BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20519_g1_i2 len=425 path=[1:0-152 154:153-189 191:190-211
213:212-255 257:256-286 288:287-424]

Length=425
                                                                      Score     E

ref|XP_002519767.1|  Brassinosteroid-regulated protein BRU1 precu...    124   1e-31   Ricinus communis
ref|XP_002526125.1|  Xyloglucan endotransglucosylase/hydrolase pr...    120   4e-31   Ricinus communis
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  122   9e-31   Hordeum vulgare [barley]
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             122   1e-30   
ref|XP_009762863.1|  PREDICTED: brassinosteroid-regulated protein...    120   6e-30   
gb|ABD96609.1|  xyloglucan endotransglucosylase XET3                    120   6e-30   Capsicum annuum
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         120   7e-30   
ref|XP_009598236.1|  PREDICTED: brassinosteroid-regulated protein...    119   1e-29   
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     119   1e-29   Triticum aestivum [Canadian hard winter wheat]
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    119   1e-29   
emb|CDP12752.1|  unnamed protein product                                115   2e-29   
ref|XP_011082928.1|  PREDICTED: probable xyloglucan endotransgluc...    118   2e-29   
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    118   2e-29   
gb|ABD96607.1|  xyloglucan endotransglucosylase XET1                    118   3e-29   Capsicum annuum
gb|EMS61840.1|  Xyloglucan endotransglucosylase/hydrolase protein 24    116   4e-29   
ref|XP_011082926.1|  PREDICTED: xyloglucan endotransglucosylase/h...    118   5e-29   
ref|XP_009598225.1|  PREDICTED: brassinosteroid-regulated protein...    117   6e-29   
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    117   9e-29   
ref|XP_009758414.1|  PREDICTED: probable xyloglucan endotransgluc...    117   1e-28   
ref|XP_011082921.1|  PREDICTED: xyloglucan endotransglucosylase/h...    116   2e-28   
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    116   2e-28   
ref|NP_001058455.2|  Os06g0696400                                       115   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009762866.1|  PREDICTED: brassinosteroid-regulated protein...    116   2e-28   
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    115   2e-28   
ref|XP_006366771.1|  PREDICTED: probable xyloglucan endotransgluc...    115   2e-28   
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    115   2e-28   
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               115   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    115   3e-28   Vitis vinifera
ref|NP_001234213.1|  xyloglucan endo-transglycosylase precursor         115   3e-28   
ref|XP_006657289.1|  PREDICTED: probable xyloglucan endotransgluc...    115   3e-28   
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    115   4e-28   
ref|NP_001058457.1|  Os06g0696600                                       115   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002536055.1|  conserved hypothetical protein                     110   4e-28   Ricinus communis
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    115   5e-28   
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    115   5e-28   
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    114   6e-28   
ref|XP_004966139.1|  PREDICTED: probable xyloglucan endotransgluc...    115   6e-28   
gb|EAZ02222.1|  hypothetical protein OsI_24317                          114   6e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          114   8e-28   
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          114   8e-28   
ref|XP_004243230.1|  PREDICTED: probable xyloglucan endotransgluc...    114   9e-28   
ref|NP_001266903.1|  XET precursor                                      114   9e-28   
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    114   9e-28   
emb|CDP18875.1|  unnamed protein product                                111   9e-28   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    114   1e-27   
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    114   1e-27   
ref|XP_007014176.1|  Xyloglucan endotransglycosylase 6                  114   1e-27   
ref|XP_010046990.1|  PREDICTED: probable xyloglucan endotransgluc...    114   1e-27   
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         114   1e-27   
ref|NP_001234207.1|  xyloglycan endo-transglycosylase precursor         114   1e-27   
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    114   1e-27   
ref|XP_011082929.1|  PREDICTED: xyloglucan endotransglucosylase/h...    112   2e-27   
ref|NP_001274880.1|  probable xyloglucan endotransglucosylase/hyd...    114   2e-27   
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             114   2e-27   
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    113   2e-27   
ref|XP_011082922.1|  PREDICTED: xyloglucan endotransglucosylase/h...    113   2e-27   
ref|XP_008449534.1|  PREDICTED: brassinosteroid-regulated protein...    113   2e-27   
ref|XP_002536698.1|  conserved hypothetical protein                     110   2e-27   Ricinus communis
emb|CDP12751.1|  unnamed protein product                                111   2e-27   
gb|AGI42457.1|  mutant xyloglucan endotransglycosylase/hydrolase        111   2e-27   
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    113   2e-27   
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    113   2e-27   
gb|ABD96608.1|  xyloglucan endotransglucosylase XET2                    113   2e-27   Capsicum annuum
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    113   2e-27   
ref|XP_009341025.1|  PREDICTED: xyloglucan endotransglucosylase/h...    113   3e-27   
gb|AFW69276.1|  xyloglucan endotransglucosylase/hydrolase protein 23    112   4e-27   
ref|NP_001149503.1|  LOC100283129 precursor                             112   4e-27   Zea mays [maize]
ref|XP_011082925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    112   4e-27   
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                112   5e-27   
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    112   5e-27   Vitis vinifera
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    112   5e-27   
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    112   6e-27   
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg             112   6e-27   
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    112   7e-27   
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    112   7e-27   
gb|ADP94235.2|  xyloglucan endotransglucosylase                         112   8e-27   
ref|XP_010102169.1|  Brassinosteroid-regulated protein BRU1             110   8e-27   
ref|XP_010913701.1|  PREDICTED: probable xyloglucan endotransgluc...    112   8e-27   
ref|XP_011083272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    111   9e-27   
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    111   1e-26   Zea mays [maize]
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    111   1e-26   
gb|EPS58668.1|  hypothetical protein M569_16144                         111   1e-26   
ref|XP_008223719.1|  PREDICTED: xyloglucan endotransglucosylase/h...    111   1e-26   
ref|NP_001284418.1|  brassinosteroid-regulated protein BRU1-like ...    111   1e-26   
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         111   1e-26   
ref|XP_009344504.1|  PREDICTED: xyloglucan endotransglucosylase/h...    111   1e-26   
ref|XP_011082923.1|  PREDICTED: xyloglucan endotransglucosylase/h...    111   1e-26   
emb|CAN80251.1|  hypothetical protein VITISV_036641                     111   1e-26   Vitis vinifera
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...    111   1e-26   
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    111   1e-26   
ref|XP_010103021.1|  putative xyloglucan endotransglucosylase/hyd...    111   1e-26   
ref|XP_002526224.1|  Xyloglucan endotransglucosylase/hydrolase pr...    111   1e-26   Ricinus communis
ref|XP_002536265.1|  conserved hypothetical protein                     108   2e-26   Ricinus communis
gb|ABL10090.1|  xyloglucan endotransglycosylase                         110   2e-26   Musa acuminata [banana]
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             110   2e-26   
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               110   2e-26   
emb|CDP16009.1|  unnamed protein product                                110   2e-26   
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...    110   2e-26   
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               110   2e-26   
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        110   2e-26   
ref|XP_011082930.1|  PREDICTED: probable xyloglucan endotransgluc...    110   2e-26   
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...    110   2e-26   Vitis vinifera
ref|XP_008449531.1|  PREDICTED: brassinosteroid-regulated protein...    110   2e-26   
gb|AFW69275.1|  hypothetical protein ZEAMMB73_374893                    111   2e-26   
ref|XP_009356706.1|  PREDICTED: xyloglucan endotransglucosylase/h...    110   2e-26   
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    110   3e-26   
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    110   3e-26   Ricinus communis
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...    110   3e-26   
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    110   3e-26   Ricinus communis
ref|XP_007014184.1|  Xyloglucan endotransglycosylase 6                  110   3e-26   
gb|ACU22849.1|  unknown                                                 108   3e-26   Glycine max [soybeans]
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               110   3e-26   
ref|XP_004140251.1|  PREDICTED: brassinosteroid-regulated protein...    108   3e-26   
gb|KCW78735.1|  hypothetical protein EUGRSUZ_C00179                     108   4e-26   
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               110   4e-26   
emb|CBI17813.3|  unnamed protein product                                110   4e-26   
ref|XP_004507927.1|  PREDICTED: probable xyloglucan endotransgluc...    110   4e-26   
ref|XP_011082931.1|  PREDICTED: probable xyloglucan endotransgluc...    110   4e-26   
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    110   4e-26   
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    110   4e-26   
ref|XP_003549490.2|  PREDICTED: probable xyloglucan endotransgluc...    110   4e-26   
ref|NP_001234478.1|  xyloglucan endotransglucosylase-hydrolase XT...    110   4e-26   
ref|XP_011082924.1|  PREDICTED: xyloglucan endotransglucosylase/h...    110   4e-26   
ref|XP_008449536.1|  PREDICTED: brassinosteroid-regulated protein...    110   4e-26   
ref|XP_008449516.1|  PREDICTED: brassinosteroid-regulated protein...    110   4e-26   
gb|KCW78732.1|  hypothetical protein EUGRSUZ_C00176                     111   5e-26   
gb|AES92349.2|  xyloglucan endotransglucosylase/hydrolase family ...    109   5e-26   
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    109   5e-26   
ref|XP_010241684.1|  PREDICTED: probable xyloglucan endotransgluc...    109   5e-26   
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  109   5e-26   
gb|AAT11860.1|  xyloglucanendotransglycosylase                          105   5e-26   Mangifera indica
ref|XP_002438935.1|  hypothetical protein SORBIDRAFT_10g028570          109   6e-26   Sorghum bicolor [broomcorn]
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    109   6e-26   
gb|KCW78733.1|  hypothetical protein EUGRSUZ_C00177                     112   6e-26   
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...    109   6e-26   
ref|XP_002270375.2|  PREDICTED: brassinosteroid-regulated protein...    108   6e-26   Vitis vinifera
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    109   7e-26   
ref|XP_011045330.1|  PREDICTED: brassinosteroid-regulated protein...    109   7e-26   
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...    109   7e-26   
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    109   7e-26   
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    109   7e-26   
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    109   8e-26   
ref|XP_002270182.2|  PREDICTED: probable xyloglucan endotransgluc...    110   8e-26   Vitis vinifera
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     109   8e-26   
ref|XP_008380219.1|  PREDICTED: xyloglucan endotransglucosylase/h...    109   9e-26   
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    108   9e-26   
ref|XP_003542156.1|  PREDICTED: probable xyloglucan endotransgluc...    108   9e-26   
ref|XP_008346306.1|  PREDICTED: xyloglucan endotransglucosylase/h...    108   9e-26   
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase               108   9e-26   
emb|CCH26408.1|  xyloglucan endotransglycosylase                        108   9e-26   
ref|XP_004164862.1|  PREDICTED: brassinosteroid-regulated protein...    108   9e-26   
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase               108   9e-26   
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase               108   1e-25   
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    108   1e-25   
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase               108   1e-25   
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    108   1e-25   
ref|XP_002535499.1|  conserved hypothetical protein                     106   1e-25   Ricinus communis
gb|EYU31577.1|  hypothetical protein MIMGU_mgv1a011275mg                108   1e-25   
gb|EYU29581.1|  hypothetical protein MIMGU_mgv1a022262mg                108   1e-25   
gb|EYU29580.1|  hypothetical protein MIMGU_mgv1a018934mg                108   1e-25   
ref|XP_007014173.1|  Xyloglucan endotransglycosylase 6                  108   1e-25   
ref|XP_009759292.1|  PREDICTED: probable xyloglucan endotransgluc...    105   1e-25   
ref|XP_010102168.1|  Xyloglucan endotransglucosylase/hydrolase pr...    109   1e-25   
ref|XP_010927111.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...    106   1e-25   
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase               108   1e-25   
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...    108   1e-25   
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    108   1e-25   
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...    108   1e-25   
ref|XP_010259808.1|  PREDICTED: xyloglucan endotransglucosylase/h...    108   1e-25   
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    108   2e-25   
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16       108   2e-25   
ref|XP_011045331.1|  PREDICTED: brassinosteroid-regulated protein...    108   2e-25   
gb|ACD03217.1|  xyloglucan endotransglucosylase/hydrolase 7             108   2e-25   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...    108   2e-25   Vitis vinifera
ref|XP_006350013.1|  PREDICTED: probable xyloglucan endotransgluc...    108   2e-25   
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...    108   2e-25   Vitis vinifera
ref|XP_010656825.1|  PREDICTED: probable xyloglucan endotransgluc...    108   2e-25   
ref|XP_002317309.1|  xyloglucan endo-1 family protein                   107   2e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008799496.1|  PREDICTED: probable xyloglucan endotransgluc...    108   2e-25   
gb|ACJ85154.1|  unknown                                                 107   2e-25   Medicago truncatula
gb|KGN47998.1|  hypothetical protein Csa_6G423400                       107   2e-25   
ref|XP_004303863.1|  PREDICTED: probable xyloglucan endotransgluc...    108   2e-25   
ref|XP_007223160.1|  hypothetical protein PRUPE_ppa009417mg             108   2e-25   
gb|ABY79073.1|  xyloglucan xyloglucosyl transferase                     107   2e-25   Hordeum vulgare [barley]
ref|XP_011043994.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   3e-25   
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...    107   3e-25   
ref|XP_011043995.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   3e-25   
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   3e-25   
gb|ACU17489.1|  unknown                                                 105   3e-25   Glycine max [soybeans]
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...    107   3e-25   
ref|XP_008229406.1|  PREDICTED: probable xyloglucan endotransgluc...    107   3e-25   
ref|XP_004488032.1|  PREDICTED: probable xyloglucan endotransgluc...    107   4e-25   
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...    107   4e-25   Ricinus communis
ref|XP_011043992.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   4e-25   
ref|XP_011043993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   4e-25   
gb|EYU31576.1|  hypothetical protein MIMGU_mgv1a011220mg                107   4e-25   
ref|XP_010053252.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   4e-25   
gb|AFW69274.1|  Xyloglucan endo-transglycosylase Xyloglucan endot...    108   4e-25   
ref|XP_008801579.1|  PREDICTED: probable xyloglucan endotransgluc...    108   4e-25   
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    107   4e-25   
ref|XP_008801575.1|  PREDICTED: probable xyloglucan endotransgluc...    105   4e-25   
ref|XP_002437518.1|  hypothetical protein SORBIDRAFT_10g028550          107   4e-25   Sorghum bicolor [broomcorn]
ref|XP_004140252.1|  PREDICTED: brassinosteroid-regulated protein...    107   5e-25   
ref|XP_004164865.1|  PREDICTED: brassinosteroid-regulated protein...    107   5e-25   
gb|KDP36433.1|  hypothetical protein JCGZ_08702                         107   5e-25   
ref|XP_004309954.1|  PREDICTED: probable xyloglucan endotransgluc...    107   5e-25   
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...    106   5e-25   
ref|XP_007154784.1|  hypothetical protein PHAVU_003G147700g             107   5e-25   
emb|CAN80250.1|  hypothetical protein VITISV_036640                     107   6e-25   Vitis vinifera
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    107   6e-25   
ref|XP_004309952.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   6e-25   
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    106   7e-25   
ref|XP_006387414.1|  hypothetical protein POPTR_1065s00200g             106   7e-25   
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             106   7e-25   Populus trichocarpa [western balsam poplar]
gb|KCW89705.1|  hypothetical protein EUGRSUZ_A01967                     106   7e-25   
emb|CAN74784.1|  hypothetical protein VITISV_032594                     106   7e-25   Vitis vinifera
ref|XP_008362366.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...    106   7e-25   
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...    106   8e-25   
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   8e-25   
ref|XP_006350014.1|  PREDICTED: probable xyloglucan endotransgluc...    106   8e-25   
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...    106   8e-25   
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...    106   8e-25   
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2          106   8e-25   Asparagus officinalis
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...    106   9e-25   
ref|NP_001105367.1|  xyloglucan endotransglycosylase homolog1 pre...    106   9e-25   Zea mays [maize]
ref|XP_009378317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   9e-25   
ref|XP_008223657.1|  PREDICTED: probable xyloglucan endotransgluc...    103   9e-25   
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...    106   1e-24   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    106   1e-24   
gb|AAF80590.1|AF223419_1  xyloglucan endotransglycosylase XET1          106   1e-24   Asparagus officinalis
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             106   1e-24   
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...    106   1e-24   
ref|XP_009597029.1|  PREDICTED: probable xyloglucan endotransgluc...    105   1e-24   
ref|XP_002518632.1|  Brassinosteroid-regulated protein BRU1 precu...    105   1e-24   Ricinus communis
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg             106   1e-24   
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg             105   1e-24   
gb|ACD03220.1|  xyloglucan endotransglucosylase/hydrolase 10            105   1e-24   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001237075.1|  syringolide-induced protein 19-1-5 precursor       105   1e-24   
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             105   1e-24   
ref|NP_001276139.1|  uncharacterized protein LOC102661404 precursor     105   1e-24   
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...    105   2e-24   
ref|XP_007154780.1|  hypothetical protein PHAVU_003G147300g             105   2e-24   
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...    105   2e-24   
gb|AAC39467.1|  endo-xyloglucan transferase                             102   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266082.1|  PREDICTED: brassinosteroid-regulated protein...    105   2e-24   Vitis vinifera
gb|AEZ00859.1|  putative xyloglucan endotransglycosylase protein        103   2e-24   
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...    105   2e-24   
ref|XP_009126894.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-24   
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase               105   2e-24   
gb|ACJ85206.1|  unknown                                                 103   2e-24   Medicago truncatula
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    105   2e-24   
gb|AAN60350.1|  unknown                                                 101   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008236805.1|  PREDICTED: probable xyloglucan endotransgluc...    103   2e-24   
ref|XP_002267838.1|  PREDICTED: brassinosteroid-regulated protein...    105   2e-24   Vitis vinifera
ref|NP_001242489.1|  uncharacterized protein LOC100807063 precursor     105   2e-24   
ref|XP_008801542.1|  PREDICTED: probable xyloglucan endotransgluc...    105   2e-24   
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...    105   2e-24   
emb|CDY02741.1|  BnaC02g11480D                                          105   2e-24   
emb|CDY67487.1|  BnaA02g35250D                                          104   2e-24   
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...    105   2e-24   
ref|XP_009793860.1|  PREDICTED: probable xyloglucan endotransgluc...    105   2e-24   
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase              105   2e-24   Rosa hybrid cultivar
ref|XP_004235158.1|  PREDICTED: probable xyloglucan endotransgluc...    105   3e-24   
gb|AFK47205.1|  unknown                                                 105   3e-24   
ref|XP_003518514.1|  PREDICTED: probable xyloglucan endotransgluc...    105   3e-24   
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...    105   3e-24   
ref|XP_010656914.1|  PREDICTED: brassinosteroid-regulated protein...    102   3e-24   
emb|CDY59999.1|  BnaA02g35330D                                          104   3e-24   
ref|XP_002274154.2|  PREDICTED: probable xyloglucan endotransgluc...    105   3e-24   Vitis vinifera
emb|CDY25903.1|  BnaC09g32750D                                          104   3e-24   
ref|XP_004293369.1|  PREDICTED: probable xyloglucan endotransgluc...    105   3e-24   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg             105   3e-24   
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor     105   3e-24   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...    104   3e-24   
gb|EMS64808.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    104   3e-24   
ref|XP_002306736.2|  xyloglucan endo-1 family protein                   105   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_008222773.1|  PREDICTED: brassinosteroid-regulated protein...    104   3e-24   
ref|XP_007221284.1|  hypothetical protein PRUPE_ppa009792mg             104   3e-24   
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   4e-24   
ref|XP_009785048.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
ref|XP_002274404.1|  PREDICTED: brassinosteroid-regulated protein...    104   4e-24   
gb|KHN38312.1|  Putative xyloglucan endotransglucosylase/hydrolas...    104   4e-24   
ref|XP_002274858.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   4e-24   
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
ref|XP_010927059.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   4e-24   
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...    104   4e-24   
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg             105   4e-24   
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             104   4e-24   
emb|CBI17811.3|  unnamed protein product                                108   4e-24   
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    104   4e-24   
ref|XP_004507838.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
ref|XP_009406667.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         104   4e-24   
ref|XP_002270416.1|  PREDICTED: probable xyloglucan endotransgluc...    104   4e-24   
gb|KHN17581.1|  Putative xyloglucan endotransglucosylase/hydrolas...    104   5e-24   
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   5e-24   
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16       104   5e-24   
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...    104   5e-24   
ref|XP_011069896.1|  PREDICTED: probable xyloglucan endotransgluc...    104   5e-24   
ref|NP_001241948.1|  uncharacterized protein LOC100800017 precursor     104   5e-24   
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...    104   5e-24   
gb|KGN47997.1|  hypothetical protein Csa_6G423390                       104   5e-24   
gb|AHB60658.1|  xyloglucan endotransglucosylase/hydrolase               104   5e-24   
ref|XP_004164863.1|  PREDICTED: brassinosteroid-regulated protein...    104   5e-24   
ref|XP_006409111.1|  hypothetical protein EUTSA_v10023177mg             104   5e-24   
emb|CDP02962.1|  unnamed protein product                                104   5e-24   
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         103   5e-24   
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...    104   6e-24   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    103   6e-24   
gb|EMT22597.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    103   6e-24   
ref|XP_006453416.1|  hypothetical protein CICLE_v10010531mg             103   6e-24   
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...    103   6e-24   
ref|XP_011094075.1|  PREDICTED: probable xyloglucan endotransgluc...    103   6e-24   
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...    103   7e-24   
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                   103   7e-24   
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...    103   7e-24   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...    103   7e-24   
ref|XP_009626663.1|  PREDICTED: probable xyloglucan endotransgluc...    103   7e-24   
ref|XP_007154667.1|  hypothetical protein PHAVU_003G137600g             103   8e-24   
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   8e-24   
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    104   8e-24   
gb|ACU20598.1|  unknown                                                 100   8e-24   
gb|AFK40018.1|  unknown                                                 103   8e-24   
ref|XP_003630685.1|  Xyloglucan endotransglycosylase                    103   8e-24   
gb|AET05161.2|  xyloglucan endotransglucosylase/hydrolase family ...    103   8e-24   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...    103   8e-24   
ref|XP_009343827.1|  PREDICTED: brassinosteroid-regulated protein...    103   8e-24   
gb|EMS56986.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    103   9e-24   
gb|KEH20644.1|  xyloglucan endotransglucosylase/hydrolase family ...    103   9e-24   
emb|CDP02963.1|  unnamed protein product                                103   9e-24   
ref|XP_003610009.1|  Xyloglucan endotransglucosylase/hydrolase          100   9e-24   
gb|ACJ84668.1|  unknown                                                 103   9e-24   
ref|XP_002274552.1|  PREDICTED: probable xyloglucan endotransgluc...    103   9e-24   
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
gb|AAA32828.1|  meri-5                                                  102   1e-23   
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg             103   1e-23   
ref|XP_009759293.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   1e-23   
ref|XP_004165696.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   1e-23   
ref|XP_004146306.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   1e-23   
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_010911419.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   1e-23   
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...    103   1e-23   
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_008223830.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_007222107.1|  hypothetical protein PRUPE_ppa009610mg             103   1e-23   
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase              103   1e-23   
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...    103   1e-23   
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...    103   1e-23   
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...    103   1e-23   
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...    103   1e-23   
ref|XP_004504381.1|  PREDICTED: brassinosteroid-regulated protein...    102   2e-23   
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg             102   2e-23   
emb|CDX94413.1|  BnaC01g17710D                                          102   2e-23   
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...    102   2e-23   
ref|XP_004235157.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_009139558.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_006360667.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_010046991.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931             102   2e-23   
gb|AFK42566.1|  unknown                                                 101   2e-23   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...    102   2e-23   
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   2e-23   
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...    102   2e-23   
gb|KDP36436.1|  hypothetical protein JCGZ_08705                         102   2e-23   
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_009409758.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_004140250.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_008223655.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   2e-23   
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...    102   2e-23   
ref|XP_003610141.1|  Xyloglucan endotransglucosylase/hydrolase          102   3e-23   
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...    102   3e-23   
gb|ACJ85040.1|  unknown                                                 101   3e-23   
gb|KHN11956.1|  Putative xyloglucan endotransglucosylase/hydrolas...    102   3e-23   
ref|NP_194756.1|  xyloglucan endotransglucosylase/hydrolase prote...    102   3e-23   
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   3e-23   
ref|XP_003545148.1|  PREDICTED: probable xyloglucan endotransgluc...    102   3e-23   
emb|CAN83588.1|  hypothetical protein VITISV_004806                     102   3e-23   
gb|KDP36428.1|  hypothetical protein JCGZ_08697                         102   3e-23   
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    102   3e-23   
ref|XP_008223656.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   3e-23   
gb|AFK49256.1|  unknown                                                 100   3e-23   
ref|XP_003560505.2|  PREDICTED: xyloglucan endotransglucosylase/h...    102   3e-23   
emb|CDY66832.1|  BnaAnng23050D                                          102   3e-23   
dbj|BAH36875.1|  xyloglucan endotransglucosylase/hydrolase              102   3e-23   
gb|KHG13977.1|  putative xyloglucan endotransglucosylase/hydrolas...    101   3e-23   
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...    102   4e-23   
gb|KCW89706.1|  hypothetical protein EUGRSUZ_A01968                     102   4e-23   
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g             102   4e-23   
emb|CAN70187.1|  hypothetical protein VITISV_039080                     104   4e-23   
emb|CAA10231.1|  xyloglucan endotransglycosylase 1                      102   4e-23   
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    101   4e-23   
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                    101   4e-23   
gb|AFK40376.1|  unknown                                                 102   4e-23   
ref|XP_008453623.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   4e-23   
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   4e-23   
ref|XP_010438197.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   5e-23   
ref|XP_009609044.1|  PREDICTED: probable xyloglucan endotransgluc...    101   5e-23   
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...    101   5e-23   
gb|AFK33537.1|  unknown                                                 101   5e-23   
gb|AEX07595.1|  xyloglucosyl transferase 2                              101   5e-23   
ref|XP_006279674.1|  hypothetical protein CARUB_v10026912mg             101   5e-23   
ref|XP_006358260.1|  PREDICTED: probable xyloglucan endotransgluc...    101   5e-23   
ref|XP_010433006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   5e-23   
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase          101   5e-23   
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...    101   5e-23   
emb|CDY03539.1|  BnaC03g67980D                                          101   5e-23   
ref|XP_006358261.1|  PREDICTED: probable xyloglucan endotransgluc...    101   5e-23   
ref|XP_002301752.1|  brassinosteroid-regulated family protein           101   5e-23   
gb|KHN24614.1|  Brassinosteroid-regulated protein BRU1                  101   5e-23   
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   6e-23   
gb|KGN65436.1|  hypothetical protein Csa_1G422450                     98.2    6e-23   
gb|ABM91075.1|  xyloglucan endotransglycosylase/hydrolase precurs...    101   6e-23   
ref|XP_006358262.1|  PREDICTED: probable xyloglucan endotransgluc...    101   6e-23   
gb|EYU20916.1|  hypothetical protein MIMGU_mgv1a011962mg                101   6e-23   
ref|XP_008799440.1|  PREDICTED: probable xyloglucan endotransgluc...    101   6e-23   
ref|XP_010929300.1|  PREDICTED: probable xyloglucan endotransgluc...    101   6e-23   
ref|XP_003542166.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   6e-23   
ref|XP_006387415.1|  xyloglucan endo-1 family protein                   101   6e-23   
emb|CAN80252.1|  hypothetical protein VITISV_036642                     101   6e-23   
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   6e-23   
gb|EYU29578.1|  hypothetical protein MIMGU_mgv1a011198mg                101   6e-23   
emb|CBI17801.3|  unnamed protein product                                101   7e-23   
gb|AII99392.1|  xyloglucan endotransglucosylase/hydrolase2              101   7e-23   
ref|XP_010053241.1|  PREDICTED: brassinosteroid-regulated protein...    101   7e-23   
gb|AII99393.1|  xyloglucan endotransglucosylase/hydrolase2              101   7e-23   
ref|XP_002321087.1|  brassinosteroid-regulated family protein           101   7e-23   
dbj|BAJ10423.1|  xyloglucan endotransglucosylase/hydrolase              101   7e-23   
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...    101   7e-23   
ref|XP_010246961.1|  PREDICTED: brassinosteroid-regulated protein...    101   7e-23   
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...    100   7e-23   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg             100   7e-23   
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...    101   8e-23   
ref|XP_008801577.1|  PREDICTED: probable xyloglucan endotransgluc...    100   8e-23   
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...    100   8e-23   
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...    100   8e-23   
ref|XP_006284057.1|  hypothetical protein CARUB_v10005183mg             101   8e-23   
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             101   8e-23   
ref|XP_002867358.1|  meristem-5                                         100   8e-23   
ref|XP_003601714.1|  Xyloglucan endotransglycosylase/hydrolase XT...    100   9e-23   
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...    100   9e-23   
gb|KDP42856.1|  hypothetical protein JCGZ_23798                         100   9e-23   
ref|XP_003601713.1|  Xyloglucan endotransglycosylase/hydrolase XT...    100   9e-23   
ref|XP_002324480.1|  xyloglucan endo-1 family protein                   100   9e-23   
ref|XP_002324481.2|  xyloglucan endo-1 family protein                   100   9e-23   
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase               100   1e-22   
gb|AFR46575.1|  xyloglucan endotransglucosylase/hydrolase 6             100   1e-22   
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
ref|XP_011023833.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
gb|AAM63080.1|  xyloglucan endo-1,4-beta-D-glucanase precursor          100   1e-22   
ref|XP_008799495.1|  PREDICTED: uncharacterized protein LOC103714121    103   1e-22   
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...    100   1e-22   
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
ref|XP_002526231.1|  xyloglucan:xyloglucosyl transferase, putative    97.4    1e-22   
ref|XP_004146358.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...    100   1e-22   
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...    100   1e-22   
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...    100   1e-22   
emb|CAD88260.1|  putative xyloglucan endotransglycosylase               100   1e-22   
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg             100   1e-22   
gb|KHF98181.1|  putative xyloglucan endotransglucosylase/hydrolas...    100   1e-22   
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg             100   1e-22   
ref|XP_004161054.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
ref|XP_002530540.1|  conserved hypothetical protein                   99.0    1e-22   
ref|XP_007015526.1|  Xyloglucan endotransglycosylase 6                  100   1e-22   
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
emb|CDY68968.1|  BnaAnng28970D                                        97.8    1e-22   
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...    100   1e-22   
ref|XP_002274827.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
gb|ABM91073.1|  xyloglucan endotransglycosylase/hydrolase precurs...    100   1e-22   
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...    100   1e-22   
ref|XP_010259800.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
ref|XP_006842022.1|  hypothetical protein AMTR_s00337p00012920        96.7    2e-22   
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9             100   2e-22   
ref|XP_003542150.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
emb|CDY39193.1|  BnaA03g50050D                                          100   2e-22   
ref|XP_007014171.1|  Xyloglucan endotransglucosylase/hydrolase fa...    100   2e-22   
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                    100   2e-22   
ref|XP_004507835.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
emb|CDX68640.1|  BnaC01g08130D                                          100   2e-22   
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...    100   2e-22   
ref|XP_006401195.1|  hypothetical protein EUTSA_v10015276mg           97.8    2e-22   
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                   100   2e-22   
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208             100   2e-22   
ref|XP_010532726.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
emb|CDX72228.1|  BnaC07g42500D                                          100   2e-22   
ref|XP_009380743.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   2e-22   
ref|XP_010053265.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   2e-22   
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg                100   2e-22   
ref|XP_006358258.1|  PREDICTED: probable xyloglucan endotransgluc...    100   2e-22   
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...  99.8    2e-22   
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3             100   2e-22   
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...  99.8    2e-22   
ref|XP_007226935.1|  hypothetical protein PRUPE_ppa015713mg           99.8    2e-22   
gb|KFK35964.1|  xyloglucan:xyloglucosyl transferase                   99.8    2e-22   



>ref|XP_002519767.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42740.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=272

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC++ A+S +A A AGNFYQD  + +G+GRGQ++DGG +++L LDK+SGSGFQS  EY
Sbjct  5    LLLCIL-ASSFLAAACAGNFYQDVDITWGSGRGQIMDGGNLLSLTLDKDSGSGFQSNKEY  63

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  64   LFGRFDVQMKLVPGNSAGTVTTFY  87



>ref|XP_002526125.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36261.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=182

 Score =   120 bits (302),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L +++  SLV   +AGN YQD  + +G+GRG++L+ G ++ L LDK SGSGFQSKNEYLF
Sbjct  11   LALLLITSLVMPIIAGNIYQDVDITWGDGRGEILNNGNIVTLSLDKASGSGFQSKNEYLF  70

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+FDMQLKLVPGNSAGTVTTFY
Sbjct  71   GKFDMQLKLVPGNSAGTVTTFY  92



>emb|CAA63663.1| xyloglucan endotransglycosylase (XET) [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ98866.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            ++L ++  A LVAVA AGNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK+EY
Sbjct  4    VELGIVAMACLVAVARAGNFFQDSEMSWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKSEY  63

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQ+KLVPGNSAGTVTTFY
Sbjct  64   LFGKIDMQIKLVPGNSAGTVTTFY  87



>gb|ABV46534.1| xyloglucan endotransglucosylase hydrolase 2 [Bambusa oldhamii]
Length=280

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            M  A LVA+A  GNFYQDA+M +G GRG+V+DGG+ + L LD+ SGSGFQSKNEYLFG+ 
Sbjct  1    MAMACLVAIAQGGNFYQDAEMSWGQGRGKVVDGGRGLDLTLDRSSGSGFQSKNEYLFGKI  60

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQ++LVPGNSAGTVTTFY
Sbjct  61   DMQIRLVPGNSAGTVTTFY  79



>ref|XP_009762863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
sylvestris]
Length=290

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  341
            SS  L LC++++  L+A A AGNFY+DA + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSVMLLLCIIMSIQLLA-ASAGNFYRDAVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  342  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>gb|ABD96609.1| xyloglucan endotransglucosylase XET3 [Capsicum annuum]
Length=287

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            LQL ++ A  L+    A NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEY
Sbjct  3    LQLSIL-AVLLLCPVWAENFYQDATVTFGDHRAQIQDGGRVLALSLDKISGSGFQSKNEY  61

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFDMQLKLVPGNSAGTVTTFY
Sbjct  62   LFGRFDMQLKLVPGNSAGTVTTFY  85



>gb|KDP36430.1| hypothetical protein JCGZ_08699 [Jatropha curcas]
Length=285

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +3

Query  192  IAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFD  371
            IA S   VA+A NFYQD  + +G+GRG++L+ G +I L LDK SGSGFQSKNEYLFG+FD
Sbjct  15   IAGSSFMVAMAANFYQDVDITWGDGRGKILNNGNLITLSLDKYSGSGFQSKNEYLFGKFD  74

Query  372  MQLKLVPGNSAGTVTTFY  425
            MQLKLVPGNSAGTVTTFY
Sbjct  75   MQLKLVPGNSAGTVTTFY  92



>ref|XP_009598236.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  341
            SS  L LC++++  L+A A AGNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSAMLLLCILMSIQLLA-ASAGNFYRDTVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  342  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>gb|AAT94297.1| endotransglucosylase/hydrolase XTH5 [Triticum aestivum]
Length=287

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++  A LVAVA  GNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK EYLFG+
Sbjct  8    ILAMACLVAVARGGNFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGK  67

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQ+KLVPGNSAGTVTTFY
Sbjct  68   IDMQIKLVPGNSAGTVTTFY  87



>gb|EMT27816.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Aegilops tauschii]
Length=287

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++  A LVAVA  GNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK EYLFG+
Sbjct  8    ILAMACLVAVARGGNFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGK  67

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQ+KLVPGNSAGTVTTFY
Sbjct  68   IDMQIKLVPGNSAGTVTTFY  87



>emb|CDP12752.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + I AS +  A AGNFYQD    FG+ R ++L+GG+++ L LDK SGSGFQSKNEYLF
Sbjct  13   LQISIIASFLLAAYAGNFYQDVTQNFGDQRFKILEGGQLLTLSLDKTSGSGFQSKNEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFDMQLKL+PGNSAGTV TFY
Sbjct  73   GRFDMQLKLIPGNSAGTVATFY  94



>ref|XP_011082928.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X2 [Sesamum indicum]
Length=274

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A F DS  + SN + L + I  + +A A A +FY+DA++ +G+GR ++L+GG+M+ L L
Sbjct  1    MAMFSDSG-ALSNLMMLLLAILVANIATA-AADFYRDAEITWGDGRAKILEGGRMLTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D++SGSGFQSKNEYLFGRFD+QLKLVPGNSAGTVTTF+
Sbjct  59   DQQSGSGFQSKNEYLFGRFDLQLKLVPGNSAGTVTTFF  96



>ref|XP_009602932.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana tomentosiformis]
Length=291

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K+ +  ++ ASL AVA AGNFY  A + +G GRG++ +GG+ ++L LDK SGSGFQSKNE
Sbjct  8    KMLILPIVMASLWAVASAGNFYNLADITWGEGRGKITEGGRGLSLSLDKFSGSGFQSKNE  67

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  68   YLFGRFDMQLKLVPGNSAGTVTTFF  92



>gb|ABD96607.1| xyloglucan endotransglucosylase XET1 [Capsicum annuum]
Length=287

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 5/85 (6%)
 Frame = +3

Query  186  MMIAASLVAVAL-----AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            M++  S++AV L     A NFYQD  + FG+ R Q+ DGG+++AL LDK SGSGFQSKNE
Sbjct  1    MLLQLSILAVLLLYPVWADNFYQDTTVTFGDQRAQIQDGGRILALSLDKISGSGFQSKNE  60

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFGRFDMQLKLVPGNSAGTVTTFY
Sbjct  61   YLFGRFDMQLKLVPGNSAGTVTTFY  85



>gb|EMS61840.1| Xyloglucan endotransglucosylase/hydrolase protein 24 [Triticum 
urartu]
Length=233

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQ  377
            A LVAVA  GNF QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK+EYLFG+ DMQ
Sbjct  2    ACLVAVARGGNFIQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKSEYLFGKIDMQ  61

Query  378  LKLVPGNSAGTVTTFY  425
            +KLVPGNSAGTVTTFY
Sbjct  62   IKLVPGNSAGTVTTFY  77



>ref|XP_011082926.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Sesamum indicum]
Length=292

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A F DS  + SN + L + I  + +A A A +FY+DA++ +G+GR ++L+GG+M+ L L
Sbjct  1    MAMFSDSG-ALSNLMMLLLAILVANIATA-AADFYRDAEITWGDGRAKILEGGRMLTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D++SGSGFQSKNEYLFGRFD+QLKLVPGNSAGTVTTF+
Sbjct  59   DQQSGSGFQSKNEYLFGRFDLQLKLVPGNSAGTVTTFF  96



>ref|XP_009598225.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  341
            SS  L LC++++  L+A A AGNFY D  + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSAMLLLCILMSIQLLA-ASAGNFYGDTVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  342  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>ref|XP_009390494.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++A SLVAVA AGNFYQD  + +G+GR ++L+ G ++ L LDK SGSGFQSKNEYLFG+ 
Sbjct  7    LLACSLVAVASAGNFYQDFDITWGDGRAKILNNGHLLTLSLDKASGSGFQSKNEYLFGKI  66

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQ+KLVPGNSAGTVT +Y
Sbjct  67   DMQIKLVPGNSAGTVTAYY  85



>ref|XP_009758414.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana sylvestris]
Length=291

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K+ +  ++ ASL A A AGNFY  A + +G GRG++ +GG+ ++L LDK SGSGFQSKNE
Sbjct  8    KMLILPIVMASLWAAASAGNFYNLADITWGEGRGKITEGGRGLSLSLDKLSGSGFQSKNE  67

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  68   YLFGRFDMQLKLVPGNSAGTVTTFF  92



>ref|XP_011082921.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  FPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            F + K ++++ L   +++ AS  A + AGNFY+DA++ +G+GR ++L+GG+ ++L LD+ 
Sbjct  4    FSNPKFAANSVLLSAVVVLASFAAPS-AGNFYRDAEITWGDGRAKILEGGRGLSLSLDQY  62

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQSKNEYLFGRFD+QLKLVPGNSAGTVTTF+
Sbjct  63   SGSGFQSKNEYLFGRFDLQLKLVPGNSAGTVTTFF  97



>ref|XP_010259797.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=290

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +3

Query  183  CMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFG  362
            C++I +SL   AL+GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNE+LFG
Sbjct  14   CLVILSSLTVSALSGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEFLFG  73

Query  363  RFDMQLKLVPGNSAGTVTTFY  425
            + DMQLKLVPGNSAGTVT +Y
Sbjct  74   KIDMQLKLVPGNSAGTVTAYY  94



>ref|NP_001058455.2| Os06g0696400 [Oryza sativa Japonica Group]
 dbj|BAF20369.2| Os06g0696400 [Oryza sativa Japonica Group]
Length=259

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQ  377
            A LVA+A  GNF+QDA++ +G GRG+++DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ
Sbjct  2    ACLVAIAHGGNFFQDAEVSWGQGRGKIVDGGRGLDLTLDRSSGSGFQSKSEYLFGKIDMQ  61

Query  378  LKLVPGNSAGTVTTFY  425
            +KLVPGNSAGTVTTFY
Sbjct  62   IKLVPGNSAGTVTTFY  77



>ref|XP_009762866.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009762867.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009762869.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X3 [Nicotiana sylvestris]
Length=290

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 4/91 (4%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVAL----AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSG  332
            ++K+   M++ + L+++ L    AGNFY+DA + +G GRG++ +GG+ +AL LDK SGSG
Sbjct  2    ASKVSTAMLLLSVLMSIQLLAASAGNFYRDAVITWGEGRGKIQEGGRGLALTLDKLSGSG  61

Query  333  FQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            FQSKNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  62   FQSKNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>ref|XP_010929301.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=281

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++A SL+ +A AGNFYQD  + +G GR ++LD  +++ L LDK SGSGFQSKNEYLFG+ 
Sbjct  8    LLACSLMTIAWAGNFYQDFDITWGEGRAKILDNAQLLTLSLDKSSGSGFQSKNEYLFGKI  67

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQLKLVPGNSAGTVT +Y
Sbjct  68   DMQLKLVPGNSAGTVTAYY  86



>ref|XP_006366771.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
 ref|XP_006366772.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
Length=287

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  219  LAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGN  398
             A NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGN
Sbjct  17   WADNFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGN  76

Query  399  SAGTVTTFY  425
            SAGTVTTFY
Sbjct  77   SAGTVTTFY  85



>ref|XP_006656424.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Oryza brachyantha]
Length=290

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++  A LVAVA  GNF+QDA++ +G  RG+++DGG+ + L LD+ SGSGFQSKNEYLFG+
Sbjct  9    IVAMACLVAVAQGGNFFQDAEISWGQDRGKIVDGGRGLDLTLDRSSGSGFQSKNEYLFGK  68

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQ+KLVPGNSAGTVTTFY
Sbjct  69   IDMQIKLVPGNSAGTVTTFY  88



>dbj|BAD53910.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD54446.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 gb|EAZ02220.1| hypothetical protein OsI_24315 [Oryza sativa Indica Group]
 gb|EAZ38140.1| hypothetical protein OsJ_22491 [Oryza sativa Japonica Group]
 dbj|BAG89831.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97023.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L ++  A LVA+A  GNF+QDA++ +G GRG+++DGG+ + L LD+ SGSGFQSK+EYLF
Sbjct  6    LGIVAMACLVAIAHGGNFFQDAEVSWGQGRGKIVDGGRGLDLTLDRSSGSGFQSKSEYLF  65

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQ+KLVPGNSAGTVTTFY
Sbjct  66   GKIDMQIKLVPGNSAGTVTTFY  87



>ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            P    SS+    L M +  S +  A AGNFYQD  + +G+GRG++L+ G+++ L LDK S
Sbjct  3    PICSSSSAVSTALLMSVVVSFLMAASAGNFYQDFDITWGDGRGKILNNGELLTLSLDKPS  62

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  96



>ref|NP_001234213.1| xyloglucan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58003.1| xyloglucan endo-transglycosylase [Solanum lycopersicum]
Length=289

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  219  LAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGN  398
             A NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGN
Sbjct  19   WADNFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGN  78

Query  399  SAGTVTTFY  425
            SAGTVTTFY
Sbjct  79   SAGTVTTFY  87



>ref|XP_006657289.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Oryza brachyantha]
Length=288

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S+   L + M + + L+  A AGNFYQD  + +G+GRG++L  G+++ L LD+ SGSGFQ
Sbjct  5    STGRALAVAMTLCSVLLLAAAAGNFYQDVDITWGDGRGKILGDGQLLTLSLDRSSGSGFQ  64

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKN+YL+GRFDMQ+KLVPGNSAGTV TFY
Sbjct  65   SKNQYLYGRFDMQIKLVPGNSAGTVATFY  93



>ref|XP_009381589.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Musa acuminata subsp. malaccensis]
Length=282

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SS      C  +A  L ++ALAGNFYQD  + +G+ R ++LD G+++ L LDK SGSGFQ
Sbjct  3    SSRASTAACFFLALCLSSIALAGNFYQDVDITWGDARAKILDDGQLLMLSLDKYSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S+N+YL+G+FDMQLKLVPG+SAGTV TFY
Sbjct  63   SRNQYLYGKFDMQLKLVPGDSAGTVATFY  91



>ref|NP_001058457.1| Os06g0696600 [Oryza sativa Japonica Group]
 dbj|BAD53913.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD54449.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAF20371.1| Os06g0696600 [Oryza sativa Japonica Group]
 gb|EAZ38142.1| hypothetical protein OsJ_22493 [Oryza sativa Japonica Group]
 dbj|BAG97451.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 73/95 (77%), Gaps = 5/95 (5%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVAL-----AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            +SSSN  +   ++AA + +V L     AGNFYQD  + +G+GRG++L  G+++ L LD+ 
Sbjct  2    VSSSNPGRTPPLVAAIVCSVLLLAGGAAGNFYQDVDITWGDGRGKILGNGQLLTLSLDRS  61

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQSKN+YL+GRFDMQ+KLVPGNSAGTV TFY
Sbjct  62   SGSGFQSKNQYLYGRFDMQIKLVPGNSAGTVATFY  96



>ref|XP_002536055.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26328.1| conserved hypothetical protein [Ricinus communis]
Length=97

 Score =   110 bits (275),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P    S +  L   +++  SL+ VA  GN YQD  + +G+GRG++L+ G ++ L L
Sbjct  1    MATYPCPPNSLTLLLITSLVMVGSLMVVA--GNIYQDVDITWGDGRGKILNNGNVVTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            DK SGSGFQSKNEYLFG+FDMQLKLVPGNSAGTVT FY
Sbjct  59   DKASGSGFQSKNEYLFGKFDMQLKLVPGNSAGTVTIFY  96



>ref|XP_008341405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=294

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L + I + +   A AGNFYQD  + FG+GR ++LDGGK++ L LD+ SGSGF+SKNEY
Sbjct  11   LFLSLFINSLMAMAAQAGNFYQDFDVTFGDGRAKILDGGKLLTLNLDQVSGSGFKSKNEY  70

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGR DMQ+KLVPGNSAGTVTT+Y
Sbjct  71   LFGRIDMQIKLVPGNSAGTVTTYY  94



>ref|XP_006348946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M++S+ L + +++  SLVAV  AGNF    ++ +G+GRG++LDGGK ++L LDK SGSGF
Sbjct  1    MANSHLLLISIVLMGSLVAVLAAGNFNDLTEITWGDGRGKILDGGKGLSLSLDKLSGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYL+GRFDMQ+K VP NSAGTVTTF+
Sbjct  61   QSKNEYLYGRFDMQIKFVPRNSAGTVTTFF  90



>ref|XP_008801408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=283

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++  SL+A A AGNF+QD Q+ +G GR Q+L+ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  6    LLLVCSLMAGASAGNFHQDFQITWGEGRAQILENGQLLTLSLDKASGSGFQSKNEYLFGK  65

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  66   IDMQLKLVPGNSAGTVTAYY  85



>ref|XP_004966139.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Setaria italica]
Length=294

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 7/97 (7%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVAL-------AGNFYQDAQMYFGNGRGQVLDGGKMIALKLD  314
            M+S  KL   + +     AV L       AGNFYQD  + +G+GRG++LDGG+++ L +D
Sbjct  5    MASGPKLMRTVALGVLCSAVLLLAGGASAAGNFYQDVDITWGDGRGKILDGGQLLTLSMD  64

Query  315  KESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            + SGSGFQSKN+YL+GRFDMQLKLVPG+SAGTVTTFY
Sbjct  65   RSSGSGFQSKNQYLYGRFDMQLKLVPGDSAGTVTTFY  101



>gb|EAZ02222.1| hypothetical protein OsI_24317 [Oryza sativa Indica Group]
Length=288

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVAL-----AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            SSSN  +   ++AA + +V L     AGNFYQD  + +G+GRG++L  G+++ L LD+ S
Sbjct  3    SSSNPGRTPPLVAAIVCSVLLLAGGAAGNFYQDVDITWGDGRGKILGNGQLLTLSLDRSS  62

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKN+YL+GRFDMQ+KLVPGNSAGTV TFY
Sbjct  63   GSGFQSKNQYLYGRFDMQIKLVPGNSAGTVATFY  96



>ref|XP_003625289.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES81507.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK49301.1| unknown [Medicago truncatula]
Length=282

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++I  S VA+A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  9    LVILISTVAIASAGNFYQDFDITWGDGRAKILNNGQLLTLSLDKSSGSGFQSKNEYLFGK  68

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  69   IDMQLKLVPGNSAGTVTAYY  88



>ref|XP_003610142.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92339.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=283

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            +K    ++I  S VA+A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKN
Sbjct  4    SKFVTFLVIFISTVAIASAGNFYQDFDITWGDGRAKILNSGQLLTLSLDKSSGSGFQSKN  63

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   EYLFGKIDMQLKLVPGNSAGTVTAYY  89



>ref|XP_004243230.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Solanum lycopersicum]
Length=290

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M++S+ L + +++  +LVAV  AGNF    ++ +G+GRG++LDGGK ++L LD  SGSGF
Sbjct  1    MANSHLLLISIVLMGNLVAVLAAGNFNDLTEITWGDGRGKILDGGKGLSLSLDNYSGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYL+GRFDMQLKLVP NSAGTVTTF+
Sbjct  61   QSKNEYLYGRFDMQLKLVPKNSAGTVTTFF  90



>ref|NP_001266903.1| XET precursor [Zea mays]
 gb|ADB54615.1| XET [Zea mays]
Length=290

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            M ++A +  +A  GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+
Sbjct  10   MAVSACIACIAHGGNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYLFGK  69

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             +MQ+KLVPGNSAGTVTT Y
Sbjct  70   IEMQMKLVPGNSAGTVTTLY  89



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++A  L+A A AGNFYQ+  + +G+GRG++LD G+++ L LDK SGSGFQSKNEYLFG+ 
Sbjct  8    LLACFLMATASAGNFYQEFDITWGDGRGKILDNGQLLTLALDKASGSGFQSKNEYLFGKI  67

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQLKLVPGNSAGTVT +Y
Sbjct  68   DMQLKLVPGNSAGTVTAYY  86



>emb|CDP18875.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   111 bits (278),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L   I AS +  A AGNFYQD    FG+ R ++L+GG+++ L LDK SGSGFQSKNEYLF
Sbjct  13   LQFTIIASFLLAAYAGNFYQDVAQTFGDQRFKILEGGQLLTLSLDKTSGSGFQSKNEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFDMQLKL+ GNSAGTV TFY
Sbjct  73   GRFDMQLKLISGNSAGTVATFY  94



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            + + + + L+A A AGNFYQD  + +G+ R Q+L+GG+++ L LDK SGSGFQSKNEYLF
Sbjct  7    ITLFMVSWLMAAATAGNFYQDFDITWGDHRAQILNGGQLLTLNLDKASGSGFQSKNEYLF  66

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GR DMQ+KLVPGNSAGTVT +Y
Sbjct  67   GRIDMQIKLVPGNSAGTVTAYY  88



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++A SL+A+A AGNF++D Q+ +G+GR ++LD G+ + L LDK SGSGFQSKNEYLFG+ 
Sbjct  20   LLACSLMAIASAGNFHRDFQITWGDGRAKILDNGQHLTLSLDKASGSGFQSKNEYLFGKI  79

Query  369  DMQLKLVPGNSAGTVTTFY  425
             MQLKLVPGNSAGTVT +Y
Sbjct  80   HMQLKLVPGNSAGTVTAYY  98



>ref|XP_007014176.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31795.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=293

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 72/95 (76%), Gaps = 2/95 (2%)
 Frame = +3

Query  147  DSKMSSSNKLQLCMM--IAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            D+  S  N L++ ++  +      VA AGNFYQD  + +G+GRG++L+ G+++ L LDK 
Sbjct  2    DTVSSHPNALEMFLITFLIVETFMVASAGNFYQDVDITWGDGRGKILNSGQLLTLSLDKA  61

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQS+NEYL+G+FDMQLKLVPGNSAGTVT +Y
Sbjct  62   SGSGFQSRNEYLYGKFDMQLKLVPGNSAGTVTAYY  96



>ref|XP_010046990.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78731.1| hypothetical protein EUGRSUZ_C00175 [Eucalyptus grandis]
Length=297

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +3

Query  141  FPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            FP + M     L +C ++  S V VALAGNFYQD  + FG+GR +VLD G+++ L LDK 
Sbjct  10   FPRTTM-----LVVCAILIGSSV-VALAGNFYQDFDVTFGDGRVKVLDNGQLVTLSLDKA  63

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGF+SKN+YL+G+FD Q+KLVPGNSAGTVTT Y
Sbjct  64   SGSGFKSKNQYLYGKFDTQIKLVPGNSAGTVTTLY  98



>gb|KDP36435.1| hypothetical protein JCGZ_08704 [Jatropha curcas]
Length=286

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +3

Query  162  SSNKLQLCMMIA--ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            + +++ L +++A  +SL+ VAL GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGF
Sbjct  2    APSRVSLLLLLAYFSSLILVALGGNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGF  61

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QS+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  62   QSRNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|NP_001234207.1| xyloglycan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58002.1| xyloglycan endo-transglycosylase [Solanum lycopersicum]
Length=287

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNS  401
            A NFYQDA + FG+ R Q+ DGG+++ L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNS
Sbjct  18   ADNFYQDAAVTFGDQRAQIQDGGRLLTLSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNS  77

Query  402  AGTVTTFY  425
            AGTVTTFY
Sbjct  78   AGTVTTFY  85



>ref|XP_009356633.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 75/94 (80%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLCMMIA---ASLVAVAL-AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            MS S+K+ + + ++    SL+A+A  AGNFYQD  + FG+GR ++LD GK++ L LD+ S
Sbjct  1    MSYSSKVSMILFLSLFINSLMAMAAQAGNFYQDFDITFGDGRAKILDRGKLLTLNLDQVS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGF+SKNEYLFGR DMQ+KLVPGNSAGTVTT+Y
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVPGNSAGTVTTYY  94



>ref|XP_011082929.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Sesamum indicum]
Length=199

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNS  401
            A +FY+DA++ +G+GR ++L+GG+M+ L LDK SGSGFQSKNEYLFGRFD+QLKLVPG+S
Sbjct  67   AADFYRDAEITWGDGRAKILEGGRMLTLSLDKNSGSGFQSKNEYLFGRFDLQLKLVPGDS  126

Query  402  AGTVTTFY  425
            AGTVTTF+
Sbjct  127  AGTVTTFF  134



>ref|NP_001274880.1| probable xyloglucan endotransglucosylase/hydrolase protein 15-like 
precursor [Solanum tuberosum]
 emb|CAJ77496.1| putative xyloglucan endotransglycosylase precursor [Solanum tuberosum]
Length=287

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  219  LAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGN  398
             A NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGN
Sbjct  17   WADNFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGN  76

Query  399  SAGTVTTF  422
            SAGTVTTF
Sbjct  77   SAGTVTTF  84



>ref|XP_007223211.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
 gb|EMJ24410.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
Length=296

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L  ++AAS + VA AGNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLF
Sbjct  13   LIALLAASSLVVASAGNFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQLKLVPGNSAGTVT +Y
Sbjct  73   GKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_008799438.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=280

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L +++A  L+A+A AGNFYQ+  + +G+GRG++LD G+++ L L+K SGSGF+SKNEYLF
Sbjct  5    LFLLLACHLMAIASAGNFYQEFDITWGDGRGKILDNGQLLTLSLNKASGSGFESKNEYLF  64

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G  DMQLKLVPGNSAGTVT +Y
Sbjct  65   GEIDMQLKLVPGNSAGTVTAYY  86



>ref|XP_011082922.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  FPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            F + K ++++ L    ++ A   A++ AGNFY+DA++ +G+GR ++L+GG+ ++L LD+ 
Sbjct  4    FTNPKFAANSVLLSAFVVLACFAALS-AGNFYRDAEITWGDGRAKILEGGRGLSLSLDQY  62

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQSKNEYL+GRFD+QLKLVPGNSAGTVTTF+
Sbjct  63   SGSGFQSKNEYLYGRFDLQLKLVPGNSAGTVTTFF  97



>ref|XP_008449534.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC+++A+  +  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+
Sbjct  12   LPLCVLMAS--IMTATAGNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEF  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMKLVPGNSAGTVTTFY  93



>ref|XP_002536698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF25685.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P    S +  L   +++  SL+ VA  GN YQD  + +G+GRG++L+ G ++ L L
Sbjct  1    MATYPCPPNSLTLLLITSLVMVGSLMVVA--GNIYQDVDITWGDGRGKILNNGNVVTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            DK SGSGFQSKNEYLFG+FDMQLKLVPGNSAGTVT FY
Sbjct  59   DKASGSGFQSKNEYLFGKFDMQLKLVPGNSAGTVTIFY  96



>emb|CDP12751.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + I AS +  A AGNFYQD    FG+ R  +L+GG++  L LDK SGSGFQSKNEYLF
Sbjct  13   LQISIIASFLLAAYAGNFYQDVAQTFGDQRFNILEGGQLFMLSLDKTSGSGFQSKNEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRF+MQLKL+PGNSAGTV TFY
Sbjct  73   GRFNMQLKLIPGNSAGTVATFY  94



>gb|AGI42457.1| mutant xyloglucan endotransglycosylase/hydrolase [Neolamarckia 
cadamba]
Length=182

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S  N + +     + LV++A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQ
Sbjct  3    SHLNSIPIVFFAFSLLVSLAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   SRNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_010046993.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046995.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78736.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78737.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78738.1| hypothetical protein EUGRSUZ_C00181 [Eucalyptus grandis]
Length=291

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S  A A A NFYQD  + +G+GR Q+L+ G ++ L LDK S
Sbjct  1    MASRSTSSLCTTALLLLVVSWAASAFARNFYQDFDITWGDGRAQILNSGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M+ S    L + IA S + VA A NFYQD  + +G+GRG++L+ G++++L LDK SGSGF
Sbjct  1    MAYSKNFTLLISIAISSLMVASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSK+EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   QSKSEYLFGKIDMQLKLVPGNSAGTVTAYY  90



>gb|ABD96608.1| xyloglucan endotransglucosylase XET2 [Capsicum annuum]
Length=288

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  228  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  407
            NFYQDA + FG+ R Q+ DGG++ AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  21   NFYQDATVTFGDQRAQIQDGGRVFALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  80

Query  408  TVTTFY  425
            TVTTFY
Sbjct  81   TVTTFY  86



>ref|XP_008223658.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
 ref|XP_008223659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
Length=286

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L  ++AAS + VA AGNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLF
Sbjct  13   LIALLAASFMVVANAGNFNQDFQITWGDGRAKILNNGELLTLLLDKASGSGFQSKNEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQLKLVPGNSAGTVT +Y
Sbjct  73   GKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_009341025.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341027.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341030.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=293

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            +SSS  + L  ++  SL+ VA AGNFYQD Q+ +G+GRG++L+ G+++ L LDK SGSGF
Sbjct  5    LSSSGYILLFSLMVTSLM-VASAGNFYQDIQVTWGDGRGKILNNGELLTLSLDKSSGSGF  63

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QS N+YLFG+ DMQ+K VPGNSAGTVTT+Y
Sbjct  64   QSTNQYLFGKIDMQIKFVPGNSAGTVTTYY  93



>gb|AFW69276.1| xyloglucan endotransglucosylase/hydrolase protein 23 [Zea mays]
Length=290

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  180  LCMM-IAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYL  356
            +C + ++A +  +A  GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYL
Sbjct  7    VCFVAVSACIACIAHGGNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYL  66

Query  357  FGRFDMQLKLVPGNSAGTVTTFY  425
            FG+ +MQ+KLVPGNSAGTVTT Y
Sbjct  67   FGKIEMQMKLVPGNSAGTVTTLY  89



>ref|NP_001149503.1| LOC100283129 precursor [Zea mays]
 gb|ACG35648.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
Length=290

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  180  LCMM-IAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYL  356
            +C + ++A +  +A  GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYL
Sbjct  7    VCFVAVSACIACIAHGGNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYL  66

Query  357  FGRFDMQLKLVPGNSAGTVTTFY  425
            FG+ +MQ+KLVPGNSAGTVTT Y
Sbjct  67   FGKIEMQMKLVPGNSAGTVTTLY  89



>ref|XP_011082925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L   +  +  A   AGNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYLF
Sbjct  17   LSAFVVLACFAAPSAGNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLF  76

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+QLKLVPGNSAGTVTTF+
Sbjct  77   GRFDLQLKLVPGNSAGTVTTFF  98



>gb|EYU25733.1| hypothetical protein MIMGU_mgv1a011641mg [Erythranthe guttata]
Length=275

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K+ + + +  S VA A+ GNF QD  + +G GR ++LD GK++ L LDK SGSGF+SKN+
Sbjct  2    KIHVLLSVLLSFVAAAICGNFNQDFDITWGEGRAKILDNGKLLTLSLDKASGSGFRSKNQ  61

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFG+ DMQ+KLVPGNSAGTVTT+Y
Sbjct  62   YLFGKIDMQIKLVPGNSAGTVTTYY  86



>ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            P    SS+    L + +  S +  A AGNFYQD  + +G+GR ++LD G+ + L LDK S
Sbjct  3    PIYSSSSAVSTALLISVVVSFLMAASAGNFYQDFGITWGDGRAKILDNGEFLTLSLDKTS  62

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  96



>ref|XP_010046998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S    A A NFYQD  + +G+GRGQ+L+ G ++ L LDK S
Sbjct  1    MASRSTSSLCRAALLLMVVSWATSASARNFYQDFDITWGDGRGQILNNGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_010656826.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + + AS +  A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLF
Sbjct  15   LLISVVASFLMAASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLF  74

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQLKLVPGNSAGTVT +Y
Sbjct  75   GKIDMQLKLVPGNSAGTVTAYY  96



>ref|XP_007224386.1| hypothetical protein PRUPE_ppa021675mg [Prunus persica]
 gb|EMJ25585.1| hypothetical protein PRUPE_ppa021675mg [Prunus persica]
Length=299

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            P SK  S   L LC  I  SLVAVA A NF QD ++ +G+GRG++L+  +++ L LDK S
Sbjct  6    PPSKYFSLVVLVLCF-IVGSLVAVASASNFNQDFEITWGDGRGKILNNNELLMLSLDKGS  64

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQS NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  65   GSGFQSTNEYLFGKIDMQLKLVPGNSAGTVTAYY  98



>ref|XP_009597028.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=300

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            LQL ++ A  L+  A A NFYQDA + +G+ R  + +GG+++ L LDK SGSGFQSK+E+
Sbjct  15   LQLSVL-AVFLLCTACADNFYQDATVTWGDQRAHIQEGGRLLTLSLDKISGSGFQSKSEF  73

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFDMQLKL+PGNSAGTVTTFY
Sbjct  74   LFGRFDMQLKLIPGNSAGTVTTFY  97



>ref|XP_008801539.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=284

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++A+ L+A A AGNFYQ   + +G+GRG++LD G+++ L LD+ SGSGFQSKNEYLFG+ 
Sbjct  15   LLASFLIATASAGNFYQGFDITWGDGRGKILDNGQLLTLALDEASGSGFQSKNEYLFGKI  74

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQLKLVPGNSAGTVT +Y
Sbjct  75   DMQLKLVPGNSAGTVTAYY  93



>gb|ADP94235.2| xyloglucan endotransglucosylase [Cenchrus americanus]
Length=291

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  SLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQL  380
             L   A  GNFYQD +M +G+GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+
Sbjct  17   ELAGTAQGGNFYQDTEMTWGDGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQI  76

Query  381  KLVPGNSAGTVTTFY  425
            KLVPGNSAGTVTTFY
Sbjct  77   KLVPGNSAGTVTTFY  91



>ref|XP_010102169.1| Brassinosteroid-regulated protein BRU1 [Morus notabilis]
 gb|EXB92419.1| Brassinosteroid-regulated protein BRU1 [Morus notabilis]
Length=231

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            SN   + + I + L+A A A NFY+D  + +G+ R Q+L+GG+++ L LDK SGSGFQSK
Sbjct  2    SNMPLISLFIVSCLMAAASASNFYRDFDITWGDRRAQILNGGQLLTLNLDKASGSGFQSK  61

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEYLFGR DMQ+KLVP NSAGTVT +Y
Sbjct  62   NEYLFGRIDMQIKLVPENSAGTVTAYY  88



>ref|XP_010913701.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=291

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L +  ++A+SLV VA  GNFYQD  + +G+GR ++LD G+++ L LDK SGSGFQSKNEY
Sbjct  13   LLVSFVLASSLVIVAYGGNFYQDFDITWGDGRAKILDNGELLTLSLDKASGSGFQSKNEY  72

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LF    MQLKLVPGNSAGTVT +Y
Sbjct  73   LFAEISMQLKLVPGNSAGTVTAYY  96



>ref|XP_011083272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Sesamum indicum]
Length=278

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A FPDS   S+  + L  ++ A     A   +FY+DA++ +G+GR ++L+GG+M+ L L
Sbjct  1    MATFPDSGALSNLSMLLLSILVAYFATAA--ADFYRDAEITWGDGRAKILEGGRMLTLLL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEY+FGRFD+QLKLVPGNSAGTVTTF+
Sbjct  59   DQNSGSGFQSKNEYMFGRFDLQLKLVPGNSAGTVTTFF  96



>ref|NP_001151103.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 gb|ACG41635.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
Length=294

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  SLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQL  380
             L   A  GNFYQD +M +G+GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+
Sbjct  17   ELAGTAQGGNFYQDTEMTWGDGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQI  76

Query  381  KLVPGNSAGTVTTFY  425
            KLVPGNSAGTVTTFY
Sbjct  77   KLVPGNSAGTVTTFY  91



>ref|XP_010927057.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=279

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A SL+  A AGN YQD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  6    LLLAFSLMTGASAGNLYQDFQITWGDGRAKILENGQLLTLSLDKASGSGFQSKNEYLFGK  65

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  66   IDMQLKLVPGNSAGTVTAYY  85



>gb|EPS58668.1| hypothetical protein M569_16144, partial [Genlisea aurea]
Length=273

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 62/79 (78%), Gaps = 1/79 (1%)
 Frame = +3

Query  189  MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRF  368
            ++   LVA A A NFY D  + +G+GR Q+LD G  + L LDK SGSGFQS+N+YLFGRF
Sbjct  4    LVVCVLVATA-AANFYSDVDVTWGDGRAQILDSGNELTLSLDKSSGSGFQSRNQYLFGRF  62

Query  369  DMQLKLVPGNSAGTVTTFY  425
            DMQLKLVPGNSAGTVTTF+
Sbjct  63   DMQLKLVPGNSAGTVTTFF  81



>ref|XP_008223719.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Prunus mume]
Length=301

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            P SK   S    +   I  SLVAVA A NF QD ++ +G+GRG++LD  +++ L LDK S
Sbjct  6    PPSKYRFSLVCLVLCFIVGSLVAVASASNFNQDFEITWGDGRGKILDNNELLMLSLDKGS  65

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQS NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   GSGFQSTNEYLFGKIDMQLKLVPGNSAGTVTAYY  99



>ref|NP_001284418.1| brassinosteroid-regulated protein BRU1-like precursor [Cucumis 
melo]
 gb|ABI94061.1| xyloglucan endotransglucosylase/hydrolase 1 [Cucumis melo]
Length=290

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC+++A+  +  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+
Sbjct  12   LLLCVLMAS--IMTASAGNFLQDVDVTWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEF  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMKLVPGNSAGTVTTFY  93



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L +   +SL+  AL GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQS+NEY
Sbjct  8    LLLLLTYFSSLILAALGGNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEY  67

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  68   LFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_009344504.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=293

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            +SSS+ + L  ++  SL+ VA AGNFYQD Q+ +G+GRG++ + G+++ L LDK SGSGF
Sbjct  5    LSSSSYILLFSLMVTSLM-VASAGNFYQDIQVTWGDGRGKIQNNGELLTLSLDKSSGSGF  63

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QS N+YLFG+ DMQ+K VPGNSAGTVTT+Y
Sbjct  64   QSTNQYLFGKIDMQIKFVPGNSAGTVTTYY  93



>ref|XP_011082923.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L   +  +  A   AGNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYL+
Sbjct  17   LSAFVVLACFAAPSAGNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLY  76

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+QLKLVPGNSAGTVTTF+
Sbjct  77   GRFDLQLKLVPGNSAGTVTTFF  98



>emb|CAN80251.1| hypothetical protein VITISV_036641 [Vitis vinifera]
Length=287

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            LQ+ ++I  S +A A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEY
Sbjct  14   LQVSLII--SFLAAASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEY  71

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  72   LFGKIDMQIKLVPGNSAGTVTAYY  95



>ref|XP_010259807.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=301

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K   C+++  SL  VA A NFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSK+E
Sbjct  14   KFLSCLLVLGSLAIVASASNFYQDFDVSWGDGRAKILNNGELLTLSLDKASGSGFQSKHE  73

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFG+ D+QLKLVPGNSAGTVT +Y
Sbjct  74   YLFGKIDIQLKLVPGNSAGTVTAYY  98



>ref|XP_010670335.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++ AS + VA AGNF++D  + +G+GRG++L+ G+ + L LDK SGSGFQS+NEYLFG+
Sbjct  8    LLLIASSIVVASAGNFHRDFDITWGDGRGKILNSGRQLTLSLDKTSGSGFQSRNEYLFGK  67

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  68   IDMQLKLVPGNSAGTVTAYY  87



>ref|XP_010103021.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 gb|EXB94588.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
Length=297

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L + +  ++SLV VA AGN YQD  + +G+GRG++ + GK++ L LDK SGSGFQSKNEY
Sbjct  11   LAILVAFSSSLVLVAFAGNLYQDFDITWGDGRGKMDNNGKVLTLSLDKASGSGFQSKNEY  70

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  71   LFGKIDMQVKLVPGNSAGTVTAYY  94



>ref|XP_002526224.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36165.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=295

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P    S +  L   +++  SL+ VA  GNFYQD  + +G+ RG++L+ G ++ L L
Sbjct  1    MAAYPCQPNSLTLLLITSLVMVGSLMVVA--GNFYQDVDITWGDERGKMLNNGNVVTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            DK SGSGFQSKNEYLFG+FDMQLKLVPGNSAGTVTTFY
Sbjct  59   DKASGSGFQSKNEYLFGKFDMQLKLVPGNSAGTVTTFY  96



>ref|XP_002536265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26118.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P    S +  L   +++  SL+ VA  GN YQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MATYPCPPNSLTLLLITSLVMVGSLMVVA--GNIYQDVDITWGDGRDKILNNGNVVTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            DK SGSGFQSKNEYLFG+FDMQLKLVPGNSAGTVT FY
Sbjct  59   DKASGSGFQSKNEYLFGKFDMQLKLVPGNSAGTVTIFY  96



>gb|ABL10090.1| xyloglucan endotransglycosylase [Musa acuminata]
Length=280

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A SLVA+A AGNFYQ+  + +G  R + LD G+++ L LDK SGSGFQSKN+YLFG+
Sbjct  6    LLVACSLVAIASAGNFYQEFDVTWGGDRAKNLDNGQLLTLSLDKASGSGFQSKNQYLFGK  65

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQ+KLVPGNSAGTVT +Y
Sbjct  66   IDMQIKLVPGNSAGTVTAYY  85



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S  N + +     + LV++A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQ
Sbjct  3    SHLNSIPIVFFAFSLLVSLAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   SRNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>emb|CDP16009.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +3

Query  186  MMIAASLV----AVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            + + ASLV     VA AGNFYQD  + FG+GR Q+L  GK++ L LDK SGSGF+SKN+Y
Sbjct  5    LSVKASLVLSFFVVAFAGNFYQDFDITFGDGRAQILQNGKLLTLSLDKTSGSGFRSKNQY  64

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ D+Q+KLVPGNSAGTVTT+Y
Sbjct  65   LFGKIDIQMKLVPGNSAGTVTTYY  88



>ref|XP_009401564.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=280

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A SLVA+A AGNFYQ+  + +G  R + LD G+++ L LDK SGSGFQSKN+YLFG+
Sbjct  6    LLVACSLVAIASAGNFYQEFDVTWGGDRAKNLDNGQLLTLSLDKASGSGFQSKNQYLFGK  65

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQ+KLVPGNSAGTVT +Y
Sbjct  66   IDMQIKLVPGNSAGTVTAYY  85



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S  N + +     + LV++A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQ
Sbjct  3    SHLNSIPIVFFAFSLLVSLAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   SRNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_007014179.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
 gb|EOY31798.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
Length=282

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M SS  L + M++  S V VA A NFYQD  + +G+ RG++L+ G+++ L LDK SGSGF
Sbjct  1    MRSSFGLLVAMLV--SFVLVASAANFYQDFDLTWGDARGKILNNGQLLTLTLDKFSGSGF  58

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  59   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  88



>ref|XP_011082930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Sesamum indicum]
Length=281

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L M+IA  +   A  GNFY+D  + +G+GRG++++GG+ + L LD+ SGSGFQSKNEY
Sbjct  3    LSLSMIIACFITPSA--GNFYKDVNVNWGDGRGKIVEGGRGLTLLLDQYSGSGFQSKNEY  60

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFDMQL+L+PGNSAGTVTTF+
Sbjct  61   LFGRFDMQLRLIPGNSAGTVTTFF  84



>ref|XP_002262761.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Vitis vinifera]
Length=281

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSSN+     ++ A ++A A AGNFYQD  + +G+ R ++ +GG++++L LDK SGSGFQ
Sbjct  3    SSSNRYSFFCLVFAMVLATASAGNFYQDFDITWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SK EYLFGR DMQLKLV GNSAGTVT +Y
Sbjct  63   SKKEYLFGRIDMQLKLVAGNSAGTVTAYY  91



>ref|XP_008449531.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
 ref|XP_008449532.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=291

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC+++A+  +  A AGNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+
Sbjct  12   LPLCVLMAS--IMTATAGNFLQDVDVTWGGPRAKILDRGRHLSLSLDKDSGSGFQSKQEF  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMKLVPGNSAGTVTTFY  93



>gb|AFW69275.1| hypothetical protein ZEAMMB73_374893 [Zea mays]
Length=394

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  210  AVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLV  389
            A +  GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLV
Sbjct  114  AASAGGNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLV  173

Query  390  PGNSAGTVTTFY  425
            PG+SAGTV TFY
Sbjct  174  PGDSAGTVATFY  185



>ref|XP_009356706.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=292

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            LC +  + +  VA AGNFYQD ++ FG+   +VL+ G++I L LDK SG+GF+SKN YLF
Sbjct  12   LCSITISLVAIVASAGNFYQDYEVMFGDQHAKVLENGQIITLALDKSSGAGFKSKNAYLF  71

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFDMQ+KL PGNSAGTVTTFY
Sbjct  72   GRFDMQIKLQPGNSAGTVTTFY  93



>ref|XP_008799439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Phoenix dactylifera]
Length=286

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  LVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLK  383
            L ++A AGNFYQD  + +G+GR ++L+ GK++ L LDK SGSGFQSK EYL+G+ DMQLK
Sbjct  22   LASIAFAGNFYQDVDITWGDGRAKILNNGKLLTLSLDKPSGSGFQSKKEYLYGKIDMQLK  81

Query  384  LVPGNSAGTVTTFY  425
            LVPGNSAGTVT +Y
Sbjct  82   LVPGNSAGTVTAYY  95



>ref|XP_002520388.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42004.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K  L +++   L+A++  GNFY+   + +G+ RG++L+GG+++ L LDK SGSGFQSKNE
Sbjct  5    KFLLSVLVICCLMAIS-EGNFYKHFDITWGDHRGKILNGGQLLTLSLDKASGSGFQSKNE  63

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFGR DMQ+KLVPGNSAGTVTTFY
Sbjct  64   YLFGRIDMQIKLVPGNSAGTVTTFY  88



>ref|XP_010259802.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=300

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K   C+++  SL  VA A +FYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSK+E
Sbjct  14   KFLSCLLVLGSLAIVASASSFYQDFDVTWGDGRAKILNTGELLTLSLDKASGSGFQSKHE  73

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  74   YLFGKIDMQLKLVPGNSAGTVTAYY  98



>ref|XP_002520387.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42003.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            S+K  L + +   L+AV+ A NFY+   + +G+ RG++L+GG+++ L LDK SGSGFQSK
Sbjct  3    SSKFLLSVFVICCLLAVSEA-NFYKHFDITWGDQRGKILNGGQLLTLSLDKASGSGFQSK  61

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEYLFGR DMQ+KLVPGNSAGTVTTFY
Sbjct  62   NEYLFGRIDMQIKLVPGNSAGTVTTFY  88



>ref|XP_007014184.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31803.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=319

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = +3

Query  150  SKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            S  S+S ++ L ++I  + +  A A NFYQ+    +G+GR Q+ DGG ++ L LDK SGS
Sbjct  36   SPSSASARVVLLLLI--NFLVAAFADNFYQNCDTVWGDGRAQIHDGGNLLTLSLDKTSGS  93

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  94   GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  125



>gb|ACU22849.1| unknown [Glycine max]
Length=200

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L +C +I      +A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEY
Sbjct  8    LLICTVIG--YFVIASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEY  65

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   LFGKIDMQLKLVPGNSAGTVTAYY  89



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S  N + +     + LV+ A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQ
Sbjct  3    SHLNSIPIVFFAFSLLVSFAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   SRNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_004140251.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=223

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + +  + V  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LF
Sbjct  15   LLLFVFMASVMTATAGNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLF  74

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+Q+KLVPGNSAGTVTTFY
Sbjct  75   GRFDVQMKLVPGNSAGTVTTFY  96



>gb|KCW78735.1| hypothetical protein EUGRSUZ_C00179 [Eucalyptus grandis]
Length=224

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK S
Sbjct  1    MASLSTSSLCIATLLLVVVSWGTFASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV+ A AGNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSSAFAGNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>emb|CBI17813.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +3

Query  150  SKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            S  + S KL L  ++  S V VA  GN YQD ++ +G+GR ++L+ G+++ L LDK SGS
Sbjct  78   STWNLSPKLFLVSLLLGSFV-VASVGNLYQDFEITWGDGRAKILNNGELLTLSLDKTSGS  136

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  137  GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  168



>ref|XP_004507927.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=284

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            +K+ L  ++ A LV    A NFYQD  + +G+GRG++ + GK++ L LDK SGSGFQSK+
Sbjct  3    SKILLGFLLIAFLVEATFASNFYQDFNIKWGDGRGKIFNNGKLLTLSLDKASGSGFQSKS  62

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            +YLFG+ DMQ+KLVPGNSAGTVTT+Y
Sbjct  63   QYLFGKIDMQIKLVPGNSAGTVTTYY  88



>ref|XP_011082931.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=289

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  147  DSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  326
            DS +  S  L++ + + A L+  +LAGNFY+D  + +G  R Q+L+GG++++L LD  SG
Sbjct  2    DSCVRVSEMLKV-LFVLAFLLGSSLAGNFYKDVTITWGGPRAQILNGGQVLSLSLDNVSG  60

Query  327  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGFQS NEYL+GRFD+QLKLVPGNSAGTVTTF+
Sbjct  61   SGFQSNNEYLYGRFDVQLKLVPGNSAGTVTTFF  93



>ref|XP_007035759.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY06685.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            +SS  L L M +       A A NFYQD  + +G+GRG++++ G+++ L LDK SGSGFQ
Sbjct  4    TSSLNLPLLMSLVIGCPVAASASNFYQDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQ  63

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  92



>ref|XP_003563483.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brachypodium distachyon]
Length=290

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L ++  A LV +A  GNF QDA+M +G+G G+V+DGG+ + L LD+ +GSGFQSK+EYLF
Sbjct  6    LGIVAMACLVGMAQGGNFNQDAEMTWGHGNGKVVDGGRGLDLTLDRTTGSGFQSKSEYLF  65

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQ+KLVPGNSAGTVTTFY
Sbjct  66   GKIDMQIKLVPGNSAGTVTTFY  87



>ref|XP_003549490.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Glycine max]
Length=292

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            S K  L + + AS +A A AGNFYQD  + +G+GR ++L+ G ++ L LDK SGSGFQSK
Sbjct  10   STKTVLYVFVLASSIA-ASAGNFYQDFDVTWGDGRAKILNNGDLLTLSLDKASGSGFQSK  68

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  69   NEYLFGKIDMQLKLVPGNSAGTVTAYY  95



>ref|NP_001234478.1| xyloglucan endotransglucosylase-hydrolase XTH9 precursor [Solanum 
lycopersicum]
 gb|AAS46244.1| xyloglucan endotransglucosylase-hydrolase XTH9 [Solanum lycopersicum]
Length=290

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            +A AGNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNEYLFGRFDMQLKLVP
Sbjct  22   LASAGNFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEYLFGRFDMQLKLVP  81

Query  393  GNSAGTVTTFY  425
             NSAGTVTTF+
Sbjct  82   KNSAGTVTTFF  92



>ref|XP_011082924.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L   +  + +    A NFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYLF
Sbjct  17   LSAFVVLACLTAPSAANFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLF  76

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+QLKLVPGNSAGTVTTF+
Sbjct  77   GRFDLQLKLVPGNSAGTVTTFF  98



>ref|XP_008449536.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVAL---AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  326
            M S +K    M++   L+A  +   AGNF+QD  + +G  R ++LDGG+ ++L LDK+SG
Sbjct  1    MHSPHKGLTIMLLQCVLMASIMTTSAGNFFQDVDITWGGPRAKILDGGRHLSLSLDKDSG  60

Query  327  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGFQSK E+LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  61   SGFQSKQEFLFGRFDVQMKLVPGNSAGTVTTFY  93



>ref|XP_008449516.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=289

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            LQLC+ +A SL+A   AGNF +D  + +G  R ++LDGG+ + L LDK+SGSGFQSK E+
Sbjct  5    LQLCVFMA-SLMAATTAGNFLRDVDVTWGGPRAKMLDGGRHLTLSLDKDSGSGFQSKKEF  63

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+++ LVPGNSAGTVTTFY
Sbjct  64   LFGRFDVRMMLVPGNSAGTVTTFY  87



>gb|KCW78732.1| hypothetical protein EUGRSUZ_C00176 [Eucalyptus grandis]
Length=433

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +3

Query  156  MSSSNKLQLC-----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            M+S +   LC     +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK 
Sbjct  142  MASRSTSSLCTAALLLIMVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKA  201

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  202  SGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  236



>gb|AES92349.2| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=275

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L +++ A+ +    AGNFYQ+  + +G+GR ++LD G+++ L LDK SGSGFQSKNEYLF
Sbjct  14   LSLLVFATFMTTYAAGNFYQNFDITWGDGRAKILDNGQLLTLSLDKASGSGFQSKNEYLF  73

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G  DMQLKLVPGNSAGTVT +Y
Sbjct  74   GNIDMQLKLVPGNSAGTVTAYY  95



>ref|XP_010046992.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=292

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +3

Query  156  MSSSNKLQLC-----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKE  320
            M+S +   LC     +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK 
Sbjct  1    MASRSTSSLCTAALLLIMVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKA  60

Query  321  SGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   SGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  95



>ref|XP_010241684.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=283

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L   +  SL+ ++ AGNFYQD  + +G+GRG++L+ G+++ L LDK SGSGFQSK EYLF
Sbjct  8    LMATLLGSLIVLSSAGNFYQDVDVTWGDGRGKILNNGQLLTLSLDKFSGSGFQSKKEYLF  67

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DM+LKLVPGNSAGTVTT+Y
Sbjct  68   GKIDMKLKLVPGNSAGTVTTYY  89



>ref|XP_007014183.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31802.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=296

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SS+  L L + +  S   +A AGNFYQD  + +G+GR Q+L+ G+++ L LDK SGSGFQ
Sbjct  7    SSNVSLTLLISVCVSASIIASAGNFYQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQ  66

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNE+LFG+  MQLKLVPGNSAGTVT +Y
Sbjct  67   SKNEFLFGKIGMQLKLVPGNSAGTVTAYY  95



>gb|AAT11860.1| xyloglucanendotransglycosylase [Mangifera indica]
Length=132

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 2/89 (2%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSS K+ +  M+ +S +  +   NFYQ+  + +G+GR Q+L+ G ++ L LDK SGSGFQ
Sbjct  3    SSSTKMLIIFMVVSSFMLAS--ANFYQNFDITWGDGRAQILNNGDLLTLSLDKASGSGFQ  60

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLF + DMQLKLVPGNSAGTVT +Y
Sbjct  61   SKNEYLFAKIDMQLKLVPGNSAGTVTAYY  89



>ref|XP_002438935.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
 gb|EER90302.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
Length=288

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            VA  GNFYQD  + +G+GRG++L+ G+++ L +D+ SGSGFQSK++YL+GRFDMQLKLVP
Sbjct  26   VAGGGNFYQDVDITWGDGRGKILNNGQLLTLSMDRSSGSGFQSKSQYLYGRFDMQLKLVP  85

Query  393  GNSAGTVTTFY  425
            GNSAGTVTTFY
Sbjct  86   GNSAGTVTTFY  96



>ref|XP_009356638.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQ----LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            MS S+KL     L + I   +   A AGNFYQD  + FG+GR ++L+GG+++ L LD+ S
Sbjct  1    MSYSSKLSMVVLLSLFITCVMATAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  94



>gb|KCW78733.1| hypothetical protein EUGRSUZ_C00177 [Eucalyptus grandis]
Length=568

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S    A A NFYQD  + +G+GRGQ+L+ G ++ L LDK S
Sbjct  1    MASRSTSSLCRAALLLMVVSWATSASARNFYQDFDITWGDGRGQILNNGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94


 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +3

Query  108  LFCILAS*LAQFPDSKMSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQ  275
            LF    S  ++     M+S +   LC    +++  S    A A NFYQD  + +G+GR Q
Sbjct  281  LFACWTSSSSRQNTPNMASLSTSSLCIATLLLVVVSWGTFASARNFYQDFDITWGDGRAQ  340

Query  276  VLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            +L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  341  ILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  390



>ref|XP_004303860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +3

Query  156  MSSSN---KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  326
            MSS N    L L + I + L   A AGNF+QD  + FG+ R ++L+GG+ + L LDK SG
Sbjct  1    MSSCNISRMLLLSLFITSLLAMTASAGNFFQDFDITFGDQRAKILEGGQFLTLNLDKYSG  60

Query  327  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGF+SK EYLFGR DMQ+KLVPGNSAGTVTT+Y
Sbjct  61   SGFKSKKEYLFGRIDMQIKLVPGNSAGTVTTYY  93



>ref|XP_002270375.2| PREDICTED: brassinosteroid-regulated protein BRU1 [Vitis vinifera]
Length=255

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            P    SS+    L + +  S +  A AGNFYQD  + +G+ R ++LD G+ + L LD  S
Sbjct  3    PIYSSSSAVSTALLISVVVSFLMAASAGNFYQDFDITWGDRRAKILDNGEFLTLSLDTTS  62

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  96



>ref|XP_010046996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            +SS  +   +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQ
Sbjct  6    TSSLCITTLLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQ  65

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_011045330.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Populus euphratica]
Length=274

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 72/90 (80%), Gaps = 4/90 (4%)
 Frame = +3

Query  165  SNKLQLCMMIA---ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            +N++ + ++++   +SL+A A AGNFY+D  + +G+GRG++L  G  ++L LDK SGSGF
Sbjct  2    ANRVSITLLVSLFVSSLLA-ASAGNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSK  YLFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  61   QSKRAYLFGRFDVQMKLVPGNSAGTVTTFY  90



>ref|XP_010670334.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            +  ++ AS +A+A AGNFY+D  + +G+GRG++++ G+++ L LDK SGSGFQSKNEYLF
Sbjct  7    IAFLLFASFIAIASAGNFYKDFDITWGDGRGKIINNGQLLTLSLDKTSGSGFQSKNEYLF  66

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQLKLV GNSAGTVT +Y
Sbjct  67   GKIDMQLKLVGGNSAGTVTAYY  88



>ref|XP_008348360.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=293

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAV----ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            MS S+KL + ++++  +  V    A AGNFYQD  + FG+GR ++L+GG+++ L LD+ S
Sbjct  1    MSYSSKLSMVVLLSLFITCVMAMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  94



>gb|KHN22712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L +C +I      +A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEY
Sbjct  8    LLICTVIG--YFVIASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEY  65

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   LFGKIDMQLKLVPGNSAGTVTAYY  89



>ref|XP_010047000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK S
Sbjct  1    MASPSAPSLCITTLLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPG+S+GTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGDSSGTVTAYY  94



>ref|XP_002270182.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=362

 Score =   110 bits (274),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +3

Query  150  SKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            S  + S KL L  ++  S V VA  GN YQD ++ +G+GR ++L+ G+++ L LDK SGS
Sbjct  71   STWNLSPKLFLVSLLLGSFV-VASVGNLYQDFEITWGDGRAKILNNGELLTLSLDKTSGS  129

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  130  GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  161



>gb|KCW78734.1| hypothetical protein EUGRSUZ_C00178 [Eucalyptus grandis]
Length=336

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            +SS  +   +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQ
Sbjct  51   TSSLCITTLLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQ  110

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  111  SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  139



>ref|XP_008380219.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Malus domestica]
Length=292

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            LC +  + +  VA AGNFYQD ++ FG+   +VL+ G++I L LDK SG+GF+SKN YLF
Sbjct  12   LCSITISLVAVVASAGNFYQDYEVMFGDQHAKVLENGQIITLALDKSSGAGFKSKNAYLF  71

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+FDMQ+KL PGNSAGTVTTFY
Sbjct  72   GKFDMQIKLQPGNSAGTVTTFY  93



>ref|XP_010536923.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=289

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSS ++ L  ++ A ++  ++  NFYQ+ ++ +G+GRGQ+ + G+++ L LD+ SGSGFQ
Sbjct  5    SSSRQMLLLPLLVAGVLLSSVHANFYQNVEITWGDGRGQINNNGELLTLSLDRASGSGFQ  64

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  65   SKNEYLFGKIDMQIKLVPGNSAGTVTAYY  93



>ref|XP_003542156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=285

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L +C +I      +A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEY
Sbjct  8    LLICTVIG--YFVIASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEY  65

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   LFGKIDMQLKLVPGNSAGTVTAYY  89



>ref|XP_008346306.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X1 [Malus domestica]
Length=277

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            + VA AGNFYQD Q+ +G+GRG++L+  +++ L LDK SGSGFQS N+YLFG+ DMQ+KL
Sbjct  5    LMVASAGNFYQDIQVTWGDGRGKILNNSELLTLSLDKSSGSGFQSTNQYLFGKIDMQIKL  64

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVTT+Y
Sbjct  65   VPGNSAGTVTTYY  77



>gb|AGI42451.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42453.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42462.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A NF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAANFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>emb|CCH26408.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=280

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + +  + V  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LF
Sbjct  2    LLLFVFMASVMTATAGNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLF  61

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+Q+KLVPGNSAGTVTTFY
Sbjct  62   GRFDVQMKLVPGNSAGTVTTFY  83



>ref|XP_004164862.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=280

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L + +  + V  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LF
Sbjct  2    LLLFVFMASVMTATAGNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLF  61

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+Q+KLVPGNSAGTVTTFY
Sbjct  62   GRFDVQMKLVPGNSAGTVTTFY  83



>gb|AGI42460.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A NF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAANFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>gb|AGI42449.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A NF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAANFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_010046997.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query  156  MSSSNKLQLC----MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            M+S +   LC    +++  S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK S
Sbjct  1    MASLSTSSLCIATLLLVVVSWGTFASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKAS  60

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>gb|AGI42452.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A NF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAANFHNDFDVTWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_004966141.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Setaria italica]
Length=292

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  225  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  404
            GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQS++EYLFG+ DMQ+KLVPGNSA
Sbjct  23   GNFYQDTEMTWGGGRGKVVDGGRGLDLTLDRTSGSGFQSRSEYLFGKIDMQIKLVPGNSA  82

Query  405  GTVTTFY  425
            GTVTTFY
Sbjct  83   GTVTTFY  89



>ref|XP_002535499.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26884.1| conserved hypothetical protein [Ricinus communis]
Length=190

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P    S +  L   +++  SL+ VA  G+FYQD  + +G+G G++L+ G ++ L L
Sbjct  1    MAAYPCQPNSLTLLLITSLVMVGSLMVVA--GDFYQDVDITWGDGCGKILNNGNVLTLSL  58

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            DK SGSGFQSKNEYLFG+FDMQLKLVPGN AGTVTTFY
Sbjct  59   DKASGSGFQSKNEYLFGKFDMQLKLVPGNYAGTVTTFY  96



>gb|EYU31577.1| hypothetical protein MIMGU_mgv1a011275mg [Erythranthe guttata]
Length=287

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +3

Query  177  QLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYL  356
            +L +++    ++ + + +FY+DA++ +G+GR ++L+GG+ ++L LD  SGSGFQSKNEYL
Sbjct  3    KLTLVLILLCISYSASADFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYL  62

Query  357  FGRFDMQLKLVPGNSAGTVTTFY  425
            FGRFD+QLKLVPGNSAGTVTTF+
Sbjct  63   FGRFDIQLKLVPGNSAGTVTTFF  85



>gb|EYU29581.1| hypothetical protein MIMGU_mgv1a022262mg [Erythranthe guttata]
Length=272

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            + L +++A  + A     NF +DA++ +G+GR +++DGG+ ++L LD+ SGSGFQSKNEY
Sbjct  6    ISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNEY  65

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFDMQLKLVP NSAGTVTTF+
Sbjct  66   LFGRFDMQLKLVPDNSAGTVTTFF  89



>gb|EYU29580.1| hypothetical protein MIMGU_mgv1a018934mg [Erythranthe guttata]
Length=272

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            + L +++A  + A     NF +DA++ +G+GR +++DGG+ ++L LD+ SGSGFQSKNEY
Sbjct  6    ISLFVLLACLVAAAPSTANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNEY  65

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFDMQLKLVP NSAGTVTTF+
Sbjct  66   LFGRFDMQLKLVPDNSAGTVTTFF  89



>ref|XP_007014173.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31792.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=294

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +3

Query  150  SKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            S  +SS  L +     A     A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGS
Sbjct  3    SFFASSVPLPVKSFFLACFFMAASAGNFYQDFDLTWGDGRAKILNNGQLLTLALDKASGS  62

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   GFQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_009759292.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Nicotiana sylvestris]
Length=154

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +3

Query  156  MSS-SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSG  332
            MSS S+KL L ++++A   AVA+AG F  + ++ +G GR ++L+ G+++ L LDK SGSG
Sbjct  1    MSSFSSKLVLALIVSA--FAVAIAGTFDDNFEITWGEGRAKMLNNGELLTLSLDKISGSG  58

Query  333  FQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            FQSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  59   FQSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  89



>ref|XP_010102168.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
 gb|EXB92418.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
Length=326

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +3

Query  150  SKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            +K+ S+  L   + I +S++  +   NFY+D  + +G+GR ++L+GG+++ L LDK SGS
Sbjct  8    NKLVSAIWLLSVVTITSSIIPCS--ANFYRDVDITWGDGRAKILNGGQVLTLSLDKNSGS  65

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQ KNEYLFGR D+Q+KLVPGNSAGTVTTFY
Sbjct  66   GFQPKNEYLFGRIDVQIKLVPGNSAGTVTTFY  97



>ref|XP_010927111.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=183

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A SL+  A AGN YQD Q+ +G+GR ++L+ G+++ L LDK S SGFQSKNEYLFG+
Sbjct  6    LLLAFSLMTGASAGNLYQDFQITWGDGRAKILENGQLLTLSLDKASSSGFQSKNEYLFGK  65

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVP NSAGTVT +Y
Sbjct  66   IDMQLKLVPXNSAGTVTAYY  85



>gb|AGI42454.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=281

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A NF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  2    NSIPIVFFAFSLLVSLAFAANFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  61

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  62   EYLFGKIDMQLKLVPGNSAGTVTAYY  87



>ref|XP_004303859.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=298

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L + I + L  +A AGNF QD  + FG+ R ++L+GGK + L LD+ SGSGF+SKNEY
Sbjct  10   LLLSLFITSLLAMIASAGNFLQDFDVTFGDQRVKILEGGKSLTLNLDQYSGSGFKSKNEY  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGR DMQ+KLVPGNSAGTVTT+Y
Sbjct  70   LFGRIDMQIKLVPGNSAGTVTTYY  93



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  159  SSSNKLQLCM-MIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            SSS+K  L M ++ A L+  A   NF+ D  + +G+GRG++   G+++ L LDK+SGSGF
Sbjct  4    SSSSKFPLLMPLMVACLIMAASGSNFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGSGF  63

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  93



>ref|XP_010525736.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=294

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L + +  S  AVA AGNF +D Q+ +G+GRG++LD G ++AL LD+ SGSGFQSKNE+
Sbjct  14   LFLMLSLLVSCFAVAFAGNFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNEF  73

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            L+G+ + Q+KLVPGNSAGTVTTFY
Sbjct  74   LYGKVEAQIKLVPGNSAGTVTTFY  97



>ref|XP_010259808.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=301

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +3

Query  180  LCMMIAASLVAV-ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYL  356
            L  +I+ SL+A+ +LA NF+QD  + +G GR ++L+ G+++ L LDK SGSGFQSKNEYL
Sbjct  17   LVFIISYSLIAIPSLANNFFQDFDVTWGGGRAKILNNGQLLTLSLDKASGSGFQSKNEYL  76

Query  357  FGRFDMQLKLVPGNSAGTVTTFY  425
            FG+ DMQLKLVPGNSAGT+T +Y
Sbjct  77   FGKIDMQLKLVPGNSAGTITAYY  99



>ref|XP_009356637.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVAL------AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            SS K+ + MM   SL   +L      AGNF+QD  + FG+GR ++L+GG+++ L LDK S
Sbjct  2    SSCKVPMNMMFLLSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKAS  61

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  62   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  95



>ref|XP_007034180.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY05106.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L  ++  SLV VA AG+FYQD  + +G+ R ++ +GGK+++L LD+ SGSGFQSK EY
Sbjct  11   LVLVGLVVNSLVVVAYAGDFYQDFDLTWGDHRAKIFNGGKLLSLSLDRVSGSGFQSKKEY  70

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGR DMQLKLV GNSAGTVT +Y
Sbjct  71   LFGRIDMQLKLVAGNSAGTVTAYY  94



>ref|XP_011045331.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=273

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L  +  +SL+A A AGNFY+D  + +G+GRG++L  G  ++L LDK SGSGFQSK  YLF
Sbjct  9    LVSLFVSSLLA-ASAGNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGFQSKRAYLF  67

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GRFD+Q+KLVPGNSAGTVTTFY
Sbjct  68   GRFDVQMKLVPGNSAGTVTTFY  89



>gb|ACD03217.1| xyloglucan endotransglucosylase/hydrolase 7 [Actinidia deliciosa]
Length=294

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S ++K+ + +M+ + LV+ +     ++D ++ +GNGRG++L+GG+++ L LD  SGSGFQ
Sbjct  7    SRASKMLMLVMLMSCLVSSSYGS--FEDVEITWGNGRGKILNGGQLLTLSLDNYSGSGFQ  64

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFGR DMQLKLVPGNSAGTVTT+Y
Sbjct  65   SKNEYLFGRIDMQLKLVPGNSAGTVTTYY  93



>ref|XP_002267890.2| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=281

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSSN   + +++ A +VA A A NFYQD  + +G+ R ++ +GG++++L LD+ SGSGFQ
Sbjct  3    SSSNGYSVFLLLFAVVVATASASNFYQDFDLTWGDNRAKIFNGGQLLSLSLDQASGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SK EYLFGR DMQLKLV GNSAGTVT +Y
Sbjct  63   SKKEYLFGRIDMQLKLVAGNSAGTVTAYY  91



>ref|XP_006350013.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            +A AGNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNE+LFGRFDMQLKLVP
Sbjct  22   LASAGNFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQLKLVP  81

Query  393  GNSAGTVTTFY  425
             NSAGTVTTF+
Sbjct  82   ENSAGTVTTFF  92



>ref|XP_002268708.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Vitis 
vinifera]
Length=294

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L  +  +SL+A A AGNFYQD  + +G+ R +++DGGK++ L LD+ SGSGFQSK EYLF
Sbjct  13   LFSLFVSSLMATASAGNFYQDFDLTWGDRRAKIVDGGKLLMLSLDRASGSGFQSKKEYLF  72

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GR DMQLKLV GNSAGTVT +Y
Sbjct  73   GRIDMQLKLVSGNSAGTVTAYY  94



>ref|XP_010656825.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=287

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            LQ+ ++I  S +A A AGNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEY
Sbjct  14   LQVSLII--SFLAAASAGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEY  71

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+  MQ+KLVPGNSAGTVT +Y
Sbjct  72   LFGKIAMQIKLVPGNSAGTVTAYY  95



>ref|XP_002317309.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE97921.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=274

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +3

Query  165  SNKLQLCMMIA--ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            +N++ + ++++   S    A AGNFY+D  + +G+GRG++L  G  ++L LDK SGSGFQ
Sbjct  2    ANRVSITLLVSLFVSSFLAASAGNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGFQ  61

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SK  YLFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  62   SKRAYLFGRFDVQMKLVPGNSAGTVTTFY  90



>ref|XP_008799496.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=306

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            +A A AGNF+QD Q+ +G+GR Q+L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQL+L
Sbjct  13   MAGASAGNFHQDFQITWGDGRAQILENGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLRL  72

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVT +Y
Sbjct  73   VPGNSAGTVTAYY  85



>gb|ACJ85154.1| unknown [Medicago truncatula]
Length=275

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L +++ A+ +    AGNFYQ+  + +G+GR ++LD G+++ L LDK SGSGFQSKNEYLF
Sbjct  14   LSLLVFATFMTTYAAGNFYQNFDITWGDGRAKILDNGQLLTLSLDKASGSGFQSKNEYLF  73

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G  DMQLKLVPGNS GTVT +Y
Sbjct  74   GNIDMQLKLVPGNSVGTVTAYY  95



>gb|KGN47998.1| hypothetical protein Csa_6G423400 [Cucumis sativus]
Length=274

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            V  A AGNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KL
Sbjct  4    VMTATAGNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKL  63

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVTTFY
Sbjct  64   VPGNSAGTVTTFY  76



>ref|XP_004303863.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like, partial [Fragaria vesca subsp. vesca]
Length=292

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++I   +V+ A A NFYQD  + FG  R Q+LDGG+++ L  D+ SGSGF S+N+YLFGR
Sbjct  4    LIITCVMVSTASARNFYQDFHILFGEQRAQILDGGQLLTLSQDQTSGSGFISQNQYLFGR  63

Query  366  FDMQLKLVPGNSAGTVTTFY  425
            FDMQ+KL PGN+AGTVTTFY
Sbjct  64   FDMQMKLAPGNTAGTVTTFY  83



>ref|XP_007223160.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica]
 gb|EMJ24359.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica]
Length=293

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            +   N + L  ++    VA A A NFYQD Q+ +G+GRG++L+ G+++ L LDK SGSGF
Sbjct  5    LCPPNYVLLISLMVGCFVA-ASASNFYQDFQVTWGDGRGKILNNGELLTLSLDKASGSGF  63

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYL+G+ DMQ+KLVPGNSAGTVT +Y
Sbjct  64   QSKNEYLYGKIDMQIKLVPGNSAGTVTAYY  93



>gb|ABY79073.1| xyloglucan xyloglucosyl transferase [Hordeum vulgare]
 dbj|BAJ96173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNS  401
            AGNFYQD  + +G+GRG++L GG ++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPG+S
Sbjct  27   AGNFYQDVDITWGDGRGKILGGGDLLTLSLDRASGSGFQSKNQYLYGRFDMQIKLVPGDS  86

Query  402  AGTVTTFY  425
            AGTV TFY
Sbjct  87   AGTVATFY  94



>ref|XP_011043994.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X3 [Populus euphratica]
Length=292

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P         L + +++ + LV V  AG FYQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MAAYPSEPNPLLLLLVISLLVGSDLVLVD-AGTFYQDVDIIWGDGRAKILNNGNLLTLSL  59

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEYLFG+FD+QLKLVPGNSAGTVTTFY
Sbjct  60   DRASGSGFQSKNEYLFGKFDIQLKLVPGNSAGTVTTFY  97



>ref|XP_010259803.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=295

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            S+ + L +  ++A+S +A + A  FYQD  + +G+GR ++L+ GK++ L LDK SGSGFQ
Sbjct  7    STVSALLIVALLASSFMATSSARTFYQDFDLTWGDGRAKILNNGKLLTLSLDKASGSGFQ  66

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SK EYLFG  DMQLKLVPGNSAGTVT +Y
Sbjct  67   SKREYLFGSIDMQLKLVPGNSAGTVTAYY  95



>ref|XP_011043995.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X4 [Populus euphratica]
Length=291

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P         L + +++ + LV V  AG FYQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MAAYPSEPNPLLLLLVISLLVGSDLVLVD-AGTFYQDVDIIWGDGRAKILNNGNLLTLSL  59

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEYLFG+FD+QLKLVPGNSAGTVTTFY
Sbjct  60   DRASGSGFQSKNEYLFGKFDIQLKLVPGNSAGTVTTFY  97



>ref|XP_010525737.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            + + A+ V VA AGNF +D Q+ +G+GRG++LD G ++AL LD+ SGSGFQSKNE+L+G+
Sbjct  14   LSLMATHVLVAFAGNFQRDVQITWGDGRGKILDNGNLLALSLDQFSGSGFQSKNEFLYGK  73

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             + Q+KLVPGNSAGTVTTFY
Sbjct  74   VEAQIKLVPGNSAGTVTTFY  93



>gb|ACU17489.1| unknown [Glycine max]
Length=174

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            ++++ L ++I   +VA A AGNF QD ++ +G+GR ++L+ G+++ L LDK SGSGF+S+
Sbjct  2    ASEIFLALLITTFVVA-ASAGNFNQDFEITWGDGRAKILNSGELLTLSLDKTSGSGFRSR  60

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   NEYLFGKIDMQLKLVPGNSAGTVTAYY  87



>ref|XP_008380453.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Malus domestica]
Length=275

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M  S+ + L  ++ +SL+    AGNFYQD  + +G  R ++  GG++++L LDK SGSGF
Sbjct  1    MGISSLVLLVGLVCSSLMVATYAGNFYQDFDLTWGGNRPKIFKGGQLLSLSLDKVSGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSK EYLFGR DMQLKLVPGNSAGTVT +Y
Sbjct  61   QSKKEYLFGRIDMQLKLVPGNSAGTVTAYY  90



>ref|XP_008229406.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Prunus mume]
Length=290

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 4/92 (4%)
 Frame = +3

Query  162  SSNKLQLCMMIA---ASLVAVA-LAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            SS+K+ L   I+    SL+A+A LAGNFYQD  + FG+ R ++L+ GK++ L LDK SG+
Sbjct  2    SSHKVSLMFFISLIITSLMAMAALAGNFYQDFDIMFGDQRLKILEEGKLVTLSLDKVSGA  61

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKN Y+FGRFD+Q+K+ PGNSAGTVTTFY
Sbjct  62   GFQSKNGYIFGRFDVQMKMPPGNSAGTVTTFY  93



>ref|XP_004488032.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=287

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            +A AGNFYQD ++ +G+ R ++L+ G+ ++L LDK SGSGF+SKNEYLFG+ DMQLKLVP
Sbjct  20   IASAGNFYQDMEITWGDNRAKILENGQFLSLSLDKASGSGFRSKNEYLFGKIDMQLKLVP  79

Query  393  GNSAGTVTTFY  425
            GNSAGTVTT+Y
Sbjct  80   GNSAGTVTTYY  90



>ref|XP_002526228.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36169.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=284

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 71/90 (79%), Gaps = 4/90 (4%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M+SSN +   +++ ASL+ VA A NFY D  + +G+GR ++L+ G+++ L LDK SGSGF
Sbjct  1    MASSNYI---LLLLASLM-VASASNFYNDFDITWGDGRAKILNDGELLTLTLDKASGSGF  56

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYLFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  57   QSKNEYLFGKIDMQIKLVPGNSAGTVTAYY  86



>ref|XP_011043992.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Populus euphratica]
Length=327

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P         L + +++ + LV V  AG FYQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MAAYPSEPNPLLLLLVISLLVGSDLVLVD-AGTFYQDVDIIWGDGRAKILNNGNLLTLSL  59

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEYLFG+FD+QLKLVPGNSAGTVTTFY
Sbjct  60   DRASGSGFQSKNEYLFGKFDIQLKLVPGNSAGTVTTFY  97



>ref|XP_011043993.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X2 [Populus euphratica]
Length=326

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P         L + +++ + LV V  AG FYQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MAAYPSEPNPLLLLLVISLLVGSDLVLVD-AGTFYQDVDIIWGDGRAKILNNGNLLTLSL  59

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEYLFG+FD+QLKLVPGNSAGTVTTFY
Sbjct  60   DRASGSGFQSKNEYLFGKFDIQLKLVPGNSAGTVTTFY  97



>gb|EYU31576.1| hypothetical protein MIMGU_mgv1a011220mg [Erythranthe guttata]
Length=288

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            ++ + + +FY+DA++ +G+GR ++L+GG+ ++L LD  SGSGFQSKNEYLFGRFD+QLKL
Sbjct  14   ISYSASADFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKL  73

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVTTF+
Sbjct  74   VPGNSAGTVTTFF  86



>ref|XP_010053252.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Eucalyptus grandis]
Length=291

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = +3

Query  144  PDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            PD  MSS     + ++     +  A AGNFYQD  + FG+ R Q+L GG++I L LDK S
Sbjct  2    PD--MSSPRLFPIVLLSLFLCLVSATAGNFYQDIDVLFGDWRTQILQGGELITLSLDKAS  59

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            G+GF+SKNEYL+GRFDM++KLV G+SAGTVTTFY
Sbjct  60   GAGFRSKNEYLYGRFDMRMKLVGGDSAGTVTTFY  93



>gb|AFW69274.1| Xyloglucan endo-transglycosylase Xyloglucan endotransglucosylase/hydrolase 
protein 23 [Zea mays]
Length=377

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  210  AVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLV  389
            A +  GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLV
Sbjct  114  AASAGGNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLV  173

Query  390  PGNSAGTVTTFY  425
            PG+SAGTV TFY
Sbjct  174  PGDSAGTVATFY  185



>ref|XP_008801579.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=368

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A SL+  A AGN  Q+ Q+ +G+GR ++++ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  17   LLLACSLMTAASAGNLDQNLQITWGDGRAKIIENGQLLTLCLDKASGSGFQSKNEYLFGK  76

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  77   IDMQLKLVPGNSAGTVTAYY  96


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  228  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLK  383
            NF+QD ++ +G+ R +V D G+ + L LDK SGSGFQSKNE+LFG+ DMQLK
Sbjct  242  NFHQDFKIIWGDRRAKVRDNGQNLTLSLDKASGSGFQSKNEFLFGKIDMQLK  293



>ref|NP_001281066.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03231.1| xyloglucan endotransglucosylase/hydrolase 7 [Malus domestica]
Length=295

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L +   + +V  A AGNF+QD  + FG+GR ++L+GG+++ L LDK SGSGF+SKNEYLF
Sbjct  14   LSLFTTSLMVMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLF  73

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GR DMQ+KLV GNSAGTVT +Y
Sbjct  74   GRIDMQIKLVSGNSAGTVTAYY  95



>ref|XP_008801575.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25, partial [Phoenix dactylifera]
Length=225

 Score =   105 bits (263),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +++A S +  A AGN  Q+ Q+ +G+GR ++++ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  2    LLLACSFMTAASAGNLDQNFQITWGDGRAKIIENGQLLTLSLDKASGSGFQSKNEYLFGK  61

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  62   IDMQLKLVPGNSAGTVTAYY  81



>ref|XP_002437518.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
 gb|EER88885.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
Length=292

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  225  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  404
            GNFY+D +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  22   GNFYKDTEMTWGQGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  81

Query  405  GTVTTFY  425
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_004140252.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=291

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC+++A+ L   A  GNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+
Sbjct  12   LLLCVLMASILTTSA--GNFLQDVDITWGGPRAKILDSGRHLSLSLDKDSGSGFQSKQEF  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q++LVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMQLVPGNSAGTVTTFY  93



>ref|XP_004164865.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26409.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L LC+++A+ L   A  GNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+
Sbjct  12   LLLCVLMASILTTSA--GNFLQDVDITWGGPRAKILDSGRHLSLSLDKDSGSGFQSKQEF  69

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGRFD+Q++LVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMQLVPGNSAGTVTTFY  93



>gb|KDP36433.1| hypothetical protein JCGZ_08702 [Jatropha curcas]
Length=291

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            +Q+ ++++  +V  AL+GNFYQ+  M +GNG+  +L+ G+++ L LDK+SGSGFQSK EY
Sbjct  8    MQMQLLVSLMMVNSALSGNFYQEFDMLWGNGKANILNNGELVTLSLDKDSGSGFQSKQEY  67

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ +MQLKLV GNSAGTVT++Y
Sbjct  68   LFGKVNMQLKLVSGNSAGTVTSYY  91



>ref|XP_004309954.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Fragaria vesca subsp. vesca]
Length=288

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SS++ +     + AS V VA AGNF QD ++ +G+GR ++ + G+++ L LDK SGSGF+
Sbjct  3    SSTSMILFVPFLLASFVMVASAGNFNQDFKITWGDGRAKIFNDGQLLTLSLDKASGSGFE  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            S NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   STNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>ref|XP_009373581.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=275

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M  S+ + L  ++ +SL+    AGNFYQD  + +G  R ++  GG++++L LDK SGSGF
Sbjct  1    MGISSLVLLVGLVCSSLMIATYAGNFYQDFDLTWGGHRPKIFKGGQLLSLSLDKVSGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSK EYLFGR DMQLKLVPGNSAGTVT +Y
Sbjct  61   QSKKEYLFGRIDMQLKLVPGNSAGTVTAYY  90



>ref|XP_007154784.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
 gb|ESW26778.1| hypothetical protein PHAVU_003G147700g [Phaseolus vulgaris]
Length=284

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +3

Query  174  LQLC-MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            L LC M++   ++ VA AG+F +D  + +G+GR ++L+ G+++ L LDK SGSGFQSKNE
Sbjct  3    LTLCYMLLFPVILIVAFAGDFNKDFDLTWGDGRARILNNGELLTLTLDKASGSGFQSKNE  62

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   YLFGKIDMQLKLVPGNSAGTVTAYY  87



>emb|CAN80250.1| hypothetical protein VITISV_036640 [Vitis vinifera]
Length=287

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 69/90 (77%), Gaps = 4/90 (4%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M+SS+ L L +    S+  VA AGNF QD  + +G+GR ++L+ G+++ L LDK SGSGF
Sbjct  1    MASSSILVLML----SMXVVASAGNFNQDFDITWGDGRAKILNNGQLLTLSLDKASGSGF  56

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QS+NEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  57   QSRNEYLFGKIDMQLKLVPGNSAGTVTAYY  86



>ref|XP_007014172.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31791.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            +SS    L M +    +  A A NFYQD  + +G+GRG++ + G++++L LDK SGSGFQ
Sbjct  4    TSSFNFTLLMSLVIGCLMAASASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGSGFQ  63

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  92



>ref|XP_004309952.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            V VA AGNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGF+SKNEYLFG+ DMQLKL
Sbjct  19   VMVAEAGNFNQDFQITWGDGRAKILNNGQLLTLSLDKASGSGFESKNEYLFGKIDMQLKL  78

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVT +Y
Sbjct  79   VPGNSAGTVTAYY  91



>gb|KHG09882.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=280

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  171  KLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  350
            K  L + +   LV VA A NF QD  + +G+GRG++L+ G ++ L LDK SGSGFQSKN+
Sbjct  2    KSSLLVSVVIGLVIVASAANFNQDIDVTWGDGRGKILENGNLLTLTLDKFSGSGFQSKNQ  61

Query  351  YLFGRFDMQLKLVPGNSAGTVTTFY  425
            YLFG+ DM +KLVPGNSAGTVTT+Y
Sbjct  62   YLFGKIDMNIKLVPGNSAGTVTTYY  86



>ref|XP_006387414.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa]
 gb|ERP46328.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa]
Length=270

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query  156  MSSSNKLQLCMMIA---ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  326
             S  +KL   ++ A   A L+  ++ GNF+QD  + +G+ R ++L+GG+++ L LDK+SG
Sbjct  24   FSCPSKLPSTLLFASLLACLLGASMGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSG  83

Query  327  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGF+SKNEYLFGR DMQ+KLV GNSAGTVTT+Y
Sbjct  84   SGFRSKNEYLFGRIDMQIKLVSGNSAGTVTTYY  116



>ref|XP_002325068.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
 gb|EEF03633.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
Length=291

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = +3

Query  132  LAQFPDSKMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKL  311
            +A +P         L + +++ + L+ V  AG+FYQD  + +G+GR ++L+ G ++ L L
Sbjct  1    MAAYPSEPNPLLLLLMISLLVGSDLLLVD-AGSFYQDVDIIWGDGRAKILNNGNLLTLSL  59

Query  312  DKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            D+ SGSGFQSKNEY FG+FD+QLKLVPGNSAGTVTTFY
Sbjct  60   DRASGSGFQSKNEYFFGKFDIQLKLVPGNSAGTVTTFY  97



>gb|KCW89705.1| hypothetical protein EUGRSUZ_A01967 [Eucalyptus grandis]
Length=288

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            MSS     + ++     +  A AGNFYQD  + FG+ R Q+L GG++I L LDK SG+GF
Sbjct  1    MSSPRLFPIVLLSLFLCLVSATAGNFYQDIDVLFGDWRTQILQGGELITLSLDKASGAGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            +SKNEYL+GRFDM++KLV G+SAGTVTTFY
Sbjct  61   RSKNEYLYGRFDMRMKLVGGDSAGTVTTFY  90



>emb|CAN74784.1| hypothetical protein VITISV_032594 [Vitis vinifera]
Length=295

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            S KL L  ++  SLV +A  GN ++D  + +G+GR ++LD G+++ L LDK SGSGFQSK
Sbjct  10   SPKLLLVSVLFGSLV-IASVGNLHKDFDITWGDGRAKILDNGQLLTLSLDKTSGSGFQSK  68

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEY+FG+ DMQLKLVPGNSAGTVT +Y
Sbjct  69   NEYMFGKIDMQLKLVPGNSAGTVTAYY  95



>ref|XP_008362366.1| PREDICTED: LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase 
protein 22-like [Malus domestica]
Length=292

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = +3

Query  189  MIAASLVAV-ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            +I  SLVAV A A NFYQD ++ FG+   +VL+ G+++ L LDK SG+GF+SKNEYLFGR
Sbjct  14   LITISLVAVVASADNFYQDFEVMFGDQLAKVLENGQLVTLSLDKSSGAGFKSKNEYLFGR  73

Query  366  FDMQLKLVPGNSAGTVTTF  422
            FDMQ+KL PGNSAGTVTTF
Sbjct  74   FDMQIKLQPGNSAGTVTTF  92



>ref|XP_004235156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Solanum lycopersicum]
Length=286

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            M+SS+KL L M    S   +A+   F Q+  + +G+GR ++L+ G ++ L LDK SGSGF
Sbjct  1    MASSSKLVLVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGF  60

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  90



>ref|XP_010929299.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=299

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +3

Query  216  ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPG  395
            A  GNFYQD  + +G+GR ++LDGG+++ L LDK SGSGFQSKN+YLFG+ DMQ+KLVPG
Sbjct  32   AHGGNFYQDFDITWGDGRAKILDGGQLVTLSLDKTSGSGFQSKNQYLFGKIDMQIKLVPG  91

Query  396  NSAGTVTTFY  425
            NSAGTVT +Y
Sbjct  92   NSAGTVTAYY  101



>ref|XP_006350014.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNS  401
            AGNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNE+LFGRFDMQ+KLVP NS
Sbjct  25   AGNFYKDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQIKLVPENS  84

Query  402  AGTVTTFY  425
            AGTVTTF+
Sbjct  85   AGTVTTFF  92



>ref|XP_006474155.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X2 [Citrus sinensis]
Length=286

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            MS ++ L L +++ + +VA A  GNFY+D  + +G+GR ++L+ G ++ L LDK SGSGF
Sbjct  1    MSMASTLHLFLVLGSLMVASA--GNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYL+G+ DMQLKLVPGNSAGTVT +Y
Sbjct  59   QSKNEYLYGKIDMQLKLVPGNSAGTVTAYY  88



>ref|XP_006474154.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X1 [Citrus sinensis]
 gb|KDO36926.1| hypothetical protein CISIN_1g023204mg [Citrus sinensis]
Length=286

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +3

Query  156  MSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  335
            MS ++ L L +++ + +VA A  GNFY+D  + +G+GR ++L+ G ++ L LDK SGSGF
Sbjct  1    MSMASTLHLFLVLGSLMVASA--GNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSGF  58

Query  336  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            QSKNEYL+G+ DMQLKLVPGNSAGTVT +Y
Sbjct  59   QSKNEYLYGKIDMQLKLVPGNSAGTVTAYY  88



>gb|AAF80591.1|AF223420_1 xyloglucan endotransglycosylase XET2 [Asparagus officinalis]
Length=284

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
            L  ++A S V +A+AGNF  D ++ +G+GRG+++D G++++L LDK SGSGF+S +EYLF
Sbjct  5    LFAVLALSSVGIAVAGNFNDDFKITWGDGRGRIVDNGQLLSLSLDKASGSGFESTHEYLF  64

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            G+ DMQLKLVPGNSAGTVT +Y
Sbjct  65   GKIDMQLKLVPGNSAGTVTAYY  86



>ref|XP_011044804.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=295

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            + L  ++ A L+  ++ GNF+QD  + +G+ R ++L+GG+++ L LDK+SGSGF+SKNEY
Sbjct  13   MPLFALLIACLLGASMGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEY  72

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFGR DMQ+KLV GNSAGTVTT+Y
Sbjct  73   LFGRIDMQIKLVSGNSAGTVTTYY  96



>ref|NP_001105367.1| xyloglucan endotransglycosylase homolog1 precursor [Zea mays]
 gb|AAC49012.1| xyloglucan endo-transglycosylase homolog; similar to Triticum 
aestivum endo-xyloglucan transferase, PIR Accession Number 
E49539 [Zea mays]
 gb|AAC49011.1| xyloglucan endo-transglycosylase homolog [Zea mays]
 gb|ACF85530.1| unknown [Zea mays]
 gb|ACG28344.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 prf||2113418A xyloglucan endotransglycosylase homolog
Length=280

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +3

Query  210  AVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLV  389
            A +  GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLV
Sbjct  17   AASAGGNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLV  76

Query  390  PGNSAGTVTTFY  425
            PG+SAGTV TFY
Sbjct  77   PGDSAGTVATFY  88



>ref|XP_009378317.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Pyrus x bretschneideri]
Length=292

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAV----ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            SS+K+ +   ++   ++V    A A NFYQD ++ FG+   +VL+ G+++ L LDK SG+
Sbjct  2    SSSKVSMTFFLSLITISVGAVVASADNFYQDFEVMFGDQHAKVLENGQVVTLSLDKSSGA  61

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GF+SKNEYLFGRFDMQ+KL PGNSAGTVTTFY
Sbjct  62   GFKSKNEYLFGRFDMQIKLQPGNSAGTVTTFY  93



>ref|XP_008223657.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Prunus mume]
Length=159

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  222  AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNS  401
            AGNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNS
Sbjct  27   AGNFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNS  86

Query  402  AGTVTTFY  425
            AGTVT +Y
Sbjct  87   AGTVTAYY  94



>ref|NP_001267702.1| probable xyloglucan endotransglucosylase/hydrolase protein 23-like 
precursor [Cucumis sativus]
 emb|CAD87535.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 emb|CAD87533.1| putative xyloglucan endotransglycosylase [Cucumis sativus]
 gb|KGN65438.1| hypothetical protein Csa_1G422470 [Cucumis sativus]
Length=283

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  341
            +S  L L ++ +ASL+A++ A NF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQS
Sbjct  2    ASTTLFLTLLFSASLIAISSA-NFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQS  60

Query  342  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            +NEYLFG+ DMQLKLV GNSAGTVT +Y
Sbjct  61   QNEYLFGKIDMQLKLVAGNSAGTVTAYY  88



>ref|XP_009356634.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +3

Query  162  SSNKLQLCMMIAASLVAVAL------AGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  323
            SS K+ + M+   SL   +L      AGNF+QD  + FG+GR ++L+GG+++ L LDK S
Sbjct  2    SSCKVAMNMVFLLSLFTTSLMAMTASAGNFFQDFDITFGDGRAKILNGGQLLTLNLDKAS  61

Query  324  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  62   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  95



>gb|AAF80590.1|AF223419_1 xyloglucan endotransglycosylase XET1 [Asparagus officinalis]
Length=284

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +3

Query  162  SSNKLQLCMMI--AASLVAVA--LAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            SS+ +  C+ I  AA+ VA++    GNFY+D  + +G+GR ++L+ G+M+ L LDK SGS
Sbjct  2    SSSLMSQCVHIFLAATFVAMSGVHGGNFYRDFDLTWGDGRAKILNNGQMLTLSLDKVSGS  61

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GFQSKN+YLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  62   GFQSKNQYLFGKIDMQLKLVPGNSAGTVTAYY  93



>ref|XP_007154781.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
 gb|ESW26775.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
Length=282

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            +A A NFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVP
Sbjct  18   IASAANFYQDFDITWGDGRAKILNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQLKLVP  77

Query  393  GNSAGTVTTFY  425
            GNSAGTVT +Y
Sbjct  78   GNSAGTVTAYY  88



>ref|XP_010927060.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Elaeis 
guineensis]
Length=298

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L  ++ AS++  A  GNFYQD  + +G+GR ++L+ G ++ L LDK SGSGFQSKN+Y
Sbjct  16   LFLAFLMVASVMVGAYGGNFYQDFDITWGDGRAKILNNGHLLTLSLDKVSGSGFQSKNQY  75

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  76   LFGKIDMQIKLVPGNSAGTVTAYY  99



>ref|XP_009597029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana tomentosiformis]
Length=284

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +3

Query  165  SNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSK  344
            ++ L L  ++  SLVA +   NF   A++ +G GRG++ +GGK ++L LDK SGSGFQSK
Sbjct  2    ASHLFLISILMGSLVAAS--ANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQSK  59

Query  345  NEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            NEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  60   NEYLFGRFDMQLKLVPGNSAGTVTTFF  86



>ref|XP_002518632.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF43774.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=277

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N L + +++  SL  V+ AGNF+QD  + +G+ R ++ +GG+M++L LDK SGSGFQSK 
Sbjct  6    NALCMAVLVMGSLFMVSSAGNFFQDFDITWGDRRAKIFNGGQMLSLSLDKVSGSGFQSKK  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFGR DMQLKLV GNSAGTVT +Y
Sbjct  66   EYLFGRIDMQLKLVAGNSAGTVTAYY  91



>ref|XP_006453420.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
 gb|ESR66660.1| hypothetical protein CICLE_v10008778mg [Citrus clementina]
Length=353

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  153  KMSSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSG  332
             MS ++ L L +++ + +VA A  GNFY+D  + +G+GR ++L+ G ++ L LDK SGSG
Sbjct  67   HMSMASTLHLFLVLGSLMVASA--GNFYKDFDITWGDGRAKMLNNGDLLTLSLDKASGSG  124

Query  333  FQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            FQSKNEYL+G+ DMQLKLVPGNSAGTVT +Y
Sbjct  125  FQSKNEYLYGKIDMQLKLVPGNSAGTVTAYY  155



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  201  SLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQL  380
            SL+  +++ NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+
Sbjct  12   SLIISSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQM  71

Query  381  KLVPGNSAGTVTTFY  425
            KLVPGNSAGTVTT Y
Sbjct  72   KLVPGNSAGTVTTLY  86



>gb|ACD03220.1| xyloglucan endotransglucosylase/hydrolase 10 [Actinidia deliciosa]
Length=283

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 67/84 (80%), Gaps = 4/84 (5%)
 Frame = +3

Query  186  MMIAASLV----AVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            +M+  SL+    AVA AG+FYQD  + +G+GR ++L  GK++ L LDK SGSGFQS+N+Y
Sbjct  5    IMVLVSLILSFTAVASAGSFYQDFDIKWGDGRAKILGEGKLLTLSLDKASGSGFQSQNQY  64

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            LFG+ DMQ+KLVPGNSAGTVT++Y
Sbjct  65   LFGKIDMQIKLVPGNSAGTVTSYY  88



>ref|NP_001237075.1| syringolide-induced protein 19-1-5 precursor [Glycine max]
 dbj|BAB86890.1| syringolide-induced protein 19-1-5 [Glycine max]
 gb|KHN17580.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++       +A AGNF+QD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  9    LICTVGYFVIASAGNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGK  68

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  69   IDMQLKLVPGNSAGTVTAYY  88



>ref|XP_006453414.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
 ref|XP_006474157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|ESR66654.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
Length=285

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  213  VALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVP  392
            VA AGNF+QD  + +G+GR  +L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVP
Sbjct  17   VASAGNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVP  76

Query  393  GNSAGTVTTFY  425
            GNSAGTVT +Y
Sbjct  77   GNSAGTVTAYY  87



>ref|NP_001276139.1| uncharacterized protein LOC102661404 precursor [Glycine max]
 gb|ACU20918.1| unknown [Glycine max]
Length=285

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  186  MMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGR  365
            ++       +A AGNF+QD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+
Sbjct  9    LICTVGYFVIASAGNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGK  68

Query  366  FDMQLKLVPGNSAGTVTTFY  425
             DMQLKLVPGNSAGTVT +Y
Sbjct  69   IDMQLKLVPGNSAGTVTAYY  88



>ref|XP_010042670.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Eucalyptus 
grandis]
Length=288

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  180  LCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  359
             C+++++ ++  A AG+FY+D  + +G  R ++ +GG+ + L LDK SGSGFQSKNEYLF
Sbjct  8    FCLIMSSLMMKGAQAGDFYRDFDLTWGGQRAKISEGGQFLTLSLDKYSGSGFQSKNEYLF  67

Query  360  GRFDMQLKLVPGNSAGTVTTFY  425
            GR DMQLKLVPGNSAGTVTT+Y
Sbjct  68   GRIDMQLKLVPGNSAGTVTTYY  89



>ref|XP_007154780.1| hypothetical protein PHAVU_003G147300g [Phaseolus vulgaris]
 gb|ESW26774.1| hypothetical protein PHAVU_003G147300g [Phaseolus vulgaris]
Length=292

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +3

Query  174  LQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  353
            L L  +I+   + VA AGN YQD  + +G+GRG++L+ G+++ L LD  SGSGFQSKN+Y
Sbjct  13   LVLAFLISVPSM-VAYAGNLYQDVDVTWGDGRGKILNNGQLLTLSLDHASGSGFQSKNQY  71

Query  354  LFGRFDMQLKLVPGNSAGTVTTFY  425
            L+G+FDMQ+KLVPGNSAGTVT +Y
Sbjct  72   LYGKFDMQIKLVPGNSAGTVTAYY  95



>ref|NP_001234472.1| xyloglucan endotransglucosylase-hydrolase XTH3 precursor [Solanum 
lycopersicum]
 gb|AAS46241.1| xyloglucan endotransglucosylase-hydrolase XTH3 [Solanum lycopersicum]
Length=287

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSS+KL L M    S   +A+   F Q+  + +G+GR ++L+ G ++ L LDK SGSGFQ
Sbjct  3    SSSSKLVLVMCFMISAFGIAIGAKFDQEFDITWGDGRAKILNNGDLLTLSLDKISGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  63   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  91



>gb|AAC39467.1| endo-xyloglucan transferase [Arabidopsis thaliana]
Length=120

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 63/81 (78%), Gaps = 3/81 (4%)
 Frame = +3

Query  183  CMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFG  362
             +++AA  V+   A +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG
Sbjct  11   TLLVAAFSVS---AADFNTDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFG  67

Query  363  RFDMQLKLVPGNSAGTVTTFY  425
            + DMQ+KLVPGNSAGTVTTFY
Sbjct  68   KIDMQIKLVPGNSAGTVTTFY  88



>ref|XP_002266082.1| PREDICTED: brassinosteroid-regulated protein BRU1 [Vitis vinifera]
Length=281

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  SSSNKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  338
            SSSN      ++ A ++A A A NFYQD  + +G+ R ++ +GG++++L LDK SGSGFQ
Sbjct  3    SSSNGYSFFGLVFAMVLATASASNFYQDFDITWGDHRAKIFNGGQLLSLSLDKTSGSGFQ  62

Query  339  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SK EYLFGR DMQLKLV GNSAGTVT +Y
Sbjct  63   SKKEYLFGRIDMQLKLVAGNSAGTVTAYY  91



>gb|AEZ00859.1| putative xyloglucan endotransglycosylase protein, partial [Elaeis 
guineensis]
Length=191

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  207  VAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKL  386
            +A A AGNF QD Q+ +G+ R ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKL
Sbjct  13   MASASAGNFDQDFQITWGDERAKILENGQLLTLSLDKPSGSGFQSKNEYLFGKIDMQLKL  72

Query  387  VPGNSAGTVTTFY  425
            VPGNSAGTVT +Y
Sbjct  73   VPGNSAGTVTAYY  85



>ref|XP_008229404.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Prunus 
mume]
Length=285

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 73/93 (78%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  SSSNKLQLCMMIA---ASLVAV-ALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  326
            SS +K+ + ++++    SL+A+ A AGNF+QD  + FG+ R ++L+GG+++ L LDK SG
Sbjct  5    SSCSKVSMVLVVSLFVTSLMAMTASAGNFFQDIDVTFGDERAKILNGGQLLTLNLDKASG  64

Query  327  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            SGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  65   SGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  97



>ref|XP_009126894.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=234

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  204  LVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLK  383
            +V  +++ NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+K
Sbjct  14   IVISSVSANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMK  73

Query  384  LVPGNSAGTVTTFY  425
            LVPGNSAGTVTT Y
Sbjct  74   LVPGNSAGTVTTLY  87



>gb|AGI42459.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  168  NKLQLCMMIAASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKN  347
            N + +     + LV++A A N + D  + +G+GRG++L+ G+++ L LDK SGSGFQS+N
Sbjct  6    NSIPIVFFAFSLLVSLAFAANSHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRN  65

Query  348  EYLFGRFDMQLKLVPGNSAGTVTTFY  425
            EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  66   EYLFGKIDMQLKLVPGNSAGTVTAYY  91



>gb|ACJ85206.1| unknown [Medicago truncatula]
Length=184

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 4/92 (4%)
 Frame = +3

Query  159  SSSNKLQLCMMIA---ASLVAVALAGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGS  329
            S+ N+  + M+IA   +S+VA   AG+FYQD  + +G+ R ++ +GG++++L LDK SGS
Sbjct  5    STHNEFHVFMLIAIMVSSMVATC-AGSFYQDFDLTWGDNRAKIFNGGQLLSLSLDKVSGS  63

Query  330  GFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  425
            GF+SK EYLFGR DMQLKLV GNSAGTVT +Y
Sbjct  64   GFKSKREYLFGRIDMQLKLVAGNSAGTVTAYY  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511272866440