BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20519_g1_i1 len=553 path=[1003:0-280 154:281-317 981:318-339
213:340-383 828:384-414 288:415-552]

Length=553
                                                                      Score     E

gb|ABD96609.1|  xyloglucan endotransglucosylase XET3                    114   5e-27   Capsicum annuum
ref|XP_006366771.1|  PREDICTED: probable xyloglucan endotransgluc...    113   8e-27   
ref|NP_001234213.1|  xyloglucan endo-transglycosylase precursor         113   9e-27   
gb|ABD96608.1|  xyloglucan endotransglucosylase XET2                    112   2e-26   Capsicum annuum
ref|XP_002526125.1|  Xyloglucan endotransglucosylase/hydrolase pr...    109   2e-26   Ricinus communis
gb|ABD96607.1|  xyloglucan endotransglucosylase XET1                    112   2e-26   Capsicum annuum
ref|NP_001234207.1|  xyloglycan endo-transglycosylase precursor         112   3e-26   
ref|XP_004966139.1|  PREDICTED: probable xyloglucan endotransgluc...    111   4e-26   
ref|NP_001274880.1|  probable xyloglucan endotransglucosylase/hyd...    111   5e-26   
gb|ABV46534.1|  xyloglucan endotransglucosylase hydrolase 2             110   7e-26   
ref|XP_002536055.1|  conserved hypothetical protein                     106   7e-26   Ricinus communis
ref|XP_002519767.1|  Brassinosteroid-regulated protein BRU1 precu...    110   8e-26   Ricinus communis
ref|XP_011082929.1|  PREDICTED: xyloglucan endotransglucosylase/h...    108   1e-25   
ref|XP_011082928.1|  PREDICTED: probable xyloglucan endotransgluc...    109   2e-25   
ref|XP_002536698.1|  conserved hypothetical protein                     106   2e-25   Ricinus communis
ref|XP_011082926.1|  PREDICTED: xyloglucan endotransglucosylase/h...    109   2e-25   
ref|XP_009762863.1|  PREDICTED: brassinosteroid-regulated protein...    109   3e-25   
gb|KDP36430.1|  hypothetical protein JCGZ_08699                         108   3e-25   
ref|XP_009762866.1|  PREDICTED: brassinosteroid-regulated protein...    108   4e-25   
ref|XP_008341405.1|  PREDICTED: brassinosteroid-regulated protein...    108   6e-25   
emb|CDP12752.1|  unnamed protein product                                105   6e-25   
emb|CAA63663.1|  xyloglucan endotransglycosylase (XET)                  108   8e-25   Hordeum vulgare [barley]
gb|ADP94235.2|  xyloglucan endotransglucosylase                         108   8e-25   
gb|AAT94297.1|  endotransglucosylase/hydrolase XTH5                     108   8e-25   Triticum aestivum [Canadian hard winter wheat]
gb|EMT27816.1|  Putative xyloglucan endotransglucosylase/hydrolas...    108   8e-25   
ref|XP_009598236.1|  PREDICTED: brassinosteroid-regulated protein...    107   9e-25   
ref|NP_001151103.1|  xyloglucan endotransglucosylase/hydrolase pr...    107   1e-24   Zea mays [maize]
ref|XP_011082921.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   1e-24   
gb|AFW69275.1|  hypothetical protein ZEAMMB73_374893                    108   1e-24   
ref|XP_011082925.1|  PREDICTED: xyloglucan endotransglucosylase/h...    107   1e-24   
gb|EMS61840.1|  Xyloglucan endotransglucosylase/hydrolase protein 24    106   2e-24   
ref|XP_002536265.1|  conserved hypothetical protein                     104   2e-24   Ricinus communis
ref|XP_002526224.1|  Xyloglucan endotransglucosylase/hydrolase pr...    107   2e-24   Ricinus communis
ref|XP_006657289.1|  PREDICTED: probable xyloglucan endotransgluc...    106   3e-24   
ref|XP_011083272.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   3e-24   
ref|XP_002438935.1|  hypothetical protein SORBIDRAFT_10g028570          106   3e-24   Sorghum bicolor [broomcorn]
ref|XP_004966141.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   3e-24   
ref|XP_011082923.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   3e-24   
ref|XP_011082922.1|  PREDICTED: xyloglucan endotransglucosylase/h...    106   4e-24   
ref|XP_011082924.1|  PREDICTED: xyloglucan endotransglucosylase/h...    105   4e-24   
ref|NP_001058455.2|  Os06g0696400                                       105   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009356633.1|  PREDICTED: brassinosteroid-regulated protein...    106   4e-24   
ref|XP_002273742.2|  PREDICTED: probable xyloglucan endotransgluc...    106   5e-24   Vitis vinifera
ref|XP_009598225.1|  PREDICTED: brassinosteroid-regulated protein...    105   5e-24   
dbj|BAD53910.1|  putative xyloglucan endotransglycosylase               105   5e-24   Oryza sativa Japonica Group [Japonica rice]
emb|CDP18875.1|  unnamed protein product                                103   5e-24   
ref|XP_002437518.1|  hypothetical protein SORBIDRAFT_10g028550          105   6e-24   Sorghum bicolor [broomcorn]
ref|XP_007014176.1|  Xyloglucan endotransglycosylase 6                  105   7e-24   
ref|XP_006656424.1|  PREDICTED: xyloglucan endotransglucosylase/h...    105   7e-24   
ref|XP_008801408.1|  PREDICTED: probable xyloglucan endotransgluc...    105   8e-24   
gb|EAZ02222.1|  hypothetical protein OsI_24317                          105   8e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001058457.1|  Os06g0696600                                       105   8e-24   Oryza sativa Japonica Group [Japonica rice]
gb|ABY79073.1|  xyloglucan xyloglucosyl transferase                     105   8e-24   Hordeum vulgare [barley]
gb|EPS58668.1|  hypothetical protein M569_16144                         105   9e-24   
ref|XP_010102170.1|  putative xyloglucan endotransglucosylase/hyd...    105   1e-23   
ref|NP_001234478.1|  xyloglucan endotransglucosylase-hydrolase XT...    105   1e-23   
ref|XP_010927056.1|  PREDICTED: probable xyloglucan endotransgluc...    104   1e-23   
gb|EYU31577.1|  hypothetical protein MIMGU_mgv1a011275mg                104   1e-23   
gb|AFW69276.1|  xyloglucan endotransglucosylase/hydrolase protein 23    104   1e-23   
ref|NP_001149503.1|  LOC100283129 precursor                             104   1e-23   Zea mays [maize]
ref|NP_001266903.1|  XET precursor                                      104   1e-23   
gb|EYU31576.1|  hypothetical protein MIMGU_mgv1a011220mg                104   1e-23   
ref|XP_010929299.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-23   
ref|XP_008799496.1|  PREDICTED: probable xyloglucan endotransgluc...    104   2e-23   
ref|XP_002535499.1|  conserved hypothetical protein                     102   2e-23   Ricinus communis
ref|XP_007035759.1|  Xyloglucan endotransglucosylase/hydrolase fa...    104   2e-23   
gb|AFW69274.1|  Xyloglucan endo-transglycosylase Xyloglucan endot...    105   2e-23   
ref|XP_011043993.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-23   
ref|XP_011043995.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-23   
ref|XP_011043992.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-23   
ref|XP_009758414.1|  PREDICTED: probable xyloglucan endotransgluc...    104   2e-23   
ref|XP_011043994.1|  PREDICTED: xyloglucan endotransglucosylase/h...    104   2e-23   
ref|XP_002520388.1|  Brassinosteroid-regulated protein BRU1 precu...    103   2e-23   Ricinus communis
ref|XP_008346306.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   2e-23   
ref|XP_010046998.1|  PREDICTED: probable xyloglucan endotransgluc...    103   2e-23   
ref|NP_001105367.1|  xyloglucan endotransglycosylase homolog1 pre...    103   3e-23   Zea mays [maize]
ref|XP_010102168.1|  Xyloglucan endotransglucosylase/hydrolase pr...    104   3e-23   
gb|ACU22849.1|  unknown                                                 102   3e-23   Glycine max [soybeans]
ref|XP_009602932.1|  PREDICTED: probable xyloglucan endotransgluc...    103   3e-23   
gb|KDP35747.1|  hypothetical protein JCGZ_10519                         103   3e-23   
ref|XP_008449536.1|  PREDICTED: brassinosteroid-regulated protein...    103   3e-23   
ref|XP_011082930.1|  PREDICTED: probable xyloglucan endotransgluc...    103   3e-23   
ref|XP_009341025.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   3e-23   
gb|KDP33066.1|  hypothetical protein JCGZ_13603                         103   3e-23   
emb|CDP12751.1|  unnamed protein product                                102   3e-23   
ref|XP_010927057.1|  PREDICTED: probable xyloglucan endotransgluc...    103   3e-23   
ref|XP_009597028.1|  PREDICTED: brassinosteroid-regulated protein...    103   4e-23   
ref|XP_003610142.1|  Xyloglucan endotransglucosylase/hydrolase          103   4e-23   
ref|XP_008223657.1|  PREDICTED: probable xyloglucan endotransgluc...    100   4e-23   
ref|XP_006350013.1|  PREDICTED: probable xyloglucan endotransgluc...    103   4e-23   
ref|XP_009406667.1|  PREDICTED: probable xyloglucan endotransgluc...    103   4e-23   
gb|KCW78735.1|  hypothetical protein EUGRSUZ_C00179                     102   5e-23   
ref|XP_010656826.1|  PREDICTED: probable xyloglucan endotransgluc...    103   5e-23   
ref|XP_002274601.1|  PREDICTED: probable xyloglucan endotransgluc...    103   5e-23   Vitis vinifera
ref|XP_010929301.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   5e-23   
gb|KHN22712.1|  Putative xyloglucan endotransglucosylase/hydrolas...    103   5e-23   
ref|XP_010259797.1|  PREDICTED: xyloglucan endotransglucosylase/h...    103   5e-23   
ref|XP_004140251.1|  PREDICTED: brassinosteroid-regulated protein...    102   5e-23   
gb|ACD03217.1|  xyloglucan endotransglucosylase/hydrolase 7             103   5e-23   Actinidia deliciosa [Chinese gooseberry]
ref|XP_003625289.1|  Xyloglucan endotransglucosylase/hydrolase          102   5e-23   
gb|EMT22597.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    102   6e-23   
ref|XP_003563483.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   6e-23   
ref|XP_010053252.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   6e-23   
gb|EMS64808.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    102   6e-23   
ref|XP_003542156.1|  PREDICTED: probable xyloglucan endotransgluc...    102   6e-23   
ref|XP_002325068.2|  hypothetical protein POPTR_0018s10300g             102   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_007223160.1|  hypothetical protein PRUPE_ppa009417mg             102   7e-23   
gb|EYU29580.1|  hypothetical protein MIMGU_mgv1a018934mg                102   7e-23   
ref|XP_008449534.1|  PREDICTED: brassinosteroid-regulated protein...    102   7e-23   
gb|EYU29581.1|  hypothetical protein MIMGU_mgv1a022262mg                102   7e-23   
ref|XP_009356706.1|  PREDICTED: xyloglucan endotransglucosylase/h...    102   7e-23   
ref|XP_008799439.1|  PREDICTED: probable xyloglucan endotransgluc...    102   8e-23   
ref|XP_010046993.1|  PREDICTED: probable xyloglucan endotransgluc...    102   8e-23   
emb|CDP16009.1|  unnamed protein product                                102   8e-23   
ref|XP_006350014.1|  PREDICTED: probable xyloglucan endotransgluc...    102   8e-23   
ref|XP_004488032.1|  PREDICTED: probable xyloglucan endotransgluc...    102   8e-23   
emb|CAN80251.1|  hypothetical protein VITISV_036641                     102   8e-23   Vitis vinifera
ref|XP_010046992.1|  PREDICTED: probable xyloglucan endotransgluc...    102   8e-23   
ref|XP_007014173.1|  Xyloglucan endotransglycosylase 6                  102   8e-23   
gb|KGN47998.1|  hypothetical protein Csa_6G423400                       102   9e-23   
ref|XP_002520387.1|  Brassinosteroid-regulated protein BRU1 precu...    102   9e-23   Ricinus communis
ref|XP_010046996.1|  PREDICTED: probable xyloglucan endotransgluc...    102   9e-23   
gb|AES92349.2|  xyloglucan endotransglucosylase/hydrolase family ...    102   1e-22   
gb|KCW78732.1|  hypothetical protein EUGRSUZ_C00176                     103   1e-22   
ref|XP_010046997.1|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   
emb|CCH26408.1|  xyloglucan endotransglycosylase                        102   1e-22   
emb|CBI17813.3|  unnamed protein product                                102   1e-22   
ref|NP_001284418.1|  brassinosteroid-regulated protein BRU1-like ...    102   1e-22   
gb|KCW78734.1|  hypothetical protein EUGRSUZ_C00178                     102   1e-22   
ref|XP_004164862.1|  PREDICTED: brassinosteroid-regulated protein...    102   1e-22   
gb|KDP36434.1|  hypothetical protein JCGZ_08703                         102   1e-22   
ref|XP_009390494.1|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   
ref|XP_003549490.2|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   
ref|XP_010241684.1|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   
ref|XP_007014184.1|  Xyloglucan endotransglycosylase 6                  102   1e-22   
ref|XP_010046990.1|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   
ref|XP_007014183.1|  Xyloglucan endotransglycosylase 6                  102   1e-22   
gb|AAC39467.1|  endo-xyloglucan transferase                           98.2    1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103015.1|  putative xyloglucan endotransglucosylase/hyd...    102   1e-22   
ref|XP_007154781.1|  hypothetical protein PHAVU_003G147400g             101   1e-22   
ref|XP_002270182.2|  PREDICTED: probable xyloglucan endotransgluc...    102   1e-22   Vitis vinifera
gb|EMS56986.1|  Xyloglucan endotransglucosylase/hydrolase protein 22    101   1e-22   
ref|XP_006474161.1|  PREDICTED: probable xyloglucan endotransgluc...    101   2e-22   
gb|KDP36435.1|  hypothetical protein JCGZ_08704                         101   2e-22   
ref|XP_007223211.1|  hypothetical protein PRUPE_ppa009346mg             101   2e-22   
ref|XP_008801539.1|  PREDICTED: probable xyloglucan endotransgluc...    101   2e-22   
gb|AAT11860.1|  xyloglucanendotransglycosylase                        98.2    2e-22   Mangifera indica
gb|KCW78733.1|  hypothetical protein EUGRSUZ_C00177                     103   2e-22   
gb|KCW89705.1|  hypothetical protein EUGRSUZ_A01967                     101   2e-22   
ref|XP_009381589.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   2e-22   
ref|NP_001237075.1|  syringolide-induced protein 19-1-5 precursor       101   2e-22   
gb|AGI42457.1|  mutant xyloglucan endotransglycosylase/hydrolase      99.4    2e-22   
ref|NP_001276139.1|  uncharacterized protein LOC102661404 precursor     101   2e-22   
ref|XP_009785048.1|  PREDICTED: probable xyloglucan endotransgluc...    101   2e-22   
ref|XP_009126894.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   2e-22   
ref|XP_008380219.1|  PREDICTED: xyloglucan endotransglucosylase/h...    101   2e-22   
ref|XP_011045331.1|  PREDICTED: brassinosteroid-regulated protein...    100   3e-22   
ref|XP_011045330.1|  PREDICTED: brassinosteroid-regulated protein...    100   3e-22   
ref|XP_009597029.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_011069896.1|  PREDICTED: probable xyloglucan endotransgluc...    101   3e-22   
emb|CDY67487.1|  BnaA02g35250D                                          100   3e-22   
ref|XP_008799438.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_006453414.1|  hypothetical protein CICLE_v10009119mg             100   3e-22   
ref|XP_002318936.2|  putative xyloglucan endotransglycosylase fam...    101   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009344504.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   3e-22   
ref|XP_006453421.1|  hypothetical protein CICLE_v10009118mg             100   3e-22   
ref|XP_004243230.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_002317309.1|  xyloglucan endo-1 family protein                   100   3e-22   Populus trichocarpa [western balsam poplar]
emb|CDY02741.1|  BnaC02g11480D                                          100   3e-22   
ref|XP_006474156.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_002270416.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   Vitis vinifera
ref|XP_002274858.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   3e-22   Vitis vinifera
emb|CDY25903.1|  BnaC09g32750D                                          100   3e-22   
ref|XP_010927058.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_010536006.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   3e-22   
emb|CDY59999.1|  BnaA02g35330D                                          100   3e-22   
ref|XP_008223658.1|  PREDICTED: probable xyloglucan endotransgluc...    100   3e-22   
ref|XP_011026281.1|  PREDICTED: brassinosteroid-regulated protein...    100   4e-22   
ref|XP_011082931.1|  PREDICTED: probable xyloglucan endotransgluc...    100   4e-22   
ref|XP_009356638.1|  PREDICTED: brassinosteroid-regulated protein...    100   4e-22   
ref|XP_010536923.1|  PREDICTED: probable xyloglucan endotransgluc...    100   4e-22   
gb|EYU25733.1|  hypothetical protein MIMGU_mgv1a011641mg                100   4e-22   
ref|XP_003560505.2|  PREDICTED: xyloglucan endotransglucosylase/h...    100   4e-22   
gb|AAN60350.1|  unknown                                               97.1    4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927111.1|  PREDICTED: LOW QUALITY PROTEIN: probable xyl...  98.6    4e-22   
ref|XP_006348946.1|  PREDICTED: probable xyloglucan endotransgluc...    100   4e-22   
gb|AEZ00859.1|  putative xyloglucan endotransglycosylase protein      99.0    4e-22   
ref|XP_008348360.1|  PREDICTED: brassinosteroid-regulated protein...    100   4e-22   
gb|ACJ85154.1|  unknown                                                 100   4e-22   Medicago truncatula
ref|XP_010102169.1|  Brassinosteroid-regulated protein BRU1           99.8    4e-22   
gb|AAF80590.1|AF223419_1  xyloglucan endotransglycosylase XET1          100   5e-22   Asparagus officinalis
ref|NP_001281066.1|  brassinosteroid-regulated protein BRU1-like ...    100   5e-22   
ref|XP_009356637.1|  PREDICTED: brassinosteroid-regulated protein...    100   5e-22   
ref|XP_010047000.1|  PREDICTED: probable xyloglucan endotransgluc...    100   5e-22   
ref|XP_004309952.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   5e-22   
ref|XP_009356635.1|  PREDICTED: probable xyloglucan endotransgluc...    100   5e-22   
gb|AGI42461.1|  xyloglucan endotransglycosylase/hydrolase               100   5e-22   
ref|XP_009356634.1|  PREDICTED: brassinosteroid-regulated protein...    100   5e-22   
ref|XP_009120273.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   5e-22   
gb|AGI42450.1|  xyloglucan endotransglycosylase/hydrolase               100   5e-22   
gb|AFP93557.1|  xyloglucan endotransglycosylase/hydrolase 1             100   5e-22   
ref|XP_007014179.1|  Xyloglucan endotransglycosylase 6 isoform 1        100   5e-22   
ref|XP_002270375.2|  PREDICTED: brassinosteroid-regulated protein...  99.8    6e-22   Vitis vinifera
ref|XP_009378317.1|  PREDICTED: xyloglucan endotransglucosylase/h...    100   6e-22   
gb|AGI42458.1|  xyloglucan endotransglycosylase/hydrolase               100   6e-22   
ref|XP_002302145.2|  hypothetical protein POPTR_0002s06120g             100   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_007014172.1|  Xyloglucan endotransglucosylase/hydrolase fa...    100   6e-22   
gb|AGI42456.1|  xyloglucan endotransglycosylase/hydrolase               100   6e-22   
ref|XP_010670335.1|  PREDICTED: probable xyloglucan endotransgluc...    100   6e-22   
gb|KHN22714.1|  Putative xyloglucan endotransglucosylase/hydrolas...    100   6e-22   
emb|CDP02962.1|  unnamed protein product                                100   6e-22   
gb|EYU20916.1|  hypothetical protein MIMGU_mgv1a011962mg              99.8    6e-22   
ref|XP_008449531.1|  PREDICTED: brassinosteroid-regulated protein...    100   7e-22   
gb|AAA32828.1|  meri-5                                                99.4    7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799440.1|  PREDICTED: probable xyloglucan endotransgluc...    100   7e-22   
ref|XP_002274552.1|  PREDICTED: probable xyloglucan endotransgluc...    100   7e-22   Vitis vinifera
gb|KHG09063.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...    100   7e-22   
ref|XP_007154780.1|  hypothetical protein PHAVU_003G147300g             100   7e-22   
ref|XP_010452475.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.8    7e-22   
ref|XP_010913701.1|  PREDICTED: probable xyloglucan endotransgluc...  99.8    8e-22   
ref|NP_001242530.1|  uncharacterized protein LOC100785313 precursor   99.8    8e-22   
ref|XP_006401194.1|  hypothetical protein EUTSA_v10014326mg           99.8    8e-22   
ref|XP_010443442.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.8    8e-22   
gb|ACU17489.1|  unknown                                               97.4    9e-22   Glycine max [soybeans]
ref|XP_002325067.2|  hypothetical protein POPTR_0018s10290g           99.8    9e-22   Populus trichocarpa [western balsam poplar]
ref|XP_004507927.1|  PREDICTED: probable xyloglucan endotransgluc...  99.8    9e-22   
ref|XP_009120272.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.8    9e-22   
ref|XP_004303860.1|  PREDICTED: probable xyloglucan endotransgluc...  99.8    9e-22   
ref|XP_006387414.1|  hypothetical protein POPTR_1065s00200g           99.4    9e-22   
gb|KHN17581.1|  Putative xyloglucan endotransglucosylase/hydrolas...  99.4    1e-21   
ref|NP_001280908.1|  brassinosteroid-regulated protein BRU1-like ...  99.4    1e-21   
ref|XP_010656825.1|  PREDICTED: probable xyloglucan endotransgluc...  99.4    1e-21   
ref|XP_011023833.1|  PREDICTED: probable xyloglucan endotransgluc...  99.8    1e-21   
ref|XP_010911439.1|  PREDICTED: probable xyloglucan endotransgluc...  99.4    1e-21   
ref|NP_001241948.1|  uncharacterized protein LOC100800017 precursor   99.4    1e-21   
ref|XP_010438197.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.0    1e-21   
emb|CDX68640.1|  BnaC01g08130D                                        99.4    1e-21   
ref|XP_009390493.1|  PREDICTED: probable xyloglucan endotransgluc...  99.0    1e-21   
ref|XP_004164865.1|  PREDICTED: brassinosteroid-regulated protein...  99.4    1e-21   
ref|XP_004140252.1|  PREDICTED: brassinosteroid-regulated protein...  99.4    1e-21   
ref|XP_010433006.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.0    1e-21   
gb|KFK29589.1|  hypothetical protein AALP_AA7G154000                  99.0    1e-21   
ref|XP_002526231.1|  xyloglucan:xyloglucosyl transferase, putative    95.9    1e-21   Ricinus communis
ref|XP_007025220.1|  Xyloglucan endotransglucosylase/hydrolase 16     99.0    1e-21   
ref|XP_006280918.1|  hypothetical protein CARUB_v10026914mg           99.0    1e-21   
ref|XP_006387415.1|  xyloglucan endo-1 family protein                 99.0    1e-21   
ref|NP_194756.1|  xyloglucan endotransglucosylase/hydrolase prote...  99.0    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011044805.1|  PREDICTED: brassinosteroid-regulated protein...  99.4    2e-21   
ref|XP_006284057.1|  hypothetical protein CARUB_v10005183mg           99.4    2e-21   
ref|XP_010927059.1|  PREDICTED: probable xyloglucan endotransgluc...  99.0    2e-21   
ref|XP_002262761.1|  PREDICTED: brassinosteroid-regulated protein...  99.0    2e-21   Vitis vinifera
ref|XP_002526228.1|  Xyloglucan endotransglucosylase/hydrolase pr...  99.0    2e-21   Ricinus communis
ref|XP_010927060.1|  PREDICTED: brassinosteroid-regulated protein...  99.0    2e-21   
ref|XP_002274404.1|  PREDICTED: brassinosteroid-regulated protein...  99.0    2e-21   Vitis vinifera
ref|XP_009127941.1|  PREDICTED: xyloglucan endotransglucosylase/h...  99.0    2e-21   
gb|ACU20598.1|  unknown                                               95.5    2e-21   Glycine max [soybeans]
ref|XP_006412727.1|  hypothetical protein EUTSA_v10025941mg           98.6    2e-21   
ref|XP_002867358.1|  meristem-5                                       98.6    2e-21   
emb|CAN74784.1|  hypothetical protein VITISV_032594                   99.0    2e-21   Vitis vinifera
ref|XP_002306736.2|  xyloglucan endo-1 family protein                 99.0    2e-21   Populus trichocarpa [western balsam poplar]
ref|XP_009108993.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.6    2e-21   
ref|XP_009377621.1|  PREDICTED: brassinosteroid-regulated protein...  99.0    2e-21   
ref|XP_011044804.1|  PREDICTED: brassinosteroid-regulated protein...  99.0    2e-21   
gb|AGI42460.1|  xyloglucan endotransglycosylase/hydrolase             98.6    2e-21   
gb|AGI42451.1|  xyloglucan endotransglycosylase/hydrolase             98.6    2e-21   
ref|XP_004303863.1|  PREDICTED: probable xyloglucan endotransgluc...  98.6    2e-21   
emb|CAN80250.1|  hypothetical protein VITISV_036640                   98.6    2e-21   Vitis vinifera
ref|XP_008236805.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    2e-21   
gb|AGI42454.1|  xyloglucan endotransglycosylase/hydrolase             98.6    2e-21   
gb|AGI42449.1|  xyloglucan endotransglycosylase/hydrolase             98.6    2e-21   
ref|XP_010103020.1|  Xyloglucan endotransglucosylase/hydrolase pr...  98.6    2e-21   
gb|KDO46534.1|  hypothetical protein CISIN_1g023431mg                 98.6    2e-21   
emb|CDY66832.1|  BnaAnng23050D                                        98.2    2e-21   
ref|XP_009380743.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.6    2e-21   
ref|XP_006474155.1|  PREDICTED: probable xyloglucan endotransgluc...  98.6    2e-21   
gb|AEX07595.1|  xyloglucosyl transferase 2                            98.2    2e-21   
gb|AGI42452.1|  xyloglucan endotransglycosylase/hydrolase             98.6    2e-21   
gb|KHG05436.1|  putative xyloglucan endotransglucosylase/hydrolas...  98.6    2e-21   
ref|XP_010259807.1|  PREDICTED: probable xyloglucan endotransgluc...  98.6    2e-21   
ref|XP_006474159.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.2    2e-21   
ref|XP_006474154.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
ref|XP_008229404.1|  PREDICTED: brassinosteroid-regulated protein...  98.2    3e-21   
gb|KHF98175.1|  putative xyloglucan endotransglucosylase/hydrolas...  98.6    3e-21   
ref|XP_009121735.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
ref|XP_002268708.1|  PREDICTED: brassinosteroid-regulated protein...  98.6    3e-21   
ref|XP_009413334.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.2    3e-21   
ref|XP_010525736.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.2    3e-21   
gb|KHN22640.1|  Putative xyloglucan endotransglucosylase/hydrolas...  98.2    3e-21   
gb|ABI84249.1|  syringolide-induced protein 19-1-5                    97.1    3e-21   
ref|NP_001242489.1|  uncharacterized protein LOC100807063 precursor   98.2    3e-21   
ref|XP_007014165.1|  Xyloglucan endotransglucosylase/hydrolase fa...  98.2    3e-21   
ref|XP_010525737.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.2    3e-21   
ref|XP_004303859.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
ref|XP_009139558.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
ref|XP_011043991.1|  PREDICTED: xyloglucan endotransglucosylase/h...  98.2    3e-21   
ref|XP_008781813.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
ref|XP_006453413.1|  hypothetical protein CICLE_v10008951mg           98.6    3e-21   
ref|XP_006453420.1|  hypothetical protein CICLE_v10008778mg           98.6    3e-21   
emb|CDY14905.1|  BnaA02g22470D                                        97.8    3e-21   
emb|CDY03539.1|  BnaC03g67980D                                        98.2    3e-21   
ref|XP_004235156.1|  PREDICTED: probable xyloglucan endotransgluc...  98.2    3e-21   
emb|CDX94413.1|  BnaC01g17710D                                        97.8    4e-21   
ref|XP_010525738.1|  PREDICTED: xyloglucan endotransglucosylase/h...  97.8    4e-21   
ref|XP_002526229.1|  conserved hypothetical protein                   97.8    4e-21   
emb|CDX72228.1|  BnaC07g42500D                                        97.8    4e-21   
ref|XP_002324481.2|  xyloglucan endo-1 family protein                 97.8    4e-21   
ref|XP_002324480.1|  xyloglucan endo-1 family protein                 97.8    4e-21   
ref|XP_011038986.1|  PREDICTED: probable xyloglucan endotransgluc...  97.8    4e-21   
ref|XP_008801577.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    4e-21   
ref|NP_001281042.1|  probable xyloglucan endotransglucosylase/hyd...  97.8    4e-21   
ref|XP_011016785.1|  PREDICTED: probable xyloglucan endotransgluc...  97.8    4e-21   
ref|XP_011026280.1|  PREDICTED: probable xyloglucan endotransgluc...  97.8    4e-21   
ref|XP_010259808.1|  PREDICTED: xyloglucan endotransglucosylase/h...  97.8    4e-21   
gb|AEX07596.1|  xyloglucosyl transferase 1                            97.8    4e-21   
ref|XP_010259802.1|  PREDICTED: probable xyloglucan endotransgluc...  97.8    4e-21   
ref|XP_007221284.1|  hypothetical protein PRUPE_ppa009792mg           97.4    4e-21   
ref|XP_010103021.1|  putative xyloglucan endotransglucosylase/hyd...  97.8    4e-21   
ref|XP_009137907.1|  PREDICTED: xyloglucan endotransglucosylase/h...  97.4    4e-21   
ref|XP_008222773.1|  PREDICTED: brassinosteroid-regulated protein...  97.4    4e-21   
emb|CAN80252.1|  hypothetical protein VITISV_036642                   97.8    5e-21   
emb|CDY39193.1|  BnaA03g50050D                                        97.4    5e-21   
ref|XP_010259803.1|  PREDICTED: probable xyloglucan endotransgluc...  97.8    5e-21   
ref|XP_008801575.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    5e-21   
ref|XP_008380453.1|  PREDICTED: brassinosteroid-regulated protein...  97.4    5e-21   
ref|XP_009377610.1|  PREDICTED: brassinosteroid-regulated protein...  97.8    5e-21   
ref|XP_002307040.2|  xyloglucan endo-1 family protein                 97.4    5e-21   
ref|XP_009373581.1|  PREDICTED: brassinosteroid-regulated protein...  97.4    5e-21   
ref|XP_010545428.1|  PREDICTED: xyloglucan endotransglucosylase/h...  97.4    5e-21   
ref|NP_200564.1|  xyloglucan endotransglucosylase/hydrolase prote...  97.4    5e-21   
ref|XP_008449516.1|  PREDICTED: brassinosteroid-regulated protein...  97.4    5e-21   
ref|XP_007138740.1|  hypothetical protein PHAVU_009G233200g           97.4    5e-21   
ref|XP_008362366.1|  PREDICTED: LOW QUALITY PROTEIN: xyloglucan e...  97.4    5e-21   
ref|XP_006425209.1|  hypothetical protein CICLE_v10010858mg           97.4    5e-21   
ref|XP_008223655.1|  PREDICTED: xyloglucan endotransglucosylase/h...  97.4    5e-21   
ref|XP_010042670.1|  PREDICTED: brassinosteroid-regulated protein...  97.4    6e-21   
ref|XP_008801540.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    6e-21   
ref|XP_004146358.1|  PREDICTED: probable xyloglucan endotransgluc...  97.4    7e-21   
gb|ABM91073.1|  xyloglucan endotransglycosylase/hydrolase precurs...  97.1    7e-21   
ref|XP_004161054.1|  PREDICTED: probable xyloglucan endotransgluc...  97.4    7e-21   
emb|CAD88260.1|  putative xyloglucan endotransglycosylase             97.4    7e-21   
gb|AAM63080.1|  xyloglucan endo-1,4-beta-D-glucanase precursor        97.1    7e-21   
ref|XP_003610009.1|  Xyloglucan endotransglucosylase/hydrolase        94.7    7e-21   
ref|XP_007048841.1|  Xyloglucan endo-transglycosylase, putative       97.4    7e-21   
gb|ACD03220.1|  xyloglucan endotransglucosylase/hydrolase 10          97.1    7e-21   
gb|AFK33537.1|  unknown                                               97.1    7e-21   
gb|KDP36428.1|  hypothetical protein JCGZ_08697                       97.1    7e-21   
ref|XP_002274827.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    7e-21   
ref|XP_002866213.1|  hypothetical protein ARALYDRAFT_918931           97.1    7e-21   
gb|KGN65436.1|  hypothetical protein Csa_1G422450                     94.0    8e-21   
ref|XP_003610153.1|  Xyloglucan endotransglucosylase/hydrolase        97.1    8e-21   
gb|KHN17579.1|  Putative xyloglucan endotransglucosylase/hydrolas...  97.1    8e-21   
ref|NP_001234472.1|  xyloglucan endotransglucosylase-hydrolase XT...  97.1    8e-21   
emb|CDP02959.1|  unnamed protein product                              96.7    8e-21   
ref|XP_010545425.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    8e-21   
ref|XP_004303862.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    9e-21   
emb|CBI17801.3|  unnamed protein product                              97.4    9e-21   
ref|NP_001267579.1|  probable xyloglucan endotransglucosylase/hyd...  97.1    9e-21   
ref|XP_008223830.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    9e-21   
ref|XP_007222107.1|  hypothetical protein PRUPE_ppa009610mg           97.1    9e-21   
ref|XP_010670334.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    9e-21   
ref|XP_010053265.1|  PREDICTED: probable xyloglucan endotransgluc...  97.1    9e-21   
gb|KCW89706.1|  hypothetical protein EUGRSUZ_A01968                   97.1    9e-21   
gb|KHG10045.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...  96.7    9e-21   
ref|XP_010047002.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    9e-21   
ref|XP_008801579.1|  PREDICTED: probable xyloglucan endotransgluc...  97.4    1e-20   
emb|CDP02963.1|  unnamed protein product                              96.7    1e-20   
ref|XP_004235158.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    1e-20   
dbj|BAJ10395.1|  xyloglucan endotransglucosylase/hydrolase            96.7    1e-20   
ref|XP_008229406.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    1e-20   
gb|AFW69278.1|  hypothetical protein ZEAMMB73_629490                  94.0    1e-20   
ref|XP_008229400.1|  PREDICTED: brassinosteroid-regulated protein...  96.7    1e-20   
ref|XP_008223656.1|  PREDICTED: xyloglucan endotransglucosylase/h...  96.3    1e-20   
gb|KFK27295.1|  hypothetical protein AALP_AA8G363900                  96.3    1e-20   
ref|XP_007215773.1|  hypothetical protein PRUPE_ppa009608mg           96.3    1e-20   
gb|KDP36433.1|  hypothetical protein JCGZ_08702                       96.3    1e-20   
ref|XP_003542150.1|  PREDICTED: probable xyloglucan endotransgluc...  96.3    1e-20   
ref|XP_010668001.1|  PREDICTED: probable xyloglucan endotransgluc...  96.3    1e-20   
emb|CAN83588.1|  hypothetical protein VITISV_004806                   96.3    1e-20   
ref|XP_010911419.1|  PREDICTED: xyloglucan endotransglucosylase/h...  96.3    1e-20   
ref|XP_008223719.1|  PREDICTED: xyloglucan endotransglucosylase/h...  96.3    1e-20   
ref|XP_008453618.1|  PREDICTED: probable xyloglucan endotransgluc...  96.7    1e-20   
ref|XP_009417169.1|  PREDICTED: probable xyloglucan endotransgluc...  96.3    1e-20   
ref|NP_001289204.1|  probable xyloglucan endotransglucosylase/hyd...  96.3    1e-20   
ref|XP_008229403.1|  PREDICTED: brassinosteroid-regulated protein...  96.3    1e-20   
dbj|BAE06062.1|  xyloglucan endotransglucosylase/hydrolase            96.7    2e-20   
ref|XP_006453416.1|  hypothetical protein CICLE_v10010531mg           95.9    2e-20   
gb|KHG09882.1|  Xyloglucan endotransglucosylase/hydrolase 22 -lik...  95.9    2e-20   
gb|AAF80591.1|AF223420_1  xyloglucan endotransglycosylase XET2        95.9    2e-20   
ref|XP_007154667.1|  hypothetical protein PHAVU_003G137600g           95.9    2e-20   
dbj|BAH36874.1|  xyloglucan endotransglucosylase/hydrolase            95.9    2e-20   
ref|XP_010932220.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.9    2e-20   
gb|KHG21666.1|  putative xyloglucan endotransglucosylase/hydrolas...  95.9    2e-20   
ref|XP_011016106.1|  PREDICTED: brassinosteroid-regulated protein...  95.9    2e-20   
ref|XP_002321087.1|  brassinosteroid-regulated family protein         95.9    2e-20   
ref|XP_004161045.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.9    2e-20   
ref|XP_002530540.1|  conserved hypothetical protein                   94.4    2e-20   
ref|XP_003549488.1|  PREDICTED: probable xyloglucan endotransgluc...  95.9    2e-20   
ref|XP_002270973.2|  PREDICTED: brassinosteroid-regulated protein...  95.9    2e-20   
ref|XP_004146309.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.9    2e-20   
ref|XP_004507837.1|  PREDICTED: probable xyloglucan endotransgluc...  95.9    2e-20   
ref|XP_011018193.1|  PREDICTED: probable xyloglucan endotransgluc...  95.9    2e-20   
ref|XP_002267890.2|  PREDICTED: brassinosteroid-regulated protein...  95.5    2e-20   
ref|XP_007154784.1|  hypothetical protein PHAVU_003G147700g           95.5    2e-20   
gb|KDO46535.1|  hypothetical protein CISIN_1g023581mg                 95.5    2e-20   
ref|XP_004293654.1|  PREDICTED: probable xyloglucan endotransgluc...  95.9    2e-20   
ref|XP_010103016.1|  putative xyloglucan endotransglucosylase/hyd...  95.5    2e-20   
ref|XP_002302146.2|  xyloglucan endo-1 family protein                 95.5    2e-20   
emb|CBI17811.3|  unnamed protein product                              99.4    3e-20   
ref|XP_004140250.1|  PREDICTED: probable xyloglucan endotransgluc...  95.5    3e-20   
ref|XP_003610008.1|  Xyloglucan endotransglucosylase/hydrolase        95.5    3e-20   
gb|AGI42459.1|  xyloglucan endotransglycosylase/hydrolase             95.5    3e-20   
ref|XP_008229402.1|  PREDICTED: brassinosteroid-regulated protein...  95.5    3e-20   
ref|NP_001267702.1|  probable xyloglucan endotransglucosylase/hyd...  95.5    3e-20   
ref|XP_006412723.1|  hypothetical protein EUTSA_v10025933mg           95.5    3e-20   
gb|KGN47997.1|  hypothetical protein Csa_6G423390                     95.5    3e-20   
gb|AFK40376.1|  unknown                                               95.5    3e-20   
ref|XP_011043999.1|  PREDICTED: probable xyloglucan endotransgluc...  95.5    3e-20   
ref|XP_008453623.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.5    3e-20   
ref|XP_007215791.1|  hypothetical protein PRUPE_ppa009863mg           95.1    3e-20   
ref|XP_004164863.1|  PREDICTED: brassinosteroid-regulated protein...  95.5    3e-20   
ref|NP_001284443.1|  probable xyloglucan endotransglucosylase/hyd...  95.1    3e-20   
ref|XP_004165696.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.5    3e-20   
gb|AFK47685.1|  unknown                                               95.1    3e-20   
gb|KHN38312.1|  Putative xyloglucan endotransglucosylase/hydrolas...  95.1    3e-20   
ref|XP_010243150.1|  PREDICTED: brassinosteroid-regulated protein...  95.1    3e-20   
ref|XP_010929300.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    3e-20   
ref|XP_004309954.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    3e-20   
gb|ACD03219.1|  xyloglucan endotransglucosylase/hydrolase 9           95.1    3e-20   
ref|XP_004303861.1|  PREDICTED: probable xyloglucan endotransgluc...  95.5    3e-20   
ref|XP_003518514.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    3e-20   
gb|KHG13977.1|  putative xyloglucan endotransglucosylase/hydrolas...  94.7    3e-20   
gb|AFK47205.1|  unknown                                               95.1    3e-20   
ref|XP_009394877.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    3e-20   
ref|XP_011043998.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    3e-20   
ref|XP_011079307.1|  PREDICTED: probable xyloglucan endotransgluc...  95.5    3e-20   
ref|XP_004146306.1|  PREDICTED: xyloglucan endotransglucosylase/h...  95.1    4e-20   
ref|XP_009380745.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    4e-20   
ref|XP_007217342.1|  hypothetical protein PRUPE_ppa020825mg           94.7    4e-20   
ref|XP_002518632.1|  Brassinosteroid-regulated protein BRU1 precu...  95.1    4e-20   
gb|AFK49256.1|  unknown                                               94.4    4e-20   
dbj|BAH36875.1|  xyloglucan endotransglucosylase/hydrolase            95.1    4e-20   
ref|XP_011044000.1|  PREDICTED: probable xyloglucan endotransgluc...  95.1    4e-20   
ref|XP_006409111.1|  hypothetical protein EUTSA_v10023177mg           95.1    4e-20   
gb|KHN11956.1|  Putative xyloglucan endotransglucosylase/hydrolas...  95.1    4e-20   
ref|XP_007215793.1|  hypothetical protein PRUPE_ppa009871mg           94.7    4e-20   
gb|EYU20918.1|  hypothetical protein MIMGU_mgv1a011123mg              95.1    4e-20   
ref|XP_008229405.1|  PREDICTED: brassinosteroid-regulated protein...  95.1    4e-20   
ref|XP_003545148.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    4e-20   
ref|XP_006360667.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    4e-20   
dbj|BAD93484.1|  pollen major allergen No.121 isoform 1               94.7    4e-20   
ref|XP_010656914.1|  PREDICTED: brassinosteroid-regulated protein...  93.2    4e-20   
ref|XP_009343827.1|  PREDICTED: brassinosteroid-regulated protein...  94.7    4e-20   
ref|XP_002270299.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
ref|XP_004507835.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
ref|XP_009344503.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
ref|XP_007034180.1|  Xyloglucan endotransglucosylase/hydrolase 16     94.7    5e-20   
ref|XP_003610141.1|  Xyloglucan endotransglucosylase/hydrolase        94.7    5e-20   
ref|XP_010536922.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
gb|AAR37363.1|  xyloglucan endo-transglycosylase                      94.4    5e-20   
ref|XP_002869654.1|  hypothetical protein ARALYDRAFT_354208           94.7    5e-20   
gb|ABL10090.1|  xyloglucan endotransglycosylase                       94.7    5e-20   
ref|XP_009401564.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
ref|XP_009341028.1|  PREDICTED: probable xyloglucan endotransgluc...  94.7    5e-20   
ref|NP_194311.1|  probable xyloglucan endotransglucosylase/hydrol...  94.7    5e-20   
gb|KFK27294.1|  hypothetical protein AALP_AA8G363800                  94.7    5e-20   
ref|XP_004502259.1|  PREDICTED: brassinosteroid-regulated protein...  94.4    5e-20   
gb|KDP32580.1|  hypothetical protein JCGZ_13130                       94.4    6e-20   
emb|CDY68968.1|  BnaAnng28970D                                        92.4    6e-20   
gb|AEQ37175.1|  xyloglucan endotransglucosylase/hydrolase             94.4    6e-20   
ref|XP_002266082.1|  PREDICTED: brassinosteroid-regulated protein...  94.4    6e-20   
ref|XP_008680972.1|  PREDICTED: xyloglucan endotransglucosylase/h...  94.4    6e-20   
ref|XP_004235157.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    7e-20   
ref|XP_008796499.1|  PREDICTED: xyloglucan endotransglucosylase/h...  94.4    7e-20   
gb|ACJ85206.1|  unknown                                               92.8    7e-20   
ref|XP_008801542.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    7e-20   
ref|XP_007224386.1|  hypothetical protein PRUPE_ppa021675mg           94.4    7e-20   
ref|XP_010433588.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    7e-20   
gb|EAZ38144.1|  hypothetical protein OsJ_22495                        94.0    7e-20   
ref|XP_008225386.1|  PREDICTED: brassinosteroid-regulated protein...  94.4    7e-20   
ref|XP_007211780.1|  hypothetical protein PRUPE_ppa009685mg           94.4    7e-20   
ref|NP_001130486.1|  xyloglucan endotransglucosylase/hydrolase pr...  94.4    7e-20   
ref|XP_011094075.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    7e-20   
gb|KDP36436.1|  hypothetical protein JCGZ_08705                       94.4    7e-20   
ref|XP_011079309.1|  PREDICTED: xyloglucan endotransglucosylase/h...  94.4    7e-20   
gb|AHE13905.1|  xyloglucan endotransglucosylase/hydrolase 8           94.4    7e-20   
gb|ABM91071.1|  xyloglucan endotransglycosylase/hydrolase precurs...  94.4    7e-20   
ref|XP_006358259.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    8e-20   
ref|XP_007226935.1|  hypothetical protein PRUPE_ppa015713mg           94.0    8e-20   
ref|XP_011024784.1|  PREDICTED: brassinosteroid-regulated protein...  94.0    8e-20   
ref|XP_002301752.1|  brassinosteroid-regulated family protein         94.0    8e-20   
ref|XP_010526338.1|  PREDICTED: probable xyloglucan endotransgluc...  94.4    9e-20   
ref|XP_004966138.1|  PREDICTED: probable xyloglucan endotransgluc...  94.0    9e-20   
ref|XP_008229401.1|  PREDICTED: brassinosteroid-regulated protein...  94.0    9e-20   
emb|CDY25904.1|  BnaC09g32760D                                        94.0    9e-20   
ref|NP_001284442.1|  xyloglucan endotransglucosylase/hydrolase pr...  94.0    9e-20   
gb|EYU42434.1|  hypothetical protein MIMGU_mgv1a023025mg              94.0    9e-20   
ref|XP_011006106.1|  PREDICTED: brassinosteroid-regulated protein...  94.0    1e-19   
ref|XP_006284247.1|  hypothetical protein CARUB_v10005412mg           94.0    1e-19   
gb|AIJ10712.1|  xyloglucan endotransglucosylase/hydrolase 3           94.0    1e-19   
gb|AET05161.2|  xyloglucan endotransglucosylase/hydrolase family ...  93.6    1e-19   



>gb|ABD96609.1| xyloglucan endotransglucosylase XET3 [Capsicum annuum]
Length=287

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  20   NFYQDATVTFGDHRAQIQDGGRVLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  536  TVTTFY  553
            TVTTFY
Sbjct  80   TVTTFY  85



>ref|XP_006366771.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
 ref|XP_006366772.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15-like [Solanum tuberosum]
Length=287

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  20   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  536  TVTTFY  553
            TVTTFY
Sbjct  80   TVTTFY  85



>ref|NP_001234213.1| xyloglucan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58003.1| xyloglucan endo-transglycosylase [Solanum lycopersicum]
Length=289

 Score =   113 bits (283),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  22   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  81

Query  536  TVTTFY  553
            TVTTFY
Sbjct  82   TVTTFY  87



>gb|ABD96608.1| xyloglucan endotransglucosylase XET2 [Capsicum annuum]
Length=288

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG++ AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  21   NFYQDATVTFGDQRAQIQDGGRVFALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  80

Query  536  TVTTFY  553
            TVTTFY
Sbjct  81   TVTTFY  86



>ref|XP_002526125.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36261.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=182

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  26   GNIYQDVDITWGDGRGEILNNGNIVTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNSA  85

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  86   GTVTTFY  92



>gb|ABD96607.1| xyloglucan endotransglucosylase XET1 [Capsicum annuum]
Length=287

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  20   NFYQDTTVTFGDQRAQIQDGGRILALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  536  TVTTFY  553
            TVTTFY
Sbjct  80   TVTTFY  85



>ref|NP_001234207.1| xyloglycan endo-transglycosylase precursor [Solanum lycopersicum]
 emb|CAA58002.1| xyloglycan endo-transglycosylase [Solanum lycopersicum]
Length=287

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG+++ L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  20   NFYQDAAVTFGDQRAQIQDGGRLLTLSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  536  TVTTFY  553
            TVTTFY
Sbjct  80   TVTTFY  85



>ref|XP_004966139.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Setaria italica]
Length=294

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  308  LCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  487
            LC  +       + AGNFYQD  + +G+GRG++LDGG+++ L +D+ SGSGFQSKN+YL+
Sbjct  20   LCSAVLLLAGGASAAGNFYQDVDITWGDGRGKILDGGQLLTLSMDRSSGSGFQSKNQYLY  79

Query  488  GRFDMQLKLVPGNSAGTVTTFY  553
            GRFDMQLKLVPG+SAGTVTTFY
Sbjct  80   GRFDMQLKLVPGDSAGTVTTFY  101



>ref|NP_001274880.1| probable xyloglucan endotransglucosylase/hydrolase protein 15-like 
precursor [Solanum tuberosum]
 emb|CAJ77496.1| putative xyloglucan endotransglycosylase precursor [Solanum tuberosum]
Length=287

 Score =   111 bits (277),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + FG+ R Q+ DGG+++AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSAG
Sbjct  20   NFYQDATVTFGDQRAQIQDGGRLLALSLDKISGSGFQSKNEYLFGRFDMQLKLVPGNSAG  79

Query  536  TVTTF  550
            TVTTF
Sbjct  80   TVTTF  84



>gb|ABV46534.1| xyloglucan endotransglucosylase hydrolase 2 [Bambusa oldhamii]
Length=280

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQDA+M +G GRG+V+DGG+ + L LD+ SGSGFQSKNEYLFG+ DMQ++LVPGNSA
Sbjct  13   GNFYQDAEMSWGQGRGKVVDGGRGLDLTLDRSSGSGFQSKNEYLFGKIDMQIRLVPGNSA  72

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  73   GTVTTFY  79



>ref|XP_002536055.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26328.1| conserved hypothetical protein [Ricinus communis]
Length=97

 Score =   106 bits (264),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  30   GNIYQDVDITWGDGRGKILNNGNVVTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  90   GTVTIFY  96



>ref|XP_002519767.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42740.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=272

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRGQ++DGG +++L LDK+SGSGFQS  EYLFGRFD+Q+KLVPGNSA
Sbjct  21   GNFYQDVDITWGSGRGQIMDGGNLLSLTLDKDSGSGFQSNKEYLFGRFDVQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>ref|XP_011082929.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Sesamum indicum]
Length=199

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+M+ L LDK SGSGFQSKNEYLFGRFD+QLKLVPG+SA
Sbjct  68   ADFYRDAEITWGDGRAKILEGGRMLTLSLDKNSGSGFQSKNEYLFGRFDLQLKLVPGDSA  127

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  128  GTVTTFF  134



>ref|XP_011082928.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 isoform X2 [Sesamum indicum]
Length=274

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+M+ L LD++SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  30   ADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGFQSKNEYLFGRFDLQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  90   GTVTTFF  96



>ref|XP_002536698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF25685.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  30   GNIYQDVDITWGDGRGKILNNGNVVTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  90   GTVTIFY  96



>ref|XP_011082926.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Sesamum indicum]
Length=292

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+M+ L LD++SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  30   ADFYRDAEITWGDGRAKILEGGRMLTLSLDQQSGSGFQSKNEYLFGRFDLQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  90   GTVTTFF  96



>ref|XP_009762863.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
sylvestris]
Length=290

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  469
            SS  L LC+I++  L+A +  GNFY+DA + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSVMLLLCIIMSIQLLAASA-GNFYRDAVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  470  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>gb|KDP36430.1| hypothetical protein JCGZ_08699 [Jatropha curcas]
Length=285

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD  + +G+GRG++L+ G +I L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  26   ANFYQDVDITWGDGRGKILNNGNLITLSLDKYSGSGFQSKNEYLFGKFDMQLKLVPGNSA  85

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  86   GTVTTFY  92



>ref|XP_009762866.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009762867.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009762869.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X3 [Nicotiana sylvestris]
Length=290

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+DA + +G GRG++ +GG+ +AL LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSA
Sbjct  26   GNFYRDAVITWGEGRGKIQEGGRGLALTLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>ref|XP_008341405.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=294

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + FG+GR ++LDGGK++ L LD+ SGSGF+SKNEYLFGR DMQ+KLVPGNSA
Sbjct  28   GNFYQDFDVTFGDGRAKILDGGKLLTLNLDQVSGSGFKSKNEYLFGRIDMQIKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  88   GTVTTYY  94



>emb|CDP12752.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD    FG+ R ++L+GG+++ L LDK SGSGFQSKNEYLFGRFDMQLKL+PGNSA
Sbjct  28   GNFYQDVTQNFGDQRFKILEGGQLLTLSLDKTSGSGFQSKNEYLFGRFDMQLKLIPGNSA  87

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  88   GTVATFY  94



>emb|CAA63663.1| xyloglucan endotransglycosylase (XET) [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ98866.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  21   GNFFQDSEMSWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>gb|ADP94235.2| xyloglucan endotransglucosylase [Cenchrus americanus]
Length=291

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G+GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  25   GNFYQDTEMTWGDGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  85   GTVTTFY  91



>gb|AAT94297.1| endotransglucosylase/hydrolase XTH5 [Triticum aestivum]
Length=287

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  21   GNFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGKIDMQIKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>gb|EMT27816.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Aegilops tauschii]
Length=287

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  21   GNFFQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKTEYLFGKIDMQIKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>ref|XP_009598236.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   107 bits (268),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  469
            SS  L LC++++  L+A +  GNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSAMLLLCILMSIQLLAASA-GNFYRDTVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  470  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>ref|NP_001151103.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 gb|ACG41635.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
Length=294

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G+GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  25   GNFYQDTEMTWGDGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  85   GTVTTFY  91



>ref|XP_011082921.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  290  SSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  469
            ++N + L  ++  +  A   AGNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQS
Sbjct  10   AANSVLLSAVVVLASFAAPSAGNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQS  69

Query  470  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            KNEYLFGRFD+QLKLVPGNSAGTVTTF+
Sbjct  70   KNEYLFGRFDLQLKLVPGNSAGTVTTFF  97



>gb|AFW69275.1| hypothetical protein ZEAMMB73_374893 [Zea mays]
Length=394

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLVPG+SA
Sbjct  119  GNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLVPGDSA  178

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  179  GTVATFY  185



>ref|XP_011082925.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  32   GNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  92   GTVTTFF  98



>gb|EMS61840.1| Xyloglucan endotransglucosylase/hydrolase protein 24 [Triticum 
urartu]
Length=233

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD++M +G+GRG+V+DGG+ + L LDK SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  11   GNFIQDSEMTWGDGRGKVVDGGRGLDLTLDKTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  70

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  71   GTVTTFY  77



>ref|XP_002536265.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26118.1| conserved hypothetical protein [Ricinus communis]
Length=156

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GR ++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  30   GNIYQDVDITWGDGRDKILNNGNVVTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  90   GTVTIFY  96



>ref|XP_002526224.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
 gb|EEF36165.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, 
putative [Ricinus communis]
Length=295

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+ RG++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGNSA
Sbjct  30   GNFYQDVDITWGDERGKMLNNGNVVTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  90   GTVTTFY  96



>ref|XP_006657289.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Oryza brachyantha]
Length=288

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            S+   L + M + + L+  A AGNFYQD  + +G+GRG++L  G+++ L LD+ SGSGFQ
Sbjct  5    STGRALAVAMTLCSVLLLAAAAGNFYQDVDITWGDGRGKILGDGQLLTLSLDRSSGSGFQ  64

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKN+YL+GRFDMQ+KLVPGNSAGTV TFY
Sbjct  65   SKNQYLYGRFDMQIKLVPGNSAGTVATFY  93



>ref|XP_011083272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Sesamum indicum]
Length=278

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+M+ L LD+ SGSGFQSKNEY+FGRFD+QLKLVPGNSA
Sbjct  30   ADFYRDAEITWGDGRAKILEGGRMLTLLLDQNSGSGFQSKNEYMFGRFDLQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  90   GTVTTFF  96



>ref|XP_002438935.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
 gb|EER90302.1| hypothetical protein SORBIDRAFT_10g028570 [Sorghum bicolor]
Length=288

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L+ G+++ L +D+ SGSGFQSK++YL+GRFDMQLKLVPGNSA
Sbjct  30   GNFYQDVDITWGDGRGKILNNGQLLTLSMDRSSGSGFQSKSQYLYGRFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  90   GTVTTFY  96



>ref|XP_004966141.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Setaria italica]
Length=292

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQS++EYLFG+ DMQ+KLVPGNSA
Sbjct  23   GNFYQDTEMTWGGGRGKVVDGGRGLDLTLDRTSGSGFQSRSEYLFGKIDMQIKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  83   GTVTTFY  89



>ref|XP_011082923.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYL+GRFD+QLKLVPGNSA
Sbjct  32   GNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  92   GTVTTFF  98



>ref|XP_011082922.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=287

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYL+GRFD+QLKLVPGNSA
Sbjct  31   GNFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLYGRFDLQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  91   GTVTTFF  97



>ref|XP_011082924.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase 2-like [Sesamum 
indicum]
Length=288

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY+DA++ +G+GR ++L+GG+ ++L LD+ SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  32   ANFYRDAEITWGDGRAKILEGGRGLSLSLDQYSGSGFQSKNEYLFGRFDLQLKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  92   GTVTTFF  98



>ref|NP_001058455.2| Os06g0696400 [Oryza sativa Japonica Group]
 dbj|BAF20369.2| Os06g0696400 [Oryza sativa Japonica Group]
Length=259

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QDA++ +G GRG+++DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  11   GNFFQDAEVSWGQGRGKIVDGGRGLDLTLDRSSGSGFQSKSEYLFGKIDMQIKLVPGNSA  70

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  71   GTVTTFY  77



>ref|XP_009356633.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=294

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + FG+GR ++LD GK++ L LD+ SGSGF+SKNEYLFGR DMQ+KLVPGNSA
Sbjct  28   GNFYQDFDITFGDGRAKILDRGKLLTLNLDQVSGSGFKSKNEYLFGRIDMQIKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  88   GTVTTYY  94



>ref|XP_002273742.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            SS+    L M +  S +  A AGNFYQD  + +G+GRG++L+ G+++ L LDK SGSGFQ
Sbjct  8    SSAVSTALLMSVVVSFLMAASAGNFYQDFDITWGDGRGKILNNGELLTLSLDKPSGSGFQ  67

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  68   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  96



>ref|XP_009598225.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=290

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQS  469
            SS  L LC++++  L+A +  GNFY D  + +G GRG++ +GG+ +AL LDK SGSGFQS
Sbjct  6    SSAMLLLCILMSIQLLAASA-GNFYGDTVITWGEGRGKIQEGGRGLALTLDKLSGSGFQS  64

Query  470  KNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            KNEYLFGRFDMQLKLVPGNSAGTVTTF+
Sbjct  65   KNEYLFGRFDMQLKLVPGNSAGTVTTFF  92



>dbj|BAD53910.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD54446.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 gb|EAZ02220.1| hypothetical protein OsI_24315 [Oryza sativa Indica Group]
 gb|EAZ38140.1| hypothetical protein OsJ_22491 [Oryza sativa Japonica Group]
 dbj|BAG89831.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97023.1| unnamed protein product [Oryza sativa Japonica Group]
Length=293

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QDA++ +G GRG+++DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  21   GNFFQDAEVSWGQGRGKIVDGGRGLDLTLDRSSGSGFQSKSEYLFGKIDMQIKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>emb|CDP18875.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD    FG+ R ++L+GG+++ L LDK SGSGFQSKNEYLFGRFDMQLKL+ GNSA
Sbjct  28   GNFYQDVAQTFGDQRFKILEGGQLLTLSLDKTSGSGFQSKNEYLFGRFDMQLKLISGNSA  87

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  88   GTVATFY  94



>ref|XP_002437518.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
 gb|EER88885.1| hypothetical protein SORBIDRAFT_10g028550 [Sorghum bicolor]
Length=292

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  22   GNFYKDTEMTWGQGRGKVVDGGRGLDLTLDRTSGSGFQSKSEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_007014176.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31795.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=293

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYL+G+FDMQLKLVPGNSA
Sbjct  30   GNFYQDVDITWGDGRGKILNSGQLLTLSLDKASGSGFQSRNEYLYGKFDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>ref|XP_006656424.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Oryza brachyantha]
Length=290

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QDA++ +G  RG+++DGG+ + L LD+ SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  22   GNFFQDAEISWGQDRGKIVDGGRGLDLTLDRSSGSGFQSKNEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_008801408.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=283

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD Q+ +G GR Q+L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  19   GNFHQDFQITWGEGRAQILENGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>gb|EAZ02222.1| hypothetical protein OsI_24317 [Oryza sativa Indica Group]
Length=288

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L  G+++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPGNSA
Sbjct  30   GNFYQDVDITWGDGRGKILGNGQLLTLSLDRSSGSGFQSKNQYLYGRFDMQIKLVPGNSA  89

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  90   GTVATFY  96



>ref|NP_001058457.1| Os06g0696600 [Oryza sativa Japonica Group]
 dbj|BAD53913.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAD54449.1| putative xyloglucan endotransglycosylase [Oryza sativa Japonica 
Group]
 dbj|BAF20371.1| Os06g0696600 [Oryza sativa Japonica Group]
 gb|EAZ38142.1| hypothetical protein OsJ_22493 [Oryza sativa Japonica Group]
 dbj|BAG97451.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L  G+++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPGNSA
Sbjct  30   GNFYQDVDITWGDGRGKILGNGQLLTLSLDRSSGSGFQSKNQYLYGRFDMQIKLVPGNSA  89

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  90   GTVATFY  96



>gb|ABY79073.1| xyloglucan xyloglucosyl transferase [Hordeum vulgare]
 dbj|BAJ96173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L GG ++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPG+SA
Sbjct  28   GNFYQDVDITWGDGRGKILGGGDLLTLSLDRASGSGFQSKNQYLYGRFDMQIKLVPGDSA  87

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  88   GTVATFY  94



>gb|EPS58668.1| hypothetical protein M569_16144, partial [Genlisea aurea]
Length=273

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY D  + +G+GR Q+LD G  + L LDK SGSGFQS+N+YLFGRFDMQLKLVPGNSA
Sbjct  15   ANFYSDVDVTWGDGRAQILDSGNELTLSLDKSSGSGFQSRNQYLFGRFDMQLKLVPGNSA  74

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  75   GTVTTFF  81



>ref|XP_010102170.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
 gb|EXB92420.1| putative xyloglucan endotransglucosylase/hydrolase protein 16 
[Morus notabilis]
Length=289

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+ R Q+L+GG+++ L LDK SGSGFQSKNEYLFGR DMQ+KLVPGNSA
Sbjct  22   GNFYQDFDITWGDHRAQILNGGQLLTLNLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>ref|NP_001234478.1| xyloglucan endotransglucosylase-hydrolase XTH9 precursor [Solanum 
lycopersicum]
 gb|AAS46244.1| xyloglucan endotransglucosylase-hydrolase XTH9 [Solanum lycopersicum]
Length=290

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNEYLFGRFDMQLKLVP NSA
Sbjct  26   GNFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEYLFGRFDMQLKLVPKNSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>ref|XP_010927056.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=277

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GRG++LD G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  20   GNFYQEFDITWGDGRGKILDNGQLLTLALDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  80   GTVTAYY  86



>gb|EYU31577.1| hypothetical protein MIMGU_mgv1a011275mg [Erythranthe guttata]
Length=287

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+ ++L LD  SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  19   ADFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  79   GTVTTFF  85



>gb|AFW69276.1| xyloglucan endotransglucosylase/hydrolase protein 23 [Zea mays]
Length=290

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ +MQ+KLVPGNSA
Sbjct  23   GNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYLFGKIEMQMKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  83   GTVTTLY  89



>ref|NP_001149503.1| LOC100283129 precursor [Zea mays]
 gb|ACG35648.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
Length=290

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ +MQ+KLVPGNSA
Sbjct  23   GNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYLFGKIEMQMKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  83   GTVTTLY  89



>ref|NP_001266903.1| XET precursor [Zea mays]
 gb|ADB54615.1| XET [Zea mays]
Length=290

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD +M +G GRG+V+DGG+ + L LD+ SGSGFQSK+EYLFG+ +MQ+KLVPGNSA
Sbjct  23   GNFYQDTEMTWGQGRGKVVDGGRGLDLSLDRASGSGFQSKDEYLFGKIEMQMKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  83   GTVTTLY  89



>gb|EYU31576.1| hypothetical protein MIMGU_mgv1a011220mg [Erythranthe guttata]
Length=288

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +FY+DA++ +G+GR ++L+GG+ ++L LD  SGSGFQSKNEYLFGRFD+QLKLVPGNSA
Sbjct  20   ADFYRDAEITWGDGRAKILEGGRALSLSLDNYSGSGFQSKNEYLFGRFDIQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  80   GTVTTFF  86



>ref|XP_010929299.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=299

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++LDGG+++ L LDK SGSGFQSKN+YLFG+ DMQ+KLVPGNSA
Sbjct  35   GNFYQDFDITWGDGRAKILDGGQLVTLSLDKTSGSGFQSKNQYLFGKIDMQIKLVPGNSA  94

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  95   GTVTAYY  101



>ref|XP_008799496.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=306

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD Q+ +G+GR Q+L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQL+LVPGNSA
Sbjct  19   GNFHQDFQITWGDGRAQILENGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLRLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_002535499.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26884.1| conserved hypothetical protein [Ricinus communis]
Length=190

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G+FYQD  + +G+G G++L+ G ++ L LDK SGSGFQSKNEYLFG+FDMQLKLVPGN A
Sbjct  30   GDFYQDVDITWGDGCGKILNNGNVLTLSLDKASGSGFQSKNEYLFGKFDMQLKLVPGNYA  89

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  90   GTVTTFY  96



>ref|XP_007035759.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY06685.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            +SS  L L M +       A A NFYQD  + +G+GRG++++ G+++ L LDK SGSGFQ
Sbjct  4    TSSLNLPLLMSLVIGCPVAASASNFYQDFDITWGDGRGKIVNNGEVLTLSLDKASGSGFQ  63

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  92



>gb|AFW69274.1| Xyloglucan endo-transglycosylase Xyloglucan endotransglucosylase/hydrolase 
protein 23 [Zea mays]
Length=377

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLVPG+SA
Sbjct  119  GNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLVPGDSA  178

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  179  GTVATFY  185



>ref|XP_011043993.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X2 [Populus euphratica]
Length=326

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G FYQD  + +G+GR ++L+ G ++ L LD+ SGSGFQSKNEYLFG+FD+QLKLVPGNSA
Sbjct  31   GTFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYLFGKFDIQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>ref|XP_011043995.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X4 [Populus euphratica]
Length=291

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G FYQD  + +G+GR ++L+ G ++ L LD+ SGSGFQSKNEYLFG+FD+QLKLVPGNSA
Sbjct  31   GTFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYLFGKFDIQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>ref|XP_011043992.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X1 [Populus euphratica]
Length=327

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G FYQD  + +G+GR ++L+ G ++ L LD+ SGSGFQSKNEYLFG+FD+QLKLVPGNSA
Sbjct  31   GTFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYLFGKFDIQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>ref|XP_009758414.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana sylvestris]
Length=291

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY  A + +G GRG++ +GG+ ++L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSA
Sbjct  26   GNFYNLADITWGEGRGKITEGGRGLSLSLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>ref|XP_011043994.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like isoform X3 [Populus euphratica]
Length=292

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G FYQD  + +G+GR ++L+ G ++ L LD+ SGSGFQSKNEYLFG+FD+QLKLVPGNSA
Sbjct  31   GTFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYLFGKFDIQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>ref|XP_002520388.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42004.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+   + +G+ RG++L+GG+++ L LDK SGSGFQSKNEYLFGR DMQ+KLVPGNSA
Sbjct  22   GNFYKHFDITWGDHRGKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_008346306.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like isoform X1 [Malus domestica]
Length=277

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD Q+ +G+GRG++L+  +++ L LDK SGSGFQS N+YLFG+ DMQ+KLVPGNSA
Sbjct  11   GNFYQDIQVTWGDGRGKILNNSELLTLSLDKSSGSGFQSTNQYLFGKIDMQIKLVPGNSA  70

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  71   GTVTTYY  77



>ref|XP_010046998.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRGQ+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRGQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94



>ref|NP_001105367.1| xyloglucan endotransglycosylase homolog1 precursor [Zea mays]
 gb|AAC49012.1| xyloglucan endo-transglycosylase homolog; similar to Triticum 
aestivum endo-xyloglucan transferase, PIR Accession Number 
E49539 [Zea mays]
 gb|AAC49011.1| xyloglucan endo-transglycosylase homolog [Zea mays]
 gb|ACF85530.1| unknown [Zea mays]
 gb|ACG28344.1| xyloglucan endotransglucosylase/hydrolase protein 23 precursor 
[Zea mays]
 prf||2113418A xyloglucan endotransglycosylase homolog
Length=280

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++LD G+++ L +D+ SGSGFQSK +YL+GRFDMQLKLVPG+SA
Sbjct  22   GNFYQDVDITWGDGRGKILDNGQLLTLSMDRSSGSGFQSKAQYLYGRFDMQLKLVPGDSA  81

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  82   GTVATFY  88



>ref|XP_010102168.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
 gb|EXB92418.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis]
Length=326

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY+D  + +G+GR ++L+GG+++ L LDK SGSGFQ KNEYLFGR D+Q+KLVPGNSA
Sbjct  31   ANFYRDVDITWGDGRAKILNGGQVLTLSLDKNSGSGFQPKNEYLFGRIDVQIKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>gb|ACU22849.1| unknown [Glycine max]
Length=200

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  23   GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>ref|XP_009602932.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Nicotiana tomentosiformis]
Length=291

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY  A + +G GRG++ +GG+ ++L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSA
Sbjct  26   GNFYNLADITWGEGRGKITEGGRGLSLSLDKFSGSGFQSKNEYLFGRFDMQLKLVPGNSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>gb|KDP35747.1| hypothetical protein JCGZ_10519 [Jatropha curcas]
Length=271

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY D  + +G+GR ++L+GG+++ L LDK SGSGF+SKNEYLFGR DMQ+KLVPGNSA
Sbjct  6    ANFYNDFDITWGDGRAKILNGGQLLTLSLDKASGSGFRSKNEYLFGRIDMQIKLVPGNSA  65

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  66   GTVTTFY  72



>ref|XP_008449536.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  27   GNFFQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  87   GTVTTFY  93



>ref|XP_011082930.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 15 [Sesamum indicum]
Length=281

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G+GRG++++GG+ + L LD+ SGSGFQSKNEYLFGRFDMQL+L+PGNSA
Sbjct  18   GNFYKDVNVNWGDGRGKIVEGGRGLTLLLDQYSGSGFQSKNEYLFGRFDMQLRLIPGNSA  77

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  78   GTVTTFF  84



>ref|XP_009341025.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341027.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
 ref|XP_009341030.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=293

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD Q+ +G+GRG++L+ G+++ L LDK SGSGFQS N+YLFG+ DMQ+K VPGNSA
Sbjct  27   GNFYQDIQVTWGDGRGKILNNGELLTLSLDKSSGSGFQSTNQYLFGKIDMQIKFVPGNSA  86

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  87   GTVTTYY  93



>gb|KDP33066.1| hypothetical protein JCGZ_13603 [Jatropha curcas]
Length=271

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQ+  + +G+GR ++L+GG+++ L LDK SGSGFQSKNEYLFGR D+Q+KLVPGNSA
Sbjct  6    ANFYQNFDITWGDGRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDVQIKLVPGNSA  65

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  66   GTVTTFY  72



>emb|CDP12751.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD    FG+ R  +L+GG++  L LDK SGSGFQSKNEYLFGRF+MQLKL+PGNSA
Sbjct  28   GNFYQDVAQTFGDQRFNILEGGQLFMLSLDKTSGSGFQSKNEYLFGRFNMQLKLIPGNSA  87

Query  533  GTVTTFY  553
            GTV TFY
Sbjct  88   GTVATFY  94



>ref|XP_010927057.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=279

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  19   GNLYQDFQITWGDGRAKILENGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_009597028.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Nicotiana 
tomentosiformis]
Length=300

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQDA + +G+ R  + +GG+++ L LDK SGSGFQSK+E+LFGRFDMQLKL+PGNSAG
Sbjct  32   NFYQDATVTWGDQRAHIQEGGRLLTLSLDKISGSGFQSKSEFLFGRFDMQLKLIPGNSAG  91

Query  536  TVTTFY  553
            TVTTFY
Sbjct  92   TVTTFY  97



>ref|XP_003610142.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES92339.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=283

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  23   GNFYQDFDITWGDGRAKILNSGQLLTLSLDKSSGSGFQSKNEYLFGKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>ref|XP_008223657.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Prunus mume]
Length=159

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  28   GNFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  88   GTVTAYY  94



>ref|XP_006350013.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNE+LFGRFDMQLKLVP NSA
Sbjct  26   GNFYRDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQLKLVPENSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>ref|XP_009406667.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSK++Y++G+FDMQLKLVPGNSA
Sbjct  24   GNFYQDVDITWGDGRAKILNNGQLLTLSLDKYSGSGFQSKDQYVYGKFDMQLKLVPGNSA  83

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  84   GTVTTFY  90



>gb|KCW78735.1| hypothetical protein EUGRSUZ_C00179 [Eucalyptus grandis]
Length=224

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94



>ref|XP_010656826.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  30   GNFYQDFDITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>ref|XP_002274601.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=297

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++LD G+ + L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  30   GNFYQDFGITWGDGRAKILDNGEFLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>ref|XP_010929301.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Elaeis guineensis]
Length=281

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G GR ++LD  +++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  20   GNFYQDFDITWGEGRAKILDNAQLLTLSLDKSSGSGFQSKNEYLFGKIDMQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  80   GTVTAYY  86



>gb|KHN22712.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  23   GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>ref|XP_010259797.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Nelumbo nucifera]
Length=290

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  311  CMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFG  490
            C++I +SL   AL+GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNE+LFG
Sbjct  14   CLVILSSLTVSALSGNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEFLFG  73

Query  491  RFDMQLKLVPGNSAGTVTTFY  553
            + DMQLKLVPGNSAGTVT +Y
Sbjct  74   KIDMQLKLVPGNSAGTVTAYY  94



>ref|XP_004140251.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=223

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  30   GNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  90   GTVTTFY  96



>gb|ACD03217.1| xyloglucan endotransglucosylase/hydrolase 7 [Actinidia deliciosa]
Length=294

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  362  YQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGTV  541
            ++D ++ +GNGRG++L+GG+++ L LD  SGSGFQSKNEYLFGR DMQLKLVPGNSAGTV
Sbjct  30   FEDVEITWGNGRGKILNGGQLLTLSLDNYSGSGFQSKNEYLFGRIDMQLKLVPGNSAGTV  89

Query  542  TTFY  553
            TT+Y
Sbjct  90   TTYY  93



>ref|XP_003625289.1| Xyloglucan endotransglucosylase/hydrolase [Medicago truncatula]
 gb|AES81507.1| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
 gb|AFK49301.1| unknown [Medicago truncatula]
Length=282

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  22   GNFYQDFDITWGDGRAKILNNGQLLTLSLDKSSGSGFQSKNEYLFGKIDMQLKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>gb|EMT22597.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Aegilops 
tauschii]
Length=285

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRG++L GG ++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPG+SAG
Sbjct  29   NFYQDVDITWGDGRGKILGGGDVLTLSLDRASGSGFQSKNQYLYGRFDMQIKLVPGDSAG  88

Query  536  TVTTFY  553
            TV TFY
Sbjct  89   TVATFY  94



>ref|XP_003563483.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brachypodium distachyon]
Length=290

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QDA+M +G+G G+V+DGG+ + L LD+ +GSGFQSK+EYLFG+ DMQ+KLVPGNSA
Sbjct  21   GNFNQDAEMTWGHGNGKVVDGGRGLDLTLDRTTGSGFQSKSEYLFGKIDMQIKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  81   GTVTTFY  87



>ref|XP_010053252.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Eucalyptus grandis]
Length=291

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  275  LDEMSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  454
            + +MSS     + ++     +  A AGNFYQD  + FG+ R Q+L GG++I L LDK SG
Sbjct  1    MPDMSSPRLFPIVLLSLFLCLVSATAGNFYQDIDVLFGDWRTQILQGGELITLSLDKASG  60

Query  455  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            +GF+SKNEYL+GRFDM++KLV G+SAGTVTTFY
Sbjct  61   AGFRSKNEYLYGRFDMRMKLVGGDSAGTVTTFY  93



>gb|EMS64808.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Triticum 
urartu]
Length=287

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRG++L GG ++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPG+SAG
Sbjct  29   NFYQDVDITWGDGRGKILGGGDVLTLSLDRASGSGFQSKNQYLYGRFDMQIKLVPGDSAG  88

Query  536  TVTTFY  553
            TV TFY
Sbjct  89   TVATFY  94



>ref|XP_003542156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Glycine max]
Length=285

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  23   GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>ref|XP_002325068.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
 gb|EEF03633.2| hypothetical protein POPTR_0018s10300g [Populus trichocarpa]
Length=291

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G+FYQD  + +G+GR ++L+ G ++ L LD+ SGSGFQSKNEY FG+FD+QLKLVPGNSA
Sbjct  31   GSFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYFFGKFDIQLKLVPGNSA  90

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  91   GTVTTFY  97



>ref|XP_007223160.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica]
 gb|EMJ24359.1| hypothetical protein PRUPE_ppa009417mg [Prunus persica]
Length=293

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD Q+ +G+GRG++L+ G+++ L LDK SGSGFQSKNEYL+G+ DMQ+KLVPGNSA
Sbjct  27   SNFYQDFQVTWGDGRGKILNNGELLTLSLDKASGSGFQSKNEYLYGKIDMQIKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  87   GTVTAYY  93



>gb|EYU29580.1| hypothetical protein MIMGU_mgv1a018934mg [Erythranthe guttata]
Length=272

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +DA++ +G+GR +++DGG+ ++L LD+ SGSGFQSKNEYLFGRFDMQLKLVP NSA
Sbjct  23   ANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNEYLFGRFDMQLKLVPDNSA  82

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  83   GTVTTFF  89



>ref|XP_008449534.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=290

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +2

Query  302  LQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  481
            L LC+++A+ + A A  GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+
Sbjct  12   LPLCVLMASIMTATA--GNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEF  69

Query  482  LFGRFDMQLKLVPGNSAGTVTTFY  553
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMKLVPGNSAGTVTTFY  93



>gb|EYU29581.1| hypothetical protein MIMGU_mgv1a022262mg [Erythranthe guttata]
Length=272

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +DA++ +G+GR +++DGG+ ++L LD+ SGSGFQSKNEYLFGRFDMQLKLVP NSA
Sbjct  23   ANFIRDAEITWGDGRAKIVDGGRGLSLSLDQFSGSGFQSKNEYLFGRFDMQLKLVPDNSA  82

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  83   GTVTTFF  89



>ref|XP_009356706.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=292

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  308  LCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  487
            LC I  + +  VA AGNFYQD ++ FG+   +VL+ G++I L LDK SG+GF+SKN YLF
Sbjct  12   LCSITISLVAIVASAGNFYQDYEVMFGDQHAKVLENGQIITLALDKSSGAGFKSKNAYLF  71

Query  488  GRFDMQLKLVPGNSAGTVTTFY  553
            GRFDMQ+KL PGNSAGTVTTFY
Sbjct  72   GRFDMQIKLQPGNSAGTVTTFY  93



>ref|XP_008799439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 25 [Phoenix dactylifera]
Length=286

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ GK++ L LDK SGSGFQSK EYL+G+ DMQLKLVPGNSA
Sbjct  29   GNFYQDVDITWGDGRAKILNNGKLLTLSLDKPSGSGFQSKKEYLYGKIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010046993.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046995.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 ref|XP_010046999.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78736.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78737.1| hypothetical protein EUGRSUZ_C00180 [Eucalyptus grandis]
 gb|KCW78738.1| hypothetical protein EUGRSUZ_C00181 [Eucalyptus grandis]
Length=291

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRAQILNSGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94



>emb|CDP16009.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + FG+GR Q+L  GK++ L LDK SGSGF+SKN+YLFG+ D+Q+KLVPGNSA
Sbjct  22   GNFYQDFDITFGDGRAQILQNGKLLTLSLDKTSGSGFRSKNQYLFGKIDIQMKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  82   GTVTTYY  88



>ref|XP_006350014.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G GRG++ +GG+ +AL LDK SGSGFQSKNE+LFGRFDMQ+KLVP NSA
Sbjct  26   GNFYKDVDITWGEGRGKIQEGGRGLALSLDKLSGSGFQSKNEFLFGRFDMQIKLVPENSA  85

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  86   GTVTTFF  92



>ref|XP_004488032.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=287

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD ++ +G+ R ++L+ G+ ++L LDK SGSGF+SKNEYLFG+ DMQLKLVPGNSA
Sbjct  24   GNFYQDMEITWGDNRAKILENGQFLSLSLDKASGSGFRSKNEYLFGKIDMQLKLVPGNSA  83

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  84   GTVTTYY  90



>emb|CAN80251.1| hypothetical protein VITISV_036641 [Vitis vinifera]
Length=287

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  29   GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010046992.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=292

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  30   NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  89

Query  536  TVTTFY  553
            TVT +Y
Sbjct  90   TVTAYY  95



>ref|XP_007014173.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31792.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=294

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  28   GNFYQDFDLTWGDGRAKILNNGQLLTLALDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  88   GTVTAYY  94



>gb|KGN47998.1| hypothetical protein Csa_6G423400 [Cucumis sativus]
Length=274

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  10   GNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  69

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  70   GTVTTFY  76



>ref|XP_002520387.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
 gb|EEF42003.1| Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus 
communis]
Length=287

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY+   + +G+ RG++L+GG+++ L LDK SGSGFQSKNEYLFGR DMQ+KLVPGNSA
Sbjct  22   ANFYKHFDITWGDQRGKILNGGQLLTLSLDKASGSGFQSKNEYLFGRIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_010046996.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94



>gb|AES92349.2| xyloglucan endotransglucosylase/hydrolase family protein [Medicago 
truncatula]
Length=275

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GR ++LD G+++ L LDK SGSGFQSKNEYLFG  DMQLKLVPGNSA
Sbjct  29   GNFYQNFDITWGDGRAKILDNGQLLTLSLDKASGSGFQSKNEYLFGNIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>gb|KCW78732.1| hypothetical protein EUGRSUZ_C00176 [Eucalyptus grandis]
Length=433

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  171  NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  230

Query  536  TVTTFY  553
            TVT +Y
Sbjct  231  TVTAYY  236



>ref|XP_010046997.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94



>emb|CCH26408.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=280

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  17   GNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  76

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  77   GTVTTFY  83



>emb|CBI17813.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD ++ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  102  GNLYQDFEITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSA  161

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  162  GTVTAYY  168



>ref|NP_001284418.1| brassinosteroid-regulated protein BRU1-like precursor [Cucumis 
melo]
 gb|ABI94061.1| xyloglucan endotransglucosylase/hydrolase 1 [Cucumis melo]
Length=290

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  27   GNFLQDVDVTWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  87   GTVTTFY  93



>gb|KCW78734.1| hypothetical protein EUGRSUZ_C00178 [Eucalyptus grandis]
Length=336

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  74   NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  133

Query  536  TVTTFY  553
            TVT +Y
Sbjct  134  TVTAYY  139



>ref|XP_004164862.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=280

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LDGG+ ++L LDK+SGSGFQSK E+LFGRFD+Q+KLVPGNSA
Sbjct  17   GNFLQDVDITWGGPRAKILDGGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMKLVPGNSA  76

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  77   GTVTTFY  83



>gb|KDP36434.1| hypothetical protein JCGZ_08703 [Jatropha curcas]
Length=286

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_009390494.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  19   GNFYQDFDITWGDGRAKILNNGHLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_003549490.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Glycine max]
Length=292

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  29   GNFYQDFDVTWGDGRAKILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010241684.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Nelumbo nucifera]
Length=283

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DM+LKLVPGNSA
Sbjct  23   GNFYQDVDVTWGDGRGKILNNGQLLTLSLDKFSGSGFQSKKEYLFGKIDMKLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  83   GTVTTYY  89



>ref|XP_007014184.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31803.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=319

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQ+    +G+GR Q+ DGG ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  60   NFYQNCDTVWGDGRAQIHDGGNLLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSAG  119

Query  536  TVTTFY  553
            TVT +Y
Sbjct  120  TVTAYY  125



>ref|XP_010046990.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
 gb|KCW78731.1| hypothetical protein EUGRSUZ_C00175 [Eucalyptus grandis]
Length=297

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + FG+GR +VLD G+++ L LDK SGSGF+SKN+YL+G+FD Q+KLVPGNSA
Sbjct  32   GNFYQDFDVTFGDGRVKVLDNGQLVTLSLDKASGSGFKSKNQYLYGKFDTQIKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  92   GTVTTLY  98



>ref|XP_007014183.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
 gb|EOY31802.1| Xyloglucan endotransglycosylase 6 [Theobroma cacao]
Length=296

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            SS+  L L + +  S   +A AGNFYQD  + +G+GR Q+L+ G+++ L LDK SGSGFQ
Sbjct  7    SSNVSLTLLISVCVSASIIASAGNFYQDFDITWGDGRAQILNNGELLTLSLDKASGSGFQ  66

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKNE+LFG+  MQLKLVPGNSAGTVT +Y
Sbjct  67   SKNEFLFGKIGMQLKLVPGNSAGTVTAYY  95



>gb|AAC39467.1| endo-xyloglucan transferase [Arabidopsis thaliana]
Length=120

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNTDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_010103015.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
 gb|EXB94582.1| putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Morus notabilis]
Length=284

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF++D ++ +GNGR ++L+ GK++ L LDK SGSGFQSK+EYLFG+ DMQLKLVPGNSA
Sbjct  23   GNFHRDFEITWGNGRARILNEGKLLTLSLDKASGSGFQSKHEYLFGKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>ref|XP_007154781.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
 gb|ESW26775.1| hypothetical protein PHAVU_003G147400g [Phaseolus vulgaris]
Length=282

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  22   ANFYQDFDITWGDGRAKILNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQLKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>ref|XP_002270182.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=362

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD ++ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  95   GNLYQDFEITWGDGRAKILNNGELLTLSLDKTSGSGFQSKNEYLFGKIDMQLKLVPGNSA  154

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  155  GTVTAYY  161



>gb|EMS56986.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Triticum 
urartu]
Length=285

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRG+++ GG ++ L LD+ SGSGFQSKN+YL+GRFDMQ+KLVPG+SAG
Sbjct  29   NFYQDVDITWGDGRGKIVGGGDVLTLSLDRASGSGFQSKNQYLYGRFDMQIKLVPGDSAG  88

Query  536  TVTTFY  553
            TV TFY
Sbjct  89   TVATFY  94



>ref|XP_006474161.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|KDO46536.1| hypothetical protein CISIN_1g023337mg [Citrus sinensis]
Length=283

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  284  MSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            M+ S    L + IA S + VA A NFYQD  + +G+GRG++L+ G++++L LDK SGSGF
Sbjct  1    MAYSKNFTLLISIAISSLMVASASNFYQDFDITWGDGRGKILNNGQLLSLSLDKASGSGF  60

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            QSK+EYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  61   QSKSEYLFGKIDMQLKLVPGNSAGTVTAYY  90



>gb|KDP36435.1| hypothetical protein JCGZ_08704 [Jatropha curcas]
Length=286

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFYQDFDITWGDGRAKILNNGQLLTLNLDKASGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_007223211.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
 gb|EMJ24410.1| hypothetical protein PRUPE_ppa009346mg [Prunus persica]
Length=296

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  28   GNFNQDFQITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  88   GTVTAYY  94



>ref|XP_008801539.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=284

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ   + +G+GRG++LD G+++ L LD+ SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  27   GNFYQGFDITWGDGRGKILDNGQLLTLALDEASGSGFQSKNEYLFGKIDMQLKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  87   GTVTAYY  93



>gb|AAT11860.1| xyloglucanendotransglycosylase [Mangifera indica]
Length=132

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQ+  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLF + DMQLKLVPGNSA
Sbjct  23   ANFYQNFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFAKIDMQLKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  83   GTVTAYY  89



>gb|KCW78733.1| hypothetical protein EUGRSUZ_C00177 [Eucalyptus grandis]
Length=568

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRGQ+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  29   NFYQDFDITWGDGRGQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  88

Query  536  TVTTFY  553
            TVT +Y
Sbjct  89   TVTAYY  94


 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GR Q+L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAG
Sbjct  325  NFYQDFDITWGDGRAQILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAG  384

Query  536  TVTTFY  553
            TVT +Y
Sbjct  385  TVTAYY  390



>gb|KCW89705.1| hypothetical protein EUGRSUZ_A01967 [Eucalyptus grandis]
Length=288

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +2

Query  284  MSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            MSS     + ++     +  A AGNFYQD  + FG+ R Q+L GG++I L LDK SG+GF
Sbjct  1    MSSPRLFPIVLLSLFLCLVSATAGNFYQDIDVLFGDWRTQILQGGELITLSLDKASGAGF  60

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            +SKNEYL+GRFDM++KLV G+SAGTVTTFY
Sbjct  61   RSKNEYLYGRFDMRMKLVGGDSAGTVTTFY  90



>ref|XP_009381589.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Musa acuminata subsp. malaccensis]
Length=282

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            SS      C  +A  L ++ALAGNFYQD  + +G+ R ++LD G+++ L LDK SGSGFQ
Sbjct  3    SSRASTAACFFLALCLSSIALAGNFYQDVDITWGDARAKILDDGQLLMLSLDKYSGSGFQ  62

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            S+N+YL+G+FDMQLKLVPG+SAGTV TFY
Sbjct  63   SRNQYLYGKFDMQLKLVPGDSAGTVATFY  91



>ref|NP_001237075.1| syringolide-induced protein 19-1-5 precursor [Glycine max]
 dbj|BAB86890.1| syringolide-induced protein 19-1-5 [Glycine max]
 gb|KHN17580.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=285

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  22   GNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>gb|AGI42457.1| mutant xyloglucan endotransglycosylase/hydrolase [Neolamarckia 
cadamba]
Length=182

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|NP_001276139.1| uncharacterized protein LOC102661404 precursor [Glycine max]
 gb|ACU20918.1| unknown [Glycine max]
Length=285

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  22   GNFHQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>ref|XP_009785048.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana sylvestris]
Length=284

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF   A++ +G GRG++ +GGK ++L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSA
Sbjct  20   ANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  80   GTVTTFF  86



>ref|XP_009126894.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=234

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_008380219.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Malus domestica]
Length=292

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  308  LCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLF  487
            LC I  + +  VA AGNFYQD ++ FG+   +VL+ G++I L LDK SG+GF+SKN YLF
Sbjct  12   LCSITISLVAVVASAGNFYQDYEVMFGDQHAKVLENGQIITLALDKSSGAGFKSKNAYLF  71

Query  488  GRFDMQLKLVPGNSAGTVTTFY  553
            G+FDMQ+KL PGNSAGTVTTFY
Sbjct  72   GKFDMQIKLQPGNSAGTVTTFY  93



>ref|XP_011045331.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=273

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G+GRG++L  G  ++L LDK SGSGFQSK  YLFGRFD+Q+KLVPGNSA
Sbjct  23   GNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGFQSKRAYLFGRFDVQMKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  83   GTVTTFY  89



>ref|XP_011045330.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X1 [Populus euphratica]
Length=274

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = +2

Query  284  MSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            M++   + L + +  S +  A AGNFY+D  + +G+GRG++L  G  ++L LDK SGSGF
Sbjct  1    MANRVSITLLVSLFVSSLLAASAGNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGF  60

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            QSK  YLFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  61   QSKRAYLFGRFDVQMKLVPGNSAGTVTTFY  90



>ref|XP_009597029.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Nicotiana tomentosiformis]
Length=284

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF   A++ +G GRG++ +GGK ++L LDK SGSGFQSKNEYLFGRFDMQLKLVPGNSA
Sbjct  20   ANFNNLAEITWGEGRGKITEGGKGLSLSLDKLSGSGFQSKNEYLFGRFDMQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  80   GTVTTFF  86



>ref|XP_011069896.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=295

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD  + +G+GR ++LD G+++ L LDK SGSGFQSKNE+LFG+ DMQLKLVPGNSA
Sbjct  30   ANFYQDFDITWGDGRARILDNGQLLTLSLDKASGSGFQSKNEFLFGKIDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>emb|CDY67487.1| BnaA02g35250D [Brassica napus]
Length=260

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_008799438.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=280

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GRG++LD G+++ L L+K SGSGF+SKNEYLFG  DMQLKLVPGNSA
Sbjct  20   GNFYQEFDITWGDGRGKILDNGQLLTLSLNKASGSGFESKNEYLFGEIDMQLKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  80   GTVTAYY  86



>ref|XP_006453414.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
 ref|XP_006474157.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Citrus sinensis]
 gb|ESR66654.1| hypothetical protein CICLE_v10009119mg [Citrus clementina]
Length=285

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+GR  +L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  21   GNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  81   GTVTAYY  87



>ref|XP_002318936.2| putative xyloglucan endotransglycosylase family protein [Populus 
trichocarpa]
 gb|EEE94859.2| putative xyloglucan endotransglycosylase family protein [Populus 
trichocarpa]
Length=318

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  51   GNFYQNFDITWGDGRAKILNNGELLTLNLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  110

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  111  GTVTAYY  117



>ref|XP_009344504.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Pyrus x bretschneideri]
Length=293

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD Q+ +G+GRG++ + G+++ L LDK SGSGFQS N+YLFG+ DMQ+K VPGNSA
Sbjct  27   GNFYQDIQVTWGDGRGKIQNNGELLTLSLDKSSGSGFQSTNQYLFGKIDMQIKFVPGNSA  86

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  87   GTVTTYY  93



>ref|XP_006453421.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
 gb|ESR66661.1| hypothetical protein CICLE_v10009118mg [Citrus clementina]
Length=285

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+GR  +L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  21   GNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  81   GTVTAYY  87



>ref|XP_004243230.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Solanum lycopersicum]
Length=290

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  284  MSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            M++S+ L + +++  +LVAV  AGNF    ++ +G+GRG++LDGGK ++L LD  SGSGF
Sbjct  1    MANSHLLLISIVLMGNLVAVLAAGNFNDLTEITWGDGRGKILDGGKGLSLSLDNYSGSGF  60

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            QSKNEYL+GRFDMQLKLVP NSAGTVTTF+
Sbjct  61   QSKNEYLYGRFDMQLKLVPKNSAGTVTTFF  90



>ref|XP_002317309.1| xyloglucan endo-1 family protein [Populus trichocarpa]
 gb|EEE97921.1| xyloglucan endo-1 family protein [Populus trichocarpa]
Length=274

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G+GRG++L  G  ++L LDK SGSGFQSK  YLFGRFD+Q+KLVPGNSA
Sbjct  24   GNFYRDVDITWGDGRGKILRRGNTLSLSLDKTSGSGFQSKRAYLFGRFDVQMKLVPGNSA  83

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  84   GTVTTFY  90



>emb|CDY02741.1| BnaC02g11480D [Brassica napus]
Length=294

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQKDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_006474156.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like isoform X3 [Citrus sinensis]
Length=285

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+GR  +L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  21   GNFHQDFDITWGDGRANILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  81   GTVTAYY  87



>ref|XP_002270416.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=296

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  29   GNLYQDFDLTWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_002274858.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Vitis vinifera]
Length=296

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  29   GNLYQDFDLTWGDGRAKILNNGQLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>emb|CDY25903.1| BnaC09g32750D [Brassica napus]
Length=260

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_010927058.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=296

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF++D Q+ +G+GR ++LD G+ + L LDK SGSGFQSKNEYLFG+  MQLKLVPGNSA
Sbjct  32   GNFHRDFQITWGDGRAKILDNGQHLTLSLDKASGSGFQSKNEYLFGKIHMQLKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  92   GTVTAYY  98



>ref|XP_010536006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
20-like [Tarenaya hassleriana]
Length=283

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF +D Q+ +GNGRG+VL+ G ++AL LD+ SGSGFQSKNE+L+GR + Q+KLVPGNSA
Sbjct  27   GNFERDVQITWGNGRGKVLENGNLLALSLDQFSGSGFQSKNEFLYGRVEAQIKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  87   GTVTTFY  93



>emb|CDY59999.1| BnaA02g35330D [Brassica napus]
Length=247

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_008223658.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
 ref|XP_008223659.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Prunus mume]
Length=286

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  28   GNFNQDFQITWGDGRAKILNNGELLTLLLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  87

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  88   GTVTAYY  94



>ref|XP_011026281.1| PREDICTED: brassinosteroid-regulated protein BRU1-like isoform 
X2 [Populus euphratica]
Length=289

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+ R ++L+GG+++ L LD  SGSGFQSKNEYLFGR DMQ+KL+PGNSA
Sbjct  29   GNFFQDFDITWGDQRAKILNGGQLLTLSLDTASGSGFQSKNEYLFGRIDMQIKLIPGNSA  88

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  89   GTVTTYY  95



>ref|XP_011082931.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Sesamum indicum]
Length=289

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G  R Q+L+GG++++L LD  SGSGFQS NEYL+GRFD+QLKLVPGNSA
Sbjct  27   GNFYKDVTITWGGPRAQILNGGQVLSLSLDNVSGSGFQSNNEYLYGRFDVQLKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTF+
Sbjct  87   GTVTTFF  93



>ref|XP_009356638.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=293

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +2

Query  284  MSSSNKLQ----LCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  451
            MS S+KL     L + I   +   A AGNFYQD  + FG+GR ++L+GG+++ L LD+ S
Sbjct  1    MSYSSKLSMVVLLSLFITCVMATAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  452  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  94



>ref|XP_010536923.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Tarenaya hassleriana]
Length=289

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            SSS ++ L  ++ A ++  ++  NFYQ+ ++ +G+GRGQ+ + G+++ L LD+ SGSGFQ
Sbjct  5    SSSRQMLLLPLLVAGVLLSSVHANFYQNVEITWGDGRGQINNNGELLTLSLDRASGSGFQ  64

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKNEYLFG+ DMQ+KLVPGNSAGTVT +Y
Sbjct  65   SKNEYLFGKIDMQIKLVPGNSAGTVTAYY  93



>gb|EYU25733.1| hypothetical protein MIMGU_mgv1a011641mg [Erythranthe guttata]
Length=275

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  299  KLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNE  478
            K+ + + +  S VA A+ GNF QD  + +G GR ++LD GK++ L LDK SGSGF+SKN+
Sbjct  2    KIHVLLSVLLSFVAAAICGNFNQDFDITWGEGRAKILDNGKLLTLSLDKASGSGFRSKNQ  61

Query  479  YLFGRFDMQLKLVPGNSAGTVTTFY  553
            YLFG+ DMQ+KLVPGNSAGTVTT+Y
Sbjct  62   YLFGKIDMQIKLVPGNSAGTVTTYY  86



>ref|XP_003560505.2| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Brachypodium distachyon]
Length=284

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD  + +G+GRG++L  G ++ L LD+ SGSGFQSK++YL+GRFDMQ+KLVPGNSAG
Sbjct  27   NFYQDVDITWGDGRGRILGNGNLLTLSLDRASGSGFQSKSQYLYGRFDMQIKLVPGNSAG  86

Query  536  TVTTFY  553
            TV TFY
Sbjct  87   TVATFY  92



>gb|AAN60350.1| unknown [Arabidopsis thaliana]
Length=121

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+  MQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_010927111.1| PREDICTED: LOW QUALITY PROTEIN: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=183

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD Q+ +G+GR ++L+ G+++ L LDK S SGFQSKNEYLFG+ DMQLKLVP NSA
Sbjct  19   GNLYQDFQITWGDGRAKILENGQLLTLSLDKASSSGFQSKNEYLFGKIDMQLKLVPXNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_006348946.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Solanum tuberosum]
Length=290

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  284  MSSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            M++S+ L + +++  SLVAV  AGNF    ++ +G+GRG++LDGGK ++L LDK SGSGF
Sbjct  1    MANSHLLLISIVLMGSLVAVLAAGNFNDLTEITWGDGRGKILDGGKGLSLSLDKLSGSGF  60

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            QSKNEYL+GRFDMQ+K VP NSAGTVTTF+
Sbjct  61   QSKNEYLYGRFDMQIKFVPRNSAGTVTTFF  90



>gb|AEZ00859.1| putative xyloglucan endotransglycosylase protein, partial [Elaeis 
guineensis]
Length=191

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+ R ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  19   GNFDQDFQITWGDERAKILENGQLLTLSLDKPSGSGFQSKNEYLFGKIDMQLKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_008348360.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Malus 
domestica]
Length=293

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 4/94 (4%)
 Frame = +2

Query  284  MSSSNKLQ----LCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  451
            MS S+KL     L + I   +   A AGNFYQD  + FG+GR ++L+GG+++ L LD+ S
Sbjct  1    MSYSSKLSMVVLLSLFITCVMAMAASAGNFYQDFDVTFGDGRAKILNGGQLLTLNLDQTS  60

Query  452  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            GSGF+SKNEYLFGR DMQ+KLV GNSAGTVT +Y
Sbjct  61   GSGFKSKNEYLFGRIDMQIKLVSGNSAGTVTAYY  94



>gb|ACJ85154.1| unknown [Medicago truncatula]
Length=275

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GR ++LD G+++ L LDK SGSGFQSKNEYLFG  DMQLKLVPGNS 
Sbjct  29   GNFYQNFDITWGDGRAKILDNGQLLTLSLDKASGSGFQSKNEYLFGNIDMQLKLVPGNSV  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010102169.1| Brassinosteroid-regulated protein BRU1 [Morus notabilis]
 gb|EXB92419.1| Brassinosteroid-regulated protein BRU1 [Morus notabilis]
Length=231

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFY+D  + +G+ R Q+L+GG+++ L LDK SGSGFQSKNEYLFGR DMQ+KLVP NSA
Sbjct  22   SNFYRDFDITWGDRRAQILNGGQLLTLNLDKASGSGFQSKNEYLFGRIDMQIKLVPENSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>gb|AAF80590.1|AF223419_1 xyloglucan endotransglycosylase XET1 [Asparagus officinalis]
Length=284

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFY+D  + +G+GR ++L+ G+M+ L LDK SGSGFQSKN+YLFG+ DMQLKLVPGNSA
Sbjct  27   GNFYRDFDLTWGDGRAKILNNGQMLTLSLDKVSGSGFQSKNQYLFGKIDMQLKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  87   GTVTAYY  93



>ref|NP_001281066.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03231.1| xyloglucan endotransglucosylase/hydrolase 7 [Malus domestica]
Length=295

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + FG+GR ++L+GG+++ L LDK SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  29   GNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_009356637.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + FG+GR ++L+GG+++ L LDK SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  29   GNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010047000.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Eucalyptus grandis]
Length=291

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 4/94 (4%)
 Frame = +2

Query  284  MSSSNKLQLCMii----aaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKES  451
            M+S +   LC+        S    A A NFYQD  + +G+GR Q+L+ G ++ L LDK S
Sbjct  1    MASPSAPSLCITTLLLVVVSWATSASARNFYQDFDITWGDGRAQILNNGDLLTLSLDKAS  60

Query  452  GSGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            GSGFQSKNEYLFG+ DMQLKLVPG+S+GTVT +Y
Sbjct  61   GSGFQSKNEYLFGKIDMQLKLVPGDSSGTVTAYY  94



>ref|XP_004309952.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Fragaria vesca subsp. vesca]
Length=291

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+ G+++ L LDK SGSGF+SKNEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFNQDFQITWGDGRAKILNNGQLLTLSLDKASGSGFESKNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_009356635.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16 [Pyrus x bretschneideri]
Length=274

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + FG+GR ++L+GG+++ L LDK SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  8    GNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSA  67

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  68   GTVTAYY  74



>gb|AGI42461.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_009356634.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Pyrus 
x bretschneideri]
Length=295

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + FG+GR ++L+GG+++ L LDK SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  29   GNFFQDFDITFGDGRAKILNGGQLLTLNLDKASGSGFKSKNEYLFGRIDMQIKLVSGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_009120273.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Brassica rapa]
Length=283

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQITNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>gb|AGI42450.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>gb|AFP93557.1| xyloglucan endotransglycosylase/hydrolase 1 [Neolamarckia cadamba]
 gb|AGI42455.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
 gb|AGI42463.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_007014179.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
 gb|EOY31798.1| Xyloglucan endotransglycosylase 6 isoform 1 [Theobroma cacao]
Length=282

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD  + +G+ RG++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  22   ANFYQDFDLTWGDARGKILNNGQLLTLTLDKFSGSGFQSKNEYLFGKIDMQLKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  82   GTVTAYY  88



>ref|XP_002270375.2| PREDICTED: brassinosteroid-regulated protein BRU1 [Vitis vinifera]
Length=255

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+ R ++LD G+ + L LD  SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  30   GNFYQDFDITWGDRRAKILDNGEFLTLSLDTTSGSGFQSKNEYLFGKIDMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>ref|XP_009378317.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Pyrus x bretschneideri]
Length=292

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFYQD ++ FG+   +VL+ G+++ L LDK SG+GF+SKNEYLFGRFDMQ+KL PGNSAG
Sbjct  28   NFYQDFEVMFGDQHAKVLENGQVVTLSLDKSSGAGFKSKNEYLFGRFDMQIKLQPGNSAG  87

Query  536  TVTTFY  553
            TVTTFY
Sbjct  88   TVTTFY  93



>gb|AGI42458.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_002302145.2| hypothetical protein POPTR_0002s06120g [Populus trichocarpa]
 gb|EEE81418.2| hypothetical protein POPTR_0002s06120g [Populus trichocarpa]
Length=367

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+ R ++L+GG+++ L LD  SGSGFQSKNEYLFGR DMQ+KL+PGNSA
Sbjct  12   GNFFQDFDITWGDQRAKILNGGQLLTLSLDTASGSGFQSKNEYLFGRIDMQIKLIPGNSA  71

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  72   GTVTTYY  78



>ref|XP_007014172.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
 gb|EOY31791.1| Xyloglucan endotransglucosylase/hydrolase family protein [Theobroma 
cacao]
Length=290

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQ  466
            +SS    L M +    +  A A NFYQD  + +G+GRG++ + G++++L LDK SGSGFQ
Sbjct  4    TSSFNFTLLMSLVIGCLMAASASNFYQDFDITWGDGRGKIDNNGEVLSLSLDKASGSGFQ  63

Query  467  SKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   SKNEYLFGKIDMQLKLVPGNSAGTVTAYY  92



>gb|AGI42456.1| xyloglucan endotransglycosylase/hydrolase [Neolamarckia cadamba]
Length=285

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+ D  + +G+GRG++L+ G+++ L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  25   GNFHNDFDITWGDGRGKILNNGQLLTLTLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



>ref|XP_010670335.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Beta vulgaris subsp. vulgaris]
Length=290

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF++D  + +G+GRG++L+ G+ + L LDK SGSGFQS+NEYLFG+ DMQLKLVPGNSA
Sbjct  21   GNFHRDFDITWGDGRGKILNSGRQLTLSLDKTSGSGFQSRNEYLFGKIDMQLKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  81   GTVTAYY  87



>gb|KHN22714.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=287

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+   ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  27   GNFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  87   GTVTAYY  93



>emb|CDP02962.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G+GR + L+ GK++ L LDK SGSG QSKNEYLFGR DMQLKLVPGNSA
Sbjct  32   GNFDQDFAVTWGDGRAKTLNNGKLLTLSLDKASGSGVQSKNEYLFGRIDMQLKLVPGNSA  91

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  92   GTVTTYY  98



>gb|EYU20916.1| hypothetical protein MIMGU_mgv1a011962mg [Erythranthe guttata]
Length=265

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            N++QD ++ +G GRG++L+ G++I L LDK+SGSGF+SKNEYLFG+ DMQ+KLVPGNSAG
Sbjct  7    NYFQDFEITWGGGRGKILNNGELITLSLDKDSGSGFESKNEYLFGKIDMQIKLVPGNSAG  66

Query  536  TVTTFY  553
            TVT +Y
Sbjct  67   TVTAYY  72



>ref|XP_008449531.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
 ref|XP_008449532.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
melo]
Length=291

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query  302  LQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEY  481
            L LC+++A+ + A A  GNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+
Sbjct  12   LPLCVLMASIMTATA--GNFLQDVDVTWGGPRAKILDRGRHLSLSLDKDSGSGFQSKQEF  69

Query  482  LFGRFDMQLKLVPGNSAGTVTTFY  553
            LFGRFD+Q+KLVPGNSAGTVTTFY
Sbjct  70   LFGRFDVQMKLVPGNSAGTVTTFY  93



>gb|AAA32828.1| meri-5 [Arabidopsis thaliana]
Length=247

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNTDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_008799440.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Phoenix dactylifera]
Length=299

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKN+YLFG+ DMQ+KLVPGNSA
Sbjct  33   GNFYQDFDITWGDGRAKILNDGQLLTLSLDKASGSGFQSKNQYLFGKIDMQIKLVPGNSA  92

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  93   GTVTAYY  99



>ref|XP_002274552.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=296

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GR ++LD G+++ L LDK SGSGFQS++EYLFG+ DMQLKLVPGNSA
Sbjct  29   GNLYQDLDITWGDGRAKILDNGQLLTLSLDKASGSGFQSQDEYLFGKIDMQLKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>gb|KHG09063.1| Xyloglucan endotransglucosylase/hydrolase 22 -like protein [Gossypium 
arboreum]
Length=292

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +2

Query  287  SSSNKLQLCMiiaaslvavalaG-NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGF  463
            SSS+K  L M +  + + +A +G NF+ D  + +G+GRG++   G+++ L LDK+SGSGF
Sbjct  4    SSSSKFPLLMPLMVACLIMAASGSNFHNDFDITWGDGRGKIASNGEVLTLSLDKQSGSGF  63

Query  464  QSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            QSKNEYLFG+ DMQLKLVPGNSAGTVT +Y
Sbjct  64   QSKNEYLFGKIDMQLKLVPGNSAGTVTAYY  93



>ref|XP_007154780.1| hypothetical protein PHAVU_003G147300g [Phaseolus vulgaris]
 gb|ESW26774.1| hypothetical protein PHAVU_003G147300g [Phaseolus vulgaris]
Length=292

 Score =   100 bits (248),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G+++ L LD  SGSGFQSKN+YL+G+FDMQ+KLVPGNSA
Sbjct  29   GNLYQDVDVTWGDGRGKILNNGQLLTLSLDHASGSGFQSKNQYLYGKFDMQIKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010452475.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22-like [Camelina sativa]
Length=287

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  22   ANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  82   GTVTTLY  88



>ref|XP_010913701.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=291

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++LD G+++ L LDK SGSGFQSKNEYLF    MQLKLVPGNSA
Sbjct  30   GNFYQDFDITWGDGRAKILDNGELLTLSLDKASGSGFQSKNEYLFAEISMQLKLVPGNSA  89

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  90   GTVTAYY  96



>ref|NP_001242530.1| uncharacterized protein LOC100785313 precursor [Glycine max]
 gb|ACU21249.1| unknown [Glycine max]
Length=287

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+GR ++L+   ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  27   GNFNQDFQITWGDGRAKILNNANLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSA  86

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  87   GTVTAYY  93



>ref|XP_006401194.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
 dbj|BAJ34580.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42647.1| hypothetical protein EUTSA_v10014326mg [Eutrema salsugineum]
Length=282

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  20   ANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  79

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  80   GTVTTLY  86



>ref|XP_010443442.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
 ref|XP_010483278.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Camelina sativa]
Length=287

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  22   ANFQRDVEITWGDGRGQIKNNGELLTLTLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  82   GTVTTLY  88



>gb|ACU17489.1| unknown [Glycine max]
Length=174

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD ++ +G+GR ++L+ G+++ L LDK SGSGF+S+NEYLFG+ DMQLKLVPGNSA
Sbjct  21   GNFNQDFEITWGDGRAKILNSGELLTLSLDKTSGSGFRSRNEYLFGKIDMQLKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  81   GTVTAYY  87



>ref|XP_002325067.2| hypothetical protein POPTR_0018s10290g [Populus trichocarpa]
 gb|EEF03632.2| hypothetical protein POPTR_0018s10290g [Populus trichocarpa]
Length=292

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  359  FYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAGT  538
            FYQ+  + +GNGRG++L+ G ++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSAGT
Sbjct  37   FYQEFDISWGNGRGKILNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQLKLVPGNSAGT  96

Query  539  VTTFY  553
            VT +Y
Sbjct  97   VTAYY  101



>ref|XP_004507927.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23-like [Cicer arietinum]
Length=284

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NFYQD  + +G+GRG++ + GK++ L LDK SGSGFQSK++YLFG+ DMQ+KLVPGNSA
Sbjct  22   SNFYQDFNIKWGDGRGKIFNNGKLLTLSLDKASGSGFQSKSQYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  82   GTVTTYY  88



>ref|XP_009120272.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
22 [Brassica rapa]
Length=283

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  21   ANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSKNEYLFGKIDMQMKLVPGNSA  80

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  81   GTVTTLY  87



>ref|XP_004303860.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 16-like [Fragaria vesca subsp. vesca]
Length=296

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 3/93 (3%)
 Frame = +2

Query  284  MSSSN---KLQLCMiiaaslvavalaGNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESG  454
            MSS N    L L + I + L   A AGNF+QD  + FG+ R ++L+GG+ + L LDK SG
Sbjct  1    MSSCNISRMLLLSLFITSLLAMTASAGNFFQDFDITFGDQRAKILEGGQFLTLNLDKYSG  60

Query  455  SGFQSKNEYLFGRFDMQLKLVPGNSAGTVTTFY  553
            SGF+SK EYLFGR DMQ+KLVPGNSAGTVTT+Y
Sbjct  61   SGFKSKKEYLFGRIDMQIKLVPGNSAGTVTTYY  93



>ref|XP_006387414.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa]
 gb|ERP46328.1| hypothetical protein POPTR_1065s00200g, partial [Populus trichocarpa]
Length=270

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+ R ++L+GG+++ L LDK+SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  50   GNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSA  109

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  110  GTVTTYY  116



>gb|KHN17581.1| Putative xyloglucan endotransglucosylase/hydrolase protein 23 
[Glycine soja]
Length=291

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G+++ L LD+ SGSGFQSKN+YLFG+ DMQ+KLVP NSA
Sbjct  27   GNMYQDVDVTWGDGRGKILNNGQLLTLSLDRASGSGFQSKNQYLFGKIDMQIKLVPANSA  86

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  87   GTVTAFY  93



>ref|NP_001280908.1| brassinosteroid-regulated protein BRU1-like precursor [Malus 
domestica]
 gb|ACD03230.1| xyloglucan endotransglucosylase/hydrolase 6 [Malus domestica]
Length=294

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + FG+GR ++L+GG+++ L LD+ SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  29   GNFYQDFDVTFGDGRAKILNGGQLLTLNLDQASGSGFKSKNEYLFGRIDMQIKLVAGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_010656825.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Vitis vinifera]
Length=287

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+  MQ+KLVPGNSA
Sbjct  29   GNFYQDFDITWGDGRAKILNNGELLTLSLDKASGSGFQSKNEYLFGKIAMQIKLVPGNSA  88

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  89   GTVTAYY  95



>ref|XP_011023833.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Populus euphratica]
Length=317

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQ+  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DM LKLVPGNSA
Sbjct  50   GNFYQNFDITWGDGRAKILNNGELLTLNLDKASGSGFQSKNEYLFGKIDMHLKLVPGNSA  109

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  110  GTVTAYY  116



>ref|XP_010911439.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=281

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD Q+ +G+ R ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQLKLVPGNSA
Sbjct  19   GNFDQDFQITWGDERAKILENGQLLTLSLDKPSGSGFQSKNEYLFGKIDMQLKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|NP_001241948.1| uncharacterized protein LOC100800017 precursor [Glycine max]
 gb|ACU19964.1| unknown [Glycine max]
Length=291

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GRG++L+ G+++ L LD+ SGSGFQSKN+YLFG+ DMQ+KLVP NSA
Sbjct  27   GNMYQDVDVTWGDGRGKILNNGQLLTLSLDRASGSGFQSKNQYLFGKIDMQIKLVPANSA  86

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  87   GTVTAFY  93



>ref|XP_010438197.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24 [Camelina sativa]
Length=268

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>emb|CDX68640.1| BnaC01g08130D [Brassica napus]
Length=282

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNSDVNVAWGNGRGKILNNGQLLTLTLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_009390493.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Musa acuminata subsp. malaccensis]
Length=275

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GN YQD  + +G+GR ++L+ G+++ L LDK SGSGFQSKNEYLFG+ DMQ+KLVPGNSA
Sbjct  19   GNLYQDFDVTWGDGRAKILNNGQLLTLSLDKTSGSGFQSKNEYLFGKIDMQIKLVPGNSA  78

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  79   GTVTAYY  85



>ref|XP_004164865.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
 emb|CCH26409.1| xyloglucan endotransglycosylase [Cucumis sativus]
Length=291

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+LFGRFD+Q++LVPGNSA
Sbjct  27   GNFLQDVDITWGGPRAKILDSGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  87   GTVTTFY  93



>ref|XP_004140252.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Cucumis 
sativus]
Length=291

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF QD  + +G  R ++LD G+ ++L LDK+SGSGFQSK E+LFGRFD+Q++LVPGNSA
Sbjct  27   GNFLQDVDITWGGPRAKILDSGRHLSLSLDKDSGSGFQSKQEFLFGRFDVQMQLVPGNSA  86

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  87   GTVTTFY  93



>ref|XP_010433006.1| PREDICTED: xyloglucan endotransglucosylase/hydrolase protein 
24-like [Camelina sativa]
Length=267

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>gb|KFK29589.1| hypothetical protein AALP_AA7G154000 [Arabis alpina]
Length=270

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNTDVDVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_002526231.1| xyloglucan:xyloglucosyl transferase, putative [Ricinus communis]
 gb|EEF36172.1| xyloglucan:xyloglucosyl transferase, putative [Ricinus communis]
Length=129

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  356  NFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSAG  535
            NFY D  + +G+GR ++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQLKLVPGNSAG
Sbjct  21   NFYNDFDITWGDGRAKILNNGELLTLTLDKASGSGFQSKKEYLFGKIDMQLKLVPGNSAG  80

Query  536  TVTTFY  553
            TVT +Y
Sbjct  81   TVTAYY  86



>ref|XP_007025220.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
 gb|EOY27842.1| Xyloglucan endotransglucosylase/hydrolase 16 [Theobroma cacao]
Length=291

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            G+F+Q+ ++ +GN R Q+LDGGK++ L LDK SGSGF+SKN+Y+FGR DMQ+KLV GNSA
Sbjct  25   GDFHQEFELTWGNERAQILDGGKLLTLTLDKTSGSGFRSKNQYIFGRIDMQIKLVAGNSA  84

Query  533  GTVTTFY  553
            GTVT FY
Sbjct  85   GTVTAFY  91



>ref|XP_006280918.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
 gb|EOA13816.1| hypothetical protein CARUB_v10026914mg [Capsella rubella]
Length=284

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             NF +D ++ +G+GRGQ+ + G+++ L LDK SGSGFQS+NEYLFG+ DMQ+KLVPGNSA
Sbjct  23   ANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSRNEYLFGKIDMQMKLVPGNSA  82

Query  533  GTVTTFY  553
            GTVTT Y
Sbjct  83   GTVTTLY  89



>ref|XP_006387415.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
 gb|ERP46329.1| xyloglucan endo-1 family protein, partial [Populus trichocarpa]
Length=271

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+ R ++L+GG+++ L LDK+SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  6    GNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSA  65

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  66   GTVTTYY  72



>ref|NP_194756.1| xyloglucan endotransglucosylase/hydrolase protein 24 [Arabidopsis 
thaliana]
 sp|P24806.2|XTH24_ARATH RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein 
24; Short=At-XTH24; Short=XTH-24; AltName: Full=Endo-xyloglucan 
transferase; AltName: Full=Meristem protein 5; Short=MERI-5 
protein; Short=MERI5 protein; AltName: Full=Xyloglucan 
endo-1,4-beta-D-glucanase; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA09783.1| endo-xyloglucan transferase [Arabidopsis thaliana]
 emb|CAB52471.1| xyloglucan endo-1, 4-beta-D-glucanase precursor [Arabidopsis 
thaliana]
 emb|CAB81020.1| xyloglucan endo-1, 4-beta-D-glucanase precursor [Arabidopsis 
thaliana]
 gb|AAK59660.1| putative xyloglucan endo-1,4-beta-D-glucanase precursor [Arabidopsis 
thaliana]
 gb|AAL34201.1| putative xyloglucan endo-1,4-beta-D-glucanase precursor [Arabidopsis 
thaliana]
 dbj|BAF01226.1| xyloglucan endo-1,4-beta-D-glucanase precursor [Arabidopsis thaliana]
 dbj|BAF02097.1| xyloglucan endo-1,4-beta-D-glucanase precursor [Arabidopsis thaliana]
 gb|AEE85745.1| xyloglucan endotransglucosylase/hydrolase protein 24 [Arabidopsis 
thaliana]
Length=269

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  22   ADFNTDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  81

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  82   GTVTTFY  88



>ref|XP_011044805.1| PREDICTED: brassinosteroid-regulated protein BRU1-like [Populus 
euphratica]
Length=342

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNF+QD  + +G+ R ++L+GG+++ L LDK+SGSGF+SKNEYLFGR DMQ+KLV GNSA
Sbjct  77   GNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSA  136

Query  533  GTVTTFY  553
            GTVTT+Y
Sbjct  137  GTVTTYY  143



>ref|XP_006284057.1| hypothetical protein CARUB_v10005183mg [Capsella rubella]
 gb|EOA16955.1| hypothetical protein CARUB_v10005183mg [Capsella rubella]
Length=342

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
             +F  D  + +GNGRG++L+ G+++ L LDK SGSGFQSK EYLFG+ DMQ+KLVPGNSA
Sbjct  96   ADFNSDVNVAWGNGRGKILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSA  155

Query  533  GTVTTFY  553
            GTVTTFY
Sbjct  156  GTVTTFY  162



>ref|XP_010927059.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase 
protein 23 [Elaeis guineensis]
Length=282

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +2

Query  353  GNFYQDAQMYFGNGRGQVLDGGKMIALKLDKESGSGFQSKNEYLFGRFDMQLKLVPGNSA  532
            GNFYQD  + +G+GR ++L+ G+++ L LD+ SGSGFQSK EYL+G+ DMQ+KLVPGNSA
Sbjct  25   GNFYQDVDITWGDGRAKILNNGELLTLSLDRSSGSGFQSKQEYLYGKIDMQIKLVPGNSA  84

Query  533  GTVTTFY  553
            GTVT +Y
Sbjct  85   GTVTAYY  91



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571442019030