433 [Zea mays]
Length=371

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 115/201 (57%), Gaps = 3/201 (1%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+ N  DV+AL+  + +K++  + G A+     L + EPSE EW L+   L  L G+   
Sbjct  155   LSRNSGDVDALKCALYAKMRRADWGGALRFARLLRDAEPSELEWRLMVAQLHELKGDLAE  214

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A R F E+L++EPLLV A HGL   + +     E   + E +  A++L  +E +  + R+
Sbjct  215   AERHFRELLAEEPLLVRALHGLALCMQKK---PEGPAVFEMLENALQLATSERRVPEERN  271

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              KLL+AQ+  +    + A +  Q L+ E+P DFR +L Q I+Y +L + ++A   F +YR
Sbjct  272   IKLLIAQMHVVMGQLDVASEKLQNLINEDPRDFRSHLCQGIVYALLDRKEDADMQFDVYR  331

Query  1082  ELLPEGHPYSSFLDNTMIASK  1144
              L+P+  P  SF+ + ++A++
Sbjct  332   SLVPDEFPDKSFISDVILAAR  352



>emb|CDP07952.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 119/209 (57%), Gaps = 3/209 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L +N   VEAL+SL++ K++     + + I+ +L   +P  TEW  L   L    G
Sbjct  131   LTQFLESNSEAVEALKSLLQQKLEVGEDEEGLKILRKLSSAQPENTEWKFLMARLLNEMG  190

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + + +R  F EIL + PLL EA   L       D+  E   +  R+ +A+K+ + E K  
Sbjct  191   KTQESREVFEEILVRNPLLFEA---LFENALLMDRCGEGAAVLRRLEEALKIAEEEKKVK  247

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD + ++AQ++ ++ + EEAL+ Y+EL KE+PTDFRPY  + ++Y++L ++KEA++ F
Sbjct  248   EARDVRFIMAQVQFLQKNVEEALQSYEELEKEDPTDFRPYFCKGMIYSLLDRNKEAREQF  307

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
               YREL P+      +L   +   KLF  
Sbjct  308   AKYRELSPKKFEVEGYLRTPLSRMKLFGT  336



>ref|XP_002885256.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61515.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=320

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (56%), Gaps = 3/209 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L E L + P  VE L+SL++ K++     +A+ ++ RL+  +P ETEW  L   L    G
Sbjct  111   LSELLDSTPEAVETLRSLLQQKLEKGEDEEALKLLERLVTAQPDETEWKFLMARLLGEMG  170

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
               E AR+ F EIL + PL   ++  L       D+  E   + +R+  A+ + + E    
Sbjct  171   RPENARQMFEEILQRNPL---SFEALFENALLMDRSGEGAAVLQRLEDALAVAEAEYLVK  227

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD +L++AQI  ++ + +EALK Y++L KE+P DFRPY  + ++Y++L K+ EAK+ F
Sbjct  228   EARDVRLIIAQIHFLQKNVDEALKSYEQLTKEDPKDFRPYFCRGMIYSLLDKNVEAKEQF  287

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
               YREL P+      +L   +   KLF  
Sbjct  288   AKYRELSPKKFEVEGYLRTPLSKMKLFGG  316



>ref|XP_003631345.1| PREDICTED: uncharacterized protein LOC100852583 [Vitis vinifera]
Length=312

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 114/201 (57%), Gaps = 3/201 (1%)
 Frame = +2

Query  551   NPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARR  730
             N   + AL+S+++ K+++   G+A+ ++ RL+  +P   EW  L   L    GE + AR 
Sbjct  110   NSEALGALKSVLQQKLEDGEDGEALKVLERLVSAQPEVVEWKFLMARLLGEMGETDRARD  169

Query  731   GFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKL  910
              F EIL+  PL  EA  G    +   DQ  E   +  R+  A++  + E+K  + RD +L
Sbjct  170   VFEEILASNPLSFEALFGNALLM---DQCGEGDAVIRRLEDALRTAENENKLKEARDVRL  226

Query  911   LLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELL  1090
             ++AQ++ +  + +EAL+ Y+EL KE+P+DFRPY  + ++YT+  +++EA++ F  YRE  
Sbjct  227   IMAQMQFLRKNVDEALRSYEELEKEDPSDFRPYFCKGMIYTLQDRNEEAREQFAKYRERS  286

Query  1091  PEGHPYSSFLDNTMIASKLFA  1153
             P+      FL   +   KLF 
Sbjct  287   PKKFEVEGFLQTPLSRMKLFG  307



>gb|EEE62561.1| hypothetical protein OsJ_17360 [Oryza sativa Japonica Group]
Length=407

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 122/219 (56%), Gaps = 18/219 (8%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L+ +P DV+AL+  + +K++    G A+    RL E EP E EW L+   L  L G+ 
Sbjct  174   EILSRDPGDVDALKCALFAKMRRAEWGGALGFARRLREAEPGEVEWRLMEALLHELKGDL  233

Query  716   ETARRGFNEILSKEPLLVEAYH--GLITAVSEDDQVEELKGIE-------------ERIL  850
               A R FNE+L+++PLLV A H   L+ A S    VE   G+              E + 
Sbjct  234   AEAERLFNEVLAEKPLLVRALHIAELVLAFS---NVEGFVGLALCMHKRSEGPTVFEMLE  290

Query  851   KAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMY  1030
             KA++L  + ++  + R+ KLL+AQ+  ++   + A +  Q L+ E+P DFRP+L Q I+Y
Sbjct  291   KALQLAISGERVPEERNIKLLIAQMHVVKGQLDVASEKLQNLINEDPRDFRPHLCQGIVY  350

Query  1031  TMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASKL  1147
              +L K +EA + F  YR L+P+  P  SF+ + + A+++
Sbjct  351   ALLDKKEEADELFDTYRSLVPDEFPDKSFISDVIQAARV  389



>gb|KFK38333.1| hypothetical protein AALP_AA3G100600 [Arabis alpina]
Length=341

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 117/191 (61%), Gaps = 5/191 (3%)
 Frame = +2

Query  533   QERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGE  712
             +++L A    VEAL S  + K +++  G+AI I+N+L+E++P+E +WP ++  +     E
Sbjct  96    KKQLEAESKVVEALLSQTKIKFESRKFGEAIKILNQLIEIQPNEQKWPAMKARIHAYNYE  155

Query  713   FETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQ  892
              ++A + F EIL K+P  ++AYH L+      +   +L  IE+RI +A++ CK   K  +
Sbjct  156   VKSAIKAFEEILVKDPDRIDAYHYLVMEYY--NSKPKLTDIEKRINEAIERCK---KTKE  210

Query  893   LRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQ  1072
             +R F++L+A IR +E +  EA+ +  EL+K++P DF  Y++Q  +Y ++ K  EA K  +
Sbjct  211   IRRFRMLIALIRVMEGNLVEAIGISDELLKDDPEDFVIYMFQGWVYALMSKKDEAAKQMK  270

Query  1073  MYRELLPEGHP  1105
                 LLPE HP
Sbjct  271   QGYCLLPENHP  281



>ref|XP_009623000.1| PREDICTED: uncharacterized protein LOC104114300 [Nicotiana tomentosiformis]
Length=317

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 120/208 (58%), Gaps = 3/208 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L  +P  +E L++L++ K++     +++ I+ +L   +P  TEW  L   L    G
Sbjct  107   LTQFLEFSPEAIETLKNLLQEKLEAGEDEESLKILKKLSSAQPENTEWKFLTARLLNEMG  166

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + + AR  F EILSK PL  EA      A+  D   E +K I+ R+ +A+K+ + E+K  
Sbjct  167   KVQEAREVFEEILSKNPLSFEALFE--NALLMDRSGEGVKVIQ-RLEEALKIAEDENKVK  223

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD + ++AQ++ ++ + EEAL+ Y EL KE+P DFRPY  + ++Y++L ++KEA+  F
Sbjct  224   EGRDVRFIMAQVQFLQKNVEEALRSYDELEKEDPKDFRPYFCKGMIYSLLDRNKEARDQF  283

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFA  1153
               YREL P+      +L   +   KLF 
Sbjct  284   AKYRELSPKKFEVEGYLQTPLSRMKLFG  311



>ref|XP_009791853.1| PREDICTED: uncharacterized protein LOC104239016 [Nicotiana sylvestris]
Length=317

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 122/208 (59%), Gaps = 3/208 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L ++P  ++ L++L++ K++     +++ I+ +L   +P  TEW  L   L    G
Sbjct  107   LTQFLESSPEAIDTLKNLLQEKLEAGEDEESLKILKKLSSAQPENTEWKFLTARLLNEMG  166

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + + AR  F EILSK PL  EA      A+  D   E +K I+ R+ +A+K+ + E+K  
Sbjct  167   KVQEAREVFEEILSKNPLSFEALFE--NALLMDRSGEGVKVIQ-RLEEALKIAEEENKVK  223

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD + ++AQ++ ++ + E+AL+ Y EL KE+P DFRPY  + ++Y++L ++KEA++ F
Sbjct  224   EGRDVRFIMAQVQFLQKNVEDALRSYDELEKEDPKDFRPYFCKGMIYSLLDRNKEAREQF  283

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFA  1153
               YREL P+      +L   +   KLF 
Sbjct  284   AKYRELSPKKFEVEGYLQTPLSRMKLFG  311



>ref|XP_006580644.1| PREDICTED: stress-induced-phosphoprotein 1-like [Glycine max]
Length=170

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 93/146 (64%), Gaps = 4/146 (3%)
 Frame = +2

Query  689   HLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLC  868
             ++ +        R+ F EIL K+ L  E +HGL+ A    +++  LKG+ +R+ +A K+C
Sbjct  27    NMHIYNNNHTNMRKLFEEILKKDLLREEVFHGLVMATLRSNEL--LKGLLKRVEEANKVC  84

Query  869   KTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKD  1048
             K + +   +RDF+LL+AQ++ ++ D+ +ALK YQELVK+EP DFRPYL Q I+YT+L K 
Sbjct  85    KKQKRDSDVRDFRLLIAQVKVMKGDFSKALKAYQELVKDEPRDFRPYLCQGIIYTILRKK  144

Query  1049  KEAKKHFQMYRELLPEG--HPYSSFL  1120
              EA K F  +  L+P+   HPY  + 
Sbjct  145   DEADKQFNKFCRLVPKDRYHPYKEYF  170



>ref|XP_003524830.1| PREDICTED: uncharacterized protein LOC100808986 [Glycine max]
Length=288

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 119/210 (57%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L  N   + AL+SL++ K++     +A SI+ RL+  +P   +W  L   L   TG
Sbjct  80    LSDLLETNTEALAALKSLLQQKLELGEDDEAFSILKRLIAAQPDAADWKFLAARLAAETG  139

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + E AR  + E+L+  PL  EA   + L+      D+  E +    R+ +A+++ + + K
Sbjct  140   DVEAARGYYQEVLAANPLSFEALFENALLM-----DRCGEGEAAMRRLEEALRVAEEDKK  194

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI  ++ + +EAL +Y +L KE+P DFRPY  + ++Y++L +++EAK+
Sbjct  195   AKEARDVKLIMAQITFLQKNVDEALGIYNQLTKEDPRDFRPYFCRGMIYSLLDRNEEAKE  254

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L   +   KLF+
Sbjct  255   QFAKYRELSPKKFEVDGYLRTPLSRMKLFS  284



>ref|XP_001756346.1| predicted protein [Physcomitrella patens]
 gb|EDQ78742.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 116/207 (56%), Gaps = 9/207 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P D++AL+ L+  +++  ++  A+ IV+ L+ L P    W L+R       G+ + 
Sbjct  16    LKRHPEDIKALEGLMYIRLRKGSVAKALEIVDDLLALRPDHAPWQLVRAQALEFLGDLKA  75

Query  722   ARRGFNEILSKEPLLVEAYH------GLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             AR  F ++L K+PL   A        GL T +S+  + EE+    E + +A++      K
Sbjct  76    ARHAFEKVLEKDPLSARALQARNNCLGLATVMSKAGEGEEML---EMLRRAVQTATQTGK  132

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + ++ +++L Q+  ++ +++EAL++Y+EL KE+P DFRPYL Q ++Y++L    +A  
Sbjct  133   TRECKNLRMVLGQMYTVQGNFQEALELYKELEKEDPKDFRPYLCQGVIYSLLEDKVKADT  192

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASK  1144
              F  YR   P+  P   +LD+ MI +K
Sbjct  193   AFLKYRRRCPKTFPERGYLDDLMIGAK  219



>ref|XP_010473601.1| PREDICTED: uncharacterized protein LOC104752999 isoform X1 [Camelina 
sativa]
Length=340

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 117/201 (58%), Gaps = 9/201 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  + ND EAL SL + K ++    +AI I+NRL+E+EP E +WP ++  +     + + 
Sbjct  110   LETHSNDAEALISLAKIKFESDKCDEAIEIMNRLIEIEPQEQKWPGMKARILSFFCKKKL  169

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG----  889
             A   F EIL  +P+ V+A H L+      D   +L   E+RI  A++ CK   KK     
Sbjct  170   AIEAFEEILLTDPIRVDALHYLVMEYY--DSKPKLLEAEKRIKYAIRRCKDMKKKKKKTK  227

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             ++R  ++L+AQIR +E +  +A+++ +ELV E+P D + YL+Q ++YT+L K  EAKK F
Sbjct  228   EIRGLRMLIAQIRVLEGNTVDAIRICEELVNEDPEDHKVYLFQGLVYTLLKKGDEAKKQF  287

Query  1070  QMYRELLPEGHPYSSFLDNTM  1132
             +    +LPE H Y   LD  M
Sbjct  288   EQVARILPENHWY---LDTPM  305



>ref|XP_010672029.1| PREDICTED: uncharacterized protein LOC104888692 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 118/210 (56%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L   L +N   V++L  L++ K++     +A+ ++ +L+E +P E EW  LR  L    G
Sbjct  130   LSHLLESNSEFVDSLWKLLQQKLELGEDEEALKVLEKLVEAQPFEMEWKFLRARLLSEMG  189

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + + +R  F +IL+  PL  EA   + L+      D+  E  G+  R+  A+ +   E K
Sbjct  190   KIQESREAFEDILALNPLSFEALFENALLM-----DRCGEKDGVIVRLEGALSIAMEESK  244

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD +L++AQI+ ++ + EEA+  Y+EL+KE+P DFRPY  + ++Y++L ++ EA++
Sbjct  245   AKEARDVRLIIAQIQFLQKNVEEAMNSYEELIKEDPKDFRPYFCKGMIYSLLDRNAEARE  304

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L   +   KLF 
Sbjct  305   QFAKYRELSPKKFEVDGYLRTPLSRMKLFG  334



>ref|XP_011090677.1| PREDICTED: uncharacterized protein LOC105171306 [Sesamum indicum]
Length=327

 Score =   121 bits (304),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 118/199 (59%), Gaps = 7/199 (4%)
 Frame = +2

Query  563   VEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNE  742
             V+AL++L++ K++     +++SI+ +L  ++P   EW      L    G+ + AR  F +
Sbjct  132   VDALKNLLQEKLEAGEDEESLSILRKLSSVQPDNLEWKFFIARLLNEMGKIQEARDAFED  191

Query  743   ILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLL  916
              L+K PL  EA   + L+      D+  E + +  R+ +A+++ ++E+K  + RD KL++
Sbjct  192   FLAKNPLSFEALFENALLM-----DRSGEREAVMRRLEEALRVAESEEKVKEARDVKLIM  246

Query  917   AQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPE  1096
             AQ++ +  + +EAL+ Y ELVKE+P+DFRPY  + ++Y+++ K+ EA++ F  YREL P+
Sbjct  247   AQMQFLHKNVDEALRSYDELVKEDPSDFRPYFCKGMIYSLMDKNVEAREQFAKYRELSPK  306

Query  1097  GHPYSSFLDNTMIASKLFA  1153
                   +L   +   KLF 
Sbjct  307   KFEVEGYLRTPLSRMKLFG  325



>ref|XP_006847993.1| hypothetical protein AMTR_s00029p00161320 [Amborella trichopoda]
 gb|ERN09574.1| hypothetical protein AMTR_s00029p00161320 [Amborella trichopoda]
Length=300

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 118/207 (57%), Gaps = 10/207 (5%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  NP+ V+AL+SL+   ++  N  +A+ I+ RL+E +PSE +W  L   L    GE   
Sbjct  98    LENNPSAVDALKSLLFKNLEAGNDTEAMKILRRLVESQPSELQWKFLMARLLSEMGEPNE  157

Query  722   ARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             AR  F EILS  PL  EA   + L+      D+  E   +  R+ +A+++  +E    + 
Sbjct  158   ARSVFEEILSVNPLSFEALFENALLM-----DRSGEGPAVLARLEEALQVASSEK---EA  209

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             RD KL++AQI  ++ + + AL+ Y++L KE+P D+RPY  + ++Y++L K+KEA++ F  
Sbjct  210   RDVKLIMAQIMYLQKNIDGALENYEQLAKEDPKDYRPYFCKGVIYSLLDKNKEAREEFAK  269

Query  1076  YRELLPEGHPYSSFLDNTMIASKLFAA  1156
             Y EL P+      FL   +   KLF +
Sbjct  270   YHELAPKKFEVEGFLQTPLSRIKLFGS  296



>ref|XP_011021679.1| PREDICTED: uncharacterized protein LOC105123685 [Populus euphratica]
Length=336

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 119/212 (56%), Gaps = 9/212 (4%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L+  L +N   +E+++SL++ K++     +A+ I+ +L+  +P  TEW  L   L     
Sbjct  127   LEAFLESNAEAIESIKSLLQQKLEKGQDEEALHILKQLVSAQPEVTEWKFLMARLLNEMC  186

Query  710   EFETARRGFNEILSKEPLLVEAYHG---LITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               + AR  F EIL   PL  EA      L+    E D       +  R+ +A+ + + E+
Sbjct  187   RVQDARNVFEEILVSNPLSFEALFENALLMERSGEGD------AVIRRLREALDIAEEEN  240

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K  + RD +L++AQI+ ++ + EEAL+ YQEL KE+P DFRPY  + ++Y++L +++EAK
Sbjct  241   KVKEARDVRLIMAQIQFLQKNVEEALESYQELSKEDPKDFRPYFCRGMIYSLLDRNEEAK  300

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
             + F  YREL P+      +L  ++   KLF +
Sbjct  301   EQFAKYRELSPKKFEVEGYLRTSLSRMKLFGS  332



>emb|CAN72842.1| hypothetical protein VITISV_000983 [Vitis vinifera]
Length=475

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 113/201 (56%), Gaps = 3/201 (1%)
 Frame = +2

Query  551   NPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARR  730
             N   +  L+S+++ K+++   G+A+ ++ R++  +P   EW  L   L    GE + AR 
Sbjct  273   NSEALGXLKSVLQQKLEDGEDGEALKVLERIVSAQPEVVEWKFLMARLLGEMGETDRARD  332

Query  731   GFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKL  910
              F EIL+  PL  EA  G    +   DQ  E   +  R+  A++  + E+K  + RD +L
Sbjct  333   VFEEILASNPLSFEALFGNALLM---DQCGEGDAVIRRLEDALRTAENENKLKEARDVRL  389

Query  911   LLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELL  1090
             ++AQ++ +  + +EAL+ Y+EL KE+P+DFRPY  + ++YT+  +++EA++ F  YRE  
Sbjct  390   IMAQMQFLRKNVDEALRSYEELEKEDPSDFRPYFCKGMIYTLQDRNEEAREQFAKYRERS  449

Query  1091  PEGHPYSSFLDNTMIASKLFA  1153
             P+      FL   +   KLF 
Sbjct  450   PKKFEVEGFLQTPLSRMKLFG  470



>ref|XP_002314740.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF00911.2| tetratricopeptide repeat-containing family protein [Populus trichocarpa]
Length=338

 Score =   120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 119/212 (56%), Gaps = 9/212 (4%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L+  L +N   +E+L+SL++ K++     +A++I+ +L+  +P  TEW  L   L     
Sbjct  129   LEAFLESNAEAIESLKSLLQQKLEKGQDDEALNILKQLVSAQPEVTEWKFLMARLLNEMR  188

Query  710   EFETARRGFNEILSKEPLLVEAYHG---LITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               + AR  F EIL   PL  EA      L+    E D       +  R+ +A+ + + E+
Sbjct  189   RVQDARNVFEEILVVNPLSFEALFENALLMERSGEGD------AVIRRLREALDIAEEEN  242

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K  + RD +L++AQI+ ++ + EEAL+ YQEL  E+P DFRPY  + ++Y++L +++EAK
Sbjct  243   KVKEARDVRLIMAQIQFLQKNVEEALESYQELSNEDPKDFRPYFCRGMIYSLLDRNEEAK  302

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
             + F  YREL P+      +L  ++   KLF +
Sbjct  303   EQFAKYRELSPKKFEVEGYLRTSLSRMKLFGS  334



>ref|XP_010086922.1| hypothetical protein L484_005182 [Morus notabilis]
 gb|EXB24803.1| hypothetical protein L484_005182 [Morus notabilis]
Length=427

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 122/197 (62%), Gaps = 3/197 (2%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRG  733
             P +VEAL+ ++  K++     +A+  V RL+ELEP E EW LL    + + G+   A+R 
Sbjct  214   PKNVEALKVVLYGKMRRGKTKEAVKYVERLVELEPEEVEWRLLMALSYEMMGQLSVAKRL  273

Query  734   FNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLL  913
             F EIL + PL + A HGL  A+ +++   E   + + + +A+++ + E +  + R+ ++L
Sbjct  274   FKEILEERPLFLRALHGLALAMHKNN---EGPAVFKMLNEALEIARREKRVTEERNIRIL  330

Query  914   LAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLP  1093
             +AQ+  +  + EE L+ +Q LV E+  DFRPYL   I+Y+++ K +EA + F+ YR L+P
Sbjct  331   IAQMHVVRGELEEGLQEFQTLVDEDHRDFRPYLCLGIIYSLMDKKEEAAEQFETYRALVP  390

Query  1094  EGHPYSSFLDNTMIASK  1144
             E  P  +FLD+ ++A+K
Sbjct  391   EEFPQRNFLDDVVLAAK  407



>ref|XP_003531119.1| PREDICTED: uncharacterized protein LOC100780000 [Glycine max]
Length=293

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 120/210 (57%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L  N   + AL+SL++ K++     +A++I+ RL+  +P   +W  L   L   TG
Sbjct  85    LSDLLETNAEALAALKSLLQQKLELGEDDEALAILKRLIAAQPDAADWKFLAARLTAETG  144

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + ++AR  + E+L+  PL  EA   + L+      D+  E +    R+ +A+++ + +  
Sbjct  145   DSDSARGYYEEVLAANPLSFEALFENALLM-----DRCGEGEAAMRRLEEALRVAEEDKM  199

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               + RD KL++AQI  ++ + +EAL +Y +L KE+P DFRPY  + ++Y++L +++EAK+
Sbjct  200   AKEARDVKLIMAQIMFLQKNVDEALVIYNQLTKEDPRDFRPYFCRGMIYSLLDRNEEAKE  259

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L   +   KLF+
Sbjct  260   QFAKYRELSPKKFEVDGYLRTPLSRMKLFS  289



>ref|XP_004504629.1| PREDICTED: uncharacterized protein LOC101499708 [Cicer arietinum]
Length=314

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 116/187 (62%), Gaps = 7/187 (4%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             +  N   +E L+SL++ K++     +A+ I+  L+  +P  T+W  +   L + TG+ ++
Sbjct  110   IETNNESIETLKSLLQQKLELGEDEEALKILKSLISSQPEVTDWKFIAARLTIETGDTDS  169

Query  722   ARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQL  895
             AR  + EIL   PL  EA   + L+      D+  E + + E++ +A+++ + ++K+ + 
Sbjct  170   ARSFYQEILKSNPLSFEALFENALLM-----DRSGEGEAVIEKLEEALRVAEEDNKEKEA  224

Query  896   RDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQM  1075
             RD K ++AQI+ ++ + ++AL +Y+EL KE+P DFRPY  + ++Y +LGK+ EAK+ F+ 
Sbjct  225   RDVKFIMAQIQFLQKNVDKALGMYEELTKEDPNDFRPYFCRGMIYALLGKNDEAKEQFEK  284

Query  1076  YRELLPE  1096
             Y+EL P+
Sbjct  285   YKELSPK  291



>ref|XP_006348542.1| PREDICTED: uncharacterized protein LOC102603168 [Solanum tuberosum]
Length=320

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 115/208 (55%), Gaps = 3/208 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L ++P  +EAL++L++ K+++    +++ I+ +L   +P  TEW  L   L    G
Sbjct  110   LTQFLESSPEAIEALKNLLQEKLESGEDEESLKILKKLSSAQPENTEWKFLTARLLNEMG  169

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + E AR  F EILSK PL  EA      A+  D   E +K I+          +    K 
Sbjct  170   KLEDAREVFEEILSKTPLSFEAL--FENALLMDRCGEGVKVIQRLEEALRLAEEESKVK-  226

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD + ++AQ++ ++ + EEAL+ Y EL KE+P DFRPY  + ++Y++L ++KEA++ F
Sbjct  227   ESRDIRFIMAQVQFLQKNVEEALRSYDELEKEDPKDFRPYFCRGMIYSLLDRNKEAREQF  286

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFA  1153
               YREL P+      +L   +   KLF 
Sbjct  287   AKYRELSPKKFEVEGYLRTALSRMKLFG  314



>ref|XP_004228536.1| PREDICTED: uncharacterized protein LOC101245871 [Solanum lycopersicum]
Length=320

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/208 (34%), Positives = 115/208 (55%), Gaps = 3/208 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L ++P  +EAL++L++ K+++    +++ I+ +L   +P  TEW  L   L    G
Sbjct  110   LTQFLESSPEAIEALKNLLQEKLESGEDEESLKILKKLSSAQPENTEWKFLTARLLNEMG  169

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
             + E AR  F EILSK PL  EA      A+  D   E +K I+          +    K 
Sbjct  170   KLEDAREVFEEILSKTPLSFEAL--FENALLMDRCGEGVKVIQRLEEALRLAEEESKVK-  226

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + RD + ++AQ++ ++ + EEAL+ Y EL KE+P DFRPY  + ++Y++L ++KEA++ F
Sbjct  227   ESRDIRFIMAQVQFLQKNVEEALRSYDELEKEDPKDFRPYFCRGMIYSLLDRNKEAREQF  286

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFA  1153
               YREL P+      +L   +   KLF 
Sbjct  287   AKYRELSPKKFEVEGYLRTALSRMKLFG  314



>ref|XP_006470900.1| PREDICTED: uncharacterized protein LOC102617544 [Citrus sinensis]
Length=309

 Score =   118 bits (295),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 118/199 (59%), Gaps = 7/199 (4%)
 Frame = +2

Query  563   VEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNE  742
             +E+L+++++ K++N    ++++I+ RL   +P  T+W  L   L    G+ + AR  F E
Sbjct  106   IESLKTVLQKKLENGEDQESLTILQRLAVAQPQVTDWKFLMARLLSEMGKTQDARNVFEE  165

Query  743   ILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLL  916
             IL+  PL  EA   + L+      D+  E + + +R+ +A+++ + E+K  + RD + ++
Sbjct  166   ILAGNPLSFEALFENALLM-----DRCGEGEAVIKRLEEALEIAQDENKLKEARDVRFIM  220

Query  917   AQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPE  1096
             AQI+ ++ + +EALK YQEL  E+P DFRPY  + ++Y++L ++ EAK+ F  YR+L P+
Sbjct  221   AQIKFLQKNVDEALKSYQELEIEDPNDFRPYFCKGMIYSLLDRNAEAKEEFAKYRQLSPK  280

Query  1097  GHPYSSFLDNTMIASKLFA  1153
                   +L   +   KLF 
Sbjct  281   KFEVEGYLRTPLSRMKLFG  299



>ref|XP_011025582.1| PREDICTED: uncharacterized protein LOC105126414 isoform X2 [Populus 
euphratica]
Length=308

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 104/221 (47%), Gaps = 60/221 (27%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRG  733
             P +VEAL+ ++  K++     +A+  V RL+E+EP E EW LL    + + G+   A+R 
Sbjct  145   PRNVEALKVVLHGKMRRGQTKEAVKYVERLIEIEPEEVEWRLLEALCYEMLGQLNKAKRL  204

Query  734   FNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLL  913
             FNEIL + PLL+ A HG                                           
Sbjct  205   FNEILEERPLLLRALHG-------------------------------------------  221

Query  914   LAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLP  1093
                      D+EEALK +Q LV + P DFRPYL Q I+Y++L + +EA + F+ YR L+P
Sbjct  222   ---------DFEEALKKFQGLVSDNPRDFRPYLCQGIIYSLLDRKEEAAEQFETYRSLVP  272

Query  1094  EGHPYSSFLDNTMIASKLFAAAK*KMVSKTSFWLHFQPSFA  1216
             E  P   FLD+ ++ +        K  S+  F   FQ +F+
Sbjct  273   EEFPQRIFLDDVVLEA--------KTKSRERFQKEFQAAFS  305



>ref|XP_006420680.1| hypothetical protein CICLE_v10005482mg [Citrus clementina]
 gb|ESR33920.1| hypothetical protein CICLE_v10005482mg [Citrus clementina]
Length=311

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 117/199 (59%), Gaps = 7/199 (4%)
 Frame = +2

Query  563   VEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNE  742
             +E+L++L++ K++N    ++++I+ RL   +P  T+W  L   L    G+ + AR  F E
Sbjct  108   IESLKTLLQKKLENGEDQESLTILQRLAVAQPQVTDWKFLMARLLSEMGKTQDARNVFEE  167

Query  743   ILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLL  916
             IL+  PL  EA   + L+      D+  E + + +R+ +A+++ +  +K  + RD + ++
Sbjct  168   ILAGNPLSFEALFENALLM-----DRCGEGEAVIKRLEEALEIAEDGNKLKEARDVRFIM  222

Query  917   AQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPE  1096
             AQI+ ++ + +EALK YQEL  E+P DFRPY  + ++Y++L ++ EAK+ F  YR+L P+
Sbjct  223   AQIKFLQKNVDEALKSYQELEIEDPNDFRPYFCKGMIYSLLDRNAEAKEEFAKYRQLSPK  282

Query  1097  GHPYSSFLDNTMIASKLFA  1153
                   +L   +   KLF 
Sbjct  283   KFEVEGYLRTPLSRMKLFG  301



>ref|XP_007158849.1| hypothetical protein PHAVU_002G187000g [Phaseolus vulgaris]
 gb|ESW30843.1| hypothetical protein PHAVU_002G187000g [Phaseolus vulgaris]
Length=288

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 119/210 (57%), Gaps = 7/210 (3%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L + L  N   + AL+SL++ K++     +A++I+ RL+  +P   +W  L   L   TG
Sbjct  80    LSDILETNAEALAALKSLLQQKLELGEDDEALAILKRLIAAQPDAVDWKFLAARLTSETG  139

Query  710   EFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTEDK  883
             + + AR  + E+L+  PL  EA   + L+      D+  E +    R+ +A+++ + ++ 
Sbjct  140   DADAARAYYEEVLAANPLSFEALFENALLM-----DRSGEGEAAMRRLEEALRVAEEDNM  194

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
             K + RD +L++AQI  ++ + +EAL +Y +L KE+  DFRPY  + ++Y++L ++ EAK+
Sbjct  195   KKEARDVRLIMAQIMFLQKNVDEALGIYDQLTKEDSRDFRPYFCRGMIYSLLDRNDEAKE  254

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
              F  YREL P+      +L   +   KLF+
Sbjct  255   QFAKYRELSPKKFEVDGYLRTPLSRMKLFS  284



>emb|CAB44682.1| putative protein [Arabidopsis thaliana]
 emb|CAB80610.1| putative protein [Arabidopsis thaliana]
Length=290

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 99/167 (59%), Gaps = 4/167 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             EK  ++ L   P ++EA++++V  K++     DA+  V +LM+LEP E EW LL    + 
Sbjct  119   EKMFEKLLENEPENMEAMKAVVYKKMRRGKNEDAVKYVEKLMKLEPHEVEWKLLEALCYE  178

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
               GE   A+R + +IL ++PLL+ A HGL   + +         + + +++AM++ +  +
Sbjct  179   TMGELSKAKRLYKDILKEQPLLIRALHGLAMVMHKTHDT----SVFDMLIEAMEVARQGN  234

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQA  1021
             +  + R+ ++L+ Q+  +E  +EE LK++Q++V + P DFRPYL Q 
Sbjct  235   RVTEERNIQVLIGQMHIVEGQFEEGLKIFQQMVNDNPRDFRPYLCQV  281



>ref|XP_010486522.1| PREDICTED: uncharacterized protein LOC104764647 isoform X2 [Camelina 
sativa]
Length=303

 Score =   109 bits (273),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 110/203 (54%), Gaps = 38/203 (19%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             L++ L  + NDVE+L SL + K ++     AI  +NRL+E+EP E +WP   ++L +   
Sbjct  101   LEKHLETHSNDVESLVSLAKIKFESDKCDQAIETMNRLIEIEPQEQKWPDALHYLVM---  157

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLC--KTEDK  883
                       E    +P L+EA                    E+RI  A++ C    + K
Sbjct  158   ----------EYYDSKPKLLEA--------------------EKRIKYAIRRCKDMKKKK  187

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               ++R  ++L+AQIR +E +  EA+++ +ELVKE+P D++ YL+Q ++YT+L K  EAKK
Sbjct  188   TKEIRGLRMLIAQIRVLEGNTVEAIRICEELVKEDPEDYKVYLFQGLVYTLLKKGDEAKK  247

Query  1064  HFQMYRELLPEGHPYSSFLDNTM  1132
              F+    +LPE H   S+LD  M
Sbjct  248   QFEQVARILPENH---SYLDTPM  267



>gb|EPS65396.1| hypothetical protein M569_09382 [Genlisea aurea]
Length=315

 Score =   110 bits (274),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 109/194 (56%), Gaps = 4/194 (2%)
 Frame = +2

Query  542   LAANPNDVEA-LQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             L +NP    A L++L++ K++     +++SI+ +L   +P   EW  L   L    G+ +
Sbjct  111   LESNPESAAAALKNLLQEKLEAGEDEESLSILTKLTSAQPDNLEWKFLTARLLSEMGKSQ  170

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLR  898
              AR  F EILS+ PL  EA       +    + E + G   R+ +A+++ + + K  + R
Sbjct  171   EARSTFEEILSRNPLSFEALFENALLMDSSGERESVLG---RLEEALRIAENDKKPREAR  227

Query  899   DFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMY  1078
             D KL++AQ++ ++ + + AL+ Y EL KE+P+DFRPYL + ++ ++  +  EA++ F  Y
Sbjct  228   DVKLIMAQMQFLQKNVDGALRSYDELAKEDPSDFRPYLCKGMILSLSDRKDEAEEEFAKY  287

Query  1079  RELLPEGHPYSSFL  1120
             REL PE      +L
Sbjct  288   RELSPEKFEVEGYL  301



>ref|XP_007137586.1| hypothetical protein PHAVU_009G138700g [Phaseolus vulgaris]
 gb|ESW09580.1| hypothetical protein PHAVU_009G138700g [Phaseolus vulgaris]
Length=295

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 92/159 (58%), Gaps = 3/159 (2%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +VEAL+  +  KI+     +A+  V  L+  EP E EW LL    +   G+   
Sbjct  134   LEKDPKNVEALKVALYGKIRRGKSKEAVKFVEDLIAAEPKEVEWRLLLALCYETMGQLSK  193

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+R F EIL K PLL+ A HGL   ++++    E   I E + KA +L   E++  + R+
Sbjct  194   AKRLFREILKKRPLLLRALHGLAMVMNKN---HEGPAIFEMLNKAQELASRENRVTEERN  250

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQ  1018
              ++L+AQ+ A++ + EE LK  QEL+ ++P DFRPY+ Q
Sbjct  251   IRILIAQMHAVQGNLEEGLKRLQELIDQDPRDFRPYICQ  289



>gb|ABR17131.1| unknown [Picea sitchensis]
Length=459

 Score =   108 bits (271),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 113/205 (55%), Gaps = 12/205 (6%)
 Frame = +2

Query  536   ERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEF  715
             E L  +PND+ +L+ L+ +++  ++I  A+  ++R+M +EP E EW  L+       G+ 
Sbjct  216   EYLKTHPNDMSSLKILLHNRMIKRDIQGAVETLDRMMLVEPYEIEWKSLKAQAHYYLGDM  275

Query  716   ETARRGFNEILSKEPLLVEAYHGLITAVS----EDDQVEELKGIEERILKAMKLCKTEDK  883
             + AR  +  IL   P    A  GL   +     ED  V  L G  E+ L       +E+K
Sbjct  276   KEARHTYERILKFSPFSPGALQGLAMVMQKSGEEDAIVPMLAGTLEKAL-------SENK  328

Query  884   KGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKK  1063
               +++  +LLL +   +E  Y+EAL  YQ++VKE+P DFRPY +Q I+Y++L K  EA K
Sbjct  329   VKEVQTLRLLLGEYYLLEKKYQEALMNYQDVVKEDPEDFRPYFWQGIIYSILEKKDEASK  388

Query  1064  HFQMYRELLPEGHPYSSFLDNTMIA  1138
              F+ YR+L  +  P  + LDN M A
Sbjct  389   QFEKYRQLAKD-FPDQNLLDNLMSA  412



>ref|XP_006388357.1| hypothetical protein POPTR_0211s00200g [Populus trichocarpa]
 gb|ERP47271.1| hypothetical protein POPTR_0211s00200g [Populus trichocarpa]
Length=271

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 115/209 (55%), Gaps = 3/209 (1%)
 Frame = +2

Query  530   LQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTG  709
             LQ  L +N   +E+L+SL+  K++N    +A+ I+  L+  +P  T W  L   L    G
Sbjct  62    LQAFLESNAEAIESLKSLLLQKLENGQDEEALKIIKLLVSAQPEVTGWKFLMARLLSEMG  121

Query  710   EFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKG  889
               + AR  F EIL   PL  EA   L       D+  E + +  R+ +A+ +   E+K  
Sbjct  122   RVQDARNVFEEILVYNPLSFEA---LFENALLMDRCGEGEAVIRRLQEALDIAGEENKVK  178

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             + R+ +L++AQ++ ++ + E+ALK YQEL KE+P DF PY  + I+Y++L +++  K+ F
Sbjct  179   EARNVRLIMAQMQFLQKNVEKALKSYQELSKEDPKDFGPYFCRGIIYSLLDRNEGVKEQF  238

Query  1070  QMYRELLPEGHPYSSFLDNTMIASKLFAA  1156
               YREL P+      +L  ++   KLF +
Sbjct  239   AKYRELSPKKFEVEGYLRTSLSRMKLFGS  267



>ref|XP_007048155.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX92312.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma 
cacao]
Length=297

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 101/166 (61%), Gaps = 3/166 (2%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+  ++ L   P +VEAL+ ++  K++     +A+  V +L+++EP+E EW LL+   + 
Sbjct  133   EERYEKVLEKEPGNVEALKVVLYGKMRRGKTKEAVECVEKLIDIEPNEFEWRLLQALCYE  192

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G+   A+R F EIL + PLL+ A HGL   + ++    E   + ER+ +A+++   E 
Sbjct  193   MMGQLSKAKRLFKEILEERPLLLRALHGLAVVMHKNH---EGPAVFERLNEALEVALREK  249

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQ  1018
             +  + R+ ++L+AQ+  ++ + EE LK +Q+L+ + P DFRPYL Q
Sbjct  250   RVTEERNIRILIAQMHVVKGELEEGLKKFQDLMNDNPRDFRPYLCQ  295



>ref|XP_010025522.1| PREDICTED: uncharacterized protein LOC104415841 isoform X2 [Eucalyptus 
grandis]
Length=330

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 98/209 (47%), Gaps = 53/209 (25%)
 Frame = +2

Query  521   EKALQERL-AANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLF  697
             E+ + ERL   +P +VEAL+ ++  K++     +A+  V RL + EP E EW LL     
Sbjct  152   EEEMSERLLETDPTNVEALKVVLYGKMRRGKTKEAVKYVQRLADAEPDEVEWKLLLALCH  211

Query  698   VLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTE  877
                G+  TA+R F EIL + PL+                                     
Sbjct  212   ETMGQISTAKRLFREILEETPLM-------------------------------------  234

Query  878   DKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEA  1057
                            +RA+  +   ALK +Q+LV + P DFRPYL Q I+Y++L K KEA
Sbjct  235   ---------------LRALHGNLNAALKDFQDLVSDNPRDFRPYLCQGIIYSLLDKKKEA  279

Query  1058  KKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
             ++  + YR L+PE  P   FLD+ ++A+K
Sbjct  280   QEQLETYRSLVPEEFPQRGFLDDVVLAAK  308



>ref|XP_010473672.1| PREDICTED: uncharacterized protein LOC104752999 isoform X2 [Camelina 
sativa]
Length=309

 Score =   101 bits (252),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 106/201 (53%), Gaps = 40/201 (20%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  + ND EAL SL + K ++    +AI I+NRL+E+EP E +WP   ++L +       
Sbjct  110   LETHSNDAEALISLAKIKFESDKCDEAIEIMNRLIEIEPQEQKWPDALHYLVM-------  162

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLC----KTEDKKG  889
                   E    +P L+EA                    E+RI  A++ C    K + K  
Sbjct  163   ------EYYDSKPKLLEA--------------------EKRIKYAIRRCKDMKKKKKKTK  196

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
             ++R  ++L+AQIR +E +  +A+++ +ELV E+P D + YL+Q ++YT+L K  EAKK F
Sbjct  197   EIRGLRMLIAQIRVLEGNTVDAIRICEELVNEDPEDHKVYLFQGLVYTLLKKGDEAKKQF  256

Query  1070  QMYRELLPEGHPYSSFLDNTM  1132
             +    +LPE H Y   LD  M
Sbjct  257   EQVARILPENHWY---LDTPM  274



>ref|XP_008338636.1| PREDICTED: uncharacterized protein LOC103401697 isoform X2 [Malus 
domestica]
Length=319

 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 92/200 (46%), Gaps = 52/200 (26%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L  +P +V AL+ ++  K++     +A+S V RL+ELEP E EW L+    + + G+   
Sbjct  151   LVGDPKNVGALKVVLYGKLRRGKAEEAVSYVERLIELEPHELEWRLMLPLCYEIMGQLTC  210

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
             A+  + +IL   PLL+ A HG                                       
Sbjct  211   AKTLYQQILEDRPLLLRALHG---------------------------------------  231

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
                          + EE L  + +LV  +P DFRPYL Q I+Y++L + KEA + F+ YR
Sbjct  232   -------------ELEEGLNKFHDLVNADPRDFRPYLCQGIIYSLLDQKKEAAEQFETYR  278

Query  1082  ELLPEGHPYSSFLDNTMIAS  1141
              L+PE  P   FLD+ ++A+
Sbjct  279   ALVPEESPQRGFLDDVVLAA  298



>ref|XP_006655059.1| PREDICTED: uncharacterized protein LOC102711534 [Oryza brachyantha]
Length=366

 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 108/226 (48%), Gaps = 44/226 (19%)
 Frame = +2

Query  542   LAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFET  721
             L+++P DV+AL+ ++ +K++  + GDA+    RL E EP                     
Sbjct  183   LSSDPGDVDALKCVLFAKMRRADWGDALGFARRLREAEPG--------------------  222

Query  722   ARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRD  901
                          LLV A HGL   +    +  E   + E +  A++L  +E+K  + R+
Sbjct  223   -------------LLVRALHGLALCMH---KRSEGPTVFEMLENALQLAISEEKVPEERN  266

Query  902   FKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYR  1081
              KLL+AQ+  ++   + A +  Q L+ E+P DFRP+L Q I+Y +L K +EA + F  YR
Sbjct  267   IKLLIAQMHVVKGQLDAASEKLQNLINEDPRDFRPHLCQGIVYALLDKKEEADELFDTYR  326

Query  1082  ELLPEGHPYSSFLDNTMIASKLFAAAK*KMVSKTSFWLHFQPSFAS  1219
              L+P+  P  SF+ + + A+        +M SK      F P   S
Sbjct  327   SLVPDEFPDKSFITDVIQAA--------RMESKDRLQKDFGPELLS  364



>ref|XP_010098547.1| hypothetical protein L484_025987 [Morus notabilis]
 gb|EXB75207.1| hypothetical protein L484_025987 [Morus notabilis]
Length=174

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 75/109 (69%), Gaps = 2/109 (2%)
 Frame = +2

Query  521  EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
            E+A +E+++ +P+D EAL+SL+E+KI+   + + + +++RL+ELEP + EWPLL+ ++  
Sbjct  64   ERASEEQVSRDPDDAEALRSLMEAKIKANKLDEVVQVLDRLIELEPEDLEWPLLKANIHS  123

Query  701  LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERI  847
              GE E  +  F  IL K+PL VEAYHGL+ A S+    E+L G+  R+
Sbjct  124  HNGELELTKSEFEAILEKDPLRVEAYHGLVMAASQSG--EKLNGMVRRV  170



>ref|XP_002965387.1| hypothetical protein SELMODRAFT_406722 [Selaginella moellendorffii]
 gb|EFJ34225.1| hypothetical protein SELMODRAFT_406722 [Selaginella moellendorffii]
Length=355

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = +2

Query  596   IQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEA  775
             ++ +++  AI ++++L+++ PS+ E+  +R H +   G+ + A + F + +  +PL + A
Sbjct  157   MEKRDMPAAIKVLSKLIDMNPSQLEFRFIRGHAYEYIGDLDNALKEFEDAVKVDPLSLRA  216

Query  776   YHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEA  955
               GL   + +  Q +++  I++ +  A      ED+    R+F++L  Q+  ++ +  +A
Sbjct  217   LQGLALVLKK--QGKDIDFIQKIVEDAAAKATEEDRPKDARNFRMLKGQLLTLKEELPQA  274

Query  956   LKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPE  1096
             L++Y++L KE+PTDFRP++ Q ++  MLG+  +A++HF  + +  P+
Sbjct  275   LELYEQLSKEDPTDFRPHVCQGLVCCMLGELDQAEEHFSNFEKYCPQ  321



>ref|XP_002977234.1| hypothetical protein SELMODRAFT_417125 [Selaginella moellendorffii]
 gb|EFJ21843.1| hypothetical protein SELMODRAFT_417125 [Selaginella moellendorffii]
Length=354

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = +2

Query  596   IQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRGFNEILSKEPLLVEA  775
             ++ +++  AI ++++L+++ PS+ E+  +R H +   G+ + A + F + +  +PL + A
Sbjct  156   MEKRDMPAAIKVLSKLIDMNPSQLEFRFIRGHAYEYIGDLDNALKEFEDAVKVDPLSLRA  215

Query  776   YHGLITAVSEDDQVEELKGIEERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEA  955
               GL   + +  Q +++  I++ +  A      ED+    R+F++L  Q+  ++ +  +A
Sbjct  216   LQGLALVLKK--QGKDIDFIQKIVEDAAAKATEEDRPKDARNFRMLRGQLLTLKEELPQA  273

Query  956   LKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPE  1096
             L++Y++L KE+PTDFRP++ Q ++  MLG+  +A++HF  + +  P+
Sbjct  274   LELYEQLSKEDPTDFRPHVCQGLVCCMLGELDQAEEHFSNFEKYCPQ  320



>ref|WP_015174664.1| Tetratricopeptide TPR_2 repeat-containing protein [Oscillatoria 
nigro-viridis]
 ref|YP_007113750.1| Tetratricopeptide TPR_2 repeat-containing protein [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ05334.1| Tetratricopeptide TPR_2 repeat-containing protein [Oscillatoria 
nigro-viridis PCC 7112]
Length=303

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 99/191 (52%), Gaps = 10/191 (5%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQ--NQNIGD---AISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             P++V AL+ L++ +++   Q +GD   AI+ + +L  L P  TE+ +L       TG+ E
Sbjct  78    PDNVTALRGLLQVRLELIGQGVGDIKDAIAPLEKLASLNPETTEYGILLAQAKERTGDRE  137

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAM---KLCKTEDKKG  889
              A + +  IL+ +P  ++A  GL+  +    + E   G+ +  LKA     L K E    
Sbjct  138   GAAQAYRSILASKPGEIKALQGLVNLLLVQQRPEAAIGLLQDTLKAAPAANLAKPESV--  195

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
              +   +L+L Q+ A++  YEEA+ +Y E  K  P DFRP L +AI+    GK  EAK  F
Sbjct  196   DVTSVQLILGQVYAVQKRYEEAIAIYDESAKANPKDFRPTLGKAIVLKEQGKTDEAKTLF  255

Query  1070  QMYRELLPEGH  1102
                 +L P  +
Sbjct  256   DRATQLAPPNY  266



>gb|KDO57815.1| hypothetical protein CISIN_1g031170mg [Citrus sinensis]
Length=164

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 89/151 (59%), Gaps = 7/151 (5%)
 Frame = +2

Query  707   GEFETARRGFNEILSKEPLLVEAY--HGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             G+ + AR  F EIL+  PL  EA   + L+      D+  E + + +R+ +A+++ +  +
Sbjct  9     GKTQDARNVFEEILAGNPLSFEALFENALLM-----DRCGEGEAVIKRLEEALEIAEDGN  63

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
             K  + RD + ++AQI+ ++ + +EALK YQEL  E+P DFRPY  + ++Y++L ++ EAK
Sbjct  64    KLKEARDVRFIMAQIKFLQKNVDEALKSYQELEIEDPNDFRPYFCKGMIYSLLDRNAEAK  123

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIASKLFA  1153
             + F  YR+L P+      +L   +   KLF 
Sbjct  124   EEFAKYRQLSPKKFEVEGYLRTPLSRMKLFG  154



>ref|WP_006633208.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK87652.1| Tetratricopeptide TPR_2 repeat-containing protein [Microcoleus 
vaginatus FGP-2]
Length=301

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 98/188 (52%), Gaps = 10/188 (5%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQ--NQNIGD---AISIVNRLMELEPSETEWPLLRNHLFVLTGEFE  718
             P++V AL+ L++ +++   Q +GD   AI+ + +L  L P  TE+ +L       TG+ E
Sbjct  77    PDNVTALRGLLQVRLELIGQGVGDIKDAIAPLEKLASLNPETTEYGILLAQAKERTGDRE  136

Query  719   TARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAM---KLCKTEDKKG  889
              A + +  IL+ +P  ++A  GL+  +    + E   G+ +  LKA     L K E    
Sbjct  137   GAAQAYRSILASKPGEIKALQGLVNLLLVQQRPEAAIGLLQDTLKAAPAANLAKPESV--  194

Query  890   QLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHF  1069
              +   +L+L Q+ A++  YEEA+ +Y E  K  P DFRP L +AI+    GK  EAK  F
Sbjct  195   DVTSVQLILGQVYAVQKRYEEAIAIYDESAKANPKDFRPTLGKAIVLKEQGKTDEAKTLF  254

Query  1070  QMYRELLP  1093
                 EL P
Sbjct  255   DRATELAP  262



>ref|XP_009336371.1| PREDICTED: uncharacterized protein LOC103928963 isoform X2 [Pyrus 
x bretschneideri]
Length=312

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 96/207 (46%), Gaps = 52/207 (25%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
             E+   + L  +P +V AL+ ++  K++     +A+S V RL+ELEP E EW L+    + 
Sbjct  137   EQMYHKILVDDPKNVGALKVVLYGKLRRGKAEEAVSYVERLIELEPHELEWRLMLPLCYE  196

Query  701   LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLCKTED  880
             + G+   A+  + +I                                             
Sbjct  197   IMGQLTCAKTLYQQI---------------------------------------------  211

Query  881   KKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAK  1060
                 L D  LLL   RA+  + EE L  +Q+LV  +P DFRPYL + I+Y++L + KEA 
Sbjct  212   ----LEDRPLLL---RALHGELEEGLNKFQDLVNADPRDFRPYLCRGIIYSLLDQKKEAA  264

Query  1061  KHFQMYRELLPEGHPYSSFLDNTMIAS  1141
             + F+ YR L+PE  P   FL++ ++A+
Sbjct  265   EQFETYRALVPEEFPQRGFLNDVVLAA  291



>ref|XP_002322835.1| chloroplast lumen common family protein [Populus trichocarpa]
 gb|EEF04596.1| chloroplast lumen common family protein [Populus trichocarpa]
Length=82

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  932   IEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELLPEGHPYS  1111
             +E  Y +ALKVY+ELVKEEP DFR YL Q I+YT+L K  EA+K F+ +++L+P+ HPY 
Sbjct  1     MEEKYLDALKVYEELVKEEPRDFRLYLCQGIIYTLLRKKDEAEKKFEQFKKLVPKNHPYR  60

Query  1112  SFLDNTMIASKLFA  1153
              +L + M A+K F+
Sbjct  61    EYLVDNMFATKFFS  74



>emb|CDP12694.1| unnamed protein product [Coffea canephora]
Length=126

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = +2

Query  839   ERILKAMKLCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQ  1018
             E + +A++L ++E K  + R+ ++L AQ+   E   EEAL  +Q L+ E P DFRPYL Q
Sbjct  14    EMLDRALELARSEKKVNEERNIRILTAQMHVGEL--EEALGKFQALINENPRDFRPYLCQ  71

Query  1019  AIMYTMLGKDKEAKKHFQMYRELLPEGHPYSSFLDNTMIASK  1144
              I+Y++L K+KEA + F++Y+ L+PE  P   FLD+ +++++
Sbjct  72    GIVYSLLDKEKEALEQFEIYQSLVPEEFPQKKFLDDVILSAR  113



>ref|WP_006104328.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX72629.1| tetratricopeptide repeat domain protein [Coleofasciculus chthonoplastes 
PCC 7420]
Length=297

 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 1/182 (1%)
 Frame = +2

Query  554   PNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFVLTGEFETARRG  733
             P +  AL+ L+E+K++  ++  AI+ +  L EL P + E+ +L       TG+ E A + 
Sbjct  73    PQNQTALRGLLEAKLRLGDVEGAIAPLETLAELNPDQPEYGVLLAQAKEQTGDREGAAQA  132

Query  734   FNEILSKEPLLVEAYHGLITAVSEDDQVEELKGI-EERILKAMKLCKTEDKKGQLRDFKL  910
             + +IL+ +P  + A  GL     + ++ E   G+ +E I  A +  +T+  +  +   KL
Sbjct  133   YRQILASQPGDINALKGLAALYIQQNRPEAAIGLLQETIKNAGQQNQTQPGRVDVSSVKL  192

Query  911   LLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLGKDKEAKKHFQMYRELL  1090
             LL ++   +  + E L +Y EL++E P DFRP L +A++    GK +EAK  F     L 
Sbjct  193   LLGEVYLSQQRFTETLTIYDELIEENPQDFRPVLAKALILRQQGKTEEAKPLFTTAVSLA  252

Query  1091  PE  1096
             P+
Sbjct  253   PQ  254



>gb|KFK23283.1| hypothetical protein AALP_AAs68826U000100, partial [Arabis alpina]
Length=225

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +2

Query  521  EKALQERLAANPNDVEALQSLVESKIQNQNIGDAISIVNRLMELEPSETEWPLLRNHLFV  700
            E  L++ +    NDVEAL SL + K +++    AI+I+NRL+E+EP E  WP+++  +  
Sbjct  94   EATLEKHIEEESNDVEALLSLTKIKFESKKYDQAIAILNRLIEIEPGEQNWPVMKARILA  153

Query  701  LTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKGIEERILKAMKLC  868
               E E+A + F EIL K+P  ++AYH L+T     D   +L  +E+RI  A++ C
Sbjct  154  FNFESESAIKAFEEILVKDPDRIDAYHYLVTEYF--DSKPKLTDLEKRINDAIERC  207



>ref|WP_024124501.1| photosynthetic pigment/protein complex formation Pitt [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899605.1| photosynthetic pigment/protein complex formation Pitt [Thermosynechococcus 
sp. NK55a]
 gb|AHB88092.1| photosynthetic pigment/protein complex formation Pitt [Thermosynechococcus 
sp. NK55a]
Length=281

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 94/197 (48%), Gaps = 6/197 (3%)
 Frame = +2

Query  521   EKALQERLAANPNDVEALQSLVESKIQ-----NQNIGDAISIVNRLMELEPSETEWPLLR  685
             EK  Q  L   PN+  AL+ LV +++Q        I   I  + RL    P +T++ +L 
Sbjct  57    EKGYQLVLEREPNNATALEGLVLARLQLIQLGKGEIASVIDPLRRLAAQRPEQTDYAILL  116

Query  686   NHLFVLTGEFETARRGFNEILSKEPLLVEAYHGLITAVSEDDQVEELKG-IEERILKAMK  862
                   TG+ E A + F  +L+K P  + A   L+    ++++ +   G IEE +  A +
Sbjct  117   GQAQQQTGDREGAAQTFQGVLAKSPGNLNALRALVDLYLKENRPQAAIGLIEETLQGAEQ  176

Query  863   LCKTEDKKGQLRDFKLLLAQIRAIEYDYEEALKVYQELVKEEPTDFRPYLYQAIMYTMLG  1042
               K +     +   +LLL  +   +  Y+EAL ++Q L KE P DFRP L QA+  T  G
Sbjct  177   ANKVQPGSVDVTAVQLLLGDVYMTQKRYDEALTLFQNLGKENPNDFRPVLAQAMALTEQG  236

Query  1043  KDKEAKKHFQMYRELLP  1093
             K  EA   +    EL P
Sbjct  237   KKTEAASLYAKAVELAP  253



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4991792167216