BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20454_g5_i5 len=593 path=[1473:0-163 4327:164-164 1225:165-167
1391:168-181 1636:182-223 1441:224-592]

Length=593
                                                                      Score     E

ref|XP_009773689.1|  PREDICTED: probable 26S proteasome non-ATPas...    159   2e-42   
sp|P93768.1|PSMD3_TOBAC  RecName: Full=Probable 26S proteasome no...    159   2e-42   Nicotiana tabacum [American tobacco]
ref|XP_009628272.1|  PREDICTED: probable 26S proteasome non-ATPas...    157   1e-41   
ref|XP_010266868.1|  PREDICTED: probable 26S proteasome non-ATPas...    154   1e-40   
emb|CBI37854.3|  unnamed protein product                                152   5e-40   
ref|XP_002279715.1|  PREDICTED: probable 26S proteasome non-ATPas...    152   1e-39   Vitis vinifera
ref|XP_002285893.1|  PREDICTED: probable 26S proteasome non-ATPas...    148   2e-38   Vitis vinifera
sp|Q06364.2|PSMD3_DAUCA  RecName: Full=Probable 26S proteasome no...    147   3e-38   Daucus carota [carrots]
dbj|BAA02696.1|  21D7 antigen                                           147   7e-38   Daucus carota [carrots]
gb|KHN09062.1|  Putative 26S proteasome non-ATPase regulatory sub...    147   7e-38   
ref|XP_004231054.1|  PREDICTED: probable 26S proteasome non-ATPas...    145   2e-37   
ref|XP_009623855.1|  PREDICTED: probable 26S proteasome non-ATPas...    145   2e-37   
ref|XP_003527532.1|  PREDICTED: probable 26S proteasome non-ATPas...    145   3e-37   
ref|XP_010063310.1|  PREDICTED: probable 26S proteasome non-ATPas...    144   8e-37   
gb|KHG11096.1|  putative 26S proteasome non-ATPase regulatory sub...    142   2e-36   
ref|XP_009799469.1|  PREDICTED: probable 26S proteasome non-ATPas...    143   2e-36   
ref|XP_003523322.1|  PREDICTED: probable 26S proteasome non-ATPas...    142   4e-36   
gb|KHN45952.1|  Putative 26S proteasome non-ATPase regulatory sub...    142   4e-36   
emb|CDP19574.1|  unnamed protein product                                141   7e-36   
emb|CDO98056.1|  unnamed protein product                                140   2e-35   
ref|XP_011088624.1|  PREDICTED: probable 26S proteasome non-ATPas...    139   3e-35   
ref|XP_010266036.1|  PREDICTED: probable 26S proteasome non-ATPas...    139   5e-35   
ref|XP_006422568.1|  hypothetical protein CICLE_v10028313mg             138   9e-35   
ref|XP_004162914.1|  PREDICTED: probable 26S proteasome non-ATPas...    130   3e-34   
ref|XP_007136115.1|  hypothetical protein PHAVU_009G019100g             136   4e-34   
ref|XP_011092961.1|  PREDICTED: probable 26S proteasome non-ATPas...    135   5e-34   
ref|XP_004290733.1|  PREDICTED: probable 26S proteasome non-ATPas...    134   2e-33   
ref|XP_006855514.1|  hypothetical protein AMTR_s00057p00205760          134   3e-33   
ref|XP_009382042.1|  PREDICTED: probable 26S proteasome non-ATPas...    130   7e-33   
gb|EYU37968.1|  hypothetical protein MIMGU_mgv1a005284mg                131   2e-32   
ref|XP_003603813.1|  26S proteasome non-ATPase regulatory subunit       131   3e-32   
ref|XP_004144854.1|  PREDICTED: probable 26S proteasome non-ATPas...    130   4e-32   
ref|XP_009382040.1|  PREDICTED: probable 26S proteasome non-ATPas...    130   6e-32   
ref|XP_007222347.1|  hypothetical protein PRUPE_ppa004821mg             129   1e-31   
ref|XP_007041788.1|  PAM domain (PCI/PINT associated module) prot...    129   1e-31   
ref|XP_008447941.1|  PREDICTED: probable 26S proteasome non-ATPas...    127   4e-31   
ref|XP_008221217.1|  PREDICTED: probable 26S proteasome non-ATPas...    127   4e-31   
ref|XP_008221216.1|  PREDICTED: probable 26S proteasome non-ATPas...    127   5e-31   
ref|XP_010536429.1|  PREDICTED: 26S proteasome non-ATPase regulat...    125   2e-30   
gb|EYU22574.1|  hypothetical protein MIMGU_mgv1a005362mg                125   2e-30   
ref|XP_009773690.1|  PREDICTED: probable 26S proteasome non-ATPas...    125   3e-30   
gb|KHG18147.1|  putative 26S proteasome non-ATPase regulatory sub...    125   4e-30   
ref|XP_004500920.1|  PREDICTED: probable 26S proteasome non-ATPas...    125   4e-30   
gb|KDP29682.1|  hypothetical protein JCGZ_18844                         124   1e-29   
ref|XP_006390248.1|  hypothetical protein EUTSA_v10018459mg             123   2e-29   
ref|XP_004154161.1|  PREDICTED: probable 26S proteasome non-ATPas...    119   4e-29   
ref|XP_009401896.1|  PREDICTED: probable 26S proteasome non-ATPas...    122   5e-29   
ref|NP_177726.1|  probable 26S proteasome non-ATPase regulatory s...    122   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355646.1|  PREDICTED: probable 26S proteasome non-ATPas...    120   1e-28   
ref|XP_010416506.1|  PREDICTED: 26S proteasome non-ATPase regulat...    120   1e-28   
gb|KFK42036.1|  hypothetical protein AALP_AA2G203500                    120   1e-28   
ref|XP_010933362.1|  PREDICTED: probable 26S proteasome non-ATPas...    120   1e-28   
ref|XP_009773691.1|  PREDICTED: probable 26S proteasome non-ATPas...    120   2e-28   
ref|XP_002889051.1|  hypothetical protein ARALYDRAFT_476749             120   2e-28   
ref|XP_010428646.1|  PREDICTED: 26S proteasome non-ATPase regulat...    120   2e-28   
ref|XP_002312950.2|  26S proteasome regulatory subunit S3 family ...    120   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002306189.1|  26S proteasome regulatory subunit S3 family ...    119   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004145004.1|  PREDICTED: probable 26S proteasome non-ATPas...    119   4e-28   
ref|XP_011045871.1|  PREDICTED: probable 26S proteasome non-ATPas...    119   4e-28   
ref|XP_006302193.1|  hypothetical protein CARUB_v10020202mg             119   5e-28   
ref|XP_002521275.1|  26S proteasome regulatory subunit S3, putative     119   5e-28   Ricinus communis
ref|XP_010666922.1|  PREDICTED: probable 26S proteasome non-ATPas...    118   7e-28   
ref|XP_007017884.1|  PAM domain protein isoform 3                       117   8e-28   
ref|XP_007017883.1|  PAM domain protein isoform 2                       117   1e-27   
ref|XP_010471748.1|  PREDICTED: 26S proteasome non-ATPase regulat...    117   1e-27   
ref|XP_006601362.1|  PREDICTED: probable 26S proteasome non-ATPas...    117   2e-27   
ref|XP_003550437.1|  PREDICTED: probable 26S proteasome non-ATPas...    117   2e-27   
ref|XP_006416422.1|  hypothetical protein EUTSA_v10007479mg             117   2e-27   
ref|XP_009106250.1|  PREDICTED: 26S proteasome non-ATPase regulat...    117   2e-27   
ref|XP_008377724.1|  PREDICTED: LOW QUALITY PROTEIN: probable 26S...    117   2e-27   
ref|XP_007017885.1|  PAM domain (PCI/PINT associated module) prot...    117   2e-27   
ref|XP_007017882.1|  PAM domain (PCI/PINT associated module) prot...    117   3e-27   
ref|XP_008460112.1|  PREDICTED: probable 26S proteasome non-ATPas...    116   5e-27   
ref|XP_002893093.1|  EMB2719                                            116   5e-27   
ref|XP_002510590.1|  26S proteasome regulatory subunit S3, putative     115   7e-27   Ricinus communis
ref|XP_008382101.1|  PREDICTED: probable 26S proteasome non-ATPas...    115   7e-27   
ref|XP_008236045.1|  PREDICTED: probable 26S proteasome non-ATPas...    115   7e-27   
ref|XP_003545019.1|  PREDICTED: probable 26S proteasome non-ATPas...    115   8e-27   
ref|XP_007200984.1|  hypothetical protein PRUPE_ppa004807mg             115   1e-26   
ref|XP_011046661.1|  PREDICTED: probable 26S proteasome non-ATPas...    115   1e-26   
ref|XP_010920092.1|  PREDICTED: probable 26S proteasome non-ATPas...    115   1e-26   
emb|CDX73215.1|  BnaC06g36630D                                          114   2e-26   
ref|XP_009413027.1|  PREDICTED: probable 26S proteasome non-ATPas...    114   4e-26   
ref|XP_008809439.1|  PREDICTED: probable 26S proteasome non-ATPas...    114   4e-26   
ref|XP_010107643.1|  putative 26S proteasome non-ATPase regulator...    114   4e-26   
ref|XP_006307354.1|  hypothetical protein CARUB_v10008972mg             113   5e-26   
ref|XP_010477252.1|  PREDICTED: 26S proteasome non-ATPase regulat...    112   2e-25   
emb|CDY31901.1|  BnaC07g15510D                                          108   3e-25   
ref|XP_010459703.1|  PREDICTED: 26S proteasome non-ATPase regulat...    111   3e-25   
ref|XP_010498455.1|  PREDICTED: 26S proteasome non-ATPase regulat...    111   3e-25   
gb|AAL09760.1|  At1g20200/T20H2_4                                       110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499304.1|  PREDICTED: probable 26S proteasome non-ATPas...    110   4e-25   
ref|XP_007160631.1|  hypothetical protein PHAVU_001G003600g             110   5e-25   
ref|NP_173447.1|  probable 26S proteasome non-ATPase regulatory s...    110   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009628273.1|  PREDICTED: probable 26S proteasome non-ATPas...    110   6e-25   
gb|AAF26768.2|AC007396_17  T4O12.21                                     110   9e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM53298.1|  putative proteasome regulatory subunit S3               108   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935159.1|  PREDICTED: probable 26S proteasome non-ATPas...    107   1e-23   
ref|XP_004231453.1|  PREDICTED: probable 26S proteasome non-ATPas...    106   1e-23   
ref|XP_008806135.1|  PREDICTED: probable 26S proteasome non-ATPas...    106   2e-23   
ref|XP_009628274.1|  PREDICTED: probable 26S proteasome non-ATPas...    105   4e-23   
ref|XP_008347374.1|  PREDICTED: probable 26S proteasome non-ATPas...    102   4e-23   
emb|CDX87648.1|  BnaA07g32250D                                          104   7e-23   
ref|XP_008811676.1|  PREDICTED: probable 26S proteasome non-ATPas...    104   1e-22   
gb|EPS67790.1|  hypothetical protein M569_06981                         103   1e-22   
gb|AFW65683.1|  hypothetical protein ZEAMMB73_847170                    101   4e-22   
gb|ACN28097.1|  unknown                                                 101   9e-22   Zea mays [maize]
ref|NP_001149170.1|  26S proteasome non-ATPase regulatory subunit 3     101   1e-21   Zea mays [maize]
gb|KDO68111.1|  hypothetical protein CISIN_1g011352mg                   100   2e-21   
ref|XP_003589555.1|  26S proteasome non-ATPase regulatory subunit       100   2e-21   
gb|AAF79894.1|AC022472_3  Contains similarity to 26s proteasome r...    100   5e-21   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01467.1|  predicted protein                                    95.1    2e-19   
ref|XP_010229049.1|  PREDICTED: probable 26S proteasome non-ATPas...  94.4    4e-19   
ref|XP_004957510.1|  PREDICTED: probable 26S proteasome non-ATPas...  93.2    1e-18   
ref|NP_001063817.1|  Os09g0541900                                     92.8    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ACA51024.1|  proteasome regulatory subunit S3                      89.7    2e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004974153.1|  PREDICTED: probable 26S proteasome non-ATPas...  92.4    2e-18   
gb|ACG34075.1|  26S proteasome non-ATPase regulatory subunit 3        91.7    4e-18   Zea mays [maize]
gb|ACF84535.1|  unknown                                               91.7    4e-18   Zea mays [maize]
ref|XP_002300686.1|  26S proteasome regulatory subunit S3 family ...  91.7    5e-18   Populus trichocarpa [western balsam poplar]
gb|ABR16257.1|  unknown                                               91.3    6e-18   Picea sitchensis
gb|EEE69116.1|  hypothetical protein OsJ_28197                        90.9    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09931.1|  hypothetical protein OsI_32229                        90.9    7e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001149380.1|  LOC100283005                                     90.5    9e-18   Zea mays [maize]
ref|NP_001062444.1|  Os08g0550100                                     90.5    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22108.1|  Putative 26S proteasome non-ATPase regulatory sub...  90.1    1e-17   
dbj|BAK07086.1|  predicted protein                                    89.7    2e-17   
ref|XP_006660365.1|  PREDICTED: probable 26S proteasome non-ATPas...  89.7    2e-17   
dbj|BAJ90869.1|  predicted protein                                    89.7    2e-17   
ref|XP_002444618.1|  hypothetical protein SORBIDRAFT_07g024800        89.0    4e-17   Sorghum bicolor [broomcorn]
ref|XP_010446200.1|  PREDICTED: 26S proteasome non-ATPase regulat...  83.6    2e-15   
ref|XP_011034975.1|  PREDICTED: probable 26S proteasome non-ATPas...  83.2    3e-15   
ref|XP_011034976.1|  PREDICTED: probable 26S proteasome non-ATPas...  83.2    3e-15   
ref|XP_011034972.1|  PREDICTED: probable 26S proteasome non-ATPas...  83.6    3e-15   
ref|XP_003578544.1|  PREDICTED: probable 26S proteasome non-ATPas...  76.6    6e-13   
emb|CDY54330.1|  BnaCnng26760D                                        75.1    1e-12   
gb|AFW65682.1|  hypothetical protein ZEAMMB73_847170                  67.0    4e-11   
ref|XP_003588288.1|  26S proteasome subunit RPN3a                     66.2    6e-11   
ref|XP_002970446.1|  hypothetical protein SELMODRAFT_231540           68.6    2e-10   
ref|XP_001757567.1|  predicted protein                                68.6    3e-10   
ref|XP_001753136.1|  predicted protein                                67.0    9e-10   
ref|XP_001764054.1|  predicted protein                                65.9    2e-09   
gb|EMS49644.1|  putative 26S proteasome non-ATPase regulatory sub...  62.4    3e-08   
dbj|BAB78499.1|  26S proteasome regulatory particle non-ATPase su...  59.7    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82954.1|  unnamed protein product                              56.6    1e-06   
gb|EEC83998.1|  hypothetical protein OsI_30168                        55.8    4e-06   Oryza sativa Indica Group [Indian rice]



>ref|XP_009773689.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana sylvestris]
Length=488

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ   PSNSLSST PS+F HLK+IASL+E GAYAREVRRI RAVRLT+ALR+
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S+L+AFLNY L PGS+VH+RLS++LPKEDE DMEVD A+   QAP K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVHSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Nicotiana tabacum]
 dbj|BAA19252.1| 21D7 [Nicotiana tabacum]
Length=488

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ   PSNSLSST PS+F HLK+IASL+E GAYAREVRRI RAVRLT+ALR+
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S+L+AFLNY L PGS+VH+RLS++LPKEDE DMEVD A+   QAP K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVHSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_009628272.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=488

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ   PSNSLSST PS+F HLK+IASL+E GAYAREVRRI RAVRLT+ALR+
Sbjct  1    MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S+L+AFLNY L PGS+V++RLS++LPKEDE DMEVD A+   QAP K+ +PELEIY
Sbjct  61   KLKASSLSAFLNYVLVPGSEVYSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_010266868.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
 ref|XP_010266869.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS+SST PS  +HLK+IASL+E GAYAREVRRIVRAVRLTIALRR
Sbjct  1    MTQDVEMKEL-PAPSNSVSSTAPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK   L+AFLN++L PGS+ H RLS+YLPKEDE DMEVD    A+QAP KH +PE+EIY
Sbjct  60   KLKAPVLSAFLNFALAPGSEAHIRLSSYLPKEDEHDMEVDTATSATQAPVKHSLPEIEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>emb|CBI37854.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS++ST PS  +HLK+IASL+E+ AYAREVRRIVRA+RLT+ LRR
Sbjct  1    MTQDVEMKEL-PAPSNSVTSTTPSTLQHLKEIASLIESSAYAREVRRIVRAIRLTMILRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK + L+ FLNY+L PGS+VH RLS+YLPKEDE DMEVD    A+Q PAKH +PELEIY
Sbjct  60   KLKATVLSGFLNYALNPGSEVHTRLSSYLPKEDEHDMEVDTATSATQTPAKHPLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_002279715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 ref|XP_010646732.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
Length=487

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS++ST PS  +HLK+IASL+E+ AYAREVRRIVRA+RLT+ LRR
Sbjct  1    MTQDVEMKEL-PAPSNSVTSTTPSTLQHLKEIASLIESSAYAREVRRIVRAIRLTMILRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK + L+ FLNY+L PGS+VH RLS+YLPKEDE DMEVD    A+Q PAKH +PELEIY
Sbjct  60   KLKATVLSGFLNYALNPGSEVHTRLSSYLPKEDEHDMEVDTATSATQTPAKHPLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_002285893.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Vitis vinifera]
 emb|CBI18933.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK++  APSNS+SST PS    LK+IASL+E G+Y +EVRRIVRA+RLT+ALRR
Sbjct  1    MTQDVEMKDR-TAPSNSVSSTGPSTLHQLKEIASLIETGSYTKEVRRIVRAIRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK   L+AFL+++L P S+ H+RLSAYLPKEDE DMEVD A+   QAP KHLVPELEIY
Sbjct  60   KLKVPVLSAFLDFALVPVSEAHSRLSAYLPKEDEHDMEVDTATSADQAPVKHLVPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 
3; Short=26S proteasome subunit S3; AltName: Full=26S 
proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 
21D7 [Daucus carota]
Length=489

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  231  MTQDVEMKEQ-QPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MTQDVEMKE   PAPSNS+++  PS  +HLK+IASL+E+GAYAREVRRI+RAVRLTIALR
Sbjct  1    MTQDVEMKEVPAPAPSNSVTAATPSTLQHLKEIASLIESGAYAREVRRILRAVRLTIALR  60

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAP---AKHLVPELEI  578
            +KL  S + AFLN+SL PGS+VHARL++YLPKEDE DMEVD A  A    AKH +PELEI
Sbjct  61   KKLNASVVNAFLNFSLVPGSEVHARLASYLPKEDEHDMEVDTAMSATTTLAKHSLPELEI  120

Query  579  YCYLL  593
            YCYLL
Sbjct  121  YCYLL  125



>dbj|BAA02696.1| 21D7 antigen [Daucus carota]
Length=488

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 4/125 (3%)
 Frame = +3

Query  231  MTQDVEMKEQ-QPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MTQDVEMKE   PAPSNS+++  PS  +HLK+IASL+E+GAYAREVRRI+RAVRLTIALR
Sbjct  1    MTQDVEMKEVPAPAPSNSVTAATPSTLQHLKEIASLIESGAYAREVRRILRAVRLTIALR  60

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAP---AKHLVPELEI  578
            +KL  S + AFLN+SL PGS+VHARL++YLPKEDE DMEVD A  A    AKH +PELEI
Sbjct  61   KKLNASVVNAFLNFSLVPGSEVHARLASYLPKEDEHDMEVDTAMSATTTLAKHSLPELEI  120

Query  579  YCYLL  593
            YCYLL
Sbjct  121  YCYLL  125



>gb|KHN09062.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK++   PSNS+SS  PS  +HLK+IASL+E G+Y++EVRRI RAVRLTIALRR
Sbjct  1    MTQDLEMKDRS-TPSNSVSSPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  SA+++FL++ LTPGS+VHA+LSAYLPKED+ +MEVD A+   Q PAKHL+PELEIY
Sbjct  60   KLTASAISSFLDHVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_004231054.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=487

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEM +Q P PS SLSS DPSV  HLK+IASL+E GAYAREVRRI RAVRLT+ LR+
Sbjct  1    MTQDVEMADQAP-PSKSLSSADPSVLPHLKEIASLIETGAYAREVRRISRAVRLTMVLRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELEIY  581
            KLK S+L AFLN+ L PGSDVH+RLS++LPKEDE DMEVD A+    A  KH +PELEIY
Sbjct  60   KLKASSLGAFLNFVLVPGSDVHSRLSSFLPKEDEHDMEVDSATSGTLASVKHSLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_009623855.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana tomentosiformis]
Length=491

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 5/125 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPA-PSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            TQDVEM EQ  A PSNS+SST  PSV  HLK+IASL+E+GAYAREVRRI RAVRLT+ALR
Sbjct  3    TQDVEMIEQGAAAPSNSVSSTGGPSVLHHLKEIASLIESGAYAREVRRIARAVRLTMALR  62

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEI  578
            +KLK S L+AFLNY+L P S++H+RLS+YLP EDE DMEVD    ASQAPAKH +PELEI
Sbjct  63   KKLKASVLSAFLNYALVPRSEMHSRLSSYLPTEDEHDMEVDTATSASQAPAKHPLPELEI  122

Query  579  YCYLL  593
            YCYLL
Sbjct  123  YCYLL  127



>ref|XP_003527532.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 106/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK++   PSNS+SS  PS  +HLK+IASL+E G+Y++EVRRI RAVRLTIALRR
Sbjct  1    MTQDLEMKDRS-TPSNSVSSPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  SA+++FL++ LTPGS+VHA+LSAYLPK+D+ +MEVD A+   Q PAKHL+PELEIY
Sbjct  60   KLTASAISSFLDHVLTPGSEVHAKLSAYLPKDDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_010063310.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Eucalyptus grandis]
 gb|KCW70517.1| hypothetical protein EUGRSUZ_F03722 [Eucalyptus grandis]
Length=487

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+  P PS+S+SS  PS  +HLK+IASL+E G+YA+E RRI RAVRLTIA R+
Sbjct  1    MTQDVEMKDH-PTPSHSVSSAVPSTLQHLKEIASLIETGSYAKEARRIARAVRLTIASRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL    LTAFL+Y+L PGS+  +RLS YLPKEDE DMEVD AS   QAPAKH++PELEIY
Sbjct  60   KLTAPVLTAFLDYALGPGSEARSRLSTYLPKEDEHDMEVDTASSANQAPAKHVLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>gb|KHG11096.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=447

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ  APSNSL S  PS   HLK+IASL+E GAY REVRRI+RA+RLT+ALRR
Sbjct  1    MTQDVEMKEQ-AAPSNSLPSFSPSTLHHLKEIASLIETGAYDREVRRILRAIRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK SAL++FLN++L PGS+   RLS++LPKEDE  MEVD    A QAPAKH +PE+EIY
Sbjct  60   KLKASALSSFLNFTLIPGSEALTRLSSFLPKEDEHAMEVDTAISAPQAPAKHSLPEIEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_009799469.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nicotiana sylvestris]
Length=491

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 104/125 (83%), Gaps = 5/125 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPA-PSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            TQDVEM EQ  A PSNS+SST  PSV  HLK+IASL+E+GAYAREVRRI RAVRLT+ALR
Sbjct  3    TQDVEMIEQAAAAPSNSVSSTGGPSVLHHLKEIASLIESGAYAREVRRIARAVRLTMALR  62

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEI  578
            +KLK S  +AFLNY+L P S+VH++LS+YLP EDE DMEVD    ASQAPAKH +PELEI
Sbjct  63   KKLKGSVFSAFLNYALVPRSEVHSQLSSYLPTEDEHDMEVDTATSASQAPAKHPLPELEI  122

Query  579  YCYLL  593
            YCYLL
Sbjct  123  YCYLL  127



>ref|XP_003523322.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
Length=487

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EM+++   PSNS+S   PS  +HLK+IASL+E G+Y++EVRRI RAVRLTIALRR
Sbjct  1    MTQDLEMRDRS-TPSNSVSLPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  SA+++FL+  LTPGS+VHA+LSAYLPKED+ +MEVD A+   Q PAKHL+PELEIY
Sbjct  60   KLTASAISSFLDLVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>gb|KHN45952.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=487

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EM+++   PSNS+S   PS  +HLK+IASL+E G+Y++EVRRI RAVRLTIALRR
Sbjct  1    MTQDLEMRDRS-TPSNSVSLPAPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  SA+++FL+  LTPGS+VHA+LSAYLPKED+ +MEVD A+   Q PAKHL+PELEIY
Sbjct  60   KLTASAISSFLDLVLTPGSEVHAKLSAYLPKEDDHEMEVDAATSAIQTPAKHLLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>emb|CDP19574.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ PA SNS++ T PS  +HLK+IASL+E GAYAREVRRIVRAVRLTIALR+
Sbjct  1    MTQDVEMKEQ-PATSNSVTLTAPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTIALRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK S ++AFL ++LTPGS+VH+RLS+Y+PK+DE +MEVD    A+QAP KH +PELEIY
Sbjct  60   KLKASVISAFLTHTLTPGSEVHSRLSSYIPKDDEHEMEVDTATSATQAPTKHSLPELEIY  119

Query  582  CYLL  593
              LL
Sbjct  120  SCLL  123



>emb|CDO98056.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M  DVEMKEQ PAPSNS++ST PS  +HLK+IASL+E G Y RE+RRIVRAVRLTIALR+
Sbjct  1    MPGDVEMKEQ-PAPSNSVTSTGPSTLQHLKEIASLIETGTYTREIRRIVRAVRLTIALRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  S ++AF+ Y+LT GS+VH RLS+Y+PK+DE +MEVD A+   Q+P+KH +PELEIY
Sbjct  60   KLTASVISAFMTYALTHGSEVHTRLSSYIPKDDEHEMEVDTATSAVQSPSKHSLPELEIY  119

Query  582  CYLL  593
             YLL
Sbjct  120  SYLL  123



>ref|XP_011088624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ PAPSNSLSST PS  +HLKDIA+L+E GAY REVRRIVRA+R TI LR+
Sbjct  1    MTQDVEMKEQHPAPSNSLSSTSPSTLQHLKDIAALIETGAYTREVRRIVRAIRWTIQLRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S L AFLN+ L PGSD H+R+S+Y+PKEDE DMEVD A+   QAPAKH +PELEIY
Sbjct  61   KLKASVLPAFLNFVLVPGSDAHSRMSSYVPKEDEHDMEVDTATSAAQAPAKHSLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_010266036.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Nelumbo nucifera]
Length=488

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSN +SST P   +HLK+I SL+E GAYAREVRRIVRAVRLT+ALRR
Sbjct  1    MTQDVEMKEL-PAPSNFVSSTVPPTLQHLKEITSLIETGAYAREVRRIVRAVRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            +LK   L+AFLN++L PGS+ H RLS+YLPK DE  MEVD A   +Q P KH +PELEIY
Sbjct  60   RLKAPVLSAFLNFALVPGSEAHIRLSSYLPKGDEHAMEVDTAPSTTQTPVKHSLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_006422568.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 ref|XP_006486715.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Citrus sinensis]
 gb|ESR35808.1| hypothetical protein CICLE_v10028313mg [Citrus clementina]
 gb|KDO68110.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=488

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSS-TDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MTQDVEMK+++  PSNSLSS   PS   HLK+IASL+E GA+AREVRRI+RAVRLT+ALR
Sbjct  1    MTQDVEMKDKEN-PSNSLSSPFTPSTLHHLKEIASLMETGAHAREVRRIMRAVRLTMALR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELEI  578
            RKLK   L+AFLN++L PGS+ H+RL +YLPKEDE +MEVD AS    APAKH +PELEI
Sbjct  60   RKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEHEMEVDTASSGAPAPAKHPLPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>ref|XP_004162914.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
Length=176

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQD EMKE  PAP     S+ PS  ++LK+I SL+E GAYAREVRRIVRA+RLT+ALRRK
Sbjct  3    TQDAEMKEL-PAPI----SSSPSTLQNLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            LK S L++FLN++L PGSDVH RLS+++PKE++ +M+VD+A+Q P+KHL+PE+EI+CYL+
Sbjct  58   LKASVLSSFLNFALPPGSDVHTRLSSFIPKEEDCEMDVDLATQTPSKHLLPEIEIFCYLI  117



>ref|XP_007136115.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
 gb|ESW08109.1| hypothetical protein PHAVU_009G019100g [Phaseolus vulgaris]
Length=487

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK++   PSNS+SS  PS  ++LK+IASL+E G+Y++EVRRI RAVRLTIALRR
Sbjct  1    MTQDLEMKDRS-TPSNSVSSPAPSTLQNLKEIASLIETGSYSKEVRRIARAVRLTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  S +++FL++ L PGS+ H +LSAYLPKED+ +MEVD A+   Q PAKHL+PELEIY
Sbjct  60   KLTASIISSFLDHVLAPGSEAHVKLSAYLPKEDDHEMEVDAATSTIQTPAKHLLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_011092961.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
 ref|XP_011092962.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Sesamum indicum]
Length=488

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQQ APSNSLSST PS  +HLKDIA+ +E GAY REVRRIVRA+R TI LR+
Sbjct  1    MTQDVEMKEQQAAPSNSLSSTSPSTLQHLKDIAAWIETGAYTREVRRIVRAIRWTIQLRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S L+AFLN+SL PGS+VH+RLS+Y+PKEDE DMEVD A   +QAPAKH +PELEIY
Sbjct  61   KLNASVLSAFLNFSLVPGSEVHSRLSSYVPKEDEQDMEVDTATSTTQAPAKHSLPELEIY  120

Query  582  CYLL  593
             YLL
Sbjct  121  SYLL  124



>ref|XP_004290733.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Fragaria vesca subsp. vesca]
Length=488

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE   APSNS+SST P+   HLK+IASL+E  AY +EVRR+VRAVRLT+A RR
Sbjct  1    MTQDVEMKEVAAAPSNSVSSTTPTTLHHLKEIASLLETAAYTKEVRRVVRAVRLTMAKRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  S L+AFL+++ +PGS+ H+RLS+YLPK+ + DM+VD A+   Q P KH  PELEIY
Sbjct  61   KLSVSVLSAFLSFAFSPGSEAHSRLSSYLPKDADHDMDVDTATSAAQVPKKHASPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_006855514.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
 gb|ERN16981.1| hypothetical protein AMTR_s00057p00205760 [Amborella trichopoda]
Length=484

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS+SS    V +HLK+IA+L+E GA+ +EVRR++RAVR TIALRR
Sbjct  1    MTQDVEMKEP-PAPSNSVSSAASPVLQHLKEIATLIETGAFTKEVRRVLRAVRHTIALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK   L++FL+  L PGS+V  RL++YLPK+DE DMEVD AS   QAP K+ +PELEIY
Sbjct  60   KLKAPVLSSFLHSVLAPGSEVFVRLTSYLPKDDEHDMEVDTASSGTQAPGKYSLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_009382042.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT DVEMKE Q A SNS+SS   PS  +HLK+IASL+E GA A+EVRRIVRAVRLT+ LR
Sbjct  1    MTADVEMKEVQ-ALSNSVSSAAVPSTLQHLKEIASLIETGAQAKEVRRIVRAVRLTMMLR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+ S ++AFL + LTPGS+V A+LS+YLPK DE +M+VD A+   Q PAKH +PELEI
Sbjct  60   RKLRASVISAFLGHVLTPGSEVLAKLSSYLPKPDEHEMDVDTAASAVQGPAKHSIPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>gb|EYU37968.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
 gb|EYU37969.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata]
Length=490

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 5/126 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQ--PAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIAL  404
            MTQDVEMKEQQ  P PS+S++   PS  ++LKDIA+L+E GAY+REVRRIVRA+R TI L
Sbjct  1    MTQDVEMKEQQQQPTPSDSVAPPSPSTLQYLKDIAALIETGAYSREVRRIVRAIRWTIQL  60

Query  405  RRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELE  575
            R+ L  S L+AFL+++L PGS+VH+RLS+Y+PKED  DM+VD A+    AP KH +PELE
Sbjct  61   RKNLNASVLSAFLSFALVPGSEVHSRLSSYVPKEDGHDMDVDSATSGTPAPTKHSLPELE  120

Query  576  IYCYLL  593
            I+CYL+
Sbjct  121  IFCYLV  126



>ref|XP_003603813.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES74064.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=490

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK++   PSNS+S   PS  +HLK+IAS++E G+Y++EVRRI RAVRLTIALR+
Sbjct  1    MTQDLEMKDRS-TPSNSVSPPVPSTLQHLKEIASVIETGSYSKEVRRIARAVRLTIALRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQA------PAKHLVPEL  572
            KL  S +++FL++ LTPGS+ HA+LSAYLPKED+ +MEVD A+ A       AKHL+PEL
Sbjct  60   KLTASVISSFLDHVLTPGSEPHAKLSAYLPKEDDHEMEVDAATSAIQTPIPTAKHLLPEL  119

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  120  EIYCYLL  126



>ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN43263.1| hypothetical protein Csa_7G014490 [Cucumis sativus]
Length=481

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 101/120 (84%), Gaps = 5/120 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQD EMKE  PAP     S+ PS  ++LK+I SL+E GAYAREVRRIVRA+RLT+ALRRK
Sbjct  3    TQDAEMKEL-PAPI----SSSPSTLQNLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            LK S L++FLN++L PGSDVH RLS+++PKE++ +M+VD+A+Q P+KHL+PE+EI+CYL+
Sbjct  58   LKASVLSSFLNFALPPGSDVHTRLSSFIPKEEDCEMDVDLATQTPSKHLLPEIEIFCYLI  117



>ref|XP_009382040.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009382041.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT DVEMKE Q A SNS+SS   PS  +HLK+IASL+E GA A+EVRRIVRAVRLT+ LR
Sbjct  1    MTADVEMKEVQ-ALSNSVSSAAVPSTLQHLKEIASLIETGAQAKEVRRIVRAVRLTMMLR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+ S ++AFL + LTPGS+V A+LS+YLPK DE +M+VD A+   Q PAKH +PELEI
Sbjct  60   RKLRASVISAFLGHVLTPGSEVLAKLSSYLPKPDEHEMDVDTAASAVQGPAKHSIPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>ref|XP_007222347.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
 gb|EMJ23546.1| hypothetical protein PRUPE_ppa004821mg [Prunus persica]
Length=490

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+++  P   L S   S+ +HLK+ AS +EA +Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD------IASQAPAKHLVPEL  572
            KL    L+AFL+Y+L PGS+ HARLSAYLPK+D   MEVD       A QAPAKH++PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDDRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>ref|XP_007041788.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 ref|XP_007041789.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOX97620.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=484

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 105/124 (85%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ  APSNSLSS+ PS   HLK+IASL+E GAYAREVRRI+RAVRLT+ALRR
Sbjct  1    MTQDVEMKEQ-AAPSNSLSSSSPSTLHHLKEIASLIETGAYAREVRRILRAVRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S L+AFLN++LTPGS+   RLS+YLP EDE +MEVD A+   QAPAKH +PELEIY
Sbjct  60   KLKASVLSAFLNFALTPGSEGLTRLSSYLPMEDEHEMEVDTATSAVQAPAKHSLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_008447941.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
 ref|XP_008447942.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=481

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (83%), Gaps = 5/120 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQD EMKE  PAP     S+ PS  +HLK+I SL+E GAYAREVRRIVRA+RLT+ALRRK
Sbjct  3    TQDAEMKEL-PAPI----SSSPSTLQHLKEIVSLLETGAYAREVRRIVRAIRLTMALRRK  57

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            LK S L++FLN++L PGSDVH RLS+++PKE++ +M+VD A+Q PAKH +PE+EI+CYL+
Sbjct  58   LKASDLSSFLNFALPPGSDVHTRLSSFIPKEEDYEMDVDSATQPPAKHPLPEIEIFCYLI  117



>ref|XP_008221217.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Prunus mume]
Length=490

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+++  P   L S   S+ +HLK+ AS +EA +Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD------IASQAPAKHLVPEL  572
            KL    L+AFL+Y+L PGS+ HARLSAYLPK++   MEVD       A QAPAKH++PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDNRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>ref|XP_008221216.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Prunus mume]
Length=491

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+++  P   L S   S+ +HLK+ AS +EA +Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDEEALPQAPLPSDSASILQHLKEGASFIEAASYTKEVRRIARAVRLTIQLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD------IASQAPAKHLVPEL  572
            KL    L+AFL+Y+L PGS+ HARLSAYLPK++   MEVD       A QAPAKH++PEL
Sbjct  61   KLTAPLLSAFLDYALLPGSEAHARLSAYLPKDNRHGMEVDNDDAATSAVQAPAKHILPEL  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>ref|XP_010536429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Tarenaya hassleriana]
Length=487

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 96/124 (77%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE Q  PS S+ +   S  ++LK+IASL+E G+Y +EVRRI RAVRLT+ LRR
Sbjct  1    MTQDVEMKENQ-TPSQSVVTAATSTLQNLKEIASLIETGSYTKEVRRIARAVRLTMGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            K   S L++FL+++L PGS+ H+RLS+++PK DE +MEVD AS   QAP+KH+  ELEIY
Sbjct  60   KFTGSVLSSFLDFALVPGSEAHSRLSSFVPKVDEHEMEVDTASSAAQAPSKHMSAELEIY  119

Query  582  CYLL  593
            CYL+
Sbjct  120  CYLI  123



>gb|EYU22574.1| hypothetical protein MIMGU_mgv1a005362mg [Erythranthe guttata]
Length=487

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +3

Query  231  MTQDVEMKEQ--QPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIAL  404
            MTQDVEMKEQ  QP PS+SL+S  PS  + LKDIA+L+E GAY REVRRIVRA+R TI L
Sbjct  1    MTQDVEMKEQPEQPTPSSSLTSPSPSTLQCLKDIAALIETGAYTREVRRIVRAIRWTIQL  60

Query  405  RRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYC  584
            R+ LK S L+AFLN++L PGSDVH+RLS+Y+PKED  DMEVD A+ AP KH +PELEI+C
Sbjct  61   RKNLKASVLSAFLNFALVPGSDVHSRLSSYVPKEDGHDMEVDSATSAPTKHSLPELEIFC  120

Query  585  YLL  593
            YL+
Sbjct  121  YLV  123



>ref|XP_009773690.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana sylvestris]
Length=488

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = +3

Query  255  EQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALT  434
            E Q APS    S DPSV + LK+IASL+E+GA   EVR+I +A+RLT+ LRRKLK S L+
Sbjct  33   EDQSAPSVYDCSVDPSVLQDLKEIASLIESGANTSEVRKIYKAMRLTMKLRRKLKVSILS  92

Query  435  AFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            AFLNY+L P S+VHA+LS+YLP++D+ D +VD+   A++A +KHLVPELEIYCYLL
Sbjct  93   AFLNYALGPVSEVHAQLSSYLPQQDKYDTQVDVEMPATEAHSKHLVPELEIYCYLL  148



>gb|KHG18147.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Gossypium 
arboreum]
Length=484

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ    ++  SS+  ++  HLK+IASL+E GAY RE RRI+RA+RLT+ALRR
Sbjct  1    MTQDVEMKEQPAPSNSVPSSSPSTL-HHLKEIASLIETGAYDREARRILRAIRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KLK S L+ FL+++LTPGS+   RLS+YLPKEDE +MEVD A+   Q PAKH +PELEIY
Sbjct  60   KLKASVLSVFLSFALTPGSEAFTRLSSYLPKEDENEMEVDTATSTAQPPAKHSLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_004500920.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=488

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 101/125 (81%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK++   PSNS+S   PS  +HLK+IASL+E G+Y++EVRRI RAVRLTIALR+
Sbjct  1    MTQDLEMKDRS-TPSNSVSPPVPSTLQHLKEIASLIETGSYSKEVRRIARAVRLTIALRK  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAP-AKHLVPELEI  578
            KL  S +++FL++ LTPGS+ H +LSAYLPKE++ +MEVD A+   Q P AKHL+PELEI
Sbjct  60   KLTASVISSFLDHVLTPGSEPHTKLSAYLPKEEDHEMEVDAATSAIQTPVAKHLLPELEI  119

Query  579  YCYLL  593
            Y YLL
Sbjct  120  YSYLL  124



>gb|KDP29682.1| hypothetical protein JCGZ_18844 [Jatropha curcas]
Length=487

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ PAPSNS +S+ PS   HLK+IASL+E GAYAREVRRIVRAVRLT+ALRR
Sbjct  1    MTQDVEMKEQ-PAPSNSTTSSSPSTLHHLKEIASLIETGAYAREVRRIVRAVRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELEIY  581
            KLK   L+AFLN++L+PGS+ H RL +YLPKEDE +MEVD A+    A  KH +PELEIY
Sbjct  60   KLKAQVLSAFLNFALSPGSEPHNRLVSYLPKEDEHEMEVDTATSVTPALVKHPLPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_006390248.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
 dbj|BAJ34390.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27534.1| hypothetical protein EUTSA_v10018459mg [Eutrema salsugineum]
Length=488

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P+ S+ S   S  +HLK+IA+L++ G+Y +EVRRI RAVRLT+ LRR
Sbjct  1    MTQDVEMKDNQ-TPTQSVVSATTSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAP-AKHLVPELEI  578
            KL +S +++FL+++L PGS+ H RLS+++PK DE DMEVD A   SQAP +KHL  ELEI
Sbjct  60   KLTSSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSNSQAPSSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_004154161.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like, partial [Cucumis sativus]
Length=235

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 2/122 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAP-SNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MTQD EMKE  PAP S+S SS  PS  ++LK+I SL+E GAYAREVRRIVRA+RLT+ALR
Sbjct  1    MTQDAEMKEL-PAPLSSSSSSVSPSTIQNLKEIVSLIETGAYAREVRRIVRAIRLTMALR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCY  587
            RKLK S L+ FLN  L  GS+VH RLS++LPKED+ +M+VD A+QAPAKH +PE+EI+CY
Sbjct  60   RKLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDTATQAPAKHHLPEIEIFCY  119

Query  588  LL  593
            L+
Sbjct  120  LI  121



>ref|XP_009401896.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 6/125 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSL-SSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT DVEM+ Q  APS+S+ S+T PS  +HLK+IASL+E GA  +EVRRIVRAVRLT+ LR
Sbjct  1    MTADVEMEVQ--APSSSVPSATVPSTLQHLKEIASLIETGAQGKEVRRIVRAVRLTMMLR  58

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+ S L+AFL + L  GS+  A+LS++LPK+DE DM+VD A+   Q PAKH +PELEI
Sbjct  59   RKLRASVLSAFLGHVLPSGSEAFAKLSSFLPKDDEHDMDVDTAASAVQGPAKHCIPELEI  118

Query  579  YCYLL  593
            +CYL+
Sbjct  119  FCYLI  123



>ref|NP_177726.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
 sp|Q9LQR8.2|PSD3B_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog B; AltName: Full=26S proteasome regulatory subunit RPN3b; 
Short=AtRPN3b; AltName: Full=26S proteasome regulatory 
subunit S3 homolog B [Arabidopsis thaliana]
 gb|AAL09749.1| At1g75990/T4O12_21 [Arabidopsis thaliana]
 gb|AAU90061.1| At1g75990 [Arabidopsis thaliana]
 gb|AEE35783.1| probable 26S proteasome non-ATPase regulatory subunit 3b [Arabidopsis 
thaliana]
Length=487

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P+ S+ S   S  ++LK+IA+L++ G+Y +EVRRI RAVRLT+ LRR
Sbjct  1    MTQDVEMKDNQ-TPTQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S +++FL+++L PGS+ H RLS+++PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSNSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>ref|XP_009355646.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Pyrus x bretschneideri]
Length=487

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS+SST PS   +LK+IASL+E  AY REVRRIVRAVRLT+ LRR
Sbjct  1    MTQDVEMKEV-PAPSNSVSSTSPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK S ++AFLN++LTPGS+VH+RLS++LPK+DE DM+VD    A+Q PAKH +PELE+Y
Sbjct  60   KLKVSVISAFLNFALTPGSEVHSRLSSFLPKDDEQDMDVDTATSATQVPAKHALPELEMY  119

Query  582  CYLL  593
             YLL
Sbjct  120  SYLL  123



>ref|XP_010416506.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Camelina sativa]
Length=487

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRRI RAVRLT+ LR+
Sbjct  1    MTQDVEMKDNH-TPTQSVVSATTSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S L++FL+++L PGS+ H RLS ++PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRLSPFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>gb|KFK42036.1| hypothetical protein AALP_AA2G203500 [Arabis alpina]
Length=488

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD+EMK+ Q    + + S   S  +HLK+IA+L+++G+Y +EVRRI RAVRLT+ LR+
Sbjct  1    MTQDIEMKDNQTPTQSIIVSATTSTLQHLKEIAALIDSGSYTKEVRRIARAVRLTVGLRK  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S +++FL+++L PGSD H RLS+++PK +E DMEVD A   SQA  KHL  ELEIY
Sbjct  61   KLTGSVISSFLDFALVPGSDAHTRLSSFVPKSNEHDMEVDTASSNSQATTKHLPAELEIY  120

Query  582  CYLL  593
            CY L
Sbjct  121  CYFL  124



>ref|XP_010933362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVF-EHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT DVEMKE Q APSNSLSS   S   +HLK+I+SL+E GAYA+EVRRIVRAVRLT+ LR
Sbjct  1    MTNDVEMKEVQ-APSNSLSSATASSTLQHLKEISSLIETGAYAKEVRRIVRAVRLTMMLR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+ + ++AFL+Y+L PGS+ H+RLS++LPK++E DM+VD A+   Q PAK+ +PELEI
Sbjct  60   RKLRAAVVSAFLSYALAPGSEAHSRLSSFLPKDEEHDMDVDTATSAAQGPAKYSLPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>ref|XP_009773691.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Nicotiana sylvestris]
Length=487

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 4/116 (3%)
 Frame = +3

Query  255  EQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALT  434
            E Q APS    S DPSV + LK+IASL+E+GA   EVR+I +A+RLT+ LRRKLK S L+
Sbjct  33   EDQSAPSVYDCSVDPSVLQDLKEIASLIESGANTSEVRKIYKAMRLTMKLRRKLKVSILS  92

Query  435  AFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            AFLNY+L P S+VHA+LS+YLP +D+ D +VD+   A++A +KHLVPELEIYCYLL
Sbjct  93   AFLNYALGPVSEVHAQLSSYLP-QDKYDTQVDVEMPATEAHSKHLVPELEIYCYLL  147



>ref|XP_002889051.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65310.1| hypothetical protein ARALYDRAFT_476749 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P+ S+ S   S  ++LK+IA+L++ G+Y +EVRRI RAVRLT+ LRR
Sbjct  1    MTQDVEMKDNQ-TPTESVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            +L  S +++FL+++L PGS+ H RLS+++PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   QLTGSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>ref|XP_010428646.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 92/124 (74%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRRI RAVRLT+ LR+
Sbjct  1    MTQDVEMKDNH-TPTQSVVSATTSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S L++FL+++L PGS+ H R+S ++PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRISPFVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>ref|XP_002312950.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86905.2| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=485

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ    +++ SS   S   HLK+IASL+E GAYA+E RRI RAVRLT  LRR
Sbjct  1    MTQDVEMKEQHQPSNSTTSSP--STLHHLKEIASLIETGAYAKETRRIQRAVRLTNTLRR  58

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KLK S L AFLN++L+ GS+   RL +YLPKEDE +MEVD A   +QAPAKH +PELEIY
Sbjct  59   KLKASVLYAFLNFALSAGSESFNRLISYLPKEDEYEMEVDTATSVTQAPAKHPLPELEIY  118

Query  582  CYLL  593
            CYLL
Sbjct  119  CYLL  122



>ref|XP_002306189.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE86700.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=488

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQQ  PSNS +S+ PS   HLK+IASL+E GAYA+E RRIVRAVRLT+ LRR
Sbjct  1    MTQDVEMKEQQQQPSNSTTSSSPSTLHHLKEIASLIETGAYAKEARRIVRAVRLTMTLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD---IASQAPAKHLVPELEIY  581
            KLK S L+AFLN++L+ GS+   RL +YLPKED  +MEVD     +QAPAK+ +PELEIY
Sbjct  61   KLKASVLSAFLNFALSAGSEPFNRLISYLPKEDAHEMEVDSVTSVTQAPAKYPLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_004145004.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 ref|XP_004160668.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cucumis sativus]
 gb|KGN46247.1| hypothetical protein Csa_6G077440 [Cucumis sativus]
Length=485

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 100/122 (82%), Gaps = 2/122 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAP-SNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MTQD EMKE  PAP S+S SS  PS  ++LK+I SL+E GAYAREVRRIVRA+RLT+ALR
Sbjct  1    MTQDAEMKEL-PAPLSSSSSSVSPSTIQNLKEIVSLIETGAYAREVRRIVRAIRLTMALR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCY  587
            RKLK S L+ FLN  L  GS+VH RLS++LPKED+ +M+VD A+QAPAKH +PE+EI+CY
Sbjct  60   RKLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDTATQAPAKHHLPEIEIFCY  119

Query  588  LL  593
            L+
Sbjct  120  LI  121



>ref|XP_011045871.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=486

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQ    +++ SS   S   HLK+IASL+E GAYA+E RRI RAVRLT  LRR
Sbjct  1    MTQDVEMKEQHQPSNSTTSSP--STLHHLKEIASLIETGAYAKETRRIQRAVRLTNTLRR  58

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KLK S L AFLN++L+ GS+   RL +YLPKEDE +MEVD A   +QAPAKH +PELEIY
Sbjct  59   KLKASVLYAFLNFALSAGSESFNRLISYLPKEDEHEMEVDTATSVTQAPAKHPLPELEIY  118

Query  582  CYLL  593
            CYLL
Sbjct  119  CYLL  122



>ref|XP_006302193.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
 gb|EOA35091.1| hypothetical protein CARUB_v10020202mg [Capsella rubella]
Length=487

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRRI RAVRLT+ LR 
Sbjct  1    MTQDVEMKDNH-TPTQSVVSATTSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRL  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S +++FL+++L PGS+ H RLS ++PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSCFVPKGDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>ref|XP_002521275.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF41131.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKE---QQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MTQDVEMKE      APSNS +S+ PS  +HLK+IASL+E GAYAREVRRIVRAVRLT+A
Sbjct  1    MTQDVEMKEVPAAAAAPSNSTTSSSPSTLQHLKEIASLIETGAYAREVRRIVRAVRLTMA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPEL  572
            LRRKLK   L+AFLN  LTPGSD + RLS++LPKED+ +MEVD A   +QAPAKH +PEL
Sbjct  61   LRRKLKAQLLSAFLNSILTPGSDPYTRLSSFLPKEDDHEMEVDTATSVTQAPAKHPLPEL  120

Query  573  EIYCYLL  593
            E+YCYLL
Sbjct  121  EMYCYLL  127



>ref|XP_010666922.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q A SNSLSS DP   +HLK+IASL+E G+Y +E RRI RA+RLT  +R 
Sbjct  1    MTQDVEMKDTQ-AHSNSLSSADPPTLKHLKEIASLLETGSYTKETRRISRAIRLTFVIRH  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL +  L  FL+Y+L PGS+ H ++SA+LPK  E +MEVD A+   Q   K  +PELEI+
Sbjct  60   KLTSRVLHLFLDYALVPGSEAHGKISAFLPKGGEHEMEVDTATSAVQTSGKSTLPELEIF  119

Query  582  CYLL  593
            CYL+
Sbjct  120  CYLI  123



>ref|XP_007017884.1| PAM domain protein isoform 3 [Theobroma cacao]
 gb|EOY15109.1| PAM domain protein isoform 3 [Theobroma cacao]
Length=323

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P +S+SS  PS   HLK+IASL+E G+Y +EVRRIVRAVRLT  LRR
Sbjct  1    MTQDVEMKDHQ-TPPHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            KL    L+AFL+++L PGS+  ARLS++LPKEDE +MEVD A+   Q   KHL+PELEI
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEI  118



>ref|XP_007017883.1| PAM domain protein isoform 2 [Theobroma cacao]
 gb|EOY15108.1| PAM domain protein isoform 2 [Theobroma cacao]
Length=363

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P +S+SS  PS   HLK+IASL+E G+Y +EVRRIVRAVRLT  LRR
Sbjct  1    MTQDVEMKDHQ-TPPHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            KL    L+AFL+++L PGS+  ARLS++LPKEDE +MEVD A+   Q   KHL+PELEI
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEI  118



>ref|XP_010471748.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=487

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRRI RAVRLT+ LR+
Sbjct  1    MTQDVEMKDNH-TPTQSVVSATTSTLQHLKEIAALIDTGSYTKEVRRIARAVRLTVGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEIY  581
            KL  S L++FL+++L PGS+ H R+S  +PK DE DMEVD A   SQAP KHL  ELEIY
Sbjct  60   KLTASVLSSFLDFALVPGSEAHTRISPLVPKSDEHDMEVDTASSTSQAPPKHLPAELEIY  119

Query  582  CYLL  593
            CY +
Sbjct  120  CYFI  123



>ref|XP_006601362.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X2 [Glycine max]
Length=497

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M++DVEMK+Q   PS+SLSS  PS  +HLK+IAS++E G+Y++EVRRI RA+RLT ALRR
Sbjct  8    MSEDVEMKDQ-ATPSHSLSSVPPSALQHLKEIASIIETGSYSKEVRRIARALRLTFALRR  66

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYL--PKEDELDMEVDIAS---QAP-AKHLVPEL  572
            KL    L++FL+Y L P S+ H RLS++L  PKE + +MEVD ++   Q P AKHL+PEL
Sbjct  67   KLTAPVLSSFLDYVLPPASEPHTRLSSFLPNPKEGDREMEVDSSTSTIQTPAAKHLLPEL  126

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  127  EIYCYLL  133



>ref|XP_003550437.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like isoform X1 [Glycine max]
 gb|KHN12619.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M++DVEMK+Q   PS+SLSS  PS  +HLK+IAS++E G+Y++EVRRI RA+RLT ALRR
Sbjct  1    MSEDVEMKDQ-ATPSHSLSSVPPSALQHLKEIASIIETGSYSKEVRRIARALRLTFALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYL--PKEDELDMEVDIAS---QAP-AKHLVPEL  572
            KL    L++FL+Y L P S+ H RLS++L  PKE + +MEVD ++   Q P AKHL+PEL
Sbjct  60   KLTAPVLSSFLDYVLPPASEPHTRLSSFLPNPKEGDREMEVDSSTSTIQTPAAKHLLPEL  119

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  120  EIYCYLL  126



>ref|XP_006416422.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
 gb|ESQ34775.1| hypothetical protein EUTSA_v10007479mg [Eutrema salsugineum]
Length=488

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE Q  PS S+ S+  S  +HLK+IA+L++ G+Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKENQ-TPSQSIISSTTSTMQHLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            K+  S L++FL+++L PGS+ H+RLS+++PK +E DMEVD AS     AP+KHL  ELEI
Sbjct  60   KITGSVLSSFLDFALVPGSEAHSRLSSFVPKGEEYDMEVDTASSATQAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_009106250.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B [Brassica rapa]
Length=491

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQDVEMK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRR+ RAVRLT+ +R+K
Sbjct  5    TQDVEMKDNNQTPAQSIVSATTSTLQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIRQK  64

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELEIYC  584
            L  S + +FL+++L PGS+ HARLS+++PK DE DMEVD AS    A +KH+  ELEIYC
Sbjct  65   LTASVVASFLDFALGPGSEAHARLSSFVPKSDEHDMEVDTASSTSLAASKHVPVELEIYC  124

Query  585  YLL  593
            Y +
Sbjct  125  YFI  127



>ref|XP_008377724.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase 
regulatory subunit 3 [Malus domestica]
Length=487

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE   APSNS+SST PS   +LK+IASL+E  AY REVRRIVRAVRLT+ LRR
Sbjct  1    MTQDVEMKEV-LAPSNSVSSTSPSXLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KLK S ++AFL ++LTPGS+VH+RLS++LPK+DE DM+VD    A+Q PAKH +PELE+Y
Sbjct  60   KLKVSVISAFLXFALTPGSEVHSRLSSFLPKDDEQDMDVDTATSATQVPAKHALPELEMY  119

Query  582  CYLL  593
             YLL
Sbjct  120  SYLL  123



>ref|XP_007017885.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
 gb|EOY15110.1| PAM domain (PCI/PINT associated module) protein isoform 4 [Theobroma 
cacao]
Length=474

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P +S+SS  PS   HLK+IASL+E G+Y +EVRRIVRAVRLT  LRR
Sbjct  1    MTQDVEMKDHQ-TPPHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            KL    L+AFL+++L PGS+  ARLS++LPKEDE +MEVD A+   Q   KHL+PELEI
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEI  118



>ref|XP_007017882.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
 gb|EOY15107.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma 
cacao]
Length=487

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P +S+SS  PS   HLK+IASL+E G+Y +EVRRIVRAVRLT  LRR
Sbjct  1    MTQDVEMKDHQ-TPPHSVSSAVPSTLHHLKEIASLIETGSYTKEVRRIVRAVRLTFGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            KL    L+AFL+++L PGS+  ARLS++LPKEDE +MEVD A+   Q   KHL+PELEI
Sbjct  60   KLTAPVLSAFLDFALQPGSEALARLSSFLPKEDEHEMEVDTATSAVQTSGKHLLPELEI  118



>ref|XP_008460112.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Cucumis melo]
Length=485

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD EMKE     S+S SS  PS  ++LK+I SL+E GAYAREVRRIVRA+RLT+ALRR
Sbjct  1    MTQDAEMKELPAPLSSSSSSASPSALQNLKEIVSLIETGAYAREVRRIVRAIRLTMALRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAKHLVPELEIYCYL  590
            KLK S L+ FLN  L  GS+VH RLS++LPKED+ +M+VD A+QAPAKH +PE+EIY YL
Sbjct  61   KLKASVLSQFLNLVLPTGSEVHTRLSSFLPKEDDCEMDVDTATQAPAKHPLPEIEIYSYL  120

Query  591  L  593
            +
Sbjct  121  I  121



>ref|XP_002893093.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69352.1| EMB2719 [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  +HLK+IA+L++ G+Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDNN-TPSQSVISSSTSTMQHLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_002510590.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
 gb|EEF52777.1| 26S proteasome regulatory subunit S3, putative [Ricinus communis]
Length=491

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +3

Query  237  QDVEMKEQQ-PAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            +DV MK  Q P+PS S+    PS   HLK+IASL+   +Y++EVR + RAVRLT+ +RRK
Sbjct  5    EDVGMKHNQTPSPSPSVPLALPSTLHHLKEIASLIVTASYSKEVRPMFRAVRLTVGIRRK  64

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQA---PAKHLVPELEIYC  584
            L    L+AF++++L P SDVH RLSAYLPKE+E DMEVD A+ A   P KH +PELEIYC
Sbjct  65   LTAPLLSAFIDFALLPASDVHNRLSAYLPKENEHDMEVDSATSATRTPPKHTLPELEIYC  124

Query  585  YLL  593
            YLL
Sbjct  125  YLL  127



>ref|XP_008382101.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=487

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE  PAPSNS+SS  PS   +LK+IASL+E  AY REVRRIVRAVRLT+ LRR
Sbjct  1    MTQDVEMKEV-PAPSNSVSSASPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMVLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQA---PAKHLVPELEIY  581
            KLK S ++AFLN++LTPGS+VH+RL ++LPK+DE DM+VD A+ A   PAKH +PELE+Y
Sbjct  60   KLKVSVISAFLNFALTPGSEVHSRLLSFLPKDDEQDMDVDTATSATLVPAKHALPELEMY  119

Query  582  CYLL  593
             YLL
Sbjct  120  SYLL  123



>ref|XP_008236045.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Prunus mume]
Length=490

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPS---NSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MTQDVEMKE  P PS   NS SST PS   +LK+IASL+E  AY REVRRIVRAVRLT+ 
Sbjct  1    MTQDVEMKEV-PVPSIPSNSASSTSPSTLHNLKEIASLLETAAYTREVRRIVRAVRLTMV  59

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRRKLK S L+AFLN++L+PGS+VH+RLS+YLP++DE DM+VD    A+Q  +KH +PEL
Sbjct  60   LRRKLKVSVLSAFLNFALSPGSEVHSRLSSYLPRDDEHDMDVDTATSATQVSSKHALPEL  119

Query  573  EIYCYLL  593
            EIY YLL
Sbjct  120  EIYSYLL  126



>ref|XP_003545019.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Glycine max]
 gb|KHN39404.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Glycine 
soja]
Length=490

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M++D EMK+Q   PS+ LSS  PS   HLK IAS++E G+Y++EVRRI RA+RLT A RR
Sbjct  1    MSEDEEMKDQ-ATPSHLLSSVPPSTLHHLKGIASIIETGSYSKEVRRIARALRLTFAFRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYL--PKEDELDMEVDIASQA----PAKHLVPEL  572
            KL T  L++FL+Y LTP S+ H RLS+YL  PKE + +MEVD A+       AKHL+PEL
Sbjct  60   KLTTPVLSSFLDYVLTPASEPHTRLSSYLPNPKEGDREMEVDSATSTIQTLAAKHLLPEL  119

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  120  EIYCYLL  126



>ref|XP_007200984.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
 gb|EMJ02183.1| hypothetical protein PRUPE_ppa004807mg [Prunus persica]
Length=490

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPS---NSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MTQDVEMKE   APS   NS SST PS   +LK+IASL+E  AY+REVRRIVRAVRLT+ 
Sbjct  1    MTQDVEMKEV-TAPSIPSNSASSTSPSTLHNLKEIASLLETAAYSREVRRIVRAVRLTMV  59

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRRKLK S L+AFLN++L+PGS+VH+RLS+YLPK+DE DM+VD    A+Q  +KH +PEL
Sbjct  60   LRRKLKVSVLSAFLNFALSPGSEVHSRLSSYLPKDDEHDMDVDTATSATQVSSKHALPEL  119

Query  573  EIYCYLL  593
            EIY YLL
Sbjct  120  EIYSYLL  126



>ref|XP_011046661.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Populus euphratica]
Length=488

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKEQQ  PSNS +S+ PS   HLK+IASL+E GAYA+E RRIVRAVRLT+ LRR
Sbjct  1    MTQDVEMKEQQQQPSNSSTSSSPSTLHHLKEIASLIETGAYAKEARRIVRAVRLTMTLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD---IASQAPAKHLVPELEIY  581
            KLK S L+AFLN++L+ GS+   RL +YLPKED  +MEVD     +QAPAK+ +PELEIY
Sbjct  61   KLKASVLSAFLNFALSAGSEPFNRLISYLPKEDAHEMEVDSVTSVTQAPAKYPLPELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>ref|XP_010920092.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=488

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MT D+EMKE Q   ++  S+T  S  +HLK+IASL+E+GAYA+EVRRIVRAVRLT+ LRR
Sbjct  1    MTNDLEMKEVQAPSNSVSSATASSTLQHLKEIASLIESGAYAKEVRRIVRAVRLTMMLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL+   ++AFL Y+L PGS+ H+RLS+YLPK+++ DM+VD A+   Q PAK+ + ELEIY
Sbjct  61   KLRAPVVSAFLGYALAPGSEAHSRLSSYLPKDEQHDMDVDTATSAVQGPAKYSLLELEIY  120

Query  582  CYLL  593
            CYLL
Sbjct  121  CYLL  124



>emb|CDX73215.1| BnaC06g36630D [Brassica napus]
Length=491

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQDVEMK+    P  S+ S   S+ +HLK+IA+L++ G+Y +EVRR+ RAVRLT+ +R+K
Sbjct  5    TQDVEMKDNNQTPPQSIVSATTSILQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIRQK  64

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAP---AKHLVPELEIYC  584
            L  S +++FL+++L  GS+ HARLS+++PK DE DMEVD AS  P   +KH+  ELE+YC
Sbjct  65   LTASVVSSFLDFALGHGSEAHARLSSFVPKSDEHDMEVDTASSIPLAASKHVPVELEVYC  124

Query  585  YLL  593
            Y +
Sbjct  125  YFI  127



>ref|XP_009413027.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413028.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413029.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Musa acuminata subsp. malaccensis]
Length=487

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 99/125 (79%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT DVEMKE Q A SNS+SS   PS  +H+K+IASL+E+GA A+EVRRIVRAVRLT+ LR
Sbjct  1    MTADVEMKEVQ-AFSNSVSSAGVPSTLQHMKEIASLIESGAQAKEVRRIVRAVRLTMMLR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+   + AFL Y LTP S+V A+LS+YLPK+D+ DM+VD A+   Q PAKH +PELEI
Sbjct  60   RKLRAPLVAAFLGYVLTPASEVFAKLSSYLPKDDDHDMDVDTAASAVQGPAKHSIPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>ref|XP_008809439.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=488

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 100/125 (80%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVF-EHLKDIASLVEAGayarevrrivravrLTIALR  407
            M+ DVEMKE Q APSNSLSS   S   +HLK+IASL+E GAYA+EVRRIVRAVRLT+ LR
Sbjct  1    MSNDVEMKEVQ-APSNSLSSATASSTLQHLKEIASLIETGAYAKEVRRIVRAVRLTMMLR  59

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEI  578
            RKL+  A++AFL+ +L PGS+ H RLS+YLPK++E DM+VD A+   Q  AK+ +PELEI
Sbjct  60   RKLRAPAVSAFLSCALAPGSEAHLRLSSYLPKDEERDMDVDTATSAAQGLAKYSLPELEI  119

Query  579  YCYLL  593
            YCYLL
Sbjct  120  YCYLL  124



>ref|XP_010107643.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
 gb|EXC16554.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Morus 
notabilis]
Length=487

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 100/124 (81%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMKE Q   ++  S++  ++  HLK+IA+L+E GA+ REVRRI+RAVRLT+ALRR
Sbjct  1    MTQDVEMKELQDPSNSVSSTSPSTL-HHLKEIAALIETGAFGREVRRILRAVRLTMALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD---IASQAPAKHLVPELEIY  581
            KLK+S L+AFLN++L PGS++HARLS+YLPK+++ +M+VD     +QA  KH  PELEIY
Sbjct  60   KLKSSVLSAFLNFALAPGSELHARLSSYLPKDNDHEMDVDTATATTQATVKHSPPELEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|XP_006307354.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
 gb|EOA40252.1| hypothetical protein CARUB_v10008972mg [Capsella rubella]
Length=488

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDNH-TPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKNDEHDMEVDTASSATEAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_010477252.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI R+VRLTI LRR
Sbjct  1    MTQDVEMKDNH-TPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARSVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTASVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQVAPSKHLPLELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>emb|CDY31901.1| BnaC07g15510D [Brassica napus]
Length=251

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 11/124 (9%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M QDVEMK+    PS S         +HLK+IA L++ G+Y +EVRRI RAVRLTI LRR
Sbjct  1    MAQDVEMKDNH-TPSQS-------TMQHLKEIADLIDTGSYTKEVRRIARAVRLTIGLRR  52

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            KL +S LT+FL+++L PGS+ H+RLS++ PK DE DMEVD    A+Q P+K+L  ELEIY
Sbjct  53   KLTSSVLTSFLDFALVPGSEPHSRLSSFTPKGDEHDMEVDTATSATQPPSKNLPSELEIY  112

Query  582  CYLL  593
            CY +
Sbjct  113  CYFI  116



>ref|XP_010459703.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A [Camelina sativa]
Length=488

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 94/125 (75%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDNH-TPSQSIISSSTSTMQNLKEIAALIDTGLYTKEVRRIARAVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPLELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_010498455.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
A-like [Camelina sativa]
Length=488

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI RAVRLTI LRR
Sbjct  1    MTQDVEMKDNH-TPSQSIVSSSTSTIQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQA----PAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS A    P+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQVSPSKHLPLELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>gb|AAL09760.1| At1g20200/T20H2_4 [Arabidopsis thaliana]
Length=378

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI RAVRLTI LR+
Sbjct  1    MTQDVEMKDNN-TPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_004499304.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Cicer arietinum]
Length=491

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDV+MK+  PAPS+S+SS  PS  ++LK+IAS++E G+ ++EVRRI RAVRLT+ALR 
Sbjct  1    MTQDVDMKDH-PAPSHSISSAIPSTLQNLKEIASIIETGSNSKEVRRISRAVRLTMALRP  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYL--PKEDELDMEVD----IASQAPAKHLVPEL  572
            KL    L++F+ + L   S+ H+RLS+YL  PK+D  +MEVD    +A Q P KHL+PEL
Sbjct  60   KLTAPILSSFITHVLPFASEPHSRLSSYLPNPKDDGNEMEVDTATSVAIQTPPKHLLPEL  119

Query  573  EIYCYLL  593
            EIYCY L
Sbjct  120  EIYCYFL  126



>ref|XP_007160631.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
 gb|ESW32625.1| hypothetical protein PHAVU_001G003600g [Phaseolus vulgaris]
Length=490

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 7/127 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M++DVEMK+Q   PS+ +SS  PS  + LK+I+S++E G+Y++EVRRI RAVRLT ALRR
Sbjct  1    MSEDVEMKDQ-ATPSHVISSALPSTLQDLKEISSIIETGSYSKEVRRIARAVRLTFALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLP--KEDELDMEVDIASQA----PAKHLVPEL  572
            KL    L++FL+Y L P S++H + S+YLP  KE + +MEVD A+ A     AKHL+PEL
Sbjct  60   KLTAPLLSSFLDYVLVPASELHTKFSSYLPSLKEGDREMEVDSATSAIQNPVAKHLLPEL  119

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  120  EIYCYLL  126



>ref|NP_173447.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
 sp|Q9LNU4.3|PSD3A_ARATH RecName: Full=26S proteasome non-ATPase regulatory subunit 3 
homolog A; AltName: Full=26S proteasome regulatory subunit RPN3a; 
Short=AtRPN3a; AltName: Full=26S proteasome regulatory 
subunit S3 homolog A; AltName: Full=Protein EMBRYO DEFECTIVE 
2719; AltName: Full=Protein HAPLESS 15 [Arabidopsis thaliana]
 gb|AAP86658.1| 26S proteasome subunit RPN3a [Arabidopsis thaliana]
 gb|AEE29950.1| probable 26S proteasome non-ATPase regulatory subunit 3a [Arabidopsis 
thaliana]
Length=488

 Score =   110 bits (275),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI RAVRLTI LR+
Sbjct  1    MTQDVEMKDNN-TPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++PK DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_009628273.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +3

Query  261  QPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAF  440
            Q  PS    S DPSV + LK+IAS++E+GA   EVR+I +A+RLT+ LRRKLK S L+AF
Sbjct  33   QSTPSVYDCSVDPSVLQDLKEIASMIESGANTSEVRKIYKAMRLTMKLRRKLKVSMLSAF  92

Query  441  LNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            LNY+L   S+VHA+LS+Y+P++D+ D +VD+    ++A + HLVPELE YCYLL
Sbjct  93   LNYALGHVSEVHAQLSSYVPQQDKYDTQVDVEMSETEAHSTHLVPELETYCYLL  146



>gb|AAF26768.2|AC007396_17 T4O12.21 [Arabidopsis thaliana]
Length=532

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 22/142 (15%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+ Q  P+ S+ S   S  ++LK+IA+L++ G+Y +EVRRI RAVRLT+ LRR
Sbjct  1    MTQDVEMKDNQ-TPTQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPK------------------EDELDMEVDIA  536
            KL  S +++FL+++L PGS+ H RLS+++PK                   DE DMEVD A
Sbjct  60   KLTGSVISSFLDFALVPGSEAHTRLSSFVPKIHVLVFALNLMEFIILVQSDEHDMEVDTA  119

Query  537  ---SQAPAKHLVPELEIYCYLL  593
               SQAP KHL  ELEIYCY +
Sbjct  120  SSNSQAPPKHLPAELEIYCYFI  141



>gb|AAM53298.1| putative proteasome regulatory subunit S3 [Arabidopsis thaliana]
Length=488

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+    PS S+ S+  S  ++LK+IA+L++ G+Y +EVRRI RAVRLTI LR+
Sbjct  1    MTQDVEMKDNN-TPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQ  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ----APAKHLVPELEI  578
            KL  S L++FL+++L PGS+ H+RLS+++P+ DE DMEVD AS     AP+KHL  ELEI
Sbjct  60   KLTGSVLSSFLDFALVPGSEAHSRLSSFVPEGDEHDMEVDTASSATQAAPSKHLPAELEI  119

Query  579  YCYLL  593
            YCY +
Sbjct  120  YCYFI  124



>ref|XP_010935159.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Elaeis guineensis]
Length=493

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 8/129 (6%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSV-----FEHLKDIASLVEAGayarevrrivravrLT  395
            MTQ+VEM E Q A + + +S+  S       +HLK+IA+L+E+GAYA+EVRRIVRAVRLT
Sbjct  1    MTQEVEMVEHQAAAAAAPTSSVSSATASSTLQHLKEIAALIESGAYAKEVRRIVRAVRLT  60

Query  396  IALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVP  566
            + LRRKL+   + +FLN+ L P S+ H+RLS+YLPKEDE DM+VD AS   Q P K+ +P
Sbjct  61   MMLRRKLRAPVIASFLNFVLPPVSEAHSRLSSYLPKEDEHDMDVDTASSAGQVPFKYSLP  120

Query  567  ELEIYCYLL  593
            ELEIYCY+L
Sbjct  121  ELEIYCYVL  129



>ref|XP_004231453.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Solanum lycopersicum]
Length=484

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = +3

Query  237  QDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKL  416
            Q+V+++ Q P PS    S DPSV + LK++ASL+E GAY  EV++I RA+RLT+ LR KL
Sbjct  30   QEVKVQHQSP-PSVYDCSVDPSVLQDLKEVASLIEGGAYTSEVQKIYRAMRLTMKLRSKL  88

Query  417  KTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAP-AKHLVPELEIYCYLL  593
            K S L+AFLNY L  GS+ H RLS+YLP+ D  D + D+ + A  +KHL+PELE++CYLL
Sbjct  89   KASVLSAFLNYVLISGSEFHKRLSSYLPR-DRHDSQCDVGTPATESKHLLPELEMFCYLL  147



>ref|XP_008806135.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=497

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 13/134 (10%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSV----------FEHLKDIASLVEAGayarevrrivr  380
            MTQDVEM E Q A + + ++  P+            +HLK+IA+L+E+GAYA+EVRRIVR
Sbjct  1    MTQDVEMGELQAAAAAAAAAAAPTNSVSSATTSSTLQHLKEIAALIESGAYAKEVRRIVR  60

Query  381  avrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPA  551
            AVRLT+ LRRKL+ + + +FL ++L P S+ H+RLS+YLPKED+ DM+VD A+   Q P 
Sbjct  61   AVRLTMTLRRKLRAAVIASFLKFALPPVSEAHSRLSSYLPKEDKHDMDVDTATSAGQVPF  120

Query  552  KHLVPELEIYCYLL  593
            K  +PELEIYCYLL
Sbjct  121  KCSLPELEIYCYLL  134



>ref|XP_009628274.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Nicotiana tomentosiformis]
Length=485

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +3

Query  261  QPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAF  440
            Q  PS    S DPSV + LK+IAS++E+GA   EVR+I +A+RLT+ LRRKLK S L+AF
Sbjct  33   QSTPSVYDCSVDPSVLQDLKEIASMIESGANTSEVRKIYKAMRLTMKLRRKLKVSMLSAF  92

Query  441  LNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            LNY+L   S+VHA+LS+Y+P +D+ D +VD+    ++A + HLVPELE YCYLL
Sbjct  93   LNYALGHVSEVHAQLSSYVP-QDKYDTQVDVEMSETEAHSTHLVPELETYCYLL  145



>ref|XP_008347374.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Malus domestica]
Length=243

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +3

Query  240  DVEMK--EQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            DV+MK  E Q     S  S   S  +HLK+ AS +EA +  +EVRRI RAVRLT+ALR K
Sbjct  5    DVQMKDDESQSQSKPSFHSDSASTLQHLKEAASFIEAASSTKEVRRISRAVRLTVALRXK  64

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD---IAS--QAPAKHLVPELEI  578
            L  + L+AFL+++L PGS+ HA LSAYL K D+ DMEVD    AS  Q PAKH +PEL+I
Sbjct  65   LTAAVLSAFLDFALLPGSEAHAHLSAYL-KNDKHDMEVDNDAAASXVQVPAKHALPELDI  123

Query  579  YCYLL  593
            YCYLL
Sbjct  124  YCYLL  128



>emb|CDX87648.1| BnaA07g32250D [Brassica napus]
Length=482

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 3/118 (3%)
 Frame = +3

Query  249  MKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSA  428
            MK+    P+ S+ S   S  +HLK+IA+L++ G+Y +EVRR+ RAVRLT+ +R+KL  S 
Sbjct  1    MKDNNQTPAQSIVSATTSTLQHLKEIAALIDTGSYTKEVRRVARAVRLTVGIRQKLTASV  60

Query  429  LTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQ---APAKHLVPELEIYCYLL  593
            + +FL+++L  GS+ HARLS+++PK DE DMEVD AS    A +KH+  ELEIYCY +
Sbjct  61   VASFLDFALGSGSEAHARLSSFVPKSDEHDMEVDTASSTSLAASKHVPVELEIYCYFI  118



>ref|XP_008811676.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Phoenix dactylifera]
Length=495

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 98/131 (75%), Gaps = 10/131 (8%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSV-------FEHLKDIASLVEAGayarevrrivravr  389
            MTQDVEM E Q AP  + +S++ +         +HLK+IA+L+  GAYA+EVRRIVRAVR
Sbjct  1    MTQDVEMTEPQAAPLAAAASSNSASSATASSALQHLKEIAALIGNGAYAKEVRRIVRAVR  60

Query  390  LTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHL  560
            LT+ LRRKL+  A+ AFL ++L PGS+  +RLS+YLPKEDE +M+VD+A+   Q P K+ 
Sbjct  61   LTMLLRRKLRAPAVAAFLTFALPPGSEAQSRLSSYLPKEDEHEMDVDMATSAGQVPFKNS  120

Query  561  VPELEIYCYLL  593
            +PELEIYCYLL
Sbjct  121  LPELEIYCYLL  131



>gb|EPS67790.1| hypothetical protein M569_06981, partial [Genlisea aurea]
Length=487

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK Q PA S++ S   PS  ++LK+IA+LVE GAY REVRRIVRA+R TI LR+
Sbjct  5    MTQDVEMKMQLPASSDTSSPPSPSTLQNLKEIAALVEMGAYGREVRRIVRAIRCTIQLRK  64

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS-QAPAKHLVPELEIYCY  587
            KL  S +++FLN++L PGS++ +RLS+Y+PK+ +  MEVD AS QA  KH +PE+EI+ Y
Sbjct  65   KLNASVISSFLNFTLVPGSEILSRLSSYIPKDGDHHMEVDTASAQAHGKHTLPEIEIFSY  124

Query  588  LL  593
            LL
Sbjct  125  LL  126



>gb|AFW65683.1| hypothetical protein ZEAMMB73_847170 [Zea mays]
Length=337

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP---SVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MT+DV+M + +P P+ S  +      S   HLK+IAS++EAG+ ++EVRRI RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRR+L    ++AFL ++L   S+ + RL+A +PKED+ +M+VD    A+Q   KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>gb|ACN28097.1| unknown [Zea mays]
 gb|AFW65684.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP---SVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MT+DV+M + +P P+ S  +      S   HLK+IAS++EAG+ ++EVRRI RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRR+L    ++AFL ++L   S+ + RL+A +PKED+ +M+VD    A+Q   KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>ref|NP_001149170.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
 gb|ACG34451.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=491

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP---SVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MT+DV+M + +P P+ S  +      S   HLK+IAS++EAG+ ++EVRRI RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRR+L    ++AFL ++L   S+ + RL+A +PKED+ +M+VD    A+Q   KH +PE+
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>gb|KDO68111.1| hypothetical protein CISIN_1g011352mg [Citrus sinensis]
Length=453

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 3/89 (3%)
 Frame = +3

Query  336  VEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDEL  515
            +E GA+AREVRRI+RAVRLT+ALRRKLK   L+AFLN++L PGS+ H+RL +YLPKEDE 
Sbjct  1    METGAHAREVRRIMRAVRLTMALRRKLKAPVLSAFLNFALAPGSEAHSRLLSYLPKEDEH  60

Query  516  DMEVDIASQ---APAKHLVPELEIYCYLL  593
            +MEVD AS    APAKH +PELEIYCYLL
Sbjct  61   EMEVDTASSGAPAPAKHPLPELEIYCYLL  89



>ref|XP_003589555.1| 26S proteasome non-ATPase regulatory subunit [Medicago truncatula]
 gb|AES59806.1| 26S proteasome non-ATPase regulatory subunit 3 [Medicago truncatula]
Length=483

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 15/127 (12%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD EMK+  P PS S+    PS  +HLK+IAS++E G+  +EVR+I RAVRLT+ALR 
Sbjct  1    MTQDEEMKDL-PTPSQSI----PSTLQHLKEIASIIETGSNLKEVRKISRAVRLTLALRS  55

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLP--KEDELDMEVDIAS----QAPAKHLVPEL  572
            KL    L++FL+Y L P    H+ LS+YLP  K  + +MEVD A+    Q PAKHL+PEL
Sbjct  56   KLTAPVLSSFLHYVLPP----HSTLSSYLPNSKGGDHEMEVDTATSAAIQTPAKHLLPEL  111

Query  573  EIYCYLL  593
            EIYCY L
Sbjct  112  EIYCYFL  118



>gb|AAF79894.1|AC022472_3 Contains similarity to 26s proteasome regulatory subunit S3 from 
Nicotiana tabacum gi|3914467 and contains a PCI PF|01399 
domain. ESTs gb|AV527569, gb|T75824, gb|T88578, gb|F15139, 
gb|AV520993, gb|AV440056, gb|AI099602, gb|F15138 come from this 
gene [Arabidopsis thaliana]
Length=519

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 34/155 (22%)
 Frame = +3

Query  231  MTQDVEMKE----------------QQPAPSNSLSSTDPSV--------------FEHLK  320
            MTQDVEMK+                Q  + S   +S    +              F  LK
Sbjct  1    MTQDVEMKDNNTPSQSIISSSTSTMQSKSRSECFNSRTVFIIAKFLLGFDALFLCFPDLK  60

Query  321  DIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLP  500
            +IA+L++ G+Y +EVRRI RAVRLTI LR+KL  S L++FL+++L PGS+ H+RLS+++P
Sbjct  61   EIAALIDTGSYTKEVRRIARAVRLTIGLRQKLTGSVLSSFLDFALVPGSEAHSRLSSFVP  120

Query  501  KEDELDMEVDIASQ----APAKHLVPELEIYCYLL  593
            K DE DMEVD AS     AP+KHL  ELEIYCY +
Sbjct  121  KGDEHDMEVDTASSATQAAPSKHLPAELEIYCYFI  155



>dbj|BAK01467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +3

Query  231  MTQDVEMKE-QQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            MT+DV+M E Q   P  + ++  PS  +HLK+IA+++EAG+ ++EVRRI RAVRLT+ALR
Sbjct  1    MTEDVQMGEPQAAPPPAAAAAPAPSTLQHLKEIAAVIEAGSLSKEVRRISRAVRLTVALR  60

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEI  578
            R+L    ++AFL ++L   SD +ARL+  LPKEDE +M+VD A   +Q   KH +PE+EI
Sbjct  61   RRLAARDVSAFLAFALPASSDAYARLTPLLPKEDEAEMDVDAAAPPTQISIKHGLPEIEI  120

Query  579  YCYLL  593
            YC LL
Sbjct  121  YCSLL  125



>ref|XP_010229049.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=490

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP--SVFEHLKDIASLVEAGayarevrrivravrLTIAL  404
            M +DV+M EQQ AP  + ++  P  S   HLK+IAS++EAG+  +EVRRI RAVRLT+AL
Sbjct  1    MPEDVQMSEQQAAPPAAATAAAPAPSTLHHLKEIASVIEAGSLTKEVRRISRAVRLTVAL  60

Query  405  RRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPA---KHLVPELE  575
            RR+L    ++AFL ++L   ++ +ARL++ LPKED+ +M++D  +QA     KH +PE+E
Sbjct  61   RRRLGHRDVSAFLAFALPASTEAYARLTSLLPKEDDTEMDLDATAQATQISIKHGLPEIE  120

Query  576  IYCYLL  593
            IYCYLL
Sbjct  121  IYCYLL  126



>ref|XP_004957510.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=489

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 4/125 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTD-PSVFEHLKDIASLVEAGayarevrrivravrLTIALR  407
            M +DVEM +     + + +     S   HLK+IAS++EAG+ ++EVRRI RA RLTIALR
Sbjct  1    MPEDVEMNDSAATAAAADAPAPAQSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTIALR  60

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIA---SQAPAKHLVPELEI  578
            R+L    + AFL ++L P S+  ARL+A +PKED  +M+VD A   +Q   KH +PE+EI
Sbjct  61   RRLAARDVAAFLAFALPPSSEAFARLAALVPKEDGSEMDVDAAAPTAQVSIKHGLPEIEI  120

Query  579  YCYLL  593
            YCYLL
Sbjct  121  YCYLL  125



>ref|NP_001063817.1| Os09g0541900 [Oryza sativa Japonica Group]
 dbj|BAB82474.1| 21D7 [Oryza sativa Japonica Group]
 dbj|BAC79193.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Oryza 
sativa Japonica Group]
 dbj|BAD46593.1| putative nuclear antigen 21D7 [Oryza sativa Japonica Group]
 dbj|BAF25731.1| Os09g0541900 [Oryza sativa Japonica Group]
 gb|EAZ45527.1| hypothetical protein OsJ_30188 [Oryza sativa Japonica Group]
Length=487

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M +DVEM + QP P+ +      S  +HLK+IAS++EAG+  +EVRRI RAVRLT+ALRR
Sbjct  1    MPEDVEMNDSQPQPAAAPPPA-ASTLQHLKEIASVIEAGSLTKEVRRISRAVRLTVALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            +L    + AFL ++L   S+  ARLS+ LPKED  +M+VD+   A+Q   KH +PE+EIY
Sbjct  60   RLAARDVAAFLAFALPHSSEAFARLSSLLPKEDGSEMDVDLAAPAAQVSIKHGLPEIEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>gb|ACA51024.1| proteasome regulatory subunit S3 [Oryza sativa Japonica Group]
Length=222

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 77/99 (78%), Gaps = 3/99 (3%)
 Frame = +3

Query  306  FEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARL  485
              HLK+IAS++EAG+ ++EVRRI RAVRLT+ALRR+L    ++AFL ++L P S+ + RL
Sbjct  24   LHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRL  83

Query  486  SAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            ++ +PKED+ +M++D+   A+Q   KH +PE+EIYCYLL
Sbjct  84   TSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLL  122



>ref|XP_004974153.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Setaria italica]
Length=491

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP---SVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            M +DV+M + +P P+    +      S   HLK+IAS++EAG+ ++EVRRI RAVRLT+A
Sbjct  1    MPEDVQMNDSEPQPAAPTPAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAVRLTVA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPEL  572
            LRR+L    ++AFL ++L   S+ +ARL+A +PKED+ +M+VD    A+Q   KH +PE+
Sbjct  61   LRRRLAARDVSAFLGFALPASSEAYARLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI  120

Query  573  EIYCYLL  593
            EIYCYLL
Sbjct  121  EIYCYLL  127



>gb|ACG34075.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP----SVFEHLKDIASLVEAGayarevrrivravrLTI  398
            M +DV+M + +P  +    +       S   HLK+IAS++EAG+ ++EVRRI RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  399  ALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPE  569
            ALRR+L    ++AFL ++L   S+ + RL A +PKED+ +M+VD    A+Q   KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYGRLIALVPKEDDTEMDVDAAAPATQISIKHGLPE  120

Query  570  LEIYCYLL  593
            +EIYCYLL
Sbjct  121  IEIYCYLL  128



>gb|ACF84535.1| unknown [Zea mays]
 gb|ACN28040.1| unknown [Zea mays]
 tpg|DAA48733.1| TPA: 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP----SVFEHLKDIASLVEAGayarevrrivravrLTI  398
            M +DV+M + +P  +    +       S   HLK+IAS++EAG+ ++EVRRI RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  399  ALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPE  569
            ALRR+L    ++AFL ++L   S+ + RL A +PKED+ +M+VD    A+Q   KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYGRLIALVPKEDDTEMDVDAVAPATQISIKHGLPE  120

Query  570  LEIYCYLL  593
            +EIYCYLL
Sbjct  121  IEIYCYLL  128



>ref|XP_002300686.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
 gb|EEE79959.1| 26S proteasome regulatory subunit S3 family protein [Populus 
trichocarpa]
Length=492

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQ--PAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIAL  404
            M+ + ++K     PAPSNS++S      + L DIASL+E G+   EV  I RAVRLT +L
Sbjct  1    MSTEAQIKSTSSTPAPSNSITSPMEGSLKSLMDIASLIETGSCKEEVFHIARAVRLTNSL  60

Query  405  RRKL-KTSALTAFLNYSLTPGSDVHARLSAYLPKED-ELDMEVDIASQAPAKHLVPELEI  578
            ++KL + + L AFL+++L+P S++H RLS +L  +  EL ME D A+ APAK + PELEI
Sbjct  61   KKKLAEPNLLQAFLDFALSPRSELHNRLSGFLDHQGGELGMEADSATSAPAKRVSPELEI  120

Query  579  YCYLL  593
            YCYLL
Sbjct  121  YCYLL  125



>gb|ABR16257.1| unknown [Picea sitchensis]
Length=492

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 5/125 (4%)
 Frame = +3

Query  234  TQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRK  413
            TQDVEMK+   APSNS + + P V  HLK++++L+E G   +EVR ++RA+R  + LRRK
Sbjct  3    TQDVEMKDSAAAPSNSSAPSPPPVLTHLKNVSALIEKGVVTKEVRLMIRAIRHIMTLRRK  62

Query  414  LKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVD----IASQAPAKH-LVPELEI  578
            +K S + AFL   L PGS+V +RL  Y PKEDE DMEVD     +   P+KH ++PELEI
Sbjct  63   IKASHVLAFLKQLLPPGSEVASRLLLYFPKEDEKDMEVDSPSSTSQTVPSKHTILPELEI  122

Query  579  YCYLL  593
            + YLL
Sbjct  123  FAYLL  127



>gb|EEE69116.1| hypothetical protein OsJ_28197 [Oryza sativa Japonica Group]
Length=467

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  312  HLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSA  491
            HLK+IAS++EAG+ ++EVRRI RAVRLT+ALRR+L    ++AFL ++L P S+ + RL++
Sbjct  26   HLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRLTS  85

Query  492  YLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
             +PKED+ +M++D+   A+Q   KH +PE+EIYCYLL
Sbjct  86   LVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLL  122



>gb|EAZ09931.1| hypothetical protein OsI_32229 [Oryza sativa Indica Group]
Length=487

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M +DVEM + QP P+ +      S  +HLK+IAS++EAG+  +EVRRI RAVRLT+ALRR
Sbjct  1    MPEDVEMNDSQPQPAAAPPPA-ASTLQHLKEIASVIEAGSLTKEVRRISRAVRLTVALRR  59

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIY  581
            +L    + AFL ++L   S+  ARLS+ LPKED  +M+VD    A+Q   KH +PE+EIY
Sbjct  60   RLAARDVAAFLAFALPHSSEAFARLSSLLPKEDGSEMDVDSAAPAAQVSIKHGLPEIEIY  119

Query  582  CYLL  593
            CYLL
Sbjct  120  CYLL  123



>ref|NP_001149380.1| LOC100283005 [Zea mays]
 gb|ACG35233.1| 26S proteasome non-ATPase regulatory subunit 3 [Zea mays]
Length=492

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 85/128 (66%), Gaps = 7/128 (5%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP----SVFEHLKDIASLVEAGayarevrrivravrLTI  398
            M +DV+M + +P  +    +       S   HLK+IAS++EAG+ ++EVRRI RA RLT+
Sbjct  1    MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV  60

Query  399  ALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPE  569
            ALRR+L    ++AFL ++L   S+ + RL A +PKED+ +M+VD    A+Q   KH +PE
Sbjct  61   ALRRRLAARDVSAFLAFALPASSEAYRRLIALVPKEDDTEMDVDAVAPATQISIKHGLPE  120

Query  570  LEIYCYLL  593
            +EIYCYLL
Sbjct  121  IEIYCYLL  128



>ref|NP_001062444.1| Os08g0550100 [Oryza sativa Japonica Group]
 dbj|BAD08959.1| putative 21D7 [Oryza sativa Japonica Group]
 dbj|BAF24358.1| Os08g0550100 [Oryza sativa Japonica Group]
Length=486

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  312  HLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSA  491
            HLK+IAS++EAG+ ++EVRRI RAVRLT+ALRR+L    ++AFL ++L P S+ + RL++
Sbjct  26   HLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRLTS  85

Query  492  YLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
             +PKED+ +M++D+   A+Q   KH +PE+EIYCYLL
Sbjct  86   LVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLL  122



>gb|EMT22108.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Aegilops 
tauschii]
Length=496

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = +3

Query  300  SVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHA  479
            S  +HLK+IAS+VEAG+  +EVRRI RAVRLT+ALRR+L    + AFL ++L P S+   
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAVRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  480  RLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            RLS  LPKED  +M+VD    A+Q   KH +PE+EIYCYLL
Sbjct  92   RLSPLLPKEDGSEMDVDTAAPAAQVSIKHGLPEIEIYCYLL  132



>dbj|BAK07086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = +3

Query  300  SVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHA  479
            S  +HLK+IAS+VEAG+  +EVRRI RA+RLT+ALRR+L    + AFL ++L P S+   
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAIRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  480  RLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            RLS  LPKED  +M+VD    A+Q   KH +PE+EIYCYLL
Sbjct  92   RLSPLLPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLL  132



>ref|XP_006660365.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3-like [Oryza brachyantha]
Length=486

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = +3

Query  300  SVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHA  479
            S   HLK+IAS++EAG+ ++EVRRI RAVRLT+ALRR+L    ++AFL ++L P S+ ++
Sbjct  22   SALHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYS  81

Query  480  RLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            RL++ +PKEDE +M+VD    A+Q   KH +PE+EIYC LL
Sbjct  82   RLTSLVPKEDETEMDVDAAAPATQISIKHGLPEIEIYCSLL  122



>dbj|BAJ90869.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 3/101 (3%)
 Frame = +3

Query  300  SVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHA  479
            S  +HLK+IAS+VEAG+  +EVRRI RA+RLT+ALRR+L    + AFL ++L P S+   
Sbjct  32   STLQHLKEIASVVEAGSLTKEVRRISRAIRLTVALRRRLAAPDVAAFLAFALPPSSEAFT  91

Query  480  RLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            RLS  LPKED  +M+VD    A+Q   KH +PE+EIYCYLL
Sbjct  92   RLSPLLPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLL  132



>ref|XP_002444618.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
 gb|EES14113.1| hypothetical protein SORBIDRAFT_07g024800 [Sorghum bicolor]
Length=496

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 87/132 (66%), Gaps = 11/132 (8%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP--------SVFEHLKDIASLVEAGayarevrrivrav  386
            M +DV+M + +P P+  +             S   HLK+IA+++EAG+ ++EVRRI RA 
Sbjct  1    MPEDVQMNDSEPQPAAPVPVAAAAAAAAPALSTLHHLKEIATVIEAGSLSKEVRRISRAF  60

Query  387  rLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKH  557
            RLT+ALRR+L    ++AFL ++L   S+ + RL+A +PKED+ +M+VD    A+Q   KH
Sbjct  61   RLTVALRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKH  120

Query  558  LVPELEIYCYLL  593
             +PE+EI+CYLL
Sbjct  121  GLPEIEIFCYLL  132



>ref|XP_010446200.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 3 homolog 
B-like [Camelina sativa]
Length=475

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 12/121 (10%)
 Frame = +3

Query  249  MKEQQPAPSNSLS-STDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTS  425
            MK+ Q    + +S +T  S  +HLK+IA+L++     +EVRRI RAVRLT+ LRRKL  S
Sbjct  1    MKDNQTQTQSLVSATTTTSTLQHLKEIAALIDT----KEVRRIARAVRLTVGLRRKLSGS  56

Query  426  ALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIASQAPAK-----HLVPELEIYCYL  590
             +++FL+++L PGS+ H RLS ++PK D  DMEVD AS + ++         ELEIYCY 
Sbjct  57   VISSFLDFALVPGSEAHTRLSCFVPKGD--DMEVDTASSSTSQAPPPPPPPTELEIYCYF  114

Query  591  L  593
            +
Sbjct  115  I  115



>ref|XP_011034975.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X2 [Populus euphratica]
Length=492

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  315  LKDIASLVEAGayarevrrivravrLTIALRRKL-KTSALTAFLNYSLTPGSDVHARLSA  491
            L DIASL+E G+  +EV  I RAVRLT +L++KL + + L AFL+++L+PGS++H RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  492  YLP-KEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            +L  +  EL ME D A+ APAK + PELEIYCYLL
Sbjct  90   FLHHQRGELGMEADSATSAPAKRVSPELEIYCYLL  124



>ref|XP_011034976.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X3 [Populus euphratica]
Length=491

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  315  LKDIASLVEAGayarevrrivravrLTIALRRKL-KTSALTAFLNYSLTPGSDVHARLSA  491
            L DIASL+E G+  +EV  I RAVRLT +L++KL + + L AFL+++L+PGS++H RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  492  YLP-KEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            +L  +  EL ME D A+ APAK + PELEIYCYLL
Sbjct  90   FLHHQRGELGMEADSATSAPAKRVSPELEIYCYLL  124



>ref|XP_011034972.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
 ref|XP_011034973.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 isoform X1 [Populus euphratica]
Length=517

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = +3

Query  315  LKDIASLVEAGayarevrrivravrLTIALRRKL-KTSALTAFLNYSLTPGSDVHARLSA  491
            L DIASL+E G+  +EV  I RAVRLT +L++KL + + L AFL+++L+PGS++H RLS 
Sbjct  30   LMDIASLIETGSCKKEVFHIARAVRLTNSLKKKLAEPNLLQAFLDFALSPGSELHNRLSG  89

Query  492  YLP-KEDELDMEVDIASQAPAKHLVPELEIYCYLL  593
            +L  +  EL ME D A+ APAK + PELEIYCYLL
Sbjct  90   FLHHQRGELGMEADSATSAPAKRVSPELEIYCYLL  124



>ref|XP_003578544.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 
3 [Brachypodium distachyon]
Length=497

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 72/99 (73%), Gaps = 3/99 (3%)
 Frame = +3

Query  306  FEHLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARL  485
             +HLK+IA +VEAG+  +EVRRI RAVRLT+ALRR+L    + AFL ++L P S+   RL
Sbjct  35   LQHLKEIALVVEAGSLTKEVRRISRAVRLTVALRRRLAARDVAAFLAFALAPSSEAFTRL  94

Query  486  SAYLPKEDELDMEVD---IASQAPAKHLVPELEIYCYLL  593
            S  LPKED  +M+VD   +A+Q   KH +PE+EIYCYLL
Sbjct  95   SPLLPKEDGSEMDVDAAALAAQVSIKHGLPEIEIYCYLL  133



>emb|CDY54330.1| BnaCnng26760D [Brassica napus]
Length=353

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 22/124 (18%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQDVEMK+      + +SST  S  +HLK+IA+L++ G+Y +EVRR+ RAVRLT+ LRR
Sbjct  1    MTQDVEMKDNHTPSQSIISSTTTSTIQHLKEIAALIDTGSYTKEVRRVARAVRLTVGLRR  60

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDIAS---QAPAKHLVPELEIY  581
            KL  S L++FL                     DE DMEVD AS   QA +KHL  ELEIY
Sbjct  61   KLTASVLSSFL-------------------LGDEHDMEVDTASSVAQASSKHLSAELEIY  101

Query  582  CYLL  593
            CY +
Sbjct  102  CYFI  105



>gb|AFW65682.1| hypothetical protein ZEAMMB73_847170 [Zea mays]
Length=112

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDP---SVFEHLKDIASLVEAGayarevrrivravrLTIA  401
            MT+DV+M + +P P+ S  +      S   HLK+IAS++EAG+ ++EVRRI RA RLT+A
Sbjct  1    MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA  60

Query  402  LRRKLKTSALTAFLNYSLTPGSDVHARLSAYLPK  503
            LRR+L    ++AFL ++L   S+ + RL+A +PK
Sbjct  61   LRRRLAARDVSAFLAFALPASSEAYGRLTALVPK  94



>ref|XP_003588288.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003604950.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003607062.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
 ref|XP_003630780.1| 26S proteasome subunit RPN3a, partial [Medicago truncatula]
Length=85

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 9/90 (10%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            MTQD EMK+  P PS S+    PS  +HLK+IAS++E G+  +EVR+I RAVRLT+ALR 
Sbjct  1    MTQDEEMKDL-PTPSQSI----PSTLQHLKEIASIIETGSNLKEVRKISRAVRLTLALRS  55

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLP  500
            KL    L++FL+Y L P    H+ LS+YLP
Sbjct  56   KLTAPVLSSFLHYVLPP----HSTLSSYLP  81



>ref|XP_002970446.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
 ref|XP_002978519.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ20505.1| hypothetical protein SELMODRAFT_233136 [Selaginella moellendorffii]
 gb|EFJ28576.1| hypothetical protein SELMODRAFT_231540 [Selaginella moellendorffii]
Length=482

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = +3

Query  249  MKEQQPAPS--NSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRRKLKT  422
            MKE  PA S  +      PS+  HLK IA+LVE G   +E+R +VRAVR  + ++RKLK 
Sbjct  1    MKEAAPAVSSPDRKDQAGPSLLSHLKSIAALVEKGVSTKEMRLMVRAVRNVMVIKRKLKP  60

Query  423  SALTAFLNYSLTPGSDVHARLSAYLPK--EDELDMEVDIASQAPAK-HLVPELEIYCYLL  593
             +L AF+ Y ++  +D    +  ++ K  ED++ MEVD+ SQ   K +++PELEI CYLL
Sbjct  61   GSLAAFVKYVMSTDAD---SVLQFVKKQEEDKVSMEVDMPSQVSNKPNVLPELEILCYLL  117



>ref|XP_001757567.1| predicted protein [Physcomitrella patens]
 gb|EDQ77624.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 73/129 (57%), Gaps = 16/129 (12%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M Q+V+MK   PAP        PSV   +K + + +E G   +E+R + RA R  + +RR
Sbjct  1    MGQEVDMKPADPAP--------PSVLSQMKVVITSIEKGVSNKEMRLMARANRQMLVVRR  52

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLPK--EDELDMEVDIASQAPAKHL------VP  566
            +L  S + AFL ++L  GSD  ARLS ++    ++E DM+VD    +   H+      +P
Sbjct  53   QLNASVVNAFLKHALPAGSDALARLSPFVAGIAKNEKDMDVDTPPISGQSHVSQKQSGLP  112

Query  567  ELEIYCYLL  593
            E+EI+CYLL
Sbjct  113  EVEIFCYLL  121



>ref|XP_001753136.1| predicted protein [Physcomitrella patens]
 gb|EDQ82177.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M QDVE +  +  P        PSV   LK + + +E G   +E+R + RA R   A+RR
Sbjct  1    MGQDVEKRPVEVVP--------PSVLSQLKGVIASIEKGVLNKEMRLMARANRQMFAVRR  52

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLP--KEDELDMEVD---IASQAPA---KHLVP  566
            +LKTS ++A + ++L  GSD  ARLS ++   ++ E DM+VD   I  Q+     + ++P
Sbjct  53   QLKTSTVSAIMKHALPAGSDALARLSPFVAALEKSEKDMDVDSPAITGQSHGSQKQSVLP  112

Query  567  ELEIYCYLL  593
            E+EI+CYLL
Sbjct  113  EVEIFCYLL  121



>ref|XP_001764054.1| predicted protein [Physcomitrella patens]
 gb|EDQ71193.1| predicted protein [Physcomitrella patens]
Length=486

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 16/129 (12%)
 Frame = +3

Query  231  MTQDVEMKEQQPAPSNSLSSTDPSVFEHLKDIASLVEAGayarevrrivravrLTIALRR  410
            M  DVEM        +SL S  PS+   L+ + S +E G  ++E+R + RA R  +A+RR
Sbjct  1    MGLDVEM--------SSLDSAPPSLLSQLRGVISSIEKGVASKEMRLMARANRQMLAVRR  52

Query  411  KLKTSALTAFLNYSLTPGSDVHARLSAYLP--KEDELDMEVDI---ASQAPA---KHLVP  566
            +LK S + AFL  +L  GSD  ARL  +L   ++ E DM+VD      Q+P    + ++P
Sbjct  53   QLKPSTVNAFLKNTLPAGSDALARLLPFLAAVEKSEKDMDVDTPPATGQSPVSQKQSVLP  112

Query  567  ELEIYCYLL  593
            E+E++CYLL
Sbjct  113  EVEVFCYLL  121



>gb|EMS49644.1| putative 26S proteasome non-ATPase regulatory subunit 3 [Triticum 
urartu]
Length=517

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = +3

Query  315  LKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSAY  494
            ++  AS VEAG+  +EVRRI RAVRLT+ALRR+L    + AFL ++L   S+   RLS  
Sbjct  58   VRSTASGVEAGSPTKEVRRISRAVRLTVALRRRLAAPDVAAFLAFALPASSEAFPRLSPL  117

Query  495  LPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            LPKED  +M+VD    A+Q   KH +PE+EIYCYLL
Sbjct  118  LPKEDGSEMDVDAAAPAAQVSIKHGLPEIEIYCYLL  153



>dbj|BAB78499.1| 26S proteasome regulatory particle non-ATPase subunit3 [Oryza 
sativa Japonica Group]
Length=419

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 41/55 (75%), Gaps = 3/55 (5%)
 Frame = +3

Query  438  FLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEIYCYLL  593
            FL ++L P S+ + RL++ +PKED+ +M++D+   A+Q   KH +PE+EIYCYLL
Sbjct  1    FLAFALPPSSEAYTRLTSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCYLL  55



>emb|CDM82954.1| unnamed protein product [Triticum aestivum]
Length=244

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +3

Query  408  RKLKTSALTAFLNYSLTPGSDVHARLSAYLPKEDELDMEVDI---ASQAPAKHLVPELEI  578
            R+L    + AFL ++L P S+   R S  LPKED  +M+VD+   A+Q   KH +PE++I
Sbjct  69   RRLVAPDIAAFLAFALPPSSEAFTRFSPLLPKEDSSEMDVDVAALAAQVSIKHGLPEIKI  128

Query  579  YCYLL  593
            YC LL
Sbjct  129  YCDLL  133



>gb|EEC83998.1| hypothetical protein OsI_30168 [Oryza sativa Indica Group]
Length=339

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +3

Query  312  HLKDIASLVEAGayarevrrivravrLTIALRRKLKTSALTAFLNYSLTPGSDVHARLSA  491
            HLK+IAS++EAG+ ++EVRRI RAVRLT+ALRR+L    ++AFL ++L P S+ + RL++
Sbjct  26   HLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRLAARDVSAFLAFALPPSSEAYTRLTS  85

Query  492  YLPK  503
             +PK
Sbjct  86   LVPK  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 704648528304