BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20447_g2_i2 len=1759 path=[1737:0-798 2536:799-1758]

Length=1759
                                                                      Score     E

ref|XP_009797424.1|  PREDICTED: uncharacterized protein LOC104243860    564   0.0      
ref|XP_009623627.1|  PREDICTED: uncharacterized protein LOC104114801    561   0.0      
ref|XP_009623628.1|  PREDICTED: uncharacterized protein LOC104114803    559   0.0      
ref|XP_009790297.1|  PREDICTED: uncharacterized protein LOC104237773    558   0.0      
ref|XP_009623626.1|  PREDICTED: uncharacterized protein LOC104114800    548   0.0      
ref|XP_010313268.1|  PREDICTED: uncharacterized protein LOC104644756    547   0.0      
ref|XP_010313269.1|  PREDICTED: uncharacterized protein LOC101259024    546   0.0      
ref|XP_006367692.1|  PREDICTED: uncharacterized protein LOC102581971    538   0.0      
ref|XP_011080434.1|  PREDICTED: uncharacterized protein LOC105163690    539   0.0      
ref|XP_009787324.1|  PREDICTED: uncharacterized protein LOC104235295    538   0.0      
ref|XP_011080433.1|  PREDICTED: uncharacterized protein LOC105163689    523   8e-178   
ref|XP_009803906.1|  PREDICTED: uncharacterized protein LOC104249222    523   2e-177   
ref|XP_009603789.1|  PREDICTED: uncharacterized protein LOC104098691    520   1e-175   
ref|XP_009785515.1|  PREDICTED: uncharacterized protein LOC104233769    520   1e-175   
ref|XP_011080435.1|  PREDICTED: uncharacterized protein LOC105163691    517   4e-175   
ref|XP_004251358.1|  PREDICTED: uncharacterized protein LOC101258437    512   3e-173   
gb|EYU46238.1|  hypothetical protein MIMGU_mgv1a007160mg                506   1e-171   
ref|XP_011090127.1|  PREDICTED: uncharacterized protein LOC105170901    499   3e-168   
gb|EYU46241.1|  hypothetical protein MIMGU_mgv1a005613mg                498   9e-168   
ref|XP_011080362.1|  PREDICTED: uncharacterized protein LOC105163636    498   1e-167   
ref|XP_006349802.1|  PREDICTED: uncharacterized protein LOC102600818    498   2e-167   
gb|EYU46239.1|  hypothetical protein MIMGU_mgv1a0225922mg               494   2e-167   
gb|EPS62128.1|  hypothetical protein M569_12664                         484   7e-163   
ref|XP_004252891.2|  PREDICTED: uncharacterized protein LOC101256858    482   2e-161   
gb|EYU46242.1|  hypothetical protein MIMGU_mgv1a026569mg                474   3e-159   
emb|CDP09269.1|  unnamed protein product                                457   3e-152   
emb|CDP09271.1|  unnamed protein product                                446   1e-147   
gb|EPS64375.1|  hypothetical protein M569_10400                         446   1e-147   
ref|XP_011032049.1|  PREDICTED: uncharacterized protein LOC105131000    431   3e-142   
ref|XP_002314081.1|  hypothetical protein POPTR_0009s05630g             429   1e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010102368.1|  hypothetical protein L484_015317                   431   2e-141   
ref|XP_006446149.1|  hypothetical protein CICLE_v10017500mg             426   8e-140   
gb|KDO61216.1|  hypothetical protein CISIN_1g037329mg                   426   9e-140   
ref|XP_002298394.2|  fringe-related family protein                      424   4e-139   Populus trichocarpa [western balsam poplar]
ref|XP_010046704.1|  PREDICTED: uncharacterized protein LOC104435699    424   9e-139   
gb|KCW87180.1|  hypothetical protein EUGRSUZ_B03707                     424   1e-138   
ref|XP_007212947.1|  hypothetical protein PRUPE_ppa022014mg             419   8e-138   
ref|XP_007212465.1|  hypothetical protein PRUPE_ppa017432mg             419   1e-137   
ref|XP_004251361.1|  PREDICTED: uncharacterized protein LOC101259312    410   2e-135   
ref|XP_011045418.1|  PREDICTED: uncharacterized protein LOC105140323    420   3e-135   
ref|XP_011013833.1|  PREDICTED: uncharacterized protein LOC105117772    420   3e-135   
ref|XP_006399763.1|  hypothetical protein EUTSA_v10015814mg             411   8e-135   
ref|XP_009374954.1|  PREDICTED: uncharacterized protein LOC103963820    413   3e-134   
ref|XP_006446152.1|  hypothetical protein CICLE_v10017529mg             409   6e-134   
ref|XP_009770979.1|  PREDICTED: uncharacterized protein LOC104221602    410   2e-133   
gb|EYU45959.1|  hypothetical protein MIMGU_mgv1a005742mg                410   2e-133   
ref|XP_009610310.1|  PREDICTED: uncharacterized protein LOC104104029    404   6e-133   
ref|XP_008385096.1|  PREDICTED: uncharacterized protein LOC103447686    410   7e-133   
ref|XP_004293167.1|  PREDICTED: uncharacterized protein LOC101293465    405   3e-132   
ref|XP_004293168.1|  PREDICTED: uncharacterized protein LOC101293755    404   4e-132   
ref|XP_002280577.1|  PREDICTED: uncharacterized protein LOC100244977    407   8e-132   Vitis vinifera
ref|XP_009621834.1|  PREDICTED: uncharacterized protein LOC104113386    400   4e-130   
ref|XP_004139115.1|  PREDICTED: uncharacterized protein LOC101213989    402   7e-130   
emb|CAN65210.1|  hypothetical protein VITISV_043548                     405   1e-129   Vitis vinifera
ref|XP_004154681.1|  PREDICTED: uncharacterized LOC101213989            400   2e-129   
gb|KDO61213.1|  hypothetical protein CISIN_1g039639mg                   397   5e-129   
ref|XP_010317971.1|  PREDICTED: uncharacterized protein LOC104646356    399   6e-129   
emb|CDP09106.1|  unnamed protein product                                400   7e-129   
gb|KHG05582.1|  Glycoprotein-N-acetylgalactosamine 3-beta-galacto...    398   1e-128   
emb|CDY53961.1|  BnaA10g29930D                                          397   3e-128   
ref|XP_010536095.1|  PREDICTED: uncharacterized protein LOC104811176    396   4e-128   
ref|XP_009121842.1|  PREDICTED: uncharacterized protein LOC103846635    396   5e-128   
ref|XP_008227352.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    394   1e-127   
ref|XP_006348567.1|  PREDICTED: uncharacterized protein LOC102583406    394   1e-127   
emb|CDP09105.1|  unnamed protein product                                397   1e-127   
ref|XP_008450413.1|  PREDICTED: uncharacterized protein LOC103492025    395   2e-127   
ref|XP_009121840.1|  PREDICTED: uncharacterized protein LOC103846632    394   9e-127   
ref|XP_009121839.1|  PREDICTED: uncharacterized protein LOC103846631    392   1e-126   
ref|XP_004289025.1|  PREDICTED: uncharacterized protein LOC101302208    388   8e-125   
ref|XP_006399762.1|  hypothetical protein EUTSA_v10015782mg             385   9e-125   
ref|XP_007015100.1|  Uncharacterized protein TCM_040746                 394   1e-124   
ref|XP_010492011.1|  PREDICTED: uncharacterized protein LOC104769490    387   6e-124   
ref|XP_010453326.1|  PREDICTED: uncharacterized protein LOC104735268    385   2e-123   
ref|XP_010686162.1|  PREDICTED: uncharacterized protein LOC104900444    384   5e-123   
ref|XP_009121841.1|  PREDICTED: uncharacterized protein LOC103846634    382   2e-122   
emb|CDX97200.1|  BnaC09g44250D                                          382   2e-122   
emb|CDY53962.1|  BnaA10g29940D                                          381   3e-122   
ref|XP_006399764.1|  hypothetical protein EUTSA_v10013507mg             379   9e-122   
ref|XP_006286708.1|  hypothetical protein CARUB_v10002857mg             377   4e-121   
ref|XP_010256826.1|  PREDICTED: uncharacterized protein LOC104597116    376   3e-120   
ref|XP_010419838.1|  PREDICTED: uncharacterized protein LOC104705520    377   4e-120   
ref|XP_009593893.1|  PREDICTED: uncharacterized protein LOC104090492    386   1e-119   
ref|XP_010262600.1|  PREDICTED: uncharacterized protein LOC104601...    374   4e-119   
ref|XP_010314847.1|  PREDICTED: uncharacterized protein LOC104645222    368   5e-119   
ref|NP_568279.2|  uncharacterized protein                               371   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871529.1|  hypothetical protein ARALYDRAFT_488094             370   1e-118   
emb|CDX70478.1|  BnaC03g05620D                                          371   2e-118   
ref|XP_010536094.1|  PREDICTED: uncharacterized protein LOC104811175    371   4e-118   
ref|XP_006446150.1|  hypothetical protein CICLE_v10017944mg             367   1e-116   
emb|CDP09272.1|  unnamed protein product                                360   3e-116   
emb|CDY53964.1|  BnaA10g29960D                                          365   7e-116   
ref|XP_009121837.1|  PREDICTED: uncharacterized protein LOC103846629    363   5e-115   
emb|CAC42907.1|  putative protein                                       352   1e-111   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97203.1|  BnaC09g44220D                                          348   2e-109   
ref|XP_006846343.1|  hypothetical protein AMTR_s00012p00258210          341   4e-106   
emb|CDX97202.1|  BnaC09g44230D                                          338   8e-106   
emb|CDX97197.1|  BnaC09g44280D                                          332   2e-104   
emb|CDY53963.1|  BnaA10g29950D                                          317   5e-99    
ref|XP_009804547.1|  PREDICTED: uncharacterized protein LOC104249759    313   1e-97    
ref|XP_010262601.1|  PREDICTED: uncharacterized protein LOC104601...    304   1e-92    
ref|XP_010262898.1|  PREDICTED: uncharacterized protein LOC104601308    305   2e-92    
ref|XP_009762736.1|  PREDICTED: uncharacterized protein LOC104214722    303   7e-92    
ref|XP_010313583.1|  PREDICTED: uncharacterized protein LOC101258725    291   3e-91    
ref|XP_009803528.1|  PREDICTED: uncharacterized protein LOC104248872    299   3e-90    
ref|XP_009619659.1|  PREDICTED: uncharacterized protein LOC104111623    299   4e-90    
ref|XP_009143455.1|  PREDICTED: uncharacterized protein LOC103867167    298   7e-90    
emb|CDY68083.1|  BnaAnng26110D                                          298   1e-89    
gb|KFK36662.1|  hypothetical protein AALP_AA4G153700                    306   2e-89    
emb|CDP00131.1|  unnamed protein product                                297   2e-89    
emb|CDY65114.1|  BnaC04g53660D                                          297   2e-89    
ref|XP_002271331.1|  PREDICTED: uncharacterized protein LOC100242633    296   5e-89    Vitis vinifera
ref|XP_006410964.1|  hypothetical protein EUTSA_v10017530mg             296   6e-89    
gb|KFK25520.1|  hypothetical protein AALP_AA8G125800                    290   6e-89    
ref|XP_002881548.1|  hypothetical protein ARALYDRAFT_902953             296   9e-89    
ref|XP_010256824.1|  PREDICTED: uncharacterized protein LOC104597114    295   1e-88    
ref|XP_004253290.1|  PREDICTED: uncharacterized protein LOC101251270    295   2e-88    
emb|CDY53960.1|  BnaA10g29920D                                          287   2e-88    
ref|XP_006602605.1|  PREDICTED: uncharacterized protein LOC100813750    293   3e-88    
ref|NP_565869.1|  uncharacterized protein                               294   5e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077633.1|  PREDICTED: uncharacterized protein LOC105161594    293   5e-88    
ref|XP_011007127.1|  PREDICTED: uncharacterized protein LOC105112918    292   1e-87    
ref|XP_009783166.1|  PREDICTED: uncharacterized protein LOC104231809    292   2e-87    
ref|XP_010658534.1|  PREDICTED: uncharacterized protein LOC100244414    291   2e-87    
ref|XP_004503166.1|  PREDICTED: uncharacterized protein LOC101513...    291   4e-87    
gb|ABR17242.1|  unknown                                                 290   4e-87    Picea sitchensis
ref|XP_004503165.1|  PREDICTED: uncharacterized protein LOC101513...    290   5e-87    
ref|XP_010505370.1|  PREDICTED: uncharacterized protein LOC104782203    291   6e-87    
ref|XP_008442515.1|  PREDICTED: uncharacterized protein LOC103486366    289   2e-86    
ref|XP_011006392.1|  PREDICTED: uncharacterized protein LOC105112393    289   2e-86    
ref|XP_010509283.1|  PREDICTED: uncharacterized protein LOC104785714    290   2e-86    
ref|XP_006429145.1|  hypothetical protein CICLE_v10011508mg             289   2e-86    
gb|KEH22967.1|  transferring glycosyl group transferase                 288   4e-86    
gb|KDP35680.1|  hypothetical protein JCGZ_09118                         288   5e-86    
ref|XP_002323517.1|  fringe-related family protein                      288   5e-86    Populus trichocarpa [western balsam poplar]
ref|XP_002309080.2|  hypothetical protein POPTR_0006s09010g             287   1e-85    Populus trichocarpa [western balsam poplar]
gb|KEH34744.1|  transferring glycosyl group transferase                 286   3e-85    
ref|XP_004170734.1|  PREDICTED: uncharacterized LOC101203954            285   3e-85    
ref|XP_004137929.1|  PREDICTED: uncharacterized protein LOC101203954    288   3e-85    
ref|XP_006601991.1|  PREDICTED: uncharacterized protein LOC100802...    285   4e-85    
ref|XP_007140496.1|  hypothetical protein PHAVU_008G117500g             286   4e-85    
ref|XP_010047935.1|  PREDICTED: uncharacterized protein LOC104436758    286   5e-85    
ref|XP_006295581.1|  hypothetical protein CARUB_v10024689mg             288   7e-85    
ref|XP_009606983.1|  PREDICTED: uncharacterized protein LOC104101239    286   7e-85    
gb|KDO52371.1|  hypothetical protein CISIN_1g044015mg                   283   1e-84    
ref|XP_004492173.1|  PREDICTED: uncharacterized protein LOC101494656    283   2e-84    
ref|XP_009762592.1|  PREDICTED: uncharacterized protein LOC104214596    284   4e-84    
ref|XP_009405843.1|  PREDICTED: uncharacterized protein LOC103988895    283   6e-84    
gb|ACN40918.1|  unknown                                                 283   7e-84    Picea sitchensis
ref|XP_004246866.1|  PREDICTED: uncharacterized protein LOC101253314    281   7e-84    
ref|XP_010256825.1|  PREDICTED: uncharacterized protein LOC104597115    282   9e-84    
ref|XP_006341206.1|  PREDICTED: uncharacterized protein LOC102579489    280   1e-83    
ref|XP_010691179.1|  PREDICTED: uncharacterized protein LOC104904...    281   2e-83    
ref|XP_010032376.1|  PREDICTED: uncharacterized protein LOC104421...    281   2e-83    
gb|EYU26604.1|  hypothetical protein MIMGU_mgv1a023492mg                281   2e-83    
ref|XP_002515719.1|  transferase, transferring glycosyl groups, p...    280   4e-83    Ricinus communis
ref|XP_008369934.1|  PREDICTED: uncharacterized protein LOC103433448    280   5e-83    
ref|XP_010449958.1|  PREDICTED: uncharacterized protein LOC104732128    280   6e-83    
ref|XP_010517049.1|  PREDICTED: uncharacterized protein LOC104792565    280   1e-82    
gb|KDP22111.1|  hypothetical protein JCGZ_25942                         271   1e-82    
ref|XP_007026944.1|  Uncharacterized protein TCM_021877                 279   2e-82    
ref|XP_001751279.1|  predicted protein                                  276   3e-82    
ref|XP_011091510.1|  PREDICTED: uncharacterized protein LOC105171936    278   3e-82    
ref|XP_002274436.1|  PREDICTED: uncharacterized protein LOC100241450    276   7e-82    Vitis vinifera
ref|XP_007206381.1|  hypothetical protein PRUPE_ppa017976mg             277   8e-82    
ref|XP_008371981.1|  PREDICTED: uncharacterized protein LOC103435367    277   9e-82    
ref|XP_008343572.1|  PREDICTED: uncharacterized protein LOC103406357    276   1e-81    
ref|XP_011094901.1|  PREDICTED: uncharacterized protein LOC105174478    275   2e-81    
ref|XP_008355675.1|  PREDICTED: uncharacterized protein LOC103419333    275   3e-81    
ref|XP_010906683.1|  PREDICTED: uncharacterized protein LOC105033526    274   4e-81    
ref|XP_009346405.1|  PREDICTED: uncharacterized protein LOC103938134    274   4e-81    
ref|XP_006435632.1|  hypothetical protein CICLE_v10031336mg             275   4e-81    
ref|XP_009346419.1|  PREDICTED: uncharacterized protein LOC103938144    275   5e-81    
ref|XP_002314204.1|  hypothetical protein POPTR_0009s03140g             275   6e-81    Populus trichocarpa [western balsam poplar]
ref|XP_004305187.1|  PREDICTED: uncharacterized protein LOC101309470    279   9e-81    
ref|XP_008387853.1|  PREDICTED: uncharacterized protein LOC103450296    274   1e-80    
ref|XP_009630351.1|  PREDICTED: uncharacterized protein LOC104120315    273   1e-80    
ref|XP_011041961.1|  PREDICTED: uncharacterized protein LOC105137785    274   1e-80    
ref|XP_002873576.1|  predicted protein                                  267   1e-80    
ref|XP_009347931.1|  PREDICTED: uncharacterized protein LOC103939549    273   2e-80    
ref|XP_009343841.1|  PREDICTED: uncharacterized protein LOC103935754    273   3e-80    
ref|XP_009351426.1|  PREDICTED: uncharacterized protein LOC103942953    272   4e-80    
ref|XP_010685940.1|  PREDICTED: uncharacterized protein LOC104900256    273   4e-80    
ref|XP_009350453.1|  PREDICTED: uncharacterized protein LOC103941982    272   5e-80    
ref|XP_004487057.1|  PREDICTED: uncharacterized protein LOC101496794    273   7e-80    
ref|XP_003597290.1|  hypothetical protein MTR_2g095970                  273   7e-80    
ref|NP_193259.2|  uncharacterized protein                               271   1e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002975764.1|  glycosyltransferase-like protein                   274   1e-79    
ref|XP_006846344.1|  hypothetical protein AMTR_s00012p00258400          272   1e-79    
ref|XP_002961368.1|  glycosyltransferase-like protein                   273   2e-79    
ref|XP_008240551.1|  PREDICTED: uncharacterized protein LOC103339050    271   2e-79    
ref|XP_010674122.1|  PREDICTED: uncharacterized protein LOC104890362    271   2e-79    
ref|XP_010435042.1|  PREDICTED: uncharacterized protein LOC104718913    270   2e-79    
ref|XP_002312114.1|  fringe-related family protein                      270   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010267798.1|  PREDICTED: uncharacterized protein LOC104604918    270   3e-79    
ref|XP_002973713.1|  glycosyltransferase-like protein                   273   3e-79    
ref|XP_010255246.1|  PREDICTED: uncharacterized protein LOC104595986    271   3e-79    
ref|XP_008441391.1|  PREDICTED: uncharacterized protein LOC103485521    270   4e-79    
ref|XP_009111499.1|  PREDICTED: uncharacterized protein LOC103836932    270   5e-79    
gb|KHN09296.1|  Glycoprotein-N-acetylgalactosamine 3-beta-galacto...    269   6e-79    
ref|XP_010112315.1|  hypothetical protein L484_011181                   270   6e-79    
ref|XP_010488062.1|  PREDICTED: uncharacterized protein LOC104765960    270   7e-79    
gb|KEH18823.1|  transferring glycosyl group transferase                 269   8e-79    
ref|XP_002314080.2|  hypothetical protein POPTR_0009s05640g             266   8e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010651091.1|  PREDICTED: uncharacterized protein LOC104879559    269   1e-78    
gb|KCW89425.1|  hypothetical protein EUGRSUZ_A01724                     266   1e-78    
ref|XP_010554886.1|  PREDICTED: uncharacterized protein LOC104824478    267   1e-78    
ref|XP_007009274.1|  Beta-1,3-N-acetylglucosaminyltransferase lun...    268   1e-78    
ref|XP_010475561.1|  PREDICTED: uncharacterized protein LOC104754961    270   2e-78    
gb|KDP44147.1|  hypothetical protein JCGZ_05614                         266   2e-78    
ref|XP_010032375.1|  PREDICTED: uncharacterized protein LOC104421...    269   2e-78    
ref|XP_010457994.1|  PREDICTED: uncharacterized protein LOC104739370    269   2e-78    
ref|XP_002882730.1|  hypothetical protein ARALYDRAFT_478479             268   2e-78    
emb|CDY67284.1|  BnaAnng23960D                                          268   2e-78    
ref|XP_010240967.1|  PREDICTED: uncharacterized protein LOC104585...    267   3e-78    
ref|XP_004493031.1|  PREDICTED: uncharacterized protein LOC101513883    267   4e-78    
ref|XP_009380306.1|  PREDICTED: uncharacterized protein LOC103968722    270   4e-78    
ref|XP_009776276.1|  PREDICTED: uncharacterized protein LOC104226084    267   4e-78    
ref|XP_010240965.1|  PREDICTED: uncharacterized protein LOC104585...    266   4e-78    
ref|XP_010051124.1|  PREDICTED: uncharacterized protein LOC104439805    266   5e-78    
ref|XP_009121140.1|  PREDICTED: uncharacterized protein LOC103845975    267   5e-78    
ref|XP_007163444.1|  hypothetical protein PHAVU_001G235100g             266   5e-78    
ref|XP_007016624.1|  Uncharacterized protein TCM_041982                 267   5e-78    
ref|XP_010480127.1|  PREDICTED: uncharacterized protein LOC104758...    267   6e-78    
ref|XP_002868218.1|  hypothetical protein ARALYDRAFT_493365             266   6e-78    
emb|CDY01988.1|  BnaC02g27390D                                          266   7e-78    
ref|XP_010551745.1|  PREDICTED: uncharacterized protein LOC104822287    266   8e-78    
emb|CDP08959.1|  unnamed protein product                                266   9e-78    
ref|XP_009128480.1|  PREDICTED: uncharacterized protein LOC103853...    266   9e-78    
ref|XP_010457107.1|  PREDICTED: uncharacterized protein LOC104738...    266   1e-77    
ref|XP_006407449.1|  hypothetical protein EUTSA_v10020559mg             266   1e-77    
ref|XP_002315207.1|  hypothetical protein POPTR_0010s20760g             266   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_003547038.2|  PREDICTED: uncharacterized protein LOC100794154    263   1e-77    
ref|XP_009605991.1|  PREDICTED: uncharacterized protein LOC104100467    265   1e-77    
ref|XP_010240968.1|  PREDICTED: uncharacterized protein LOC104585699    265   1e-77    
ref|XP_009779247.1|  PREDICTED: uncharacterized protein LOC104228481    265   2e-77    
ref|XP_010495666.1|  PREDICTED: uncharacterized protein LOC104772768    265   2e-77    
ref|XP_002531833.1|  transferase, transferring glycosyl groups, p...    265   2e-77    Ricinus communis
ref|XP_010464844.1|  PREDICTED: uncharacterized protein LOC104745342    265   2e-77    
ref|XP_010456306.1|  PREDICTED: uncharacterized protein LOC104737750    265   3e-77    
emb|CBI16231.3|  unnamed protein product                                263   3e-77    
ref|XP_006344119.1|  PREDICTED: uncharacterized protein LOC102598352    260   3e-77    
ref|XP_002980904.1|  glycosyltransferase-like protein                   267   3e-77    
ref|XP_010046420.1|  PREDICTED: uncharacterized protein LOC104435352    265   3e-77    
ref|XP_004169123.1|  PREDICTED: uncharacterized LOC101218166            266   4e-77    
ref|XP_004148789.1|  PREDICTED: uncharacterized protein LOC101218166    266   4e-77    
ref|XP_007152167.1|  hypothetical protein PHAVU_004G107300g             265   4e-77    
gb|KHN33433.1|  hypothetical protein glysoja_005475                     265   5e-77    
emb|CDY54929.1|  BnaAnng13620D                                          264   6e-77    
ref|XP_011002626.1|  PREDICTED: uncharacterized protein LOC105109...    264   7e-77    
ref|XP_008465293.1|  PREDICTED: uncharacterized protein LOC103502944    265   9e-77    
ref|XP_006587835.1|  PREDICTED: uncharacterized protein LOC100777888    263   1e-76    
ref|XP_007135113.1|  hypothetical protein PHAVU_010G102100g             263   1e-76    
ref|XP_004242083.1|  PREDICTED: uncharacterized protein LOC101253909    263   1e-76    
ref|XP_010543772.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   1e-76    
ref|XP_010522968.1|  PREDICTED: uncharacterized protein LOC104801...    263   1e-76    
ref|XP_006829033.1|  hypothetical protein AMTR_s00001p00252920          263   1e-76    
ref|XP_006378694.1|  hypothetical protein POPTR_0010s20760g             263   1e-76    
ref|XP_004171692.1|  PREDICTED: lysine histidine transporter 1-like     261   2e-76    
ref|XP_006303976.1|  hypothetical protein CARUB_v10008901mg             263   2e-76    
ref|XP_006283536.1|  hypothetical protein CARUB_v10004586mg             263   2e-76    
ref|XP_008233003.1|  PREDICTED: uncharacterized protein LOC103332088    263   2e-76    
ref|XP_003606544.1|  Fringe-like protein                                263   2e-76    
ref|XP_008233657.1|  PREDICTED: uncharacterized protein LOC103332685    262   2e-76    
emb|CAB10303.1|  hypothetical protein                                   263   3e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KHN26942.1|  hypothetical protein glysoja_031019                     263   3e-76    
ref|XP_010474760.1|  PREDICTED: uncharacterized protein LOC104754...    262   3e-76    
ref|XP_004514056.1|  PREDICTED: uncharacterized protein LOC101515637    262   3e-76    
ref|XP_001772645.1|  predicted protein                                  260   3e-76    
ref|XP_009358373.1|  PREDICTED: uncharacterized protein LOC103949004    263   3e-76    
ref|XP_008363471.1|  PREDICTED: uncharacterized protein LOC103427177    263   4e-76    
ref|XP_010486794.1|  PREDICTED: uncharacterized protein LOC104764892    262   4e-76    
ref|XP_006283625.1|  hypothetical protein CARUB_v10004682mg             261   4e-76    
ref|XP_002875039.1|  hypothetical protein ARALYDRAFT_490540             268   5e-76    
gb|KHN30225.1|  hypothetical protein glysoja_010603                     263   6e-76    
ref|XP_006367660.1|  PREDICTED: uncharacterized protein LOC102595998    261   7e-76    
ref|XP_003548651.1|  PREDICTED: uncharacterized protein LOC100790149    261   7e-76    
ref|XP_009354569.1|  PREDICTED: uncharacterized protein LOC103945695    262   8e-76    
emb|CDY57235.1|  BnaC01g42120D                                          260   8e-76    
ref|XP_011002624.1|  PREDICTED: uncharacterized protein LOC105109...    261   1e-75    
ref|XP_007150256.1|  hypothetical protein PHAVU_005G138800g             262   1e-75    
ref|XP_001769539.1|  predicted protein                                  260   1e-75    
ref|XP_003542010.2|  PREDICTED: uncharacterized protein LOC100778156    261   1e-75    
ref|NP_187749.1|  uncharacterized protein                               261   1e-75    
ref|XP_010447528.1|  PREDICTED: uncharacterized protein LOC104730...    261   1e-75    
ref|XP_009619167.1|  PREDICTED: uncharacterized protein LOC104111223    260   1e-75    
ref|XP_006339795.1|  PREDICTED: uncharacterized protein LOC102583570    258   2e-75    
ref|XP_006414552.1|  hypothetical protein EUTSA_v10025038mg             259   2e-75    
ref|XP_011036974.1|  PREDICTED: uncharacterized protein LOC105134321    259   2e-75    
ref|XP_007015101.1|  Uncharacterized protein TCM_040747                 252   3e-75    
ref|XP_009769878.1|  PREDICTED: uncharacterized protein LOC104220673    259   3e-75    
ref|XP_004251447.1|  PREDICTED: uncharacterized protein LOC101264891    259   3e-75    
ref|XP_004245574.1|  PREDICTED: uncharacterized protein LOC101249113    260   4e-75    
ref|XP_004308844.1|  PREDICTED: uncharacterized protein LOC101314710    259   5e-75    
ref|XP_010109544.1|  hypothetical protein L484_018279                   258   5e-75    
ref|XP_010436096.1|  PREDICTED: uncharacterized protein LOC104719814    259   5e-75    
emb|CBI34374.3|  unnamed protein product                                259   5e-75    
ref|XP_002279187.1|  PREDICTED: uncharacterized protein LOC100267372    259   5e-75    
gb|KDO69160.1|  hypothetical protein CISIN_1g048713mg                   253   6e-75    
ref|XP_010543017.1|  PREDICTED: uncharacterized protein LOC104816...    258   8e-75    
ref|XP_009147484.1|  PREDICTED: uncharacterized protein LOC103871019    258   8e-75    
ref|XP_002868593.1|  hypothetical protein ARALYDRAFT_916060             259   9e-75    
ref|XP_004307473.1|  PREDICTED: uncharacterized protein LOC101299814    258   9e-75    
ref|XP_008349721.1|  PREDICTED: uncharacterized protein LOC103412996    259   9e-75    
ref|XP_006297467.1|  hypothetical protein CARUB_v10013487mg             258   1e-74    
ref|XP_007139801.1|  hypothetical protein PHAVU_008G059900g             258   1e-74    
ref|XP_009801577.1|  PREDICTED: uncharacterized protein LOC104247307    258   1e-74    
ref|XP_008222523.1|  PREDICTED: uncharacterized protein LOC103322...    258   1e-74    
ref|XP_008222530.1|  PREDICTED: uncharacterized protein LOC103322...    258   1e-74    
emb|CDY22931.1|  BnaA01g18690D                                          257   1e-74    
gb|KCW89426.1|  hypothetical protein EUGRSUZ_A01725                     256   1e-74    
gb|KFK38500.1|  hypothetical protein AALP_AA3G121200                    258   1e-74    
ref|NP_171663.1|  uncharacterized protein                               257   1e-74    
ref|XP_009146730.1|  PREDICTED: uncharacterized protein LOC103870351    258   1e-74    
ref|XP_010441307.1|  PREDICTED: uncharacterized protein LOC104724513    258   1e-74    
ref|XP_010276911.1|  PREDICTED: uncharacterized protein LOC104611526    258   1e-74    
ref|XP_009612606.1|  PREDICTED: uncharacterized protein LOC104105884    257   2e-74    
ref|XP_008341969.1|  PREDICTED: uncharacterized protein LOC103404789    257   2e-74    
ref|XP_002511900.1|  transferase, transferring glycosyl groups, p...    258   2e-74    
emb|CDY56847.1|  BnaCnng31240D                                          258   2e-74    
ref|XP_006396919.1|  hypothetical protein EUTSA_v10028593mg             258   2e-74    
ref|XP_011089382.1|  PREDICTED: uncharacterized protein LOC105170350    258   2e-74    
ref|XP_007207320.1|  hypothetical protein PRUPE_ppa004846mg             257   2e-74    
ref|XP_010455541.1|  PREDICTED: uncharacterized protein LOC104737...    258   2e-74    
ref|XP_008385241.1|  PREDICTED: uncharacterized protein LOC103447819    258   2e-74    
ref|XP_009342273.1|  PREDICTED: uncharacterized protein LOC103934264    256   2e-74    
gb|KHF99988.1|  Beta-1,3-glucosyltransferase                            257   2e-74    
ref|XP_010051115.1|  PREDICTED: uncharacterized protein LOC104439796    256   3e-74    
ref|XP_009624408.1|  PREDICTED: uncharacterized protein LOC104115469    257   3e-74    
gb|AAF81315.1|AC061957_11  Contains similarity to a hypothetical ...    257   4e-74    
ref|XP_009405000.1|  PREDICTED: uncharacterized protein LOC103988...    256   4e-74    
emb|CDP20373.1|  unnamed protein product                                257   4e-74    
emb|CDY08529.1|  BnaA05g27650D                                          257   4e-74    
ref|XP_006343942.1|  PREDICTED: uncharacterized protein LOC102586899    257   4e-74    
gb|KCW85654.1|  hypothetical protein EUGRSUZ_B02441                     256   5e-74    
ref|XP_002304515.1|  fringe-related family protein                      257   5e-74    
ref|XP_008230135.1|  PREDICTED: uncharacterized protein LOC103329438    255   5e-74    
ref|XP_006447475.1|  hypothetical protein CICLE_v10015096mg             255   5e-74    
ref|XP_008365447.1|  PREDICTED: uncharacterized protein LOC103429078    255   5e-74    
ref|XP_006365158.1|  PREDICTED: uncharacterized protein LOC102606181    256   6e-74    
ref|XP_008379601.1|  PREDICTED: uncharacterized protein LOC103442579    255   7e-74    
ref|XP_009799200.1|  PREDICTED: uncharacterized protein LOC104245307    256   7e-74    
ref|XP_010466580.1|  PREDICTED: uncharacterized protein LOC104746751    255   8e-74    
ref|XP_003558255.1|  PREDICTED: uncharacterized protein LOC100836685    256   9e-74    
gb|KFK28899.1|  hypothetical protein AALP_AA7G062500                    256   9e-74    
gb|EPS62175.1|  hypothetical protein M569_12617                         252   9e-74    
ref|XP_010422090.1|  PREDICTED: uncharacterized protein LOC104707437    256   1e-73    
ref|NP_198961.1|  uncharacterized protein                               256   1e-73    
ref|XP_008455407.1|  PREDICTED: uncharacterized protein LOC103495576    255   1e-73    
gb|KCW71570.1|  hypothetical protein EUGRSUZ_E00106                     255   1e-73    
gb|KHG00530.1|  Beta-1,3-N-acetylglucosaminyltransferase lunatic ...    256   1e-73    
ref|XP_010323808.1|  PREDICTED: uncharacterized protein LOC101246943    253   1e-73    
ref|XP_010055094.1|  PREDICTED: uncharacterized protein LOC104443417    255   2e-73    
ref|XP_010480134.1|  PREDICTED: uncharacterized protein LOC104758...    261   2e-73    
ref|XP_010457110.1|  PREDICTED: uncharacterized protein LOC104738...    261   2e-73    
ref|XP_007043330.1|  Uncharacterized protein isoform 3                  254   2e-73    
ref|XP_009347733.1|  PREDICTED: uncharacterized protein LOC103939376    255   3e-73    
gb|KEH29638.1|  transferring glycosyl group transferase                 254   3e-73    
gb|KDP25872.1|  hypothetical protein JCGZ_22902                         253   3e-73    
ref|XP_010435007.1|  PREDICTED: uncharacterized protein LOC104718882    254   3e-73    
ref|XP_010522969.1|  PREDICTED: uncharacterized protein LOC104801...    261   3e-73    
emb|CDX86577.1|  BnaC08g01260D                                          254   4e-73    
ref|XP_010676434.1|  PREDICTED: uncharacterized protein LOC104892257    255   4e-73    
ref|XP_004510755.1|  PREDICTED: uncharacterized protein LOC101498680    253   4e-73    
ref|XP_007043328.1|  Uncharacterized protein isoform 1                  253   4e-73    
gb|EPS67030.1|  hypothetical protein M569_07747                         253   5e-73    
ref|XP_004231192.2|  PREDICTED: uncharacterized protein LOC101264770    253   5e-73    
emb|CDX90042.1|  BnaA10g00400D                                          254   5e-73    
ref|XP_010259965.1|  PREDICTED: uncharacterized protein LOC104599215    254   6e-73    
ref|XP_007051739.1|  Uncharacterized protein TCM_005286                 253   6e-73    
ref|XP_002964913.1|  glycosyltransferase-like protein                   253   7e-73    
ref|XP_008776386.1|  PREDICTED: uncharacterized protein LOC103696507    250   7e-73    
ref|XP_007217531.1|  hypothetical protein PRUPE_ppa023439mg             253   7e-73    
ref|XP_009111055.1|  PREDICTED: uncharacterized protein LOC103836532    253   7e-73    
ref|XP_006287536.1|  hypothetical protein CARUB_v10000749mg             253   7e-73    
ref|XP_009108177.1|  PREDICTED: uncharacterized protein LOC103833880    253   8e-73    
ref|XP_002892055.1|  predicted protein                                  253   9e-73    
ref|XP_009119708.1|  PREDICTED: uncharacterized protein LOC103844660    253   1e-72    
gb|EPS71450.1|  hypothetical protein M569_03309                         250   1e-72    
ref|XP_009128481.1|  PREDICTED: uncharacterized protein LOC103853...    259   1e-72    
ref|XP_010557014.1|  PREDICTED: uncharacterized protein LOC104826156    252   1e-72    
ref|XP_004298826.1|  PREDICTED: uncharacterized protein LOC101314371    253   1e-72    
ref|XP_006405352.1|  hypothetical protein EUTSA_v10027721mg             253   1e-72    
ref|XP_010937566.1|  PREDICTED: uncharacterized protein LOC105056899    252   1e-72    
ref|XP_006352036.1|  PREDICTED: uncharacterized protein LOC102586291    252   1e-72    
ref|XP_006580556.1|  PREDICTED: uncharacterized protein LOC100818244    253   1e-72    
ref|XP_004143975.1|  PREDICTED: uncharacterized protein LOC101214810    253   1e-72    
emb|CDY39739.1|  BnaA04g11140D                                          253   2e-72    
ref|XP_009595643.1|  PREDICTED: uncharacterized protein LOC104091909    253   2e-72    
emb|CDY44474.1|  BnaCnng11270D                                          253   2e-72    
ref|XP_006396229.1|  hypothetical protein EUTSA_v10028441mg             259   2e-72    
emb|CDY15540.1|  BnaA08g28240D                                          252   2e-72    
ref|XP_011073166.1|  PREDICTED: uncharacterized protein LOC105158...    253   2e-72    
ref|XP_011022631.1|  PREDICTED: uncharacterized protein LOC105124342    253   2e-72    
ref|XP_004138579.1|  PREDICTED: uncharacterized protein LOC101220661    266   2e-72    
ref|NP_567166.1|  fringe-related protein                                258   2e-72    
ref|XP_010112954.1|  hypothetical protein L484_021475                   251   2e-72    
ref|XP_004144582.1|  PREDICTED: uncharacterized protein LOC101222721    251   3e-72    
gb|EAY89403.1|  hypothetical protein OsI_10908                          252   3e-72    
ref|XP_009763260.1|  PREDICTED: uncharacterized protein LOC104215204    252   3e-72    
ref|XP_010543014.1|  PREDICTED: uncharacterized protein LOC104816045    250   3e-72    
ref|XP_009384071.1|  PREDICTED: uncharacterized protein LOC103971705    253   4e-72    
ref|XP_008373511.1|  PREDICTED: uncharacterized protein LOC103436813    252   4e-72    
ref|XP_009363408.1|  PREDICTED: uncharacterized protein LOC103953398    252   4e-72    
ref|XP_009611458.1|  PREDICTED: uncharacterized protein LOC104104945    251   4e-72    
emb|CDY15168.1|  BnaC05g00470D                                          251   4e-72    
ref|XP_010474761.1|  PREDICTED: uncharacterized protein LOC104754...    258   4e-72    
ref|XP_011073151.1|  PREDICTED: uncharacterized protein LOC105158...    252   5e-72    
ref|XP_007209898.1|  hypothetical protein PRUPE_ppa004142mg             252   5e-72    
ref|XP_004967904.1|  PREDICTED: uncharacterized protein LOC101761114    251   5e-72    
emb|CDY61924.1|  BnaA03g58710D                                          251   6e-72    
ref|XP_006414551.1|  hypothetical protein EUTSA_v10025038mg             249   6e-72    
ref|XP_009353239.1|  PREDICTED: uncharacterized protein LOC103944504    250   6e-72    
ref|XP_010529619.1|  PREDICTED: uncharacterized protein LOC104806420    251   7e-72    
ref|XP_010313666.1|  PREDICTED: uncharacterized protein LOC101245623    250   7e-72    
ref|XP_009140092.1|  PREDICTED: uncharacterized protein LOC103864083    251   8e-72    
ref|XP_008803116.1|  PREDICTED: uncharacterized protein LOC103716754    250   8e-72    
ref|XP_009341434.1|  PREDICTED: uncharacterized protein LOC103933463    249   9e-72    
ref|XP_007160097.1|  hypothetical protein PHAVU_002G292100g             250   1e-71    
ref|XP_002977124.1|  glycosyltransferase-like protein                   250   1e-71    
ref|XP_006413551.1|  hypothetical protein EUTSA_v10024902mg             250   1e-71    
ref|XP_010554930.1|  PREDICTED: uncharacterized protein LOC104824526    249   2e-71    
ref|XP_009137355.1|  PREDICTED: uncharacterized protein LOC103861400    249   2e-71    
ref|XP_008437319.1|  PREDICTED: uncharacterized protein LOC103482775    249   2e-71    
ref|XP_006439493.1|  hypothetical protein CICLE_v10019694mg             250   2e-71    
ref|XP_002992119.1|  glycosyltransferase-like protein                   250   2e-71    
emb|CDY13255.1|  BnaC09g24010D                                          249   2e-71    
ref|XP_007040329.1|  Beta-1,3-glucosyltransferase                       250   2e-71    
ref|XP_009367865.1|  PREDICTED: uncharacterized protein LOC103957435    255   3e-71    
ref|XP_006289368.1|  hypothetical protein CARUB_v10002854mg             255   3e-71    
ref|XP_004503683.1|  PREDICTED: uncharacterized protein LOC101490078    249   3e-71    
gb|KHG15704.1|  Beta-1,3-N-acetylglucosaminyltransferase lunatic ...    249   4e-71    
ref|XP_008365448.1|  PREDICTED: uncharacterized protein LOC103429079    248   4e-71    
ref|NP_001049681.1|  Os03g0269900                                       249   4e-71    
ref|XP_009342266.1|  PREDICTED: uncharacterized protein LOC103934254    248   4e-71    
emb|CDP12059.1|  unnamed protein product                                248   5e-71    
ref|XP_010538809.1|  PREDICTED: uncharacterized protein LOC104813025    249   5e-71    
ref|XP_002509844.1|  transferase, transferring glycosyl groups, p...    248   5e-71    
gb|EAY89404.1|  hypothetical protein OsI_10909                          249   6e-71    
emb|CDX94192.1|  BnaC07g38260D                                          248   6e-71    
dbj|BAJ94191.1|  predicted protein                                      248   6e-71    
ref|XP_003624018.1|  hypothetical protein MTR_7g078320                  248   7e-71    
gb|ABN08498.1|  Protein of unknown function DUF604                      248   8e-71    
dbj|BAE71200.1|  hypothetical protein                                   248   9e-71    
ref|XP_006360582.1|  PREDICTED: uncharacterized protein LOC102585670    246   1e-70    
ref|XP_009385929.1|  PREDICTED: uncharacterized protein LOC103973162    249   1e-70    
gb|KHG26047.1|  putative ATP-dependent DNA ligase ykoU                  247   1e-70    
ref|XP_007215288.1|  hypothetical protein PRUPE_ppa004954mg             247   1e-70    
emb|CDY44101.1|  BnaA01g13090D                                          248   1e-70    
ref|NP_567683.1|  uncharacterized protein                               248   1e-70    
ref|XP_006372976.1|  hypothetical protein POPTR_0017s06690g             246   2e-70    
ref|XP_010055681.1|  PREDICTED: uncharacterized protein LOC104443836    247   2e-70    
ref|XP_009799907.1|  PREDICTED: uncharacterized protein LOC104245902    247   2e-70    
emb|CDY63419.1|  BnaCnng42070D                                          247   2e-70    
ref|XP_009137051.1|  PREDICTED: uncharacterized protein LOC103861091    247   2e-70    
ref|XP_011029332.1|  PREDICTED: uncharacterized protein LOC105129092    247   2e-70    
ref|XP_002298017.1|  fringe-related family protein                      247   3e-70    
emb|CDY15541.1|  BnaA08g28250D                                          246   3e-70    
ref|XP_009135164.1|  PREDICTED: uncharacterized protein LOC103859389    246   3e-70    
ref|XP_009118598.1|  PREDICTED: uncharacterized protein LOC103843...    246   3e-70    
ref|XP_003532915.1|  PREDICTED: uncharacterized protein LOC100795943    246   4e-70    
ref|XP_004984927.1|  PREDICTED: uncharacterized protein LOC101767048    246   6e-70    
ref|XP_003516297.1|  PREDICTED: uncharacterized protein LOC100803539    245   7e-70    
ref|XP_004487371.1|  PREDICTED: uncharacterized protein LOC101493...    244   7e-70    
gb|KDP25871.1|  hypothetical protein JCGZ_22901                         245   8e-70    
gb|AAP06923.1|  hypothetical protein                                    249   8e-70    
ref|XP_007043332.1|  Uncharacterized protein isoform 5                  244   8e-70    
ref|XP_009111053.1|  PREDICTED: uncharacterized protein LOC103836531    245   8e-70    
gb|EPS67635.1|  hypothetical protein M569_07140                         243   9e-70    
ref|XP_006283508.1|  hypothetical protein CARUB_v10004561mg             246   1e-69    
gb|KHN35036.1|  hypothetical protein glysoja_004802                     244   1e-69    
gb|KFK42866.1|  hypothetical protein AALP_AA1G049200                    245   1e-69    
gb|KDP28590.1|  hypothetical protein JCGZ_14361                         244   1e-69    
gb|KFK43099.1|  hypothetical protein AALP_AA1G080100                    246   1e-69    
ref|XP_009598396.1|  PREDICTED: uncharacterized protein LOC104094224    245   1e-69    
gb|KDO76311.1|  hypothetical protein CISIN_1g037480mg                   245   1e-69    
ref|XP_002317032.1|  hypothetical protein POPTR_0011s15040g             245   2e-69    
ref|XP_003538307.2|  PREDICTED: uncharacterized protein LOC100801504    244   2e-69    
emb|CDY53321.1|  BnaCnng24830D                                          244   2e-69    
ref|XP_006360694.1|  PREDICTED: uncharacterized protein LOC102601770    244   2e-69    
gb|AAK97671.1|  AT4g23490/F16G20_190                                    245   2e-69    
gb|KDO86266.1|  hypothetical protein CISIN_1g010780mg                   244   2e-69    
gb|KFK33009.1|  hypothetical protein AALP_AA6G318400                    244   2e-69    
ref|XP_011100287.1|  PREDICTED: uncharacterized protein LOC105178499    243   2e-69    
ref|XP_002867706.1|  hypothetical protein ARALYDRAFT_492523             244   2e-69    
ref|XP_004487370.1|  PREDICTED: uncharacterized protein LOC101493...    243   2e-69    
ref|XP_004295964.1|  PREDICTED: uncharacterized protein LOC101307385    244   3e-69    
ref|XP_010433901.1|  PREDICTED: uncharacterized protein LOC104717962    244   3e-69    
emb|CAN76207.1|  hypothetical protein VITISV_043112                     255   3e-69    
ref|XP_011004389.1|  PREDICTED: uncharacterized protein LOC105110887    244   3e-69    
emb|CDY46850.1|  BnaA10g03340D                                          243   4e-69    
gb|KDP25398.1|  hypothetical protein JCGZ_20554                         244   4e-69    
ref|XP_003517477.1|  PREDICTED: uncharacterized protein LOC100801444    243   4e-69    
gb|KFK33008.1|  hypothetical protein AALP_AA6G318400                    243   5e-69    
ref|XP_002468117.1|  hypothetical protein SORBIDRAFT_01g039850          244   5e-69    
ref|XP_008455831.1|  PREDICTED: uncharacterized protein LOC103495932    242   6e-69    
ref|XP_006417759.1|  hypothetical protein EUTSA_v10007281mg             244   6e-69    
ref|XP_008654085.1|  PREDICTED: uncharacterized protein LOC103634306    243   6e-69    
ref|XP_004512191.1|  PREDICTED: uncharacterized protein LOC101493384    242   8e-69    
ref|XP_010089064.1|  hypothetical protein L484_024237                   243   9e-69    
ref|NP_192874.2|  uncharacterized protein                               242   1e-68    



>ref|XP_009797424.1| PREDICTED: uncharacterized protein LOC104243860 [Nicotiana sylvestris]
Length=481

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/437 (61%), Positives = 332/437 (76%), Gaps = 8/437 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N   + L +   +N+ TN+SHL+FGLLGSEKAWHHR++Y+ESWWRPN T G+L LD PP 
Sbjct  53    NSQTNTLSNDAKTNNATNISHLLFGLLGSEKAWHHRKSYIESWWRPNITKGYLLLDFPPK  112

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
              +LLPW  +SPPY++SD+V ++VEET HV+P V R+VHGIME  R+  +     LRW+VM
Sbjct  113   GDLLPWSINSPPYKISDDVPKLVEETKHVDPTVLRLVHGIMEVFREEHE----GLRWLVM  168

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDD++F VDN+VD+LAQYDHTKYYY GGHSEFI +N ++SF Q FGG G +LS+PLA A
Sbjct  169   GDDDSVFFVDNMVDILAQYDHTKYYYFGGHSEFILSNYWYSFNQGFGGAGFILSYPLAKA  228

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +A+ +M CLKRY+HL +AD+TT  CIAD+GVNLSP QG HQID+ GD+SGFLS HP + L
Sbjct  229   LANNMMSCLKRYAHLKAADRTTMTCIADIGVNLSPLQGIHQIDLRGDLSGFLSSHPKSLL  288

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHHFDMV PIFPS++RA S  H + AAN DQ RMLQQ +C  R  NW+FSV+WGYSA+
Sbjct  289   MSLHHFDMVEPIFPSLDRAHSGFHLLNAANYDQSRMLQQTICHKRSSNWTFSVSWGYSAH  348

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IYEKIMPRS++QNPIETF+TW  SPRPP+++FDVR   + DPC  PH FF +SVE    R
Sbjct  349   IYEKIMPRSWIQNPIETFKTWNKSPRPPHYMFDVRS-PSLDPCEAPHVFFFKSVER-NPR  406

Query  1388  DEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDS  1567
             +EIV TY R W RG+ AC +  G+ SA+ +S+I VYS  TK  +I R ECCDV I    S
Sbjct  407   NEIVTTYTRGWPRGIGACLSS-GNYSAEYVSEIHVYSSATKRIEIDRCECCDV-IHEAGS  464

Query  1568  ESAVIKTRRCMADDIIA  1618
               A IK R CM D+IIA
Sbjct  465   NKAEIKYRECMIDEIIA  481



>ref|XP_009623627.1| PREDICTED: uncharacterized protein LOC104114801 [Nicotiana tomentosiformis]
Length=481

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/437 (61%), Positives = 331/437 (76%), Gaps = 8/437 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N   + L +   +N+ TN+SHL+FGLLGSEKAWHHR +YVESWWRPN T G+L LD PP 
Sbjct  53    NSQTNTLSNDAKTNNATNISHLLFGLLGSEKAWHHRISYVESWWRPNITKGYLLLDFPPK  112

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
              +LLPW  +SPPY++SD+V ++VEET HV+P V R+VHGIME  R+  +     LRW+VM
Sbjct  113   GDLLPWSINSPPYKISDDVPKLVEETKHVDPTVLRLVHGIMEVFREEHE----GLRWLVM  168

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDD++F VDN+VD+LAQYDHTKYYY GGHSEFI +N ++SF Q FGG G +LS+PLA A
Sbjct  169   GDDDSVFFVDNMVDILAQYDHTKYYYFGGHSEFILSNYWYSFNQGFGGAGFILSYPLAKA  228

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +A+ +M CLKRY+HL +AD+TT  CIAD+GVNLSP QG HQID+ GD+SGFLS HP + L
Sbjct  229   LANNMMSCLKRYAHLKAADRTTMTCIADIGVNLSPLQGIHQIDLRGDLSGFLSSHPKSLL  288

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHHFDMV PIFPS++RA S  H + AAN DQ RMLQQ +C  R  NW+FSV+WGYSA+
Sbjct  289   MSLHHFDMVEPIFPSLDRAHSGFHLLNAANYDQSRMLQQTICHKRSSNWTFSVSWGYSAH  348

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IYEKIMPRS++QNPIETF+TW  SPRPP+++FDVR   + DPC  PH FF +SVE    R
Sbjct  349   IYEKIMPRSWIQNPIETFKTWNKSPRPPHYMFDVRS-PSLDPCEAPHVFFFKSVER-NPR  406

Query  1388  DEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDS  1567
             +EIV  Y R W RG+ AC +  G+ SA+ +S+I VYSP TK  +I R ECCDV I    S
Sbjct  407   NEIVTIYTRGWPRGIGACLSS-GNYSAEYVSEIHVYSPATKRIEIDRCECCDV-IHEAGS  464

Query  1568  ESAVIKTRRCMADDIIA  1618
               A IK R C+ D+IIA
Sbjct  465   NKAEIKYRECLIDEIIA  481



>ref|XP_009623628.1| PREDICTED: uncharacterized protein LOC104114803 [Nicotiana tomentosiformis]
Length=473

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/425 (63%), Positives = 329/425 (77%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             + +PTN++HL+FGLLGSEKAWHHR++Y+ESWWRPN T G L LD PP   LLPW  +SPP
Sbjct  57    TKNPTNINHLLFGLLGSEKAWHHRKSYIESWWRPNITRGHLLLDVPPKGNLLPWSINSPP  116

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             Y++SD+V ++V+ET HV+ RV RMVHGIME  R+        +RWV+MGDDD+IF +DN+
Sbjct  117   YKISDDVPKLVKETKHVDSRVLRMVHGIMEVFREEHD----GVRWVIMGDDDSIFFLDNM  172

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+LAQYDHTKYYY+GGHSEFI +N ++SF +AFGG GI+LS+PLA A A  IM CLKRY
Sbjct  173   VDILAQYDHTKYYYIGGHSEFILSNYWYSFHEAFGGAGIILSYPLARAFAKNIMSCLKRY  232

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             SHL SAD+TT  CI+D+GVNLSP QG HQID+ GDISGFLSYHP + L SLHHFDMV+PI
Sbjct  233   SHLKSADRTTMLCISDIGVNLSPLQGIHQIDLRGDISGFLSYHPKSLLTSLHHFDMVDPI  292

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+RA+S+ H   AAN DQ RMLQQ +C  R +NW+FSV+WGYSA+IYEKIMPRS++Q
Sbjct  293   FPSMDRAQSSFHLHNAANYDQSRMLQQTICHQRSKNWTFSVSWGYSAHIYEKIMPRSWIQ  352

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
             NPI TF+TW PSP PP ++FDVR   + DPC  PH FF +SVE    R+EIV TY R W 
Sbjct  353   NPIVTFKTWQPSPSPPYYMFDVRS-PSWDPCEAPHVFFFKSVER-NPRNEIVTTYTREWP  410

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             RG+ AC +  G+ SA+ IS+I VYSP TK  +I R ECCD+ +++  S  A IK R C  
Sbjct  411   RGIGACLS-TGNYSAEYISEIHVYSPSTKRIEIDRCECCDIILEA-GSNKADIKYRECKI  468

Query  1604  DDIIA  1618
             D+IIA
Sbjct  469   DEIIA  473



>ref|XP_009790297.1| PREDICTED: uncharacterized protein LOC104237773 [Nicotiana sylvestris]
Length=475

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/425 (62%), Positives = 329/425 (77%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             +N+ TN++HL+FG+LGSEKAWHHR++Y+ESWWRPN T G L LD PP   LLPW  +SPP
Sbjct  59    TNNRTNINHLLFGILGSEKAWHHRKSYIESWWRPNITRGHLLLDVPPKGNLLPWSINSPP  118

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             Y++SD+V ++V+ET HV+ RV RMVHGIME  R+  +     +RWV+MGDDD+IF VDN+
Sbjct  119   YKISDDVPKLVKETKHVDSRVLRMVHGIMEVFREEHE----GVRWVIMGDDDSIFFVDNM  174

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+L QYDHTKYYY+GGHSEFI +N ++SF +AFGG GI+LS+PLA A A  IM CLKRY
Sbjct  175   VDILTQYDHTKYYYIGGHSEFILSNYWYSFHEAFGGAGIILSYPLARAFAKNIMSCLKRY  234

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             SHL SAD+TT  CI+D+GVNLSP QG HQID+ GDISGFLSYHP + L+SLHHFDMV+PI
Sbjct  235   SHLKSADRTTMLCISDIGVNLSPLQGIHQIDLRGDISGFLSYHPKSLLMSLHHFDMVDPI  294

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+RA+S+ H   AAN DQ RMLQQ +C  R  NW+FSV+WGYSA+IYEKIMPRS++Q
Sbjct  295   FPSMDRAQSSFHLQNAANYDQSRMLQQTICHKRSSNWTFSVSWGYSAHIYEKIMPRSWIQ  354

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
             NPI TF+TW PSP PP ++FDVR   + DPC  PH FF +S+E+ T R+EIV TY R+W 
Sbjct  355   NPIVTFKTWQPSPSPPYYMFDVRS-PSLDPCEAPHVFFFKSIEK-TPRNEIVTTYTRAWP  412

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
              G+ AC +  G+ SA+ +S+I VYSP TK  +I R ECCD+ I    S  A IK R C  
Sbjct  413   SGIGACLS-TGNYSAEYVSEIHVYSPATKRIEIDRCECCDI-IHEAGSSKADIKYRECKI  470

Query  1604  DDIIA  1618
             D+IIA
Sbjct  471   DEIIA  475



>ref|XP_009623626.1| PREDICTED: uncharacterized protein LOC104114800 [Nicotiana tomentosiformis]
Length=477

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/425 (61%), Positives = 326/425 (77%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             +N  TN+SHLVFGLLGSEKAWH+R++Y+ESWWRPN T G+L LD PP  +LLPW  +SPP
Sbjct  61    TNIATNISHLVFGLLGSEKAWHNRKSYIESWWRPNITKGYLLLDFPPKDDLLPWSINSPP  120

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             Y++SDNV ++VEET HV+P V R+VHGIME  R+  +     LRW+VMGDDD++F VDN+
Sbjct  121   YKISDNVVKLVEETKHVDPTVLRLVHGIMEVFREEHE----DLRWLVMGDDDSVFFVDNM  176

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+LAQYDHTKYYY GGHSEFI +N ++SF Q FGG G +LS+PLA A+A  +++CLKRY
Sbjct  177   VDILAQYDHTKYYYFGGHSEFILSNYWYSFNQGFGGAGFILSYPLAKALAKDMVNCLKRY  236

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             ++LN+ADKTT  CIAD+GVNLSP QG HQID+ GDISGFLS HP + L+SLHH DMV+PI
Sbjct  237   NYLNAADKTTMTCIADIGVNLSPLQGIHQIDLRGDISGFLSSHPKSLLMSLHHLDMVDPI  296

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+R++S  H   AAN DQ RMLQQ +C  R  NW+FSV+WGYSA+IYEKIMPRS++Q
Sbjct  297   FPSMDRSQSIFHLQNAANYDQSRMLQQTICHKRSSNWTFSVSWGYSAHIYEKIMPRSWIQ  356

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PIETF+TW  SP PP+++FDVR   + DPC  PH FF +SVE+ T  +EI+ TY R+W 
Sbjct  357   RPIETFKTWQKSPNPPHYMFDVRN-PSLDPCEAPHIFFFKSVEK-TPSNEILTTYIRAWP  414

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             RG+ AC    G+ SA+ +S+I VYSP  K  +I R ECCD+ I    S  A +K R C  
Sbjct  415   RGIGACLYA-GNLSAEYVSEIHVYSPAIKRIEIDRCECCDI-IHEAGSNKADVKYRECKT  472

Query  1604  DDIIA  1618
             D+IIA
Sbjct  473   DEIIA  477



>ref|XP_010313268.1| PREDICTED: uncharacterized protein LOC104644756 [Solanum lycopersicum]
Length=477

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/421 (62%), Positives = 320/421 (76%), Gaps = 9/421 (2%)
 Frame = +2

Query  359   NLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPP-GAELLPWPPSSPPYRVS  535
             N+SH++FGLLGSEKAWHHR++Y+ESWWRPN T G L LD PP G +LLPW  +SPPYRVS
Sbjct  65    NISHIIFGLLGSEKAWHHRKSYIESWWRPNITKGHLLLDVPPQGDDLLPWSFNSPPYRVS  124

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             DN+S++++ETNHV PRV RMVHGIME VR+  +     +RWV+MGDDD+IF VDN+VD+L
Sbjct  125   DNLSKLLKETNHVEPRVLRMVHGIMEVVREVHE----GVRWVIMGDDDSIFFVDNMVDIL  180

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             AQYDHTKYYY GGHSEFI +N ++SF QAFGG GI++S+PLA   A  +M CLKRY+HL 
Sbjct  181   AQYDHTKYYYFGGHSEFILSNYWYSFNQAFGGAGIIMSYPLAKEFAKNVMSCLKRYAHLR  240

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
             SAD+TT  CIAD+GVNLSP QG HQID+ GDISGFLSYHP + L SLHHFDM +PIFPSM
Sbjct  241   SADRTTMNCIADIGVNLSPLQGIHQIDLRGDISGFLSYHPKSLLTSLHHFDMFDPIFPSM  300

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             +R +S  H    A  DQ RMLQQ +C HR ++W+FSV+WGYSA+IYEKIMPRS++Q PIE
Sbjct  301   DRVQSVFHLQNVAKYDQSRMLQQTICHHRSKSWTFSVSWGYSAHIYEKIMPRSWIQRPIE  360

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF+TW PSP PP ++FDVR   + DPC  PH FF +SV++ T R EIV  Y R W RG+ 
Sbjct  361   TFRTWQPSPNPPYYMFDVRS-PSWDPCEAPHVFFFKSVKK-TQRGEIVTMYTRGWPRGIG  418

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDII  1615
              C +  G+ SA+ IS+I VYSP TK   I + ECCD+ I    S    IK R C  ++II
Sbjct  419   TCLSS-GNFSAEYISEIHVYSPTTKRILIDKCECCDI-IHEAGSNKVDIKYRECKINEII  476

Query  1616  A  1618
             A
Sbjct  477   A  477



>ref|XP_010313269.1| PREDICTED: uncharacterized protein LOC101259024 [Solanum lycopersicum]
Length=478

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/425 (61%), Positives = 327/425 (77%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S S TN+SHL+FGLLGSEKAWHHR++Y+ESWWRPN T G+L LD PP  +LLPW  +SPP
Sbjct  62    SKSSTNISHLLFGLLGSEKAWHHRKSYIESWWRPNITNGYLLLDVPPKGDLLPWSSNSPP  121

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             Y++SD+V ++V ET HV+  V R+VHGIME  R+  +     +RW+VMGDDD+IF +DN+
Sbjct  122   YKISDDVPKLVNETKHVDATVLRLVHGIMEVFREEYE----GVRWLVMGDDDSIFFLDNM  177

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+LAQYDHTKYYY GGHSEFI +N ++SF Q FGG G +LS+PLA A+A  +M CLKRY
Sbjct  178   VDILAQYDHTKYYYFGGHSEFILSNYWYSFNQGFGGAGFILSYPLAKALARDMMSCLKRY  237

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             +HLN+AD+TT  CIAD+GVNLSP  G HQID+ GD+SGFLS HP + L+SLHHFDMV+PI
Sbjct  238   AHLNAADRTTMTCIADIGVNLSPLLGVHQIDLRGDLSGFLSSHPKSLLMSLHHFDMVDPI  297

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+RA+S  H + AAN DQ RMLQQ +C  R  +W+FS++WGYSA+IYEKIMPRS+LQ
Sbjct  298   FPSMDRAQSGYHLLNAANYDQSRMLQQTICHKRSTSWTFSISWGYSAHIYEKIMPRSWLQ  357

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
             NPIETF+TW  SP+PP+++FD R   + DPC  PH FF +SVE+ T ++EI+ TY R+W 
Sbjct  358   NPIETFKTWARSPKPPHYMFDTRT-PSWDPCEAPHVFFFKSVEK-TPKNEILTTYTRAWP  415

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             RG+  C +  G+ SA+ +S+I VYSP TK  +I R ECCDV I    S  A IK R C  
Sbjct  416   RGIGNC-SFTGNYSAEYVSEIHVYSPSTKRIEIDRCECCDV-IHEEGSNKADIKYRECKE  473

Query  1604  DDIIA  1618
             D+IIA
Sbjct  474   DEIIA  478



>ref|XP_006367692.1| PREDICTED: uncharacterized protein LOC102581971 [Solanum tuberosum]
Length=440

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/435 (59%), Positives = 324/435 (74%), Gaps = 8/435 (2%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE  493
             S S+  + +   + TN+SHLVFGLLG+E+AWHHR+ YVE+WWRPN T G + LD PP  +
Sbjct  14    STSQTRTSSKIVAQTNISHLVFGLLGNERAWHHRKHYVEAWWRPNVTRGHIFLDVPPRGD  73

Query  494   LLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGD  673
             LLPW  +SPPYR+SD+V ++V ETNHV+PRV RMVHGIME VR A +     +RWV++GD
Sbjct  74    LLPWSLNSPPYRISDDVRKLVRETNHVDPRVLRMVHGIMEVVRQAHE----GVRWVILGD  129

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DDTIF VDN+VD+LAQYDHTKYYY GGHSEFI +N ++SF Q FGG GI+LS+PLA   A
Sbjct  130   DDTIFFVDNMVDILAQYDHTKYYYFGGHSEFILSNYWYSFHQGFGGAGIILSYPLAREFA  189

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               +M CLKRY+HL S+D+TT  C+ADLGVNL+P QG HQID+ GDISGFLSYHP + L S
Sbjct  190   HNVMSCLKRYAHLKSSDRTTMVCVADLGVNLTPLQGIHQIDLRGDISGFLSYHPKSLLTS  249

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHH+D V+PIFPSM RA++  H + AA  DQ RMLQQ +C HR ++W+FSV+WGYSA+IY
Sbjct  250   LHHYDTVDPIFPSMTRAQAGSHLLKAAFYDQSRMLQQTICHHRSKSWTFSVSWGYSAHIY  309

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
             EKIMPRS++Q PI TF+TW  S   P ++FDVR   + +PC  PH FF +SVE+ T R E
Sbjct  310   EKIMPRSWIQRPIVTFRTWQRSSSQPQYMFDVRG-PSWNPCEAPHVFFFKSVEK-TQRGE  367

Query  1394  IVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSES  1573
             I+ TY R W RG+ AC +  G+ SA+ +S+I VYSP  K  +I + ECCDV I    S  
Sbjct  368   IITTYSRGWPRGIGACLSS-GNFSAEYVSEIYVYSPAIKRIQIDKCECCDV-IHEEGSIK  425

Query  1574  AVIKTRRCMADDIIA  1618
             A IK R C  +++IA
Sbjct  426   ADIKYRECKINELIA  440



>ref|XP_011080434.1| PREDICTED: uncharacterized protein LOC105163690 [Sesamum indicum]
Length=478

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 324/423 (77%), Gaps = 12/423 (3%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPTNLSHLVFGL+GSEKAWHHR+AY+ESWWRPN T G L LD PP   LLPW P+SP YR
Sbjct  68    SPTNLSHLVFGLVGSEKAWHHRKAYIESWWRPNVTRGLLFLDNPPTPGLLPWSPASPSYR  127

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             +SD++++ + +T+ V P+  R++H IME  R+  +     +RW+VMGDDD+I  +DN+VD
Sbjct  128   ISDDLTKFLNKTD-VTPQ--RIIHAIMEVYREDHE----NMRWLVMGDDDSILFLDNIVD  180

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VLAQYDHTKYYY GGHSEFI +N +FSF Q FGG G +LS+PLA A+A  + +CL+RY H
Sbjct  181   VLAQYDHTKYYYFGGHSEFILSNYWFSFSQGFGGAGFILSYPLAKALAADMENCLRRYRH  240

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             LN+AD TT  CIAD+GV+L+  +G HQID+ GDISGFLS HP  PL+SLHHFDMV PIFP
Sbjct  241   LNAADLTTMACIADIGVSLTALKGIHQIDLRGDISGFLSSHPKFPLLSLHHFDMVAPIFP  300

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             S +RAES RH M AA  DQ RMLQQ +C+HR  NWSFS++WGYSA+IYE+IMPRSYLQ P
Sbjct  301   SKDRAESTRHLMKAAAVDQSRMLQQTICYHRQSNWSFSISWGYSAHIYERIMPRSYLQYP  360

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             IETF+TWG SPRPP+++F+ R   ++DPC  PH FF ES+ + TA +EI+ ++ R+W RG
Sbjct  361   IETFKTWGRSPRPPHYMFNTRS-PSSDPCEAPHIFFYESINK-TAENEILTSFARAWPRG  418

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADD  1609
             LPAC +  G+ SAD +S+I VYSP  K  ++ RSECCDV    V+   A ++ R C AD+
Sbjct  419   LPAC-SSTGNHSADSVSRIQVYSPARKRFQMDRSECCDVV--GVNESQADVRLRECAADE  475

Query  1610  IIA  1618
             IIA
Sbjct  476   IIA  478



>ref|XP_009787324.1| PREDICTED: uncharacterized protein LOC104235295 [Nicotiana sylvestris]
Length=477

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/425 (60%), Positives = 326/425 (77%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             +N  TN+SHLVFG+LGSEKAWH+R++Y+ESWWRPN T G L LD PP  +LLPW  +SPP
Sbjct  61    TNIATNISHLVFGILGSEKAWHNRKSYIESWWRPNITRGHLLLDFPPKDDLLPWSINSPP  120

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             Y++SDNV ++V ET HV+P V R+VHGIME  R+  +     LRW+VMGDDD++F VDN+
Sbjct  121   YKISDNVVKLVAETKHVDPTVLRLVHGIMEVFREEHE----GLRWLVMGDDDSVFFVDNM  176

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+LAQYDHT+YYY GGHSEFI +N ++SF Q FGG G +LS+PLA A+A  +++CLKRY
Sbjct  177   VDILAQYDHTEYYYFGGHSEFILSNYWYSFNQGFGGAGFILSYPLAKALAKDMINCLKRY  236

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             ++LN+ADKTT  CIAD+GVNLSP QG HQID+ G+ISGFLS HP + L+SLHHFDMV+PI
Sbjct  237   NYLNAADKTTMTCIADIGVNLSPLQGIHQIDLRGNISGFLSSHPKSLLMSLHHFDMVDPI  296

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+R++S  H + AAN DQ RMLQQ +C  R  NW+FS++WGYSA+IYEKIMPRS++Q
Sbjct  297   FPSMDRSQSIFHLLNAANYDQSRMLQQTICHKRSSNWTFSISWGYSAHIYEKIMPRSWIQ  356

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PIETF+TW  SP PP+++FDVR   + DPC  PH FF +S+E+ T R+EI+ TY R+  
Sbjct  357   RPIETFKTWQKSPNPPHYMFDVRN-PSLDPCEAPHIFFFKSIEK-TPRNEILTTYIRARP  414

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             RG+ AC    G+ SA+ +S+I V+SP  K  +I R ECCD+ I    S  A +K R C  
Sbjct  415   RGIGACLYA-GNLSAEYVSEIHVFSPAIKRIEIDRCECCDI-IHEAGSNKADVKYRECKT  472

Query  1604  DDIIA  1618
             D+IIA
Sbjct  473   DEIIA  477



>ref|XP_011080433.1| PREDICTED: uncharacterized protein LOC105163689 [Sesamum indicum]
Length=467

 Score =   523 bits (1348),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 261/444 (59%), Positives = 320/444 (72%), Gaps = 19/444 (4%)
 Frame = +2

Query  308   NESRSELESR-NDSNS-----PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQ  469
             +E+ S    R ND +S     PTNLSHLVFGLLGSEKAWHHR+AY+ESWWRPNAT GFL 
Sbjct  36    SETSSSFSPRINDYSSQPNYPPTNLSHLVFGLLGSEKAWHHRKAYIESWWRPNATRGFLY  95

Query  470   LDKPPGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGT  649
             LDK P  +LLPW  +SPPYRVSDN++  + ET+ + P + RMVHGIME  R+A       
Sbjct  96    LDKAPTGDLLPWSNASPPYRVSDNLTEFLRETDALAPVMIRMVHGIMEVFREADNE---N  152

Query  650   LRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLS  829
             LRWVVMGDDD++F VDN+VDVL QYDHTKYYYLGG SEFI +N +FSF Q FGG G +LS
Sbjct  153   LRWVVMGDDDSVFFVDNIVDVLGQYDHTKYYYLGGQSEFIMSNYWFSFNQGFGGAGFMLS  212

Query  830   FPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSY  1009
             +PLA A++  +  CL+RY+   SAD+ T  CIAD+GVNLSP +G HQID+ GDISGFLS 
Sbjct  213   YPLAKALSKDMESCLRRYAKWGSADQITMVCIADIGVNLSPQKGIHQIDLRGDISGFLSS  272

Query  1010  HPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVA  1189
             HP  PLISLHHFD V PIFPSM+R ES RH M AA  DQ RMLQQ +C HR  +WSFSV+
Sbjct  273   HPKFPLISLHHFDGVEPIFPSMDRYESTRHLMRAAADDQSRMLQQTICHHRQSSWSFSVS  332

Query  1190  WGYSANIYEKIMPRSYLQNPIETFQTWGPSPRP-PNWIFDVRKRTTTDPCLVPHAFFLES  1366
             WGYS +IYEKIMPRSYLQ PIETF+TW  +PRP P+++F+ R   + D C  PH FF + 
Sbjct  333   WGYSVHIYEKIMPRSYLQMPIETFKTWSSTPRPRPHYMFNTR-LPSNDSCEAPHVFFFQR  391

Query  1367  VEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDV  1546
             VE+ +    I+ TY R+  RGLP C    G+ +AD +S+I V+SP TK  ++ R ECCD+
Sbjct  392   VEKSST--GILTTYSRAAPRGLPPC----GNHTADLLSEIHVFSPSTKRKEMDRCECCDI  445

Query  1547  TIDSVDSESAVIKTRRCMADDIIA  1618
                 V    A +K R C+ ++IIA
Sbjct  446   V--GVGGGKAELKFRECIINEIIA  467



>ref|XP_009803906.1| PREDICTED: uncharacterized protein LOC104249222 [Nicotiana sylvestris]
Length=483

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 253/437 (58%), Positives = 321/437 (73%), Gaps = 10/437 (2%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KPPGA  490
             SRS+       ++PTNLSHL+FGLLGSE+AWH+R+ Y+ESWWRPN T G+L LD  P G 
Sbjct  55    SRSKTSQFGHDSNPTNLSHLLFGLLGSEEAWHYRKEYIESWWRPNKTRGYLFLDVAPTGD  114

Query  491   ELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMG  670
             +L PW  SSPPYRVSDN++++++ETNHV P +ARMVHGIME  R+  +     +RWVVMG
Sbjct  115   DLFPWSSSSPPYRVSDNITKLIQETNHVAPTMARMVHGIMEVFREEHE----GVRWVVMG  170

Query  671   DDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAM  850
             DDD++F VDN+VDVL QYDHTKYYYLGG SE++ +N ++SF QAFGG G +LS+PLA AM
Sbjct  171   DDDSVFFVDNMVDVLGQYDHTKYYYLGGQSEYLLSNYWYSFNQAFGGAGFILSYPLAKAM  230

Query  851   ADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLI  1030
             +  I  CL+RY  L SAD+ T  CI+D+GVNL+P +G HQID+ GDISG LS HP APL+
Sbjct  231   SKYIESCLRRYPFLRSADQITMVCISDVGVNLTPLKGSHQIDLRGDISGLLSSHPKAPLM  290

Query  1031  SLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANI  1210
             SLHH D  NPIFPSM R +S  H M AA  DQ RMLQQ++C++RP NWSFS++WGYS +I
Sbjct  291   SLHHLDAANPIFPSMERLQSVHHLMNAAKFDQSRMLQQVICYNRPNNWSFSISWGYSIHI  350

Query  1211  YEKIMPRSYLQNPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             YE I+PRS+LQ PIETF+ WG +P+ PP ++ + R   T D C  PH FFLES E+ T +
Sbjct  351   YENILPRSHLQIPIETFKPWGVTPKDPPYYLLNTR-LPTNDSCQAPHVFFLESAEKST-K  408

Query  1388  DEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDS  1567
             +EI+  + RS  RGLPAC +  G  SAD+IS+I VYS   K   + R ECCDVT  ++ +
Sbjct  409   NEILTMFSRSLPRGLPAC-SYSGSHSADQISQIEVYSSRRKRIDMDRCECCDVT-HNIGT  466

Query  1568  ESAVIKTRRCMADDIIA  1618
               A IK R C  D+IIA
Sbjct  467   NKAKIKLRECHMDEIIA  483



>ref|XP_009603789.1| PREDICTED: uncharacterized protein LOC104098691 [Nicotiana tomentosiformis]
Length=500

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 250/438 (57%), Positives = 318/438 (73%), Gaps = 9/438 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N S S   S ND+N PTNLSHLVFGLLGSEKAWH+R++Y+ESWWRP  T G+L LD+ P 
Sbjct  71    NSSISHFISSNDTN-PTNLSHLVFGLLGSEKAWHYRKSYIESWWRPKITRGYLFLDEKPK  129

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
               LLPW  +SPPYR+SD+++++V+ET HV P +ARMVHGIME  R+  +     +RWVVM
Sbjct  130   WNLLPWSKNSPPYRISDDITKLVQETQHVAPIMARMVHGIMELFREEHE----GVRWVVM  185

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDD+IF V+N+VDVLAQYDHT+YYY GG SE+I +N ++SF Q FGG G +LS+PLA A
Sbjct  186   GDDDSIFFVENMVDVLAQYDHTQYYYFGGQSEYILSNFWYSFSQGFGGAGFILSYPLAKA  245

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +A+ +  CL+RY  L SAD+ T  CI DLGV+ SP +G HQID+HGDISG LS HP  PL
Sbjct  246   LAEDMESCLRRYPFLRSADQITMACIVDLGVSFSPLKGLHQIDLHGDISGLLSSHPKVPL  305

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHHFD + PIFPSM+R +S +  M AA  DQ RMLQQ +C+H+P NWSFS+++GYS +
Sbjct  306   MSLHHFDAIAPIFPSMDRIQSTKQLMKAAKFDQSRMLQQTICYHKPSNWSFSISFGYSVH  365

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
             IYEKIMPRSYLQ PIETF+ W   P+ PP ++F+ R  +  D C  PH FFL+S+ E   
Sbjct  366   IYEKIMPRSYLQYPIETFEAWNNKPQNPPYYMFNTRP-SAKDSCETPHVFFLKSIGETWN  424

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVD  1564
             ++EI ATY RS  R LP C  G G+  A+ +++I VYSP TK  +I R ECCDV I +  
Sbjct  425   KNEIWATYSRSAVRRLPGCPIG-GNHPANYVNRIQVYSPRTKRTRIDRCECCDV-IHTTG  482

Query  1565  SESAVIKTRRCMADDIIA  1618
             S  A +K R C   + IA
Sbjct  483   SNKAKVKFRECFNKEKIA  500



>ref|XP_009785515.1| PREDICTED: uncharacterized protein LOC104233769 [Nicotiana sylvestris]
Length=508

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/434 (57%), Positives = 314/434 (72%), Gaps = 9/434 (2%)
 Frame = +2

Query  320   SELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL  499
             S   S N++N PTNLSHLVFGLLGSEKAWH+R++Y+ESWWRP  T G+L LD+ P   LL
Sbjct  83    SHFISSNETN-PTNLSHLVFGLLGSEKAWHYRKSYIESWWRPKITRGYLFLDEKPKWNLL  141

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             PW  +SPPY++SD+++++V+ET HV P +ARMVHGIME  R+  +     +RWVVMGDDD
Sbjct  142   PWSKNSPPYKISDDITKLVQETQHVAPVMARMVHGIMELFREEHE----GVRWVVMGDDD  197

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADG  859
             +IF VDN+VDVLAQYDHT+YYY GG SE+I +N ++SF Q FGG G +LS+PLA A+A+ 
Sbjct  198   SIFFVDNMVDVLAQYDHTQYYYFGGQSEYILSNFWYSFSQGFGGAGFILSYPLAKALAED  257

Query  860   IMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLH  1039
             +  CL+RY  L SAD+ T  CI DLGV+ SP +G HQID+ GDISG LS HP  PL+SLH
Sbjct  258   MESCLRRYPFLRSADQITMACIVDLGVSFSPLKGLHQIDLRGDISGLLSSHPKVPLMSLH  317

Query  1040  HFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK  1219
             HFD + PIFPSMNR +S +  M AA  DQ RMLQQ +C+HRP NWSFS++WGYS +IYEK
Sbjct  318   HFDAIAPIFPSMNRIQSTKQLMKAAKFDQSRMLQQTICYHRPSNWSFSISWGYSVHIYEK  377

Query  1220  IMPRSYLQNPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEI  1396
             IMPRSYLQ PIETF TW   P+ PP ++F+ R  +  D C  PH FFL+S+ E   ++EI
Sbjct  378   IMPRSYLQYPIETFDTWNNKPQNPPYYMFNTRS-SANDSCETPHVFFLKSIGETWNKNEI  436

Query  1397  VATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESA  1576
              ATY RS  R LP C  G G+  A+ +++I VYSP TK  ++ R ECCD+ I    S  A
Sbjct  437   WATYSRSAVRRLPGCSIG-GNHPANYVNRIQVYSPRTKRTRMDRCECCDI-IHITGSNKA  494

Query  1577  VIKTRRCMADDIIA  1618
              +K R C   + IA
Sbjct  495   KVKFRECFNKEKIA  508



>ref|XP_011080435.1| PREDICTED: uncharacterized protein LOC105163691 [Sesamum indicum]
Length=476

 Score =   517 bits (1332),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 261/438 (60%), Positives = 321/438 (73%), Gaps = 10/438 (2%)
 Frame = +2

Query  305   DNESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPP  484
             +N+ R   ++   ++S TNLSHLVFGL+GSE+AWHHR+AY+ESWWRPN T G+L LDK P
Sbjct  49    NNKIRDPPQATATADSRTNLSHLVFGLVGSEQAWHHRKAYIESWWRPNGTRGYLFLDKAP  108

Query  485   GAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVV  664
                LLPWP +SPPYRVSD++  ++   N    R  RMVHGIME +R+         RW+V
Sbjct  109   SPGLLPWPETSPPYRVSDDLKELL---NKSEIRAQRMVHGIMEVLREVDYE---NFRWLV  162

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAM  844
             MGDDD+IF VDN+VDVLA YDHTKYYYLGG+SEFI +N  FSF QAFGGGGI+LS+PLA 
Sbjct  163   MGDDDSIFFVDNMVDVLATYDHTKYYYLGGNSEFILSNYLFSFNQAFGGGGIILSYPLAK  222

Query  845   AMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAP  1024
             A+A  + +CL+RY  LNSAD TT  CIAD+G NLSP +G HQID  GDISG L  HP +P
Sbjct  223   ALARDMENCLRRYVFLNSADNTTRACIADIGANLSPQKGNHQIDFRGDISGLLLSHPLSP  282

Query  1025  LISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSA  1204
             L+SLHHFDMV PIFP  +R ES R  M AA +DQ RMLQQ +C HR  NWSFS++WGYSA
Sbjct  283   LLSLHHFDMVEPIFPGTDRFESTRLLMKAAAADQSRMLQQTICHHRQSNWSFSISWGYSA  342

Query  1205  NIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
              I+E+IMPRSYLQ P+ETF+ W  +PRPPN++F+ RK  + DPC  PHAFF ESVE+ T 
Sbjct  343   QIFERIMPRSYLQMPVETFKPWVRTPRPPNYLFNTRK-PSRDPCEAPHAFFFESVEKKTE  401

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVD  1564
              DEI+ +Y R+W R LPAC +  G+ SAD I +I V+SP  K  ++ R ECC++    VD
Sbjct  402   SDEILTSYSRAWPRDLPAC-SSSGNHSADYIQRIQVFSPANKRTQVDRCECCEIV--GVD  458

Query  1565  SESAVIKTRRCMADDIIA  1618
             S  A IK R CM D+IIA
Sbjct  459   SIKAEIKFRECMTDEIIA  476



>ref|XP_004251358.1| PREDICTED: uncharacterized protein LOC101258437 [Solanum lycopersicum]
Length=478

 Score =   512 bits (1319),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 248/429 (58%), Positives = 315/429 (73%), Gaps = 9/429 (2%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KPPGAELLPWPPS  514
             +D +SPTNL HLVFGLLGSE+AWH R+ Y+ESWWRPN T G+L LD  P G +LLPW  S
Sbjct  57    SDDSSPTNLRHLVFGLLGSEEAWHFRKDYIESWWRPNKTRGYLFLDVAPKGDDLLPWSSS  116

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPYRVSDN+++++EE+ HV P +ARMVHGIME  R+  +     +RW+VMGDDD+IF V
Sbjct  117   SPPYRVSDNITQLLEESKHVAPVMARMVHGIMEVFREDHE----GVRWLVMGDDDSIFFV  172

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DN+VDVL++YDHTKYYYLG  SEFI +N+++SF QAFGG G +LS+PLA AM+  I  CL
Sbjct  173   DNMVDVLSRYDHTKYYYLGAQSEFIMSNHWYSFNQAFGGAGFILSYPLAKAMSKYIETCL  232

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
             ++Y  L SAD+ T  CI+D+GV  +P +G HQID+ GDISG LS HP APL+SLHH D  
Sbjct  233   RKYPFLRSADQITMVCISDVGVIFTPLKGSHQIDLRGDISGLLSSHPKAPLMSLHHLDAT  292

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             + IFPS+ R +S RH M AAN DQ RMLQQ++C++RP NWSFS++WGYS +IYE I+PRS
Sbjct  293   DSIFPSIERRQSVRHLMKAANLDQSRMLQQVICYNRPTNWSFSISWGYSLHIYENILPRS  352

Query  1235  YLQNPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             +LQ PIETFQ WG +P+ PP ++ + R R T D C  PH FF+++VE+     EI+ TY 
Sbjct  353   HLQLPIETFQPWGVTPKDPPYYMLNTRSR-TNDSCQAPHIFFMKNVEKTKTSSEILTTYS  411

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             RS  R L +C +  G+ SAD IS I VYSP TK  ++ R ECCDV I    +  A IK R
Sbjct  412   RSSPRELLSC-SYTGNYSADYISMIQVYSPRTKRIEMDRCECCDV-IHKKGTNKATIKLR  469

Query  1592  RCMADDIIA  1618
              C  D+IIA
Sbjct  470   ECHVDEIIA  478



>gb|EYU46238.1| hypothetical protein MIMGU_mgv1a007160mg [Erythranthe guttata]
Length=417

 Score =   506 bits (1302),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 253/422 (60%), Positives = 313/422 (74%), Gaps = 10/422 (2%)
 Frame = +2

Query  362   LSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDN  541
             L+H+VFG++GSEKAW  R+ Y+ESWWRPN T G+L LDKPPG  LLPWP +SPP+RVSD+
Sbjct  3     LNHIVFGIVGSEKAWRFRKTYIESWWRPNHTNGYLFLDKPPGPPLLPWPETSPPFRVSDD  62

Query  542   VSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQ  721
             ++ ++   N  + R  RMVHGIME +R+     T  LRWVVMGDDD+IF VDN+VDVLA+
Sbjct  63    LTDLLN--NKSDIRAQRMVHGIMEVLREVKDHKT--LRWVVMGDDDSIFFVDNIVDVLAK  118

Query  722   YDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSA  901
             YDHTKYYYLGGHSEFI +N YFSF QAFGGGGI+LS+PLA A+A  I  CLKRY  LNSA
Sbjct  119   YDHTKYYYLGGHSEFILSNYYFSFNQAFGGGGIMLSYPLAKALAGDIESCLKRYVFLNSA  178

Query  902   DKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNR  1081
             D TT  CIAD+GVNL+PHQG HQ+D  GDISGFLS HP APL+SLHHFDMV+PIFP+ +R
Sbjct  179   DNTTKACIADIGVNLTPHQGNHQVDFRGDISGFLSTHPLAPLLSLHHFDMVDPIFPAKDR  238

Query  1082  AESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETF  1261
              +S RH M AA +DQ RMLQQ +C+ R  NWS S++WGYSA+IYE+IMPRSYL  PIETF
Sbjct  239   FQSTRHLMTAAKADQSRMLQQTICYDRRSNWSLSISWGYSAHIYERIMPRSYLIIPIETF  298

Query  1262  QTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE---IVATYRRSWRRGL  1432
               W  + +PPN++F+ R R++ DPC  PH FF +SV+E  A      IV +Y R+W R L
Sbjct  299   TPWLKTLKPPNYMFNTRSRSSADPCEAPHVFFFDSVQETAAIGSGGGIVTSYSRAWPRPL  358

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             PAC +  G+ SAD I +I+V+SP TK     R ECCD+     D   A +  R C +++I
Sbjct  359   PACLSS-GNHSADFIQRILVFSPPTKRTSTDRCECCDII--KADGGEAEVIVRECRSNEI  415

Query  1613  IA  1618
             IA
Sbjct  416   IA  417



>ref|XP_011090127.1| PREDICTED: uncharacterized protein LOC105170901 [Sesamum indicum]
Length=479

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 242/429 (56%), Positives = 309/429 (72%), Gaps = 12/429 (3%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             + N +  PT LSHL FG++GSE AWHHRRAY+ESWWRPNAT G L LD+PP   LLPW  
Sbjct  63    TSNPAYPPTVLSHLAFGIVGSEDAWHHRRAYIESWWRPNATHGLLFLDQPPSENLLPWSR  122

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
              SPPYR+S ++   + +++ V P+  R+ +GI E  R   Q     LRW+VMGDDD+IF 
Sbjct  123   ESPPYRISRDLRTFLNKSD-VTPQ--RIANGIAEVFR---QVDHANLRWLVMGDDDSIFF  176

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV++L +YDHTKYYY+G  SEF+ +N  FSF Q FGG G +LS+PLA  +   + +C
Sbjct  177   LDNLVEILQRYDHTKYYYIGARSEFVLSNFLFSFSQGFGGAGFILSYPLAKDLVRDMDNC  236

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             L RYSH+ +AD+TT  CIAD+GVNL+P +GFHQID+ GDISG LS HP  PL+SLHHFDM
Sbjct  237   LMRYSHVVAADQTTMSCIADMGVNLTPLEGFHQIDLRGDISGLLSSHPKVPLLSLHHFDM  296

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             V PIFP+M+R++S RH M AAN+DQ RMLQQ +C  R RNWSFS++WGYSA+IYE+IMPR
Sbjct  297   VEPIFPTMDRSQSTRHLMMAANADQSRMLQQTVCHDRRRNWSFSISWGYSAHIYERIMPR  356

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             S+LQ PIETFQ W P+P PP ++F+ R   +TDPC  PH FFL++V+     D+I+  YR
Sbjct  357   SFLQYPIETFQAWLPAPGPPFYMFNTRL-PSTDPCEAPHVFFLDTVKR--KADDILTVYR  413

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R+W RG+P CF   G+ SAD I KI V SP  K  +I RSECCD+    V    A +K R
Sbjct  414   RAWPRGMPTCFFA-GNHSADYIHKIRVTSPAKKRLEIHRSECCDIV--GVVGNKADVKFR  470

Query  1592  RCMADDIIA  1618
              CM  +I+A
Sbjct  471   ECMDKEIMA  479



>gb|EYU46241.1| hypothetical protein MIMGU_mgv1a005613mg [Erythranthe guttata]
Length=477

 Score =   498 bits (1283),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 239/437 (55%), Positives = 309/437 (71%), Gaps = 10/437 (2%)
 Frame = +2

Query  314   SRSE--LESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             +R+E  + S  ++  PTNLSH+ FGLLGS K W HRR Y+E+WWRPN T G++ LD+ P 
Sbjct  49    ARTEPHISSSGENKIPTNLSHIAFGLLGSVKTWPHRRGYLEAWWRPNKTRGYVYLDQAPT  108

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
               LLPWP ++PPYR+ DN+S +  +    +  + RMVHGI+E  R+        +RW+VM
Sbjct  109   PNLLPWPQTAPPYRIVDNLSEIFRDVKPRHALMPRMVHGILELFREE----HDDMRWIVM  164

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDD+IF VDN+VDVL   DHTKYYYLG HSE + +N +FSF QAFGGGGIVLS+PLA A
Sbjct  165   GDDDSIFFVDNIVDVLGGLDHTKYYYLGWHSESVISNFWFSFDQAFGGGGIVLSYPLAKA  224

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +A  +  CL RY+  +SAD  T  CIAD+GVNL+PH+G HQ+D+HGD SG+LS HP   L
Sbjct  225   LAADMDGCLIRYAQSSSADLITMTCIADIGVNLTPHKGIHQVDLHGDFSGYLSAHPKVHL  284

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             ++ HHFD ++PIFPSM+R ++ RH M AA++DQ R+LQQ +C+ RP NWSFS+AWGYSA 
Sbjct  285   MTFHHFDAMDPIFPSMDRMQATRHLMKAADADQSRLLQQTICYQRPTNWSFSIAWGYSAQ  344

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IYEKI PRSYLQ PIETF+ W   P+PP ++F+ R   ++DPC  PH FFLESV +  A 
Sbjct  345   IYEKIHPRSYLQMPIETFRPWAKGPKPPFYMFNTR-LPSSDPCEAPHMFFLESVYKSVAG  403

Query  1388  DEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDS  1567
             D+IV TY R+  R +P C +  G+ SAD IS I V+SP  K  +I RSECCD+    VD 
Sbjct  404   DQIVTTYLRARPRDMPPC-SSAGNHSADSISSIKVFSPAVKRIEIDRSECCDIL--GVDD  460

Query  1568  ESAVIKTRRCMADDIIA  1618
               A +K R C   +IIA
Sbjct  461   NKAEVKFRECKLGEIIA  477



>ref|XP_011080362.1| PREDICTED: uncharacterized protein LOC105163636 [Sesamum indicum]
Length=474

 Score =   498 bits (1281),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 236/423 (56%), Positives = 302/423 (71%), Gaps = 8/423 (2%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             S TNLSH+ FGLLGS K W HRR Y+E+WWRPN T G++ LD+PP  +LLPWP ++PPYR
Sbjct  60    SRTNLSHIAFGLLGSVKTWPHRRGYLEAWWRPNRTRGYVYLDRPPTPDLLPWPQTAPPYR  119

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             + DN+S +          + RMVHGI+E  R+        +RW+VMGDDD+IF VDN+VD
Sbjct  120   IVDNLSEIFRNVKPRFELMPRMVHGILELFREE----HDDMRWIVMGDDDSIFFVDNIVD  175

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VLA+YDHTKYYYLG HSE + +N +FSF QAFGGGGIVLS+PLA A+   +  CL RY+ 
Sbjct  176   VLAEYDHTKYYYLGWHSESVISNYWFSFDQAFGGGGIVLSYPLAKALVKDMDGCLVRYAQ  235

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
              +SAD  T  CIAD+GVNL+PH+G HQ+D+HGD SG+LS HP  PL++ HHFD ++PIFP
Sbjct  236   SSSADLITMTCIADIGVNLTPHKGIHQVDLHGDFSGYLSAHPKVPLMTFHHFDAMDPIFP  295

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             + +R +S RH M AA++DQ R+LQQ +C+ R  NWSFS++WGYSA IYE+IMPRSYLQ P
Sbjct  296   NKDRFQSTRHLMKAADADQSRLLQQTICYQRQSNWSFSISWGYSAQIYERIMPRSYLQMP  355

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             IETF+ W   P+PP ++F+ R   + +PC  PH FFLESV +  + DEIV +Y R+  RG
Sbjct  356   IETFRPWAKGPKPPFYMFNTRP-PSNNPCEAPHVFFLESVYKSVSGDEIVTSYLRARPRG  414

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADD  1609
             LPAC +  G+ SAD IS I V+SP  K  +  R ECCD+     D   A IK R C  D+
Sbjct  415   LPAC-SFSGNHSADSISTIQVFSPAKKRLQTDRCECCDIV--RTDDVKAQIKFRECKIDE  471

Query  1610  IIA  1618
             IIA
Sbjct  472   IIA  474



>ref|XP_006349802.1| PREDICTED: uncharacterized protein LOC102600818 [Solanum tuberosum]
Length=478

 Score =   498 bits (1281),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 238/426 (56%), Positives = 307/426 (72%), Gaps = 8/426 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S++ TNLSHL FGLLGSEKAWH+R++Y+E+WW+P  T G+L LD  P   LLPW  +SPP
Sbjct  60    SSNDTNLSHLSFGLLGSEKAWHYRKSYIETWWKPKLTRGYLFLDVSPNPNLLPWSKNSPP  119

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             YRVS N++++V+ET+H+ P +ARMVHGIME +    Q   G +RWV+MGDDD+IF ++NL
Sbjct  120   YRVSTNITKLVQETHHIAPIMARMVHGIMELID---QEHEG-VRWVIMGDDDSIFFLENL  175

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VDVL +YDH KYYY GG SE+I +N ++SF Q FGG GI++SFPLA A+A  +  CL+RY
Sbjct  176   VDVLGKYDHNKYYYFGGQSEYILSNFWYSFNQGFGGAGIIMSFPLAKALAQDMESCLRRY  235

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              HL SAD  T  CI DLG +  P +G HQID+HGDISGFLS HP  PLISLHHFD V+PI
Sbjct  236   PHLRSADLITMTCIVDLGGSFIPLKGLHQIDLHGDISGFLSSHPKEPLISLHHFDAVSPI  295

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+R +S +H M AA  D  R+LQQ++C HR  NW+FSV+WGYS +IYEKIMPRS+L 
Sbjct  296   FPSMDRIQSTKHLMKAAKFDNSRILQQIICHHRLSNWTFSVSWGYSVHIYEKIMPRSHLI  355

Query  1244  NPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
              PIETF TW   P+ PP ++F+ R     D C  PH F+L+S+     ++EI+ATY RS 
Sbjct  356   KPIETFDTWSGRPQNPPFYMFNTRSH-VKDSCETPHIFYLKSIGGAQNKNEIMATYSRSV  414

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCM  1600
              R L  C   DG+ SA+ ++KI VYSP  K A++GR ECCD+ I +  S  A +K R C 
Sbjct  415   VRKLQGC-PIDGNHSANYVNKIQVYSPRKKRAEMGRCECCDI-IHTTGSNKAQVKLRECF  472

Query  1601  ADDIIA  1618
              ++ IA
Sbjct  473   TNEKIA  478



>gb|EYU46239.1| hypothetical protein MIMGU_mgv1a0225922mg, partial [Erythranthe 
guttata]
Length=384

 Score =   494 bits (1271),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 238/386 (62%), Positives = 293/386 (76%), Gaps = 11/386 (3%)
 Frame = +2

Query  365   SHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNV  544
             +H+VFG++GSEKAW  R++Y+ESWWRPN T G+L LD PPG  LLPWP +SPP+RVSD++
Sbjct  3     NHIVFGIVGSEKAWQFRKSYIESWWRPNHTNGYLFLDVPPGPHLLPWPETSPPFRVSDDL  62

Query  545   SRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQY  724
             ++++ +T+    R  RMVHGIME +R+        LRWVVMGDDD++F VDN+VDVLAQY
Sbjct  63    TKLLNKTD---IRAQRMVHGIMEVLREVKDHKN--LRWVVMGDDDSVFFVDNIVDVLAQY  117

Query  725   DHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSAD  904
             DHTKYYYLGGHSEFI +N+ FSF QAFGGGGI+LS+PLA A+A  + +CLKRY  LNSAD
Sbjct  118   DHTKYYYLGGHSEFILSNSIFSFNQAFGGGGIMLSYPLAKALAGDMENCLKRYVFLNSAD  177

Query  905   KTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRA  1084
              TT  CIAD+GVNLSP +G HQID  GDISGFLS H   PL+SLHHFDMV+PIFP+ +R 
Sbjct  178   NTTKACIADIGVNLSPQRGNHQIDFRGDISGFLSTHSLTPLLSLHHFDMVDPIFPAKDRF  237

Query  1085  ESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQ  1264
             ES RH M AA +DQ RMLQQ +C++R  NWSFS++WGYSA IYE+IM RSYL  PIETF 
Sbjct  238   ESTRHLMTAAKADQSRMLQQTICYNRRNNWSFSISWGYSAQIYERIMHRSYLLMPIETFT  297

Query  1265  TWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE----IVATYRRSWRRGL  1432
              W  +P PP ++F+ R R + DPC  PHAFF +SVE  TA ++    I+ TY R+W RGL
Sbjct  298   PWLETPNPPAYMFNTRGR-SGDPCEAPHAFFFQSVERTTAAEDGGGGIITTYSRAWPRGL  356

Query  1433  PACFAGDGDQSADRISKIVVYSPVTK  1510
             PAC    G+ SAD I  I V+SP TK
Sbjct  357   PACLTS-GNHSADFIHTIRVFSPDTK  381



>gb|EPS62128.1| hypothetical protein M569_12664, partial [Genlisea aurea]
Length=423

 Score =   484 bits (1245),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 303/425 (71%), Gaps = 8/425 (2%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
              +PTNL+H+VFG++GSE+ W  RR Y+ESWWRPN T G++ LD+ P   LLPWP +SPPY
Sbjct  6     ETPTNLNHIVFGIVGSEQGWQSRRNYIESWWRPNVTRGYVFLDQNPNPSLLPWPETSPPY  65

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDA-PQRATGTLRWVVMGDDDTIFLVDNL  703
             R+S ++    E  N    R  RMV+GIME +R+   +   G  RW+VMGDDDTIF  DNL
Sbjct  66    RISSDLR---EFLNKSEVRAQRMVNGIMEVLREVEAEGGGGGFRWLVMGDDDTIFFTDNL  122

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VD+++++DH KYYYLG  SEFI++N +FSF QAFGGGGI+LS+PLA AMA  + +CLKRY
Sbjct  123   VDMVSRFDHRKYYYLGARSEFIYSNYWFSFDQAFGGGGIMLSYPLAKAMAKDMKNCLKRY  182

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             ++LNSAD TT  C+ DLG NL P QG HQ+D  GDISG LS HP APLISLHHFD V+PI
Sbjct  183   AYLNSADNTTRACVTDLGTNLLPQQGNHQLDFRGDISGLLSSHPIAPLISLHHFDFVDPI  242

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP+M+R ES RH M+AA++DQ RMLQQ +C+HR   WS SV+WGY A IYE I+PRS+L 
Sbjct  243   FPTMDRFESTRHLMSAASADQSRMLQQTICYHRGFRWSLSVSWGYLAQIYETILPRSHLH  302

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PIETFQ W  +P PP+++F+ R R + + CL PH F+LE++++V    EI  TY RS  
Sbjct  303   TPIETFQPWLETPGPPHYMFNTRLR-SAESCLAPHLFYLEALKKVPGGHEIQTTYARSTA  361

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             RG+  C + +G + A+ +  I V+SP TK  +  R ECCD+    V  +   +K RRC+ 
Sbjct  362   RGVSPCRSEEG-RPAEFVRVIQVFSPATKRYETDRCECCDII--RVGGDKVQVKIRRCLT  418

Query  1604  DDIIA  1618
              ++IA
Sbjct  419   GEVIA  423



>ref|XP_004252891.2| PREDICTED: uncharacterized protein LOC101256858 [Solanum lycopersicum]
Length=477

 Score =   482 bits (1240),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 229/425 (54%), Positives = 303/425 (71%), Gaps = 8/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S++ TNLSHL+FGLLGSEKAWH+R++Y+E+WWRP  T G+L LD  P   LLPW  +SPP
Sbjct  61    SSNDTNLSHLIFGLLGSEKAWHYRKSYIETWWRPKITRGYLFLDVSPNPNLLPWSKNSPP  120

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             YRVS N++++V+ET+H+ P +ARMVHGI E      Q   G +RWV+MGDDD+IF ++NL
Sbjct  121   YRVSTNITKLVQETHHIAPIMARMVHGIKELFD---QEHEG-VRWVIMGDDDSIFFLENL  176

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VDVL +YDH KYYY GG SE+I +N ++SF Q FGG GI++SFPLA A+A  +  C++RY
Sbjct  177   VDVLGKYDHNKYYYFGGQSEYILSNFWYSFNQGFGGAGIIMSFPLAKALAQDMESCIRRY  236

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              HLNSAD  T  CI DLG +  P +G HQID+ GDISGFLS HP  PLISLHHFD V+PI
Sbjct  237   PHLNSADLITMTCIVDLGGSFVPLKGLHQIDLRGDISGFLSSHPKEPLISLHHFDAVSPI  296

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             +PSM+R +S +H M AA  D  R+LQQ++C HR  NW+FSV+WGYS +IYEKIMPRS+L 
Sbjct  297   YPSMDRIQSTKHLMKAAKFDNSRILQQIICHHRLSNWTFSVSWGYSIHIYEKIMPRSHLI  356

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PI+TF TW     PP ++F+ R     D C  PH F+L+S+     ++ I+ATY RS  
Sbjct  357   KPIQTFNTWSKPQNPPFYMFNTRS-NVNDSCETPHIFYLKSIGGAN-KNGIMATYSRSVV  414

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             R L  C   +G+  A+ ++KI VYSP  K A++ R ECCD+ I +  S+ A+++ R C  
Sbjct  415   RKLQGC-PINGNHPANYVNKIQVYSPRKKRAEMDRCECCDI-IHTTGSKKAIVQLRECFT  472

Query  1604  DDIIA  1618
             ++ IA
Sbjct  473   NEKIA  477



>gb|EYU46242.1| hypothetical protein MIMGU_mgv1a026569mg [Erythranthe guttata]
Length=429

 Score =   474 bits (1221),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 223/398 (56%), Positives = 292/398 (73%), Gaps = 8/398 (2%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             + NS TNLSHLVFGLLGSEKAWH R++Y+ESWWRPN T GFL LDKPP   LLPWP +SP
Sbjct  31    NDNSRTNLSHLVFGLLGSEKAWHDRKSYIESWWRPNTTKGFLYLDKPPTGNLLPWPETSP  90

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTL--RWVVMGDDDTIFLV  694
             PYR+SD+++  +++     P + RMVH IME  R+  ++    L  RW VMGDDD++F V
Sbjct  91    PYRISDDLTEFLKQNKPKAPIMIRMVHAIMEIFREINEKNNDNLDIRWFVMGDDDSVFFV  150

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DN+VDVLA+YDHTKYYY+GG SEF+ +N +FSF+Q FGG G +LS+ L  A+A G+ +CL
Sbjct  151   DNIVDVLAEYDHTKYYYIGGQSEFVLSNYWFSFQQGFGGAGFMLSYRLVKALAMGMENCL  210

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
             +RY++L SAD  T  CI+D+GVNLSP++G HQID+HGDISG LS HP +PLISLHH D +
Sbjct  211   RRYAYLRSADYITMVCISDIGVNLSPNKGIHQIDLHGDISGLLSSHPKSPLISLHHLDKM  270

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
              PIFP+M+  ES RH M AA +DQ RMLQQ +C HR  NW+FSV+WGYSA+IYE++MPR+
Sbjct  271   KPIFPNMDSFESTRHLMKAAAADQTRMLQQTICHHRGSNWTFSVSWGYSAHIYERVMPRN  330

Query  1235  YLQNPIETFQTWGPSPRP--PNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
             YLQ PIETF+ W  +P    P ++F+ R   + DPC  PH FF + VE+ ++  EI+ TY
Sbjct  331   YLQKPIETFKPWVGTPETHRPFYMFNTR-LPSDDPCEKPHVFFFKGVEKASSSSEILTTY  389

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKI  1522
              R+  RGL  C       +A+ +S+I V+SP TK  ++
Sbjct  390   SRAAPRGLGPC---SDSPNAEFVSEIRVFSPATKREEV  424



>emb|CDP09269.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   457 bits (1175),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 287/406 (71%), Gaps = 10/406 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N  ++ L+S N ++S TN+SHL+F +LGSE AWHHR+ Y E+WWRPN T G L LD  P 
Sbjct  24    NPEKTLLQS-NSNDSTTNISHLLFAILGSEGAWHHRKGYGEAWWRPNVTRGHLYLDTAPE  82

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
              +LLPW  +SPPYRVS+N+ ++++E     P + R+VH I+E  ++  +      RW+VM
Sbjct  83    GDLLPWSSASPPYRVSENIEKLIKEIAPAVPPIIRLVHTILEAFKEGDKEG---FRWLVM  139

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDDT+F VDNLVDVLA+YDHT YYY+G  S+++ +N +FSF   FGG GI LS+PLA A
Sbjct  140   GDDDTVFFVDNLVDVLAKYDHTDYYYIGCQSDYVKSNFWFSFNMGFGGAGIALSYPLAKA  199

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +A  +  CL+RY+H+N+ D    YCI+DLGVNLSP +G HQ+DM+GDISGFLS HP  PL
Sbjct  200   LAKDMNGCLRRYAHMNTFDIIAMYCISDLGVNLSPQKGLHQVDMNGDISGFLSAHPKTPL  259

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHHFD V PIFP M+RAE+ RH M A N DQ R+LQQ +CFHR   W+ S++WGYS N
Sbjct  260   LSLHHFDEVEPIFPGMDRAEAIRHLMKAGNIDQSRLLQQTICFHRKHRWTVSISWGYSVN  319

Query  1208  IYEKIMPRSYLQNPIETFQTW-GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
             +YE+I+PRS+LQ  IETFQ W  P+  PP+++F  R  T  DPC  PH FF ES+E++  
Sbjct  320   LYERIIPRSWLQIAIETFQKWVAPNADPPHFMFTTR-FTENDPCETPHVFFFESMEKMPG  378

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKI  1522
              + I+ +Y RS  R LP CFA      AD +S + VYSP TK  ++
Sbjct  379   -NVILTSYYRSRPRELPPCFAS---LPADYVSHVHVYSPATKRRQV  420



>emb|CDP09271.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 213/404 (53%), Positives = 294/404 (73%), Gaps = 8/404 (2%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE  493
             S S+  S  D + PTN+SHL FGL GSEK +H R+AY+E+WWRPN T G++ +D+ P A+
Sbjct  66    SSSQPASTVDDDVPTNVSHLAFGLQGSEKTYHFRKAYLEAWWRPNITRGYVYIDREPTAD  125

Query  494   LLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGD  673
             LLPW P SP YR++D++S++++E    +  + RMVHGI+E  R+  +     +RW++MGD
Sbjct  126   LLPWSPKSPQYRMNDDLSKLIQEIRPRSALMPRMVHGILELFREEHE----GIRWIIMGD  181

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DDT+F VDNLV VL++YDHTKYYY+G  SEF+ +N +F+F QAFGGGGI+LS+PLA A+ 
Sbjct  182   DDTMFFVDNLVHVLSKYDHTKYYYIGYPSEFVLSNYWFNFNQAFGGGGIILSYPLAKALV  241

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               +  CL++YS L SAD  T  C+AD+G NL+PH+G HQ D+ GD SGFLS HP   ++S
Sbjct  242   RDMDRCLRKYSDL-SADLMTMACLADIGANLTPHKGVHQNDLRGDYSGFLSSHPKELVLS  300

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             +HH+D+++PIFP  +R +SA+H M A N DQ R+ QQ +C HRP NW+FSV+WGYSA+IY
Sbjct  301   IHHWDVLDPIFPKKDRFQSAQHLMKAGNVDQSRLFQQTICHHRPTNWTFSVSWGYSAHIY  360

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
             EK+M RS+L  PIETFQ W  S +PP ++F+ R R   DPC  PH FF ES++E T+ +E
Sbjct  361   EKVMARSWLMTPIETFQGWSRSNKPPLFMFNTR-RPFGDPCEAPHVFFFESIKE-TSNNE  418

Query  1394  IVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG  1525
             I+  Y RS  R LPAC A  G+ SA+ +S++ V+SP TK  ++ 
Sbjct  419   ILTIYARSAPRNLPACPAS-GNHSAEFVSQVHVFSPATKRPEVS  461



>gb|EPS64375.1| hypothetical protein M569_10400, partial [Genlisea aurea]
Length=459

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 294/424 (69%), Gaps = 11/424 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TNLSH+ FG++GS + W HRR Y E+WWRPNAT GF+ LD+PP  E LPWP ++PPYRV 
Sbjct  44    TNLSHIAFGVMGSVQMWPHRRGYQEAWWRPNATRGFIYLDRPPPPEFLPWPETAPPYRVV  103

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             DN+SR+ E+       + RMVHGI++  R+        LRW+VMGDDDT+F  DN+ DVL
Sbjct  104   DNISRLFEKEKPRFELMPRMVHGILQLFREV---DGDDLRWIVMGDDDTVFFADNVADVL  160

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH +YYYLG HSE + +N +FSF  AFGGGGIVLS PLA A+A  + DCL RY+   
Sbjct  161   SEYDHERYYYLGWHSESVISNLWFSFDMAFGGGGIVLSRPLAAALARDMDDCLVRYAAST  220

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
             SAD  T  CIAD+GVNL+PH+G HQ D+HGD+SG+L  HP  P+++ HHF  V PIFP  
Sbjct  221   SADLITMTCIADIGVNLTPHKGIHQGDLHGDLSGYLWAHPKVPVMAFHHFGAVEPIFPGK  280

Query  1076  NRAESARHFMAAANSDQPRMLQQLLC-FHRP-RNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +R ES RH M A+++DQ R+ QQ +C   RP R WS SV+WGYSA IYE++ PRSYLQ P
Sbjct  281   DRFESTRHLMTASDADQSRLFQQTICHLRRPNREWSVSVSWGYSAQIYERVFPRSYLQVP  340

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             IETF  W     PP ++F+ R   + DPC  PH FFL+SVE+  A D I+ TY R+  RG
Sbjct  341   IETFTPWARGSEPPFFMFNTRP-VSNDPCEAPHVFFLDSVEKTAAGDRILTTYVRARPRG  399

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVT-IDSVDSESAVIKTRRCMAD  1606
             LP C AG+ ++SAD ++KI V SP TK  +I R ECCDV  +D V+ E   +  R C  D
Sbjct  400   LPPCAAGE-NRSADPVAKITVSSPATKRIQIDRCECCDVVEVDDVEME---VNYRECRID  455

Query  1607  DIIA  1618
             +IIA
Sbjct  456   EIIA  459



>ref|XP_011032049.1| PREDICTED: uncharacterized protein LOC105131000 [Populus euphratica]
Length=418

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 285/424 (67%), Gaps = 7/424 (2%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             +SPTN+SH+ F ++ S  +W +R++Y+ESWWRPN T G++ LDK P  E LPWP +SPP+
Sbjct  2     DSPTNISHIGFIVISSLNSWKNRKSYIESWWRPNVTRGYVFLDKEPTEEFLPWPSTSPPF  61

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             RV+++++++       +P   RM H +++  R   +     LRW+VM DDD+I  VDNLV
Sbjct  62    RVNEDITKLRVYPKIASPLQVRMFHSLLDMYRVGDK----DLRWLVMCDDDSIIFVDNLV  117

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             +VL +YDH KY Y+GG SE + +N  FSF   FGG G  +S+P A A++  + DC++RY 
Sbjct  118   EVLRKYDHNKYQYIGGISECVKSNADFSFDMGFGGAGYAVSYPFAQALSTKLEDCIERYP  177

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
             +L  +D     C ADLG+ L+  +G HQID+ GDISGFLS+HP +PL++LHH D+V+PIF
Sbjct  178   YLRVSDHMAQSCFADLGIALTIEKGIHQIDLRGDISGFLSFHPQSPLLTLHHLDVVDPIF  237

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             PSM++ E+ RH M AA  DQ R++QQ +C+ R  NWSFSV+WGYS +IYE I+PRS L+ 
Sbjct  238   PSMDKYEALRHLMKAAKVDQSRVVQQTICYQRESNWSFSVSWGYSTHIYENIIPRSILRK  297

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             P+ETF+ W  + RPP ++F+ R   T +PC  PH FF ES+E     D+++ TY R+ +R
Sbjct  298   PLETFRPWSRNTRPPFFMFNTR-WLTNNPCEAPHVFFFESIEHNPENDQVLTTYVRAAQR  356

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMAD  1606
              +P C A  G+ SAD ISKI V+S  T     G  ECCDV   + ++    IK R C+ D
Sbjct  357   NMPPCSAS-GNHSADSISKIRVHSQATARKTAGVMECCDVDYKA-ETNVTEIKIRSCLKD  414

Query  1607  DIIA  1618
             ++IA
Sbjct  415   EVIA  418



>ref|XP_002314081.1| hypothetical protein POPTR_0009s05630g [Populus trichocarpa]
 gb|EEE88036.1| hypothetical protein POPTR_0009s05630g [Populus trichocarpa]
Length=418

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/424 (48%), Positives = 284/424 (67%), Gaps = 7/424 (2%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             +SPTN+SH+ F ++GS  +W +R++Y+ESWWRPN T G++ LDK P  E LPWP +SPP+
Sbjct  2     DSPTNISHIGFIVIGSLNSWKNRKSYIESWWRPNVTRGYVFLDKEPTEEFLPWPSTSPPF  61

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             +V+++++++       NP   RM H +++  R   +     LRW++M DDD+IF VDNLV
Sbjct  62    QVNEDITKLRVYPKIANPLQVRMFHSLLDMYRVGDK----GLRWLIMCDDDSIFFVDNLV  117

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             +VL +YDH KY Y+GG SE + +N  FSF   FGG G  +S+P A A++  + DC++RY 
Sbjct  118   EVLRKYDHNKYQYIGGISECVKSNADFSFDMGFGGAGYAVSYPFAQAISTKLEDCIERYP  177

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
             HL  +D     C ADLG+ L+  +G HQID+ GDISGFLSY P +PL++LHH D+V+PIF
Sbjct  178   HLWVSDHMAQSCFADLGIALTIEKGIHQIDLRGDISGFLSYLPQSPLLTLHHLDIVDPIF  237

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             PSM+R E+ RH M AA  DQ R+ QQ +C+ R  NWSFSV+WGYS +IYE I+PRS L+ 
Sbjct  238   PSMDRYEALRHLMKAAKVDQSRVAQQTICYQRESNWSFSVSWGYSTHIYENIIPRSILRK  297

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PIETF+ +  + RPP ++F+ R +   +PC  PH FF ES+E     D+++ TY R+ +R
Sbjct  298   PIETFRPFSKNTRPPLYMFNTRWQ-INNPCEAPHVFFFESIEHNPENDQVLTTYVRAAQR  356

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMAD  1606
              LP C A  G+ SAD ISKI V S  T     G  ECCDV   + ++    IK R C+ D
Sbjct  357   NLPPCSAS-GNHSADSISKIRVLSQATTRKTAGVIECCDVDYKA-ETNITDIKIRSCLKD  414

Query  1607  DIIA  1618
             ++IA
Sbjct  415   EVIA  418



>ref|XP_010102368.1| hypothetical protein L484_015317 [Morus notabilis]
 gb|EXB93329.1| hypothetical protein L484_015317 [Morus notabilis]
Length=487

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 203/433 (47%), Positives = 288/433 (67%), Gaps = 8/433 (2%)
 Frame = +2

Query  320   SELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL  499
             S   ++   ++PTNLSH+VFG++GS   W ++R Y ++WWRPN T G+L LD+PP  E L
Sbjct  63    SSSATKTSFSTPTNLSHIVFGVVGSMNTWKNKRFYSQAWWRPNVTRGYLFLDRPPTNEFL  122

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             PWP S PP+RV+++++++    N + P   R+   ++ET R   Q     +RW VM DDD
Sbjct  123   PWPSSWPPFRVNEDLTKMKTHPNFLKPTQVRIARTVLETFRQGDQ----DVRWYVMADDD  178

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADG  859
             T+  VDNLV VLA+YDHT  +Y+G +SE + +N  FSF+ AFGG G  +S+PL  ++A  
Sbjct  179   TVLAVDNLVGVLAKYDHTNKFYIGTNSECVKSNFDFSFEMAFGGAGYAMSYPLVASLAGK  238

Query  860   IMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLH  1039
             +  CL+RY  L  +D     C++DLG++L+ + GFHQID+  D+SG LS HP  P +SLH
Sbjct  239   LDACLERYPRLWVSDFMLFTCLSDLGISLTHNNGFHQIDLFRDVSGLLSSHPQTPFLSLH  298

Query  1040  HFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK  1219
             H D ++PIFP  NR +S  H M AA SDQ R+LQQ +C HRP NW+FSV+WGYS +IYE 
Sbjct  299   HIDTIDPIFPGKNRPDSINHLMKAAKSDQSRLLQQTICHHRPTNWTFSVSWGYSVHIYEN  358

Query  1220  IMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIV  1399
             I+PRS+L+ P+ETF+ W  S RPP ++F+ R   T +PC  PH FF +SVE  T +D+I 
Sbjct  359   ILPRSFLRKPLETFRPWK-SMRPPLYMFNTR-WPTNNPCEAPHVFFFDSVENSTEKDQIT  416

Query  1400  ATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAV  1579
              TY R + RGLPAC +G G+ SAD ++KI ++SP   P + G  ECCDV + +       
Sbjct  417   TTYIRVFPRGLPACSSG-GNHSADHMAKIRIFSPAKLPLEAGGRECCDV-VHTSGMNITE  474

Query  1580  IKTRRCMADDIIA  1618
             ++ R C+ D++ A
Sbjct  475   VRYRPCIKDEVTA  487



>ref|XP_006446149.1| hypothetical protein CICLE_v10017500mg, partial [Citrus clementina]
 gb|ESR59389.1| hypothetical protein CICLE_v10017500mg, partial [Citrus clementina]
Length=463

 Score =   426 bits (1095),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 203/427 (48%), Positives = 283/427 (66%), Gaps = 8/427 (2%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S ++  SPTN++H+VFG+ G+   W +RRAYVE+WWRPN T G+L L++ P  E LPWPP
Sbjct  43    SSSNITSPTNINHIVFGIAGTVNGWKYRRAYVEAWWRPNVTRGYLFLERFPSREFLPWPP  102

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+RV++N++R+       N    R+   I+ET R+  +     +RW VM DDDTI  
Sbjct  103   SSPPFRVNENITRLKSYEKIKNSFQVRVFRTILETFREGDE----DVRWYVMADDDTILF  158

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             VDNLV+VLA+YDHT+Y Y+G +SE + +N Y SF  AFGG G  LS+PL  A+A     C
Sbjct  159   VDNLVEVLAKYDHTQYLYIGTNSECVSSNFYASFNMAFGGAGYALSYPLVEALAAKFDKC  218

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             +++Y +L ++D     C+ADLGV L+  +GFHQID+H DISG LS  P  P++SLHH D+
Sbjct  219   VEKYQNLYASDLMLYSCLADLGVTLTLEKGFHQIDLHSDISGLLSALPQIPVLSLHHLDV  278

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             +NPIFPSM+R++S  H M AA  D  R+LQQ +C+   RNWSFS++WGY+ +IYE I+PR
Sbjct  279   INPIFPSMSRSKSINHLMKAAKLDHSRLLQQTICYDMQRNWSFSISWGYTTHIYESILPR  338

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             +++  P+ETF+ W  S R P ++F+ R   T + C  PH FF  S E  T  ++I  TY 
Sbjct  339   NFVVKPLETFRPWRRSDRQPLYMFNTRG-ITRNSCEAPHVFFFHSAENST-ENKIATTYL  396

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R+  R LP C +  G+ SAD I+ I V+SP T+  ++G++ECCDV     D     IK R
Sbjct  397   RALPRNLPPC-SNSGNISADSINTIHVFSPATEHKRMGKTECCDVE-KMRDVNVTDIKLR  454

Query  1592  RCMADDI  1612
             +C  D+I
Sbjct  455   KCTKDEI  461



>gb|KDO61216.1| hypothetical protein CISIN_1g037329mg [Citrus sinensis]
Length=474

 Score =   426 bits (1096),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 285/429 (66%), Gaps = 8/429 (2%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S ++  SPTN++H+VFG+ G+   W +RRAYVE+WWRPN T G+L L++ P  E LPWPP
Sbjct  54    SSSNVTSPTNINHIVFGIAGTVNGWKYRRAYVEAWWRPNVTRGYLFLERFPSREFLPWPP  113

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+RV++N++R+       N    R+   I+ET R+  +     +RW VM DDDTI  
Sbjct  114   SSPPFRVNENITRLKSYEKIKNSFQVRVFRTILETFREGDE----DVRWYVMADDDTILF  169

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             VDNLV+VLA+YDHT+Y Y+G +SE + +N + SF  AFGG G  LS+PL  A+A     C
Sbjct  170   VDNLVEVLAKYDHTQYLYIGTNSECVSSNFHASFNMAFGGAGYALSYPLVEALAAKFDKC  229

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             +++Y +L ++D     C+ADLGV L+  +GFHQID+H DISG LS  P  P++SLHH D+
Sbjct  230   VEKYQNLYASDLMLYSCLADLGVTLTLEKGFHQIDLHSDISGLLSALPQIPVLSLHHLDV  289

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             +NPIFPSM+R++S  H M AA  D  R+LQQ +C+   RNWSFS++WGY+ +IYE I+PR
Sbjct  290   INPIFPSMSRSKSINHLMKAAKLDHSRLLQQTICYDMQRNWSFSISWGYTTHIYESILPR  349

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             +++  P+ETF+ W  S R P ++F+ R   T + C  PH FF  S E  T  ++I  TY 
Sbjct  350   NFVVKPLETFRPWRRSDRQPLYMFNTRG-ITRNSCEAPHVFFFHSAENST-ENKIATTYL  407

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R+  R LP C +  G+ SAD I+ I V+SP T+  ++G++ECCDV     D     IK R
Sbjct  408   RALPRNLPPC-SNSGNISADSINTIHVFSPATEHKRMGKTECCDVE-KMRDVNVTDIKLR  465

Query  1592  RCMADDIIA  1618
             +C  D+II+
Sbjct  466   KCTKDEIIS  474



>ref|XP_002298394.2| fringe-related family protein [Populus trichocarpa]
 gb|EEE83199.2| fringe-related family protein [Populus trichocarpa]
Length=439

 Score =   424 bits (1089),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/429 (49%), Positives = 283/429 (66%), Gaps = 11/429 (3%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S N + +PT++SH+VF ++ S   W HR++YVESWWRPN T G++ LD+ P     PWP 
Sbjct  22    SANVTTTPTSISHIVFAMVSSVNTWKHRKSYVESWWRPNVTRGYIFLDRDPSQRFHPWPS  81

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+RV+   + V    N       R+V  IMET      +    +RW VM DDDT+  
Sbjct  82    SSPPFRVN---APVKFRLNRKYATQVRIVRTIMETF----MQGDKDVRWYVMADDDTVLF  134

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV+VLA+Y+HT+Y+Y+G +SE + +N  FSF+ AFGG G  LS+PLA A++  +  C
Sbjct  135   IDNLVEVLAKYNHTEYFYIGMNSESVSSNVNFSFEMAFGGAGYALSYPLAEALSTKVDGC  194

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             ++RY ++ S+D     C+AD GV L+ H+GFHQID+HGDISG LS H  +P++SLHH D+
Sbjct  195   IQRYPNVYSSDFILQTCLADFGVPLTHHRGFHQIDLHGDISGLLSAHHQSPVLSLHHIDV  254

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             V+PIFPSMNR+ S  H M AA  D  R+L+Q +C+ R  NWSFS +WGYSA+IYE I PR
Sbjct  255   VDPIFPSMNRSASVNHLMEAAKVDHSRLLEQTICYQRKNNWSFSTSWGYSAHIYENIHPR  314

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             S+L  PIETF+ W    +PP ++F+ R   T DPC  PH FF+ESVE+ T  +++V TY 
Sbjct  315   SFLLLPIETFRPWLRIFKPPFYMFNTRS-LTNDPCDAPHEFFMESVEK-TRGNQVVTTYT  372

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R   R LP C +  G+ SA+ ISKI V+S  T   K G  ECCDV  ++ D     IK R
Sbjct  373   RKSPRNLPPC-SSSGNHSANHISKIQVFSSATTLKKAGLMECCDVE-ETADMNITRIKLR  430

Query  1592  RCMADDIIA  1618
              CM D++IA
Sbjct  431   ACMKDEVIA  439



>ref|XP_010046704.1| PREDICTED: uncharacterized protein LOC104435699 [Eucalyptus grandis]
Length=482

 Score =   424 bits (1090),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 286/427 (67%), Gaps = 13/427 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             +++PTN+SHLVFG++G+   W+ RR YVESWWRPN T G+L LD+ P  EL  WPPSSPP
Sbjct  67    TDTPTNISHLVFGIVGTVNTWNRRRPYVESWWRPNVTRGYLFLDRAPSKELREWPPSSPP  126

Query  524   YRVSDNVSR--VVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
              RV+++++R  V+    +  P   R+   I+E  R   +     +RW VM DDDT+  VD
Sbjct  127   VRVNEDITRWGVLRRVRNRVP--IRIFRTILEMFRQGDK----DVRWYVMADDDTVLFVD  180

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV+VL++YDHTKYYY+G  SEF  +N   SF+ AFGG G  LS+P+   +A  +  C+K
Sbjct  181   NLVEVLSRYDHTKYYYIGSSSEFFMSNFLLSFEMAFGGAGYALSYPVVEMLATELDACIK  240

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             R   L S+D     C+ D G++L+  +GFHQ+D HGDISGFLS HP +P++SLHH D ++
Sbjct  241   RNPWLYSSDIMLHICLTDHGISLTQERGFHQVDFHGDISGFLSAHPQSPVLSLHHIDAID  300

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFPSMN +E+    M  A  DQ R+LQQ +C+HR R WS SV+WGYSA+IYE I+ RS+
Sbjct  301   PIFPSMNHSEAINQLMKPAQVDQSRLLQQTICYHRERKWSISVSWGYSAHIYENILSRSF  360

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P+ETF+ W    +PP ++F+ R     +PC+VPH FFL+S+E  +  DEIV TY R+
Sbjct  361   LRRPMETFKPWMKRVKPPLYMFNTRI-LENNPCIVPHVFFLKSMENASC-DEIVTTYTRA  418

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
              +  LP+C  G G+ SA+ IS++ V+SP  +  + GR ECCDV  D  +  +  ++ R C
Sbjct  419   SKSRLPSCALG-GNHSANPISRVQVFSPRRRHIEAGRMECCDVLAD--NQNTTKVRLRPC  475

Query  1598  MADDIIA  1618
             M  ++IA
Sbjct  476   MFGEVIA  482



>gb|KCW87180.1| hypothetical protein EUGRSUZ_B03707 [Eucalyptus grandis]
Length=486

 Score =   424 bits (1090),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 286/427 (67%), Gaps = 13/427 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             +++PTN+SHLVFG++G+   W+ RR YVESWWRPN T G+L LD+ P  EL  WPPSSPP
Sbjct  71    TDTPTNISHLVFGIVGTVNTWNRRRPYVESWWRPNVTRGYLFLDRAPSKELREWPPSSPP  130

Query  524   YRVSDNVSR--VVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
              RV+++++R  V+    +  P   R+   I+E  R   +     +RW VM DDDT+  VD
Sbjct  131   VRVNEDITRWGVLRRVRNRVP--IRIFRTILEMFRQGDK----DVRWYVMADDDTVLFVD  184

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV+VL++YDHTKYYY+G  SEF  +N   SF+ AFGG G  LS+P+   +A  +  C+K
Sbjct  185   NLVEVLSRYDHTKYYYIGSSSEFFMSNFLLSFEMAFGGAGYALSYPVVEMLATELDACIK  244

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             R   L S+D     C+ D G++L+  +GFHQ+D HGDISGFLS HP +P++SLHH D ++
Sbjct  245   RNPWLYSSDIMLHICLTDHGISLTQERGFHQVDFHGDISGFLSAHPQSPVLSLHHIDAID  304

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFPSMN +E+    M  A  DQ R+LQQ +C+HR R WS SV+WGYSA+IYE I+ RS+
Sbjct  305   PIFPSMNHSEAINQLMKPAQVDQSRLLQQTICYHRERKWSISVSWGYSAHIYENILSRSF  364

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P+ETF+ W    +PP ++F+ R     +PC+VPH FFL+S+E  +  DEIV TY R+
Sbjct  365   LRRPMETFKPWMKRVKPPLYMFNTRI-LENNPCIVPHVFFLKSMENASC-DEIVTTYTRA  422

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
              +  LP+C  G G+ SA+ IS++ V+SP  +  + GR ECCDV  D  +  +  ++ R C
Sbjct  423   SKSRLPSCALG-GNHSANPISRVQVFSPRRRHIEAGRMECCDVLAD--NQNTTKVRLRPC  479

Query  1598  MADDIIA  1618
             M  ++IA
Sbjct  480   MFGEVIA  486



>ref|XP_007212947.1| hypothetical protein PRUPE_ppa022014mg, partial [Prunus persica]
 gb|EMJ14146.1| hypothetical protein PRUPE_ppa022014mg, partial [Prunus persica]
Length=407

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 202/422 (48%), Positives = 279/422 (66%), Gaps = 18/422 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTNL+H+V G++GS   W  ++AY E+WW+PN T G+L LD+ P  E LPWP S+PP+RV
Sbjct  4     PTNLNHIVVGIVGSMNTWKKKKAYTEAWWKPNVTRGYLFLDRAPTLEFLPWPSSAPPFRV  63

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             +++++        V P   R++  I+ET R+  +     +RW VMGDDDT+  VDNLV+V
Sbjct  64    NEDITGFKVYPKIVRPDQVRIIRTILETFREGDK----DVRWYVMGDDDTVLFVDNLVEV  119

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             LA+YDHTKYYY+G  SE IH+N  FSF  AFGGGG  LS+PL   +A  + +C++RY +L
Sbjct  120   LAKYDHTKYYYIGSSSECIHSNFDFSFDMAFGGGGYALSYPLVATLATKLDECIERYPYL  179

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+ADLGV L+  +GFHQID+HGDISG LS HP +PL+SLHH D ++PIFP 
Sbjct  180   RFSDFMLHICLADLGVALTQEKGFHQIDLHGDISGLLSSHPQSPLLSLHHIDTIDPIFPF  239

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R+ES  H M  A  D  R+LQQ +C+HRP NWSFS++WGYSA+IYE ++PRS L+ P+
Sbjct  240   MSRSESINHLMRPAKVDPSRLLQQTICYHRPSNWSFSISWGYSAHIYENVIPRSILRRPL  299

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  + RPP ++F+ R  T  DPC  PH F  +S++E    ++ V TY R+  RGL
Sbjct  300   ETFRPWK-NTRPPFYVFNTR-LTYNDPCQAPHLFSFDSIDENVKGNQTVTTYSRTAPRGL  357

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P C +  G+ SAD I+KI          +    +CCD+   + D  +  +  R CM  +I
Sbjct  358   PPC-SSSGNHSADFITKI----------QARGIDCCDIAY-APDINTTQVIYRACMEGEI  405

Query  1613  IA  1618
             IA
Sbjct  406   IA  407



>ref|XP_007212465.1| hypothetical protein PRUPE_ppa017432mg, partial [Prunus persica]
 gb|EMJ13664.1| hypothetical protein PRUPE_ppa017432mg, partial [Prunus persica]
Length=408

 Score =   419 bits (1076),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/422 (48%), Positives = 276/422 (65%), Gaps = 17/422 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTNL+H+V G++GS   W  ++AY E+WW+PN T G+L LD+ P  E LPWP S+PP+R+
Sbjct  4     PTNLNHIVVGIVGSMNTWKKKKAYTEAWWKPNVTRGYLFLDRAPKPEFLPWPSSAPPFRI  63

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S++++        V P   R++  I+ET R+  +     +RW VM DDDTI  VDNLV+V
Sbjct  64    SEDITGFKVYPKIVRPDQVRIIRTILETFREGDK----DVRWYVMADDDTILFVDNLVEV  119

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             LA+YDHTKYYY+G  SE I +N  FSF  AFGGGG  LS+PL   +A  + +C++RY +L
Sbjct  120   LAKYDHTKYYYIGSSSECIKSNFDFSFDMAFGGGGYALSYPLVATLATKLDECIERYPYL  179

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+ADLGV L+  +GFHQID+HGDISG LS HP +PL+SLHH D ++PIFP 
Sbjct  180   RVSDFMLHSCLADLGVALTQEKGFHQIDLHGDISGLLSSHPQSPLLSLHHIDTIDPIFPF  239

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R+ES  H M  A  D  R+LQQ +C+HRP NWSFS++WGYSA+IYE I+PRS L+ P+
Sbjct  240   MSRSESINHLMRPAKVDSSRLLQQTICYHRPSNWSFSISWGYSAHIYENIIPRSILRRPL  299

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  S RPP ++F+ R  T  DPC  PH F  +S+ E    ++ + TY R+  RGL
Sbjct  300   ETFRPWKNSIRPPFYMFNTR-LTYNDPCQAPHLFSFDSIAENVKGNQTITTYSRTAPRGL  358

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P C +  G+ SAD I+KI          +    +CCD+   + D  +  +  R CM  +I
Sbjct  359   PPC-SSSGNHSADFITKI----------QARGIDCCDIAY-APDINTTQLIYRACMEGEI  406

Query  1613  IA  1618
             IA
Sbjct  407   IA  408



>ref|XP_004251361.1| PREDICTED: uncharacterized protein LOC101259312 [Solanum lycopersicum]
Length=329

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/337 (59%), Positives = 251/337 (74%), Gaps = 8/337 (2%)
 Frame = +2

Query  608   METVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYF  787
             ME  R+  +     +RW+VMGDDD+IF VDN+VD+LA YDHTKYYY GGHSEFI +N ++
Sbjct  1     MEVFREGHE----GVRWLVMGDDDSIFFVDNMVDILAHYDHTKYYYFGGHSEFILSNYWY  56

Query  788   SFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFH  967
             SF Q FGG G +LS+PLA A+A  +M CLKRY++LN+AD+TT  CIAD+GVNLSP QG H
Sbjct  57    SFNQGFGGAGFILSYPLAKALARDMMSCLKRYAYLNAADRTTMTCIADIGVNLSPLQGIH  116

Query  968   QIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQL  1147
             QID+ GD+SGFLS HP + L+SLHHFDMV+PIFP M+RA+S  H   AA  DQ RMLQQ 
Sbjct  117   QIDLRGDLSGFLSSHPKSLLMSLHHFDMVDPIFPFMDRAQSIFHLQNAAKYDQSRMLQQT  176

Query  1148  LCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTT  1327
             +C HR ++W+FSV+WGYS +IYEKIMPRS++Q PIETF+ W  SP PP ++FDVR  T+ 
Sbjct  177   ICHHRSKSWTFSVSWGYSVHIYEKIMPRSWIQRPIETFKPWQNSPNPPRYMFDVRS-TSR  235

Query  1328  DPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT  1507
             DPC  PH FF +SVE+ T ++EIV TY R+W RG+  C +  G+ SA+ +S+I VYSP T
Sbjct  236   DPCEAPHIFFFKSVEK-TPKNEIVTTYSRAWPRGIGNC-SFTGNYSAEYVSEIHVYSPST  293

Query  1508  KPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             K  +I R ECCD+ +    S  A IK R C  D+IIA
Sbjct  294   KRIQIDRCECCDI-VHKDGSNKAEIKYRECKEDEIIA  329



>ref|XP_011045418.1| PREDICTED: uncharacterized protein LOC105140323 [Populus euphratica]
Length=620

 Score =   420 bits (1080),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 283/429 (66%), Gaps = 11/429 (3%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S N + +PT++SH+VF ++ S   W HR++YVESWWRPN T G++ LD+ P     PWP 
Sbjct  203   SANVTTTPTSISHIVFAMVSSVDTWKHRKSYVESWWRPNVTRGYIFLDRDPSQRFHPWPS  262

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+RV+  V         +N R    +  I+ T+ +A  +    +RW VM DDDT+  
Sbjct  263   SSPPFRVNAPVKF------RLNSRYVTQLR-IVRTIMEAFMQGDKDVRWYVMADDDTVLF  315

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV+VLA+Y+HT+Y+Y+G +SE + +N  FSF+ AFGG G  LS+PLA A++  +  C
Sbjct  316   IDNLVEVLAKYNHTEYFYIGMNSECVSSNVNFSFEMAFGGAGYALSYPLAEALSTRVDGC  375

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             ++RY  + S+D     C+AD GV L+ H+GFHQID+HGDISG LS H  +P++SLHH D+
Sbjct  376   IQRYPSVYSSDFILQTCLADFGVPLTHHRGFHQIDLHGDISGLLSAHHQSPVLSLHHIDV  435

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             V+PIFPSMNR+ S  H M AA  D  R+L+Q +C+ R  NWSFS +WGYSA+IYE I PR
Sbjct  436   VDPIFPSMNRSASVNHLMEAAKVDHSRLLEQTICYQRKNNWSFSTSWGYSAHIYENIHPR  495

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             S+L  PIETF+ W    +PP ++F+ R   T DPC  PH FF+ESVE+ T  +++V TY 
Sbjct  496   SFLLRPIETFRPWLRIFKPPFYMFNTRS-LTNDPCDAPHEFFMESVEK-TRGNQVVTTYT  553

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R   R LP C +  G+ SA+ ISKI V+S  T   K G  ECC+V  ++ D     IK R
Sbjct  554   RKSPRNLPPC-SSSGNHSANHISKIQVFSSATTLKKAGLMECCNVE-ETADMNITHIKLR  611

Query  1592  RCMADDIIA  1618
              CM D++IA
Sbjct  612   ACMKDEVIA  620



>ref|XP_011013833.1| PREDICTED: uncharacterized protein LOC105117772 [Populus euphratica]
Length=620

 Score =   420 bits (1079),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 283/429 (66%), Gaps = 11/429 (3%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S N + +PT++SH+VF ++ S   W HR++YVESWWRPN T G++ LD+ P     PWP 
Sbjct  203   SANVTTTPTSISHIVFAMVSSVDTWKHRKSYVESWWRPNVTRGYIFLDRDPSQRFHPWPS  262

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+RV+  V         +N R    +  I+ T+ +A  +    +RW VM DDDT+  
Sbjct  263   SSPPFRVNAPVKF------RLNSRYVTQLR-IVRTIMEAFMQGDKDVRWYVMADDDTVLF  315

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV+VLA+Y+HT+Y+Y+G +SE + +N  FSF+ AFGG G  LS+PLA A++  +  C
Sbjct  316   IDNLVEVLAKYNHTEYFYIGMNSECVSSNVNFSFEMAFGGAGYALSYPLAEALSTRVDGC  375

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             ++RY  + S+D     C+AD GV L+ H+GFHQID+HGDISG LS H  +P++SLHH D+
Sbjct  376   IQRYPSVYSSDFILQTCLADFGVPLTHHRGFHQIDLHGDISGLLSAHHQSPVLSLHHIDV  435

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             V+PIFPSMNR+ S  H M AA  D  R+L+Q +C+ R  NWSFS +WGYSA+IYE I PR
Sbjct  436   VDPIFPSMNRSASVNHLMEAAKVDHSRLLEQTICYQRKNNWSFSTSWGYSAHIYENIHPR  495

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             S+L  PIETF+ W    +PP ++F+ R   T DPC  PH FF+ESVE+ T  +++V TY 
Sbjct  496   SFLLRPIETFRPWLRIFKPPFYMFNTRS-LTNDPCDAPHEFFMESVEK-TRGNQVVTTYT  553

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R   R LP C +  G+ SA+ ISKI V+S  T   K G  ECC+V  ++ D     IK R
Sbjct  554   RKSPRNLPPC-SSSGNHSANHISKIQVFSSATTLKKAGLMECCNVE-ETADMNITHIKLR  611

Query  1592  RCMADDIIA  1618
              CM D++IA
Sbjct  612   ACMKDEVIA  620



>ref|XP_006399763.1| hypothetical protein EUTSA_v10015814mg [Eutrema salsugineum]
 gb|ESQ41216.1| hypothetical protein EUTSA_v10015814mg [Eutrema salsugineum]
Length=414

 Score =   411 bits (1057),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 289/425 (68%), Gaps = 13/425 (3%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
              + TNLSHL+F L+G+ +AW HRR Y+ESWWRPN T G L LD  P  E  PW P+ PPY
Sbjct  2     EAATNLSHLMFVLVGTSRAWKHRRTYIESWWRPNVTRGNLFLDVKPSPEFRPWSPTFPPY  61

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             +V++++ ++       NP+  R+   ++ET R    +    +RW VMGDDD++F VDN+V
Sbjct  62    KVNEDLKKLRIYRKLRNPKHIRIYRSVLETHR---LKQDEGVRWYVMGDDDSLFFVDNIV  118

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             DVL++Y+HT+ +Y+G  SE I +N Y SF   FGGGG  LS+PL  AMA  + +C++RY 
Sbjct  119   DVLSKYNHTEKHYIGMFSETIKSNFYLSFDMGFGGGGCALSYPLVEAMAVKLDECVERYH  178

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
             ++ + D+   +C+ADLGV++   +GFHQ+D+HGD+SG LS HP APL+SLHHF +V P+F
Sbjct  179   YIWAVDQLQSFCLADLGVDVIHEKGFHQMDLHGDLSGLLSAHPTAPLLSLHHFGIVAPLF  238

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             P M+R  S  H M AAN DQ RMLQQ +C  R RNW+FSV+WGYSA++YEKI PRS+L+ 
Sbjct  239   PGMDRHASVLHLMKAANVDQSRMLQQSICHVRARNWTFSVSWGYSAHVYEKIFPRSHLKR  298

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PIETF+ W    RPP ++F+ R   + DPC  PH FF +S+E+ +  + IV +Y R++ R
Sbjct  299   PIETFRPWIRG-RPPFYMFNTRP-VSRDPCEAPHWFFFDSIEQES--EGIVTSYTRTFPR  354

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMA  1603
              + +C +  G+ SAD ++ I V++P  KP K GR+ ECCDV  +  D  + ++  R C  
Sbjct  355   NMTSC-SFSGNISADPLASIRVFAP--KPPKQGRTVECCDVEYEGSDVANIIL--RDCRR  409

Query  1604  DDIIA  1618
             D+IIA
Sbjct  410   DEIIA  414



>ref|XP_009374954.1| PREDICTED: uncharacterized protein LOC103963820 [Pyrus x bretschneideri]
Length=490

 Score =   413 bits (1061),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 202/428 (47%), Positives = 277/428 (65%), Gaps = 10/428 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S+ PTNLSH+VFG++GS   W  ++ Y+E WWR N T G+L LD+ P  E LPWP SSPP
Sbjct  70    SSPPTNLSHIVFGIVGSMNTWKAKKPYIEVWWRSNVTRGYLFLDRAPTPEFLPWPSSSPP  129

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV+++ +R+        P   R+V  I+ET R+  +     +RW VM DDDT+ LVDNL
Sbjct  130   FRVNEDFTRLKGYPQVRKPVQVRIVRTILETFREGDK----DVRWYVMADDDTVLLVDNL  185

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VL  YDH KY+Y+G +SE + +N  FSF  AFGG G  LS+PL  A+A  +  C++RY
Sbjct  186   VEVLENYDHEKYHYIGMNSECVKSNFDFSFNMAFGGAGYALSYPLMAAVATKLDGCIERY  245

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              ++  +D     C+ADLGV L+  +GFHQID+HGDISG LS HP +P +SLHH D +NPI
Sbjct  246   PYIWVSDFMLQSCLADLGVALTQEKGFHQIDLHGDISGLLSSHPESPFLSLHHLDTINPI  305

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSMN   S  H M +A  D  R+LQQ +C+ RP NWSFS++WGYSA+IYE I+PRS L+
Sbjct  306   FPSMNXXXSINHLMKSAKVDHSRLLQQTICYRRPSNWSFSISWGYSAHIYETIIPRSILR  365

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEE---VTARDEIVATYRR  1414
              P+ETF+ W  + R P ++F+ R   + +PC  PH FF +S+ +   +  R  +  TY R
Sbjct  366   RPLETFRPWVHNARAPLYMFNTR-WPSNNPCEAPHVFFFDSIYQNNTIEGRQTVTTTYSR  424

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRR  1594
             + +RGLP C +  G+ SAD ISKI V S   K  +    +CCD+  +  D  +A +  R 
Sbjct  425   ASQRGLPPC-SSSGNHSADFISKIQVQSLPAKRLEARGIDCCDIVYEP-DINTAQVIYRA  482

Query  1595  CMADDIIA  1618
             CM  +IIA
Sbjct  483   CMEGEIIA  490



>ref|XP_006446152.1| hypothetical protein CICLE_v10017529mg, partial [Citrus clementina]
 gb|ESR59392.1| hypothetical protein CICLE_v10017529mg, partial [Citrus clementina]
Length=410

 Score =   409 bits (1051),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 204/427 (48%), Positives = 276/427 (65%), Gaps = 21/427 (5%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPTNLSH++F L+G  + W +RR Y+E+WWR N + G + LD  P  ELLPWP SSPP+R
Sbjct  1     SPTNLSHIMFVLVGCIRTWKYRRPYIEAWWRENKSRGNIWLDVAPTQELLPWPSSSPPFR  60

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             V++++ ++      VNP   R+   ++ET R    +    +RW VM DDDT+F +DNLV+
Sbjct  61    VNEDIKKLKIYPKLVNPVEVRIYRSVLETFRLEDNK---DVRWFVMADDDTLFFLDNLVE  117

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL +YDHTKYYY+G +SE I +N  FSF   +GG G  LS+ L  A+A  I +C++RY H
Sbjct  118   VLGKYDHTKYYYIGTNSECIKSNYDFSFDMGYGGAGYALSYALVEALASTIDECIERYPH  177

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D  +  C ADLGV+L   +G HQID+ GDISG LS HP +PLI+LHHFD + PIFP
Sbjct  178   LYVSDYLSSSCSADLGVDLIIEKGIHQIDLRGDISGLLSSHPKSPLITLHHFDAIAPIFP  237

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             SMNR E+  H M  A  DQ R+LQQ +C+ R  NW+FS++WGYSA+IYE I PRS L+ P
Sbjct  238   SMNRTEAVNHLMKPAKLDQSRLLQQTICYLRQSNWTFSISWGYSAHIYESIFPRSILRRP  297

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESV----EEVTARDEIVATYRRS  1417
             +ETF+ W    RPP ++F+ R+  + DPC  PH F LE V    E  ++ + I+ TY RS
Sbjct  298   LETFRPWKED-RPPLFMFNTRQ-PSNDPCKAPHVFSLEGVLDRDEGSSSHEHIITTYSRS  355

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
              +R LPAC + +G+ SAD I KI          + GR ECCDV       + A +K R C
Sbjct  356   LQRNLPAC-SSNGNHSADPIVKI----------QAGRIECCDVDY-VAGKDIANVKLRAC  403

Query  1598  MADDIIA  1618
             M  +++A
Sbjct  404   MKSEVLA  410



>ref|XP_009770979.1| PREDICTED: uncharacterized protein LOC104221602 [Nicotiana sylvestris]
Length=477

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 280/440 (64%), Gaps = 15/440 (3%)
 Frame = +2

Query  311   ESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA  490
             +S+    ++    SPTN+SHLVFG+ GS   W +++ Y+ SWW+PN T GFL LD+ P  
Sbjct  49    KSKQYYYNKTSHISPTNISHLVFGIAGSSNTWGNKKWYIHSWWKPNITRGFLFLDRTPN-  107

Query  491   ELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMET--VRDAPQRATGTLRWVV  664
             E LPWP SSPP+++SD+ SR      H  P   RM+  I ET  V  +P      +RW V
Sbjct  108   EHLPWPSSSPPFKISDDNSRYAPYHKHGMPFAIRMLRVIEETFNVEHSPG-----VRWYV  162

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAM  844
             M DDDT+ L+DNLVDVL++YDH KYYY+G +SE + +N   SF+ AFGG G  LS+PLA 
Sbjct  163   MTDDDTVLLIDNLVDVLSKYDHRKYYYVGMNSECLVSNFGMSFQMAFGGAGYALSYPLAQ  222

Query  845   AMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAP  1024
             A+A  +  C+KRY  L  +D     CIADLGV ++   GFHQID+  DISGFLS HP +P
Sbjct  223   AVAKNMDTCIKRYPFLYGSDHILQACIADLGVTITLENGFHQIDLRRDISGFLSAHPQSP  282

Query  1025  LISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSA  1204
              +SLHH D+V PIFP MN  E+  H M AA  DQ R+LQQ  C+ +  NW+FSV+WGYS 
Sbjct  283   FLSLHHLDLVAPIFPLMNHHEAVNHLMTAARVDQSRLLQQSTCYLKKYNWTFSVSWGYSI  342

Query  1205  NIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
             NIYEKI   S+L+ P+ETF  W    RPP ++F+VR+  T D C +PH  F +SVE  T 
Sbjct  343   NIYEKIHSPSFLERPLETFSEWRKGARPP-YMFNVRQ-LTNDSCEIPHVLFFDSVEG-TR  399

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG--RSECCDVTIDS  1558
              + IV  Y +   R +PAC    G+ SAD +SKI V+SP+ K   +   R ECCD+ +  
Sbjct  400   LNHIVTRYIKRTPRAMPAC-GSSGNHSADDVSKIRVFSPMHKLHVVAGNRRECCDI-VQP  457

Query  1559  VDSESAVIKTRRCMADDIIA  1618
             +  +S  IK R CM  +IIA
Sbjct  458   IGMDSMAIKLRTCMKHEIIA  477



>gb|EYU45959.1| hypothetical protein MIMGU_mgv1a005742mg [Erythranthe guttata]
Length=472

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/427 (49%), Positives = 279/427 (65%), Gaps = 13/427 (3%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS-PPYR  529
             PTN+SHL FG+ G+  AW  +R Y++SWW+PN T G +  DK P  + LPWP +S PP+R
Sbjct  53    PTNISHLFFGISGASDAWSSKRHYIQSWWKPNTTRGIIFFDKSP-VQHLPWPSNSLPPFR  111

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             VS++ SR  E   H  P V R +  I ET R   Q   G +RW VM D DT+F+++NLV+
Sbjct  112   VSEDNSRYREYNKHKMPFVIRTLRVIEETFR-VVQNDEGDVRWYVMADHDTVFMINNLVE  170

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L++YDHTKYYY+G +SE I +N  FSF+ AFGG G  LS+PLA A++  +  C+KRY  
Sbjct  171   TLSKYDHTKYYYIGMNSECIVSNIVFSFEMAFGGAGYALSYPLAKALSSNMDLCIKRYPT  230

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             + S+D+    C+ DLGV+L+  +GFHQID H DISGFLS HP++PL+SLHH D V+PIFP
Sbjct  231   MFSSDQILQSCVHDLGVSLTQEKGFHQIDFHRDISGFLSAHPHSPLVSLHHLDAVDPIFP  290

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             S NR ES  H M AA  DQ R+LQQ +C+++  NW+FSV+WGYS  IYE+I+P SYL  P
Sbjct  291   STNRVESVNHLMKAAAVDQSRLLQQTVCYYKKHNWTFSVSWGYSVQIYEEILPPSYLHRP  350

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEE-VTARDEIVATYRRSWRR  1426
             +ETF  W     PP ++F+ R  +   PC  PH FF +SVEE     D IV +Y    RR
Sbjct  351   LETFIPWKKGANPP-YMFNTRAISKDRPCESPHFFFFDSVEEKYRVMDHIVTSYA---RR  406

Query  1427  GLPA-CFA-GDGDQSADRISKIVVYSPVTKPA--KIGRSECCDVTIDSVDSESAVIKTRR  1594
              LP  C +   G +SAD +SKI V SP+ K      GR ECCDV +  V  +S  +K R 
Sbjct  407   SLPGNCNSTAGGSRSADSVSKIRVLSPLGKLGWQGGGRRECCDV-VQMVGMDSLAVKLRD  465

Query  1595  CMADDII  1615
             CM D+++
Sbjct  466   CMNDEMV  472



>ref|XP_009610310.1| PREDICTED: uncharacterized protein LOC104104029 [Nicotiana tomentosiformis]
Length=337

 Score =   404 bits (1038),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 250/346 (72%), Gaps = 10/346 (3%)
 Frame = +2

Query  584   VARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSE  763
             +ARMVHGIME  R+  +     +RWVVMGDDD++F VDN+VDVLAQYDHTKYYYLGG SE
Sbjct  1     MARMVHGIMEVFREEHE----GVRWVVMGDDDSVFFVDNMVDVLAQYDHTKYYYLGGQSE  56

Query  764   FIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVN  943
             ++ +N ++SF QAFGG G +LS+PLA AM+  I  CL+RY  L SAD+ T  CI+D+GVN
Sbjct  57    YLLSNYWYSFNQAFGGAGFILSYPLAKAMSKYIESCLRRYPFLRSADQITMVCISDVGVN  116

Query  944   LSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSD  1123
             L+P +G HQID+ GDISG LS HP APL+SLHH D  +PIFPSM R +S  H M AA  D
Sbjct  117   LTPLKGSHQIDLRGDISGLLSSHPKAPLMSLHHLDAADPIFPSMERLQSVHHLMNAAKFD  176

Query  1124  QPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPR-PPNWI  1300
             Q RMLQQ++C++RP NWSFS++WGYS +IYE I+PRS+LQ PIETFQ WG +P+ PP ++
Sbjct  177   QSRMLQQVICYNRPNNWSFSISWGYSIHIYENILPRSHLQIPIETFQPWGVTPKDPPYYL  236

Query  1301  FDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRIS  1480
              + R   T D C  PH FFLESVE  T ++EI+  + RS  RGLPAC +  G  SAD IS
Sbjct  237   LNTR-LPTNDSCQAPHVFFLESVE--TRKNEILTMFSRSLPRGLPAC-SYSGSHSADDIS  292

Query  1481  KIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             KI VYS   K   + R ECCDVT  S  + +A +K R C  D+IIA
Sbjct  293   KIEVYSSRRKRIDMDRCECCDVTNKS-GTSNAKVKLRECHMDEIIA  337



>ref|XP_008385096.1| PREDICTED: uncharacterized protein LOC103447686 [Malus domestica]
Length=503

 Score =   410 bits (1053),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 205/441 (46%), Positives = 279/441 (63%), Gaps = 23/441 (5%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S+ PTNL H+VFG++GS   W  +R Y+E WWR N T G+L LD+ P  E LPWP SSPP
Sbjct  70    SSPPTNLRHIVFGIVGSMNTWKAKRPYIEVWWRSNVTRGYLFLDRAPTPEFLPWPSSSPP  129

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV++  +R+            R+V  I+ET R+  +     +RW VM DDDT+ LVDNL
Sbjct  130   FRVNEYFTRLKGYPQVRKLVQVRIVRTILETFREGDK----DVRWYVMADDDTVLLVDNL  185

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VL +YDH KY+Y+G +SE + +N  FSF  AFGG G  LS+PL  A+A  +  C++RY
Sbjct  186   VEVLEKYDHEKYHYIGMNSECVKSNFDFSFNMAFGGAGYALSYPLMAAVATKLDGCIERY  245

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              ++  +D     C+ADLGV L+  +GFHQID+HGDISG LS HP  P +SLHH D +NPI
Sbjct  246   PYIWVSDFMLQSCLADLGVALTQEKGFHQIDLHGDISGLLSSHPEFPFLSLHHLDTINPI  305

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSMNR+ES  H M +A  D  R+LQQ +C+HRP NWSFS++WGYSA+IYE I+PRS L+
Sbjct  306   FPSMNRSESINHLMKSAKVDHSRLLQQTICYHRPSNWSFSISWGYSAHIYETIIPRSILR  365

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEE---VTARDEIVATYRR  1414
              P+ETF+ W  + R P ++F+ R   + +PC  PH FF ES+ +   +  R  +  TY R
Sbjct  366   RPLETFRPWVHNARAPLYMFNTR-WPSNNPCEAPHVFFFESIYQNNTIEGRQTVTTTYSR  424

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-------------RSECCDVTID  1555
             + +RGLP C +  G+ SAD ISKI V S   K  ++                +CCD+  +
Sbjct  425   ASQRGLPPC-SSSGNHSADFISKIQVQSLPAKRLEVSFFDSLYCLSFSARGIDCCDIVYE  483

Query  1556  SVDSESAVIKTRRCMADDIIA  1618
               D  +A +  R CM  +IIA
Sbjct  484   P-DINTAQVIYRACMDGEIIA  503



>ref|XP_004293167.1| PREDICTED: uncharacterized protein LOC101293465 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   405 bits (1040),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/412 (47%), Positives = 267/412 (65%), Gaps = 7/412 (2%)
 Frame = +2

Query  383   LLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRVVEE  562
             +LG      H+ AY+E+WWRPN T G+L LD+ P  E LPWP S PP+RV+++V+++   
Sbjct  1     MLGCVNTLKHKTAYIEAWWRPNVTKGYLFLDRAPTPEFLPWPSSYPPFRVNEDVTKLKVY  60

Query  563   TNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYY  742
                 NP   R+V  I+E  R+        +RW VM DDDT+F+VDNLV VLA+YDHTKY+
Sbjct  61    PKIRNPVQVRIVRSILEIFREG----DNDVRWYVMSDDDTVFMVDNLVKVLAKYDHTKYH  116

Query  743   YLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYC  922
             Y+G  SE + +N  FSF  AFGG G +LS+PL   ++  + +C+ RYS+  ++D T   C
Sbjct  117   YIGTSSESVKSNFDFSFDMAFGGAGYILSYPLVAVLSTKLDECIDRYSYSWTSDFTLHEC  176

Query  923   IADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHF  1102
             ++DLGV L+  +G HQID+HGDISG LS HP  P +SLHH D V PIFPSMNR+ES  H 
Sbjct  177   LSDLGVALTQEKGLHQIDLHGDISGLLSSHPQTPFLSLHHIDEVEPIFPSMNRSESINHL  236

Query  1103  MAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSP  1282
             M AA  D  R+LQQ +C+HRP NWSFS++WGYSA+IYE I+PRS L+ PIETF  W  + 
Sbjct  237   MKAAKVDHSRLLQQTVCYHRPSNWSFSISWGYSAHIYENIIPRSTLRRPIETFWPWKRNA  296

Query  1283  RPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQ  1462
             R P ++F+ R     DPC  PH F+L++V++     + V TY R   RGLP C +  G+ 
Sbjct  297   RQPFYMFNTR-WPFNDPCQAPHVFYLDTVDQSVEGSKTVTTYSRVAPRGLPPC-SSSGNH  354

Query  1463  SADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             SAD I+ I VYS +    ++   +CCD+ + + D  +  +  R CM  + +A
Sbjct  355   SADSITNIEVYSTLEISLEVRGMDCCDI-VPAEDMNTTRVMYRSCMDSEFVA  405



>ref|XP_004293168.1| PREDICTED: uncharacterized protein LOC101293755 [Fragaria vesca 
subsp. vesca]
Length=403

 Score =   404 bits (1039),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/414 (48%), Positives = 274/414 (66%), Gaps = 13/414 (3%)
 Frame = +2

Query  383   LLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRVVEE  562
             ++GS K   H+ AY+++WWRPN T G+L LD+ P AE LPWP S PP+RV+D+V+++   
Sbjct  1     MVGSVKTLRHKTAYIKAWWRPNVTRGYLFLDEAPPAEFLPWPSSYPPFRVNDDVTKLKVY  60

Query  563   TNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYY  742
                +NP   R+V  I+E  R   +R  G +RW VM DDDT+F+VDNLV+VLA+YDHTKY+
Sbjct  61    PKILNPIQVRIVRSILEIFR---ERDKG-VRWYVMSDDDTVFVVDNLVEVLAKYDHTKYH  116

Query  743   YLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYC  922
             Y+G  SEF+ +N+ FSF  AFGG G +LS+PL  A++  + DC+ RYS+   +D T   C
Sbjct  117   YIGTRSEFVKSNSDFSFDMAFGGAGYILSYPLVAALSTKLDDCIDRYSYSWFSDLTLHEC  176

Query  923   IADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHF  1102
             + DLGV L+   G HQID+ GD+SG LS HP +P +S+HH D VNPIFPSMNR+ES  H 
Sbjct  177   LTDLGVTLTQENGLHQIDLRGDVSGLLSAHPQSPFLSIHHLDTVNPIFPSMNRSESINHL  236

Query  1103  MAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSP  1282
             M AA  D  R+LQQ +C+HRP NWSFS++WGYSA+IYE I+PRS L+ P+ETF  W  + 
Sbjct  237   MKAAKVDPSRLLQQTICYHRPSNWSFSISWGYSAHIYESILPRSTLRKPLETFSRWRNAS  296

Query  1283  RPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT--ARDEIVATYRRSWRRGLPACFAGDG  1456
             + P ++F+ R   + +PC  PH F+ +SV       +   V TY R   RGL +C +  G
Sbjct  297   Q-PFYMFNTR-LPSKNPCQAPHVFYFDSVHHRVDGGKRRTVTTYSRVAPRGLRSC-SSTG  353

Query  1457  DQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             + SAD I+KI VYS      ++G  +CCD+    V + +  +  R CM  ++IA
Sbjct  354   NHSADSITKIEVYSSPEVRLEMGGKDCCDI----VHANNTRVIYRSCMKGEVIA  403



>ref|XP_002280577.1| PREDICTED: uncharacterized protein LOC100244977 [Vitis vinifera]
 emb|CBI16081.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   407 bits (1046),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 203/426 (48%), Positives = 275/426 (65%), Gaps = 11/426 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             ++SPTNLS LVFG+  S   W  +R Y+++WWRPN T G+L L++ P    LPWP S PP
Sbjct  89    TDSPTNLSDLVFGIAASVNTWRTKRIYIDAWWRPNITRGYLFLERTP-TNFLPWPSSFPP  147

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RVS+++SR      H  P   RMV  I ET R+        +RW VM DDDT+  +DNL
Sbjct  148   FRVSEDISRYQPYNKHRMPHAIRMVRVIAETYREE----NKGVRWYVMADDDTVLFIDNL  203

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VLA+YDH KY+Y+G +SE + +N   SF+ AFGG G  LS+PLA A+A  +  C+KRY
Sbjct  204   VEVLARYDHRKYFYIGMNSECVTSNIDHSFEMAFGGAGYALSYPLAEALARNLDVCIKRY  263

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+ADLGV+L+  +GFHQID+HGD+SG LS HP +P +SLHH D+ +P+
Sbjct  264   PTLYGSDHILQSCVADLGVSLTHEKGFHQIDLHGDLSGLLSAHPQSPFLSLHHLDVTDPL  323

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+R ES    M AA  DQ R+LQQ +C+H+P NWSFS++WGYS  IYE I P S L+
Sbjct  324   FPSMDRNESVVRLMKAAKVDQSRLLQQTICYHKPYNWSFSISWGYSTQIYENIYPPSVLE  383

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P++TF  W     PP ++F+ R  + T PC  PH FF ES E++   ++IV TY R + 
Sbjct  384   RPLQTFVPWKRIRMPP-YMFNTRFPSRT-PCEAPHVFFFESAEKIKG-EQIVTTYIRKFP  440

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRRCM  1600
             R LP C    G+ SAD ISK+ V+SP+ +    G R ECCD+ +       + +K R CM
Sbjct  441   RLLPPC-PSSGNHSADYISKVKVFSPLRRLHGTGNRRECCDI-VRVAKMNFSEVKYRACM  498

Query  1601  ADDIIA  1618
              D+I+ 
Sbjct  499   QDEIVG  504



>ref|XP_009621834.1| PREDICTED: uncharacterized protein LOC104113386 [Nicotiana tomentosiformis]
Length=429

 Score =   400 bits (1027),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 281/440 (64%), Gaps = 17/440 (4%)
 Frame = +2

Query  305   DNESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPP  484
             DN  R   +  N  +SPTN+SHLVFG+  S K W  R +YVESWWRPN T GF+ L+  P
Sbjct  3     DNLMR--FKGDNQDDSPTNVSHLVFGITSSSKTWKDRISYVESWWRPNVTRGFVFLENFP  60

Query  485   GAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVV  664
               ELL WP S PP+++S+N SR      H  P+  RM   + ET +   + A    RW +
Sbjct  61    -RELLSWPSSCPPFKISENTSRYKMYDKHPIPQTIRMARVVAETFKMENKSA----RWYI  115

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYF-SFKQAFGGGGIVLSFPLA  841
             M DDDTIF +DNLV+VL++YDH KY+Y+G +SE  HA+N+  SF  AFGGGG V S+ L 
Sbjct  116   MADDDTIFFLDNLVEVLSKYDHRKYFYVGMNSE-THASNFVHSFNMAFGGGGYVFSYALV  174

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
              AM D +  C+KRY      D+    C+ADLGV+L+  +GFHQ+D+HGDISGFLS HP +
Sbjct  175   EAMVDNLDICIKRYPTYYGGDRILQSCVADLGVSLTRQKGFHQMDLHGDISGFLSAHPQS  234

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAAN-SDQPRMLQQLLCFHRPRNWSFSVAWGY  1198
             PL+SLHH D V+PIFP MN+++S  H M  A   D+ R+LQQ +C+++P+NW+FS++WGY
Sbjct  235   PLVSLHHLDFVDPIFPLMNKSQSLNHLMKVAKLGDESRILQQSICYYKPKNWTFSISWGY  294

Query  1199  SANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEV  1378
             S  IYE I P S +  P++TF  W    +P  W     +  + +PC  PH  F ES++++
Sbjct  295   SIQIYESIFPPSLITIPLQTFIPWSKLFKP--WFVFNTRLPSNNPCEAPHLLFFESMQKM  352

Query  1379  TARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTID  1555
               ++ ++  Y R + R LP C +  G+ SA+ IS+I V SP+ K   +G R ECCDV ++
Sbjct  353   --KNHLLTNYTRKYPRKLPPC-SFSGNHSANHISEIHVLSPMKKLDSVGSRRECCDV-VN  408

Query  1556  SVDSESAVIKTRRCMADDII  1615
               ++    IK R CM D+II
Sbjct  409   KAETNVTEIKLRDCMQDEII  428



>ref|XP_004139115.1| PREDICTED: uncharacterized protein LOC101213989 [Cucumis sativus]
 gb|KGN66496.1| hypothetical protein Csa_1G615150 [Cucumis sativus]
Length=493

 Score =   402 bits (1032),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 271/425 (64%), Gaps = 9/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             ++ PTN SH++F ++GS   W ++R Y ESWWRPN T G + LD+ P AE LPW  SS P
Sbjct  78    TDPPTNASHIMFSIVGSMNTWKYKRYYSESWWRPNVTRGHVFLDRSPSAEFLPWSDSSAP  137

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV++++           P   R+   +ME+ R+  +      RW VM DDDTI  VDNL
Sbjct  138   FRVNEDIRGFAVYPRIKWPDQVRIFRTVMESFREGDKDT----RWFVMTDDDTIIFVDNL  193

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V  L +YDH K++Y+G +SE + +N  FSF  AFGG G  LS+PLA  +A  +  C++RY
Sbjct  194   VKTLGKYDHKKHWYIGMNSECVKSNFDFSFDMAFGGAGYALSYPLAALVAKRLDGCIERY  253

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              HL  +D+   +C++DLG  ++   GFHQID+ GD SG+LSYHP  PL+SLHH D++NPI
Sbjct  254   PHLRVSDQMLFFCLSDLGFTITHEIGFHQIDLRGDASGYLSYHPQTPLLSLHHIDLINPI  313

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             +P+M+R  + RH M A   DQ R+LQQ +C+HRP NW+FS++WGYSA+IYE IM R+YL+
Sbjct  314   YPNMDRPAAIRHLMKAGAVDQSRLLQQTICYHRPLNWTFSMSWGYSAHIYEAIMSRNYLK  373

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P+ETF  +  +   P ++F+ R     +PC  PH  F ES+E     D IV TY R W 
Sbjct  374   RPLETFAPFERT-HAPVFMFNTRWGVLDNPCEAPHVLFFESIER-DGEDRIVTTYLRKWA  431

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             R LP+C A  G+ SA+ ISKI V+S    P + G +ECCDV +  +D+    +  R C +
Sbjct  432   RNLPSC-ASSGNHSAESISKIRVFSSAKIPLEAGGAECCDVRM--LDANVTEVNYRPCYS  488

Query  1604  DDIIA  1618
              +++A
Sbjct  489   GEVMA  493



>emb|CAN65210.1| hypothetical protein VITISV_043548 [Vitis vinifera]
Length=631

 Score =   405 bits (1042),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/426 (48%), Positives = 276/426 (65%), Gaps = 11/426 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             ++SPTNLS LVFG+  S   W  +R Y+++WWRPN T G+L L++ P    LPWP S PP
Sbjct  216   TDSPTNLSDLVFGIAASVNTWRTKRIYIDAWWRPNITRGYLFLERTP-TNFLPWPSSFPP  274

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RVS+++SR      H  P   RMV  I ET R+  +     +RW VM DDDT+  +DNL
Sbjct  275   FRVSEDISRYQPYNKHRMPHAIRMVRVIAETYREENK----GVRWYVMADDDTVLFIDNL  330

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VLA+YDH KY+Y+G +SE + +N   SF+ AFGG G  LS+PLA A+A  +  C+KRY
Sbjct  331   VEVLARYDHRKYFYIGMNSECVTSNIDHSFEMAFGGAGYALSYPLAEALARNLDVCIKRY  390

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+ADLGV+L+  +GFHQID+HGD+SG LS HP +P +SLHH D+ +P+
Sbjct  391   PTLYGSDHILQSCVADLGVSLTHEKGFHQIDLHGDLSGLLSAHPQSPFLSLHHLDVTDPL  450

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSM+R ES    M AA  DQ R+LQQ +C+H+P NWSFS++WGYS  IYE I P S L+
Sbjct  451   FPSMDRNESVVRLMKAAKVDQSRLLQQTICYHKPYNWSFSISWGYSTQIYENIYPPSVLE  510

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P++TF  W     PP ++F+ R  + T PC  PH FF ES E++   ++IV TY R + 
Sbjct  511   RPLQTFVPWKRIRMPP-YMFNTRFPSRT-PCEAPHVFFFESAEKIKG-EQIVTTYIRKFP  567

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRRCM  1600
             R LP C    G+ SAD ISK+ V+SP+ +    G R ECCD+ +       + +K R CM
Sbjct  568   RLLPPC-PSSGNHSADYISKVKVFSPLRRLHGTGNRRECCDI-VRVAKMNFSEVKYRACM  625

Query  1601  ADDIIA  1618
              D+I+ 
Sbjct  626   QDEIVG  631



>ref|XP_004154681.1| PREDICTED: uncharacterized LOC101213989 [Cucumis sativus]
Length=493

 Score =   400 bits (1029),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 270/425 (64%), Gaps = 9/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             ++ PTN SH++F ++GS   W ++R Y ESWWRPN T G + LD+ P AE LPW  SS P
Sbjct  78    TDPPTNASHIMFSIVGSMNTWKYKRYYSESWWRPNVTRGHVFLDRSPSAEFLPWSDSSAP  137

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV++++           P   R+   +ME+ R+  +      RW VM DDDTI  VDNL
Sbjct  138   FRVNEDIRGFAVYPRIKWPDQVRIFRTVMESFREGDKDT----RWFVMTDDDTIIFVDNL  193

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V  L +YDH K++Y+G +SE + +N  FSF  AFGG G  LS+PLA  +A  +  C++RY
Sbjct  194   VKTLGKYDHKKHWYIGMNSECVKSNFDFSFDMAFGGAGYALSYPLAALVAKRLDGCIERY  253

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              HL  +D+   +C++DLG  ++   GFHQID+ GD SG+LSYHP  PL+SLHH D++NPI
Sbjct  254   PHLRVSDQMLFFCLSDLGFTITHEMGFHQIDLRGDASGYLSYHPQTPLLSLHHIDLINPI  313

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             +P+M+R  + RH M A   DQ R+LQQ +C+HRP NW+FS++WGYSA+IYE IM R+YL+
Sbjct  314   YPNMDRPAAIRHLMKAGAVDQSRLLQQTICYHRPLNWTFSMSWGYSAHIYEAIMSRNYLK  373

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P+ETF  +  +   P ++F+ R     +PC  PH  F ES+E     D IV TY R W 
Sbjct  374   RPLETFAPFERT-HAPVFMFNTRWGVLDNPCEAPHVLFFESIER-DGEDRIVTTYLRKWA  431

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             R LP C A  G+ SA+ ISKI V+S    P + G +ECCDV +  +D+    +  R C +
Sbjct  432   RNLPPC-AFSGNHSAESISKIRVFSSAKIPLEAGGAECCDVRM--LDANVTEVNYRPCYS  488

Query  1604  DDIIA  1618
              +++A
Sbjct  489   GEVMA  493



>gb|KDO61213.1| hypothetical protein CISIN_1g039639mg [Citrus sinensis]
Length=412

 Score =   397 bits (1019),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/419 (48%), Positives = 269/419 (64%), Gaps = 11/419 (3%)
 Frame = +2

Query  374   VFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRV  553
             +F L+G  + W +RR Y+E+WWR N T G + LD  P  ELLPWP SSPP+RV++++ ++
Sbjct  1     MFVLVGCIRTWKYRRPYIEAWWRENKTRGNIWLDVAPTQELLPWPSSSPPFRVNEDIKKL  60

Query  554   VEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHT  733
                   VNP   R+   ++ET R    +    + W VM DDDT+F +DNLV+VL +YDHT
Sbjct  61    KIYPKLVNPVEVRIYRSVLETFRLEDNK---DVWWFVMADDDTLFFLDNLVEVLGKYDHT  117

Query  734   KYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTT  913
             KYYY+G +SE I +N  FSF   +GG G  LS+ L  A+A  I +C++RY HL  +D  +
Sbjct  118   KYYYIGTNSECIKSNYDFSFDMGYGGAGYALSYALVEALASTIDECIERYPHLYVSDYLS  177

Query  914   GYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESA  1093
               C ADLGV+L   +G HQID+ GDISG LS HP + LI+LHHFD ++PIFPSMNR E+ 
Sbjct  178   SSCSADLGVDLIIEKGIHQIDLRGDISGLLSSHPKSSLITLHHFDAIDPIFPSMNRTEAV  237

Query  1094  RHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWG  1273
              H M  A  DQ R+LQQ + + R  NW+FS++WGYSA+IYE I PRS L+ P+ETF+ W 
Sbjct  238   NHLMKPAKLDQSRLLQQTIFYLRRSNWTFSISWGYSAHIYESIFPRSILRRPLETFRPWK  297

Query  1274  PSPRPPNWIFDVRKRTTTDPCLVPHAFFLESV----EEVTARDEIVATYRRSWRRGLPAC  1441
                RP  ++F+ R R + DPC  PH F LE V    E  ++ + I+ TY RS +R LPAC
Sbjct  298   EDRRPL-FMFNTR-RPSNDPCKAPHVFSLEGVLDRDEGSSSHEHIITTYSRSLQRNLPAC  355

Query  1442  FAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
              + +G+ SAD I KI V+SP T   + GR ECCDV       + A IK R CM  ++ A
Sbjct  356   -SSNGNHSADPIVKIQVFSPSTGRKEAGRIECCDVDY-VAGKDIANIKLRACMKSEVSA  412



>ref|XP_010317971.1| PREDICTED: uncharacterized protein LOC104646356 [Solanum lycopersicum]
Length=496

 Score =   399 bits (1026),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 275/431 (64%), Gaps = 12/431 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N +N  TN+SHLVFG+  S   W  ++ Y+ SWW+PN T G+L LD+ P  E LPWP  S
Sbjct  74    NSNNIKTNISHLVFGIAASSNTWGKKKHYINSWWKPNITKGYLFLDRTPNDEHLPWPNIS  133

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYR+S + SR +    H  P   RMV  I ET  +  +  + T+RW VM DDDT+ +++
Sbjct  134   PPYRISSDNSRYMPYNKHGMPFAIRMVRVIEETFME--EHDSSTVRWYVMADDDTVLMIE  191

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV+VL++YDH KYYY+G +SE I +N   SF+ AFGG G  LS+PLA A+A  +  C+K
Sbjct  192   NLVNVLSKYDHMKYYYVGMNSECIVSNFGMSFQMAFGGAGYALSYPLAQALAKNMDTCIK  251

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY +L  +D     CIADLGV ++  +GFHQID+  DISGFLS HP +P ISLHH D+V+
Sbjct  252   RYPYLYGSDHILQACIADLGVTITLEKGFHQIDLRRDISGFLSAHPQSPFISLHHLDLVS  311

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFPSMN  ++  H M AA+ DQ R+LQQ +C+++  NW+FSV+WGYS  IY+KI+P+SY
Sbjct  312   PIFPSMNHYDALNHLMKAASVDQSRLLQQSVCYNKIHNWTFSVSWGYSVQIYDKIIPQSY  371

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPC-LVPHAFFLESVEEVTARDEIVATYRR  1414
             LQ PIETF  W     PP ++F++RK      C  VP+  F +S E  T  +  V TY +
Sbjct  372   LQTPIETFGEWRKGAWPP-YMFNIRKFNNYSSCGEVPNILFFDSFEG-TKLNHFVTTYVK  429

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG---RSECCDVTIDSVDSESAVIK  1585
                R        D D S++ + K+ V+SP+ K   +G   R ECCD+ I  +  +S  IK
Sbjct  430   KNHR--ICANNDDDDHSSNGVMKVHVFSPMDK-LHVGDGNRKECCDI-IQPIGMDSMAIK  485

Query  1586  TRRCMADDIIA  1618
              R CM  +IIA
Sbjct  486   LRTCMKHEIIA  496



>emb|CDP09106.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   400 bits (1027),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 287/439 (65%), Gaps = 14/439 (3%)
 Frame = +2

Query  320   SELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL  499
             S   S   +NS T++SH+VFG+  +  +W ++R ++ESWWRPN T GF+ LD  P  +L+
Sbjct  79    SSYSSGTGTNSATSISHIVFGIASTSNSWRNKRWFIESWWRPNVTRGFVFLDTFP-VDLI  137

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             PWP SSPP+R+S+N SR  +   H      R+   I E + +  Q     +RW V+ DDD
Sbjct  138   PWPASSPPFRISENTSRYKDYDKHEMTHAIRLARIIREIINEEDQNDED-VRWYVIADDD  196

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYF-SFKQAFGGGGIVLSFPLAMAMAD  856
             T+  ++NLV+VL++YD+ KY+Y+G +SE  HA+NYF SF+ AFGG G  LS+PLA A+A 
Sbjct  197   TVIFINNLVEVLSRYDYNKYFYVGMNSE-CHASNYFHSFEMAFGGAGYALSYPLARALAK  255

Query  857   GIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISL  1036
              +  C++RY  L  +D     C+ADLGV+L+  +GFHQID+H DISG LS HP +PL+SL
Sbjct  256   NLDVCIRRYPSLYGSDHIVQSCVADLGVSLTQEKGFHQIDLHSDISGLLSAHPQSPLVSL  315

Query  1037  HHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE  1216
             HH  +V+PIFPSM R +S  H M AAN+D+ R+LQQ +C+H+  NWSFS++WGYSA +YE
Sbjct  316   HHLKVVDPIFPSMTRNQSLNHLMKAANADESRLLQQTICYHKQNNWSFSISWGYSAQVYE  375

Query  1217  KIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT---AR  1387
              I P S L+ P++TF+ W  +   P +I + R  +T DPC +PH FF  SVE +T    R
Sbjct  376   AIYPPSILRLPLQTFRPWMFA--KPFYILNTRIPSTKDPCQIPHVFFFYSVETITDIIGR  433

Query  1388  DEIVA-TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAK-IG-RSECCDVTIDS  1558
               ++A TY R   R LPAC +  G+ SA  I+ I V SPV +    +G R ECC+V  +S
Sbjct  434   QHLIATTYTRRRPRFLPAC-SSTGNHSAAHINMIRVLSPVLEMHDGVGRRRECCEVEYES  492

Query  1559  VDSESAVIKTRRCMADDII  1615
               S +  ++ R C+ D+II
Sbjct  493   -RSNTTKVQIRACVEDEII  510



>gb|KHG05582.1| Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 
1 [Gossypium arboreum]
Length=475

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 271/429 (63%), Gaps = 7/429 (2%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S    N PTN+SH+ F L+G  K W  RR Y E+WWRPN T G + +D PP  E LPWP 
Sbjct  54    STETVNYPTNISHIKFVLVGCTKTWLTRRPYTEAWWRPNQTRGNIFMDSPPPKEFLPWPK  113

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             +SPP++++ + +++       NP  AR+   ++++      +    +RW VM DDDT+F 
Sbjct  114   TSPPFQLNTDATKLPVYPKLANPIEARIFRSVLDSFSLGDNQG---VRWFVMADDDTVFF  170

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV VLA+YDHTK YY+G HSE + +N  F+F  A+GG G  LS+ L   +A  + DC
Sbjct  171   IDNLVQVLAKYDHTKQYYVGMHSESVISNFLFAFDMAYGGAGYALSYSLVEQLAPLMNDC  230

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             L+RY  ++++D  T  C+ DLGV L+  +G HQID+ GDISG +S HP AP+++LHHFD 
Sbjct  231   LERYPFMHTSDHLTSSCLFDLGVALTLERGIHQIDLLGDISGMISAHPQAPIVTLHHFDN  290

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             ++PIFP+ NR E+ +H M AA  DQ R+ QQ +C+ +P NWS SV+WGYS +IYE I+PR
Sbjct  291   IDPIFPNRNRTEAVKHLMKAAEIDQSRLAQQTICYDKPMNWSVSVSWGYSVHIYESIIPR  350

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
             S L+ P+ETF+ W   P PP ++F+ R   T DPC  PH FF+E + ++     ++ TYR
Sbjct  351   SILKKPLETFKPWKNGP-PPLYMFNTR-LLTNDPCHTPHVFFMEYIRKLKGNSVVLTTYR  408

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             R  RR L  CF   G+ SAD I ++ V+S  T   + G+ +CC+V +         IK R
Sbjct  409   RKARRQLQPCFV-PGNYSADNILRVRVFSNATLRKEAGKIDCCNV-LHMAGMNVMNIKLR  466

Query  1592  RCMADDIIA  1618
              C   ++IA
Sbjct  467   NCRKGEVIA  475



>emb|CDY53961.1| BnaA10g29930D [Brassica napus]
Length=480

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 276/426 (65%), Gaps = 12/426 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
               + TNLSHL+F L+GS + W  R+ Y+ SWWRPN T G +  D  P  E  PW P+ PP
Sbjct  66    KEAATNLSHLMFVLVGSSRTWRDRKVYLGSWWRPNVTRGNIFFDVEPSEEFQPWSPALPP  125

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
              +V++++ ++       N    R+   I+E  R    +    +RW V GDDD++F VDN+
Sbjct  126   LKVNEDLKKLKIYPKLTNRNHTRIYRSILENYR---LKQDEDVRWYVTGDDDSVFFVDNM  182

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VDVL++YDHT+ +Y+G  SE I +N +FSF  AFGGGG  LS+PL  A+ + + +C++RY
Sbjct  183   VDVLSKYDHTEKHYIGMFSETIKSNFHFSFDMAFGGGGYALSYPLVKALVEELDNCIERY  242

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              ++ + D     C+ADLGV+LS  +GFHQ+D++GDISGFLS  P APL+SLHHF+ V P+
Sbjct  243   HYIWAVDHLQSLCLADLGVDLSLEKGFHQMDLYGDISGFLSSQPTAPLVSLHHFETVTPL  302

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP M+R  S  H M AAN DQ RMLQQ +C  R  NW+FSV+WGYS +IYEKI PRSYL+
Sbjct  303   FPGMDRPGSVNHIMKAANVDQSRMLQQSICHVRACNWTFSVSWGYSVHIYEKIFPRSYLK  362

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PIETF+ W    RPP ++F+ R   + DPC  PH FF  S+E+   ++ +V +Y+R + 
Sbjct  363   LPIETFRPWWHGGRPPFYMFNTRP-VSRDPCEAPHWFFFVSIEQ--EKEGVVTSYKRKFP  419

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDVTIDSVDSESAVIKTRRCM  1600
             R + +CF   G+ SAD ++ I V+SP T KP K  + ECCDV  +  +   A ++ R C 
Sbjct  420   RNMASCFFS-GNTSADPLTTIRVFSPKTPKPGK--KVECCDVEYEGAN--VAYMRLRDCR  474

Query  1601  ADDIIA  1618
               +IIA
Sbjct  475   RHEIIA  480



>ref|XP_010536095.1| PREDICTED: uncharacterized protein LOC104811176 [Tarenaya hassleriana]
Length=477

 Score =   396 bits (1018),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 280/427 (66%), Gaps = 16/427 (4%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D  +PTN+SHL+F L+GS  AW +R+ Y+ESWWRPN T G + LD  P  E  PW P+ P
Sbjct  66    DETAPTNISHLMFVLVGSSGAWKNRKTYIESWWRPNVTRGNIFLDVEPSEEFRPWSPTFP  125

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             P++V++++ ++       NP   R+   I+ET R   +R  G +RW VMGDDD++F VDN
Sbjct  126   PFQVNEDIRKLKIFPKLANPIHIRIYRSILETYRL--KRDEG-VRWYVMGDDDSLFFVDN  182

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             +VDVL++YDHTK  Y+G +SE I +N  FSF+ A+GGGG  LS+PL  A+A  + +C++R
Sbjct  183   IVDVLSKYDHTKRQYIGMYSETIRSNFAFSFEMAYGGGGYALSYPLVEALATKLDECVER  242

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  + + D+    C+ADLGVN  P +GFHQ+D+HGD+SG LS HP APL+SLHHFD++ P
Sbjct  243   YHFIWAGDQLQSACLADLGVNFIPEKGFHQMDVHGDLSGLLSSHPTAPLLSLHHFDVLTP  302

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             + P      S  H M AA+ DQ R+LQQ +C  RP NW+FSV+WGYSA++YE I PRS+L
Sbjct  303   LRPG-----SVVHLMKAADVDQSRILQQSICHVRPMNWTFSVSWGYSAHVYENIFPRSHL  357

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
               PIETF+ W  + RPP ++F+ R   + DPC  PH FF +S+E       ++ +Y R +
Sbjct  358   MRPIETFRPWI-NGRPPVFMFNTRP-VSQDPCEAPHWFFFDSIENKPEETRVITSYARKF  415

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSP-VTKPAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
              R LP C +  G+ SAD I+ I V+SP + K A+  R ECCDV         A I+ R C
Sbjct  416   PRNLPPC-SFTGNISADPIATIRVFSPKIGKEAR--RVECCDVEYGG--KGVAEIRMRDC  470

Query  1598  MADDIIA  1618
               D++IA
Sbjct  471   GTDEVIA  477



>ref|XP_009121842.1| PREDICTED: uncharacterized protein LOC103846635 [Brassica rapa]
Length=468

 Score =   396 bits (1017),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 283/435 (65%), Gaps = 21/435 (5%)
 Frame = +2

Query  329   ESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWP  508
             E      + TNLSHL+F L+GS  AW HRR Y+ESWWRPN T G + +D  P  E  PW 
Sbjct  50    EETGPKETTTNLSHLMFVLVGSSSAWKHRRTYIESWWRPNVTRGNIFMDVEPSEEFRPWS  109

Query  509   PSSPPYRVSDNVSRVVEETNHVNPRVARMVH-----GIMETVRDAPQRATGTLRWVVMGD  673
             P+ PP++V++++ ++      + P++A  VH      I+ET R   Q+  G +RW VMGD
Sbjct  110   PTFPPFKVNEDLRKL-----SIYPKLANQVHIRIYRSILETYR--LQQDDG-VRWYVMGD  161

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DD++F VDN+VDVL++YDHT+  Y+G  SE   +N   +F+ A+GGGG  LS+PL  A+ 
Sbjct  162   DDSLFFVDNIVDVLSKYDHTEKRYIGMFSESTKSNFRLAFEMAYGGGGYALSYPLVEALV  221

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               + +C+++Y  + + DK   YC+ADLG +L P +GFHQ+D+ GD+SG LS HP APL+S
Sbjct  222   AKLDECIEKYHFIWAGDKLQSYCLADLGADLIPEKGFHQMDLRGDLSGLLSSHPTAPLLS  281

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHHFD V P+FP MNR  S    M AAN DQ RMLQQ +C+ R  NW+FSV+WGYSA++Y
Sbjct  282   LHHFDAVAPLFPGMNRHGSVLQIMKAANVDQSRMLQQSICYVRASNWTFSVSWGYSAHVY  341

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
             E I PRSYL+ PIETF+ W      P ++F+ R R + +PC  PH FF +S+E+V     
Sbjct  342   ENIFPRSYLKLPIETFRPWLRG-WFPFYMFNTR-RVSRNPCEAPHWFFFDSIEQVDG--G  397

Query  1394  IVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSES  1573
             +V +Y R + R + +C +   D SAD ++ I V+SP+T P +  + ECCDV  +  D   
Sbjct  398   VVTSYTRKFIRNMTSC-SFSCDISADPLASIRVFSPIT-PKEGRKVECCDVEYEGAD--V  453

Query  1574  AVIKTRRCMADDIIA  1618
             A I+ R C +D+II+
Sbjct  454   ANIRLRDCRSDEIIS  468



>ref|XP_008227352.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103326878 
[Prunus mume]
Length=443

 Score =   394 bits (1013),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/422 (47%), Positives = 274/422 (65%), Gaps = 14/422 (3%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTNL+H+V G++GS   W  ++A+ E+WW+PN    +L LD+ P  E LPWP S+PP+RV
Sbjct  36    PTNLNHIVVGIVGSMNTWKKKKAHTEAWWKPNX---YLFLDRAPTLEFLPWPSSAPPFRV  92

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S++++        V P   R++  I+ET R+  +     +RW VM D  TI  VDNLV+V
Sbjct  93    SEDITGFEVYPKIVRPNQVRIIRTILETFREGDK----DVRWYVMAD--TILFVDNLVEV  146

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             LA+YDHT+YYY+G  SE I +N  FSF  AFGGGG  LS+PL   +A  + +C++RY +L
Sbjct  147   LAKYDHTEYYYIGSSSECIKSNFDFSFDMAFGGGGYALSYPLVATLATKLDECIERYPYL  206

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+ADLGV L+  +GFHQID+ GDISG LS H  +PL+SLHH D ++ IFP 
Sbjct  207   RVSDFMLHSCLADLGVALTQEKGFHQIDLRGDISGLLSSHHTSPLLSLHHIDTIDAIFPF  266

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R+ES  H M  A  D  R+LQQ++C+HRP NWSFSV+WGYSA+IY+ I+P S L+ P+
Sbjct  267   MSRSESINHLMRPAKVDPSRLLQQIICYHRPSNWSFSVSWGYSAHIYDNIIPLSILRRPL  326

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  + RPP ++F+ R  T  DPC  PH F  +S++E    D+ V TY R+  RGL
Sbjct  327   ETFRPWK-NTRPPFYMFNTR-LTYNDPCQAPHLFSFDSIDENVKGDQTVTTYSRTAARGL  384

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P C +  G+ SAD I+KI V  P  +    G+ +CCD+      + + VI  R CM  +I
Sbjct  385   PPC-SSSGNHSADFITKIQVTLPAIRLEARGK-DCCDIAYAPNINTTQVIY-RACMEGEI  441

Query  1613  IA  1618
             IA
Sbjct  442   IA  443



>ref|XP_006348567.1| PREDICTED: uncharacterized protein LOC102583406 [Solanum tuberosum]
Length=435

 Score =   394 bits (1011),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/426 (48%), Positives = 273/426 (64%), Gaps = 15/426 (4%)
 Frame = +2

Query  359   NLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSD  538
             N  HLVFG+  S   W  ++ Y+ SWW+PN T G+L LD+ P  E LPWP SSPPYR+S 
Sbjct  19    NTGHLVFGIAASSNTWGTKKCYINSWWKPNITKGYLFLDRTPNDEHLPWPNSSPPYRISS  78

Query  539   NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLA  718
             + SR +    H  P   RMV  I ET  +  +  + T+RW VM DDDT+F+++NLV+VL+
Sbjct  79    DNSRYMPYNKHGMPFAIRMVRVIQETFME--EHDSSTVRWYVMADDDTVFMIENLVNVLS  136

Query  719   QYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNS  898
             +YDH KYYY+G +SE I +N   SF+ AFGGGG  LS+PLA A+A  +  C+KRY +L  
Sbjct  137   KYDHMKYYYVGMNSECIVSNFGMSFQMAFGGGGYALSYPLAQALAKNMDTCIKRYPYLYG  196

Query  899   ADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMN  1078
             +D     CIADLGV ++  +GFHQID+  DISGFLS HP +P ISLHH D+V+PIFPSMN
Sbjct  197   SDHILQACIADLGVTITLEKGFHQIDLRRDISGFLSAHPQSPFISLHHLDLVSPIFPSMN  256

Query  1079  RAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIET  1258
               ++  H M AA+ DQ R+LQQ  C+++  NW+FSV+WGYS  IY+KI+ +SYLQ PIET
Sbjct  257   HYDALNHLMKAASVDQSRLLQQSTCYNKRHNWTFSVSWGYSVQIYDKIISQSYLQTPIET  316

Query  1259  FQTWGPSPRPPNWIFDVRKRTTTDPCL---VPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             F  W     PP ++F+VRK    +      VP+  F +S+E  T  + IV TY +   R 
Sbjct  317   FGEWRKGAWPP-YMFNVRKFNNNNNFSCDEVPNILFFDSLEG-TRLNHIVTTYVKKNHR-  373

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIG---RSECCDVTIDSVDSESAVIKTRRCM  1600
                C   D D S++ + K+ V+SP+ K   +G   R ECCD+ I  +  +S  IK R CM
Sbjct  374   --ICANNDDDHSSNGVMKVHVFSPMHK-LHVGDGNRGECCDI-IQPIGMDSMAIKLRTCM  429

Query  1601  ADDIIA  1618
               +IIA
Sbjct  430   KHEIIA  435



>emb|CDP09105.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   397 bits (1020),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 209/425 (49%), Positives = 272/425 (64%), Gaps = 11/425 (3%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             NSPT +S +VFG+ G  K W ++R YVESWWRPN T G+L LD  P     PWP SSPP+
Sbjct  114   NSPTKISDIVFGIAGLSKTWGYKRWYVESWWRPNTTRGYLFLDTAPTRHF-PWPRSSPPF  172

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             RVS+++S+  +   H  P   R++  I E  R   + A    RW VMGDDDT+FL++NLV
Sbjct  173   RVSEDISKYDKYYKHGRPFFIRILRVIEEIFRVESEGA----RWYVMGDDDTVFLIENLV  228

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             +VL++YDH KY+Y+G  SE + +N   SF+ AFGG G  LS+PLA A+   +  C+KRYS
Sbjct  229   EVLSRYDHRKYFYIGMPSECVISNFVNSFEMAFGGAGYALSYPLAKAVVKNMDVCIKRYS  288

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
                ++D     CIADLGV L+  +GFHQID+H DISGFLS  P+ PL++LHH D ++PIF
Sbjct  289   TAFASDFIMHSCIADLGVPLTRERGFHQIDLHRDISGFLSALPHTPLLTLHHIDAIDPIF  348

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             PSMNR ES  H M AA  DQ R+LQQ +C+ +  NW+FSV+WGYS  IYE I+P S L  
Sbjct  349   PSMNRPESVAHLMKAAKVDQSRLLQQSVCYFKRSNWTFSVSWGYSVQIYEDIIPPSILHK  408

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PI TF  W     PP ++F+ R   +T+PC  PHA F   VEE  A +  V +Y +  +R
Sbjct  409   PIATFIPWKKGANPP-YMFNARP-PSTNPCEAPHALFFGGVEEARA-NHFVTSYTQRSQR  465

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRRCMA  1603
             GL  C +  G+ SA+ ISKI V SP+ K    G R ECCDV +      S  IK R CM 
Sbjct  466   GLGTC-SSSGNHSAEFISKIYVLSPMEKLEWDGSRRECCDV-VQLAGMNSRGIKLRTCMK  523

Query  1604  DDIIA  1618
             D+I+A
Sbjct  524   DEIVA  528



>ref|XP_008450413.1| PREDICTED: uncharacterized protein LOC103492025 [Cucumis melo]
Length=493

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 270/425 (64%), Gaps = 9/425 (2%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             ++ PTN SH++F ++GS   W ++R Y ESWWRPN T G +  ++PP AE LPW  SS P
Sbjct  78    TDPPTNASHIMFSIVGSMNTWKYKRYYSESWWRPNVTRGHVFFERPPSAEFLPWSDSSAP  137

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV+++++          P   R+   +ME+ R+  +      RW VM DDDTI  VDNL
Sbjct  138   FRVNEDITGFAVYPRIKWPDQVRIFRTVMESFREGNKDT----RWFVMTDDDTIIFVDNL  193

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V  L +YDH K++Y+G +SE + +N  FSF  AFGG G  LS+PLA  +A  +  C++RY
Sbjct  194   VKTLRKYDHNKHWYIGMNSECVKSNFDFSFDMAFGGAGYALSYPLAALVAKRLDGCIERY  253

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              +L  +D+   +C++DLG  ++   GFHQID+ GD SG+LSYHP  PL+SLHH D++NPI
Sbjct  254   PYLRVSDQMLFFCLSDLGFTITHEMGFHQIDLRGDASGYLSYHPQTPLLSLHHIDLINPI  313

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             +P+M+R  + RH M A   DQ R+LQQ +C+HRP NW+FS++WGYSA+IYE IM R+YL+
Sbjct  314   YPNMDRPAAIRHLMKAGAVDQSRLLQQTICYHRPLNWTFSMSWGYSAHIYEAIMARNYLK  373

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P+ETF  +  +   P ++F+ R     +PC  PH  + ES+E     D IV TY R W 
Sbjct  374   RPLETFAPFERT-HAPVFMFNTRWGVLDNPCEAPHVLYFESIER-DGEDRIVTTYLRKWA  431

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             R LP C A  G+ SA+ ISKI V+S    P + G +ECCDV +  +D     +  R C +
Sbjct  432   RNLPPC-AFYGNHSAESISKIRVFSSAKLPLEAGGAECCDVRM--LDVNVTEVNYRPCYS  488

Query  1604  DDIIA  1618
              +++A
Sbjct  489   GEVMA  493



>ref|XP_009121840.1| PREDICTED: uncharacterized protein LOC103846632 [Brassica rapa]
Length=503

 Score =   394 bits (1012),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 275/426 (65%), Gaps = 12/426 (3%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
               + TNLSHL+F L+GS + W  R+ Y+ SWWRPN T G +  D  P  E  PW P+ PP
Sbjct  89    KEAATNLSHLMFVLVGSSRTWRDRKVYLGSWWRPNVTRGNIFFDVEPSEEFQPWSPALPP  148

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
              +V++++ ++       N    R+   I+E  R    +    +RW V GDDD++F VDN+
Sbjct  149   LKVNEDLKKLKIYPKLTNRNHTRIYRSILENYR---LKQDEDVRWYVTGDDDSVFFVDNM  205

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VDVL++YDHT+ +Y+G  SE I +N +FSF  AFGGGG  LS+PL  A+ + + +C++RY
Sbjct  206   VDVLSKYDHTEKHYIGMFSETIKSNFHFSFDMAFGGGGYALSYPLVKALVEELDNCIERY  265

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              ++ + D     C+ADLGV+LS  +GFHQ+D++GDISGFLS  P APL+SLHHF+ V P+
Sbjct  266   HYIWAVDHLQSLCLADLGVDLSLEKGFHQMDLYGDISGFLSSQPTAPLVSLHHFETVTPL  325

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP M+R  S  H M AAN DQ RMLQQ +C  R  NW+FSV+WGYS +IYEKI PR YL+
Sbjct  326   FPGMDRPGSVNHIMKAANVDQSRMLQQSICHVRACNWTFSVSWGYSVHIYEKIFPRGYLK  385

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              PIETF+ W    RPP ++F+ R   + DPC  PH FF  S+E+   ++ +V +Y+R + 
Sbjct  386   LPIETFRPWWHGGRPPFYMFNTRP-VSRDPCEAPHWFFFVSIEQ--EKEGVVTSYKRKFP  442

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDVTIDSVDSESAVIKTRRCM  1600
             R + +CF   G+ SAD ++ I V+SP T KP +  + ECCDV  +  +   A ++ R C 
Sbjct  443   RNMASCFFS-GNTSADPLTTIRVFSPKTPKPGR--KVECCDVEYEGAN--VAYMRLRDCR  497

Query  1601  ADDIIA  1618
               +IIA
Sbjct  498   RHEIIA  503



>ref|XP_009121839.1| PREDICTED: uncharacterized protein LOC103846631 [Brassica rapa]
Length=468

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 271/424 (64%), Gaps = 13/424 (3%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
              + TNLSHL+F ++GS + W  RR YVESWWRPN T G +  D  P  ELLPW P+ PP+
Sbjct  58    ETATNLSHLMFVVVGSPRTWKKRRNYVESWWRPNVTRGNIFFDVEPSKELLPWSPTFPPF  117

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             RVS+NV ++        P   R    I+ET R   +     +RW V GDDD++F VDNLV
Sbjct  118   RVSENVKKLRFYPKLRKPSHTRFYRAILETYRLMDE----GVRWYVTGDDDSLFFVDNLV  173

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             DVL++YDHT+ +Y+G +SE I +N YF F   FGG G  LS+ L  A+   + +C+++Y 
Sbjct  174   DVLSKYDHTRQHYIGTNSETIKSNAYFGFNMGFGGAGYALSYALVEALVVKLDECVEKYH  233

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
              + + D     C+ADLGV+L+  +GFHQ+D+ GDISG LS H  APL+SLHHF  V+P+F
Sbjct  234   FIWAVDMIQSLCLADLGVDLTLEKGFHQMDLFGDISGLLSSHTTAPLLSLHHFATVSPLF  293

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             P M+R  S  H M  AN DQ RMLQQ +C  R  NW+FSV+WGYS +IYEKI PRSYL+ 
Sbjct  294   PGMDRPGSVLHIMKPANVDQSRMLQQSICHVRACNWTFSVSWGYSVHIYEKIFPRSYLKL  353

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PIETF+ W    RPP ++F+ R   + DPC  PH FF +S+E+    D +V +Y R + R
Sbjct  354   PIETFRPWYRG-RPPVFMFNTRP-VSRDPCEAPHWFFFDSIEK--ENDGVVTSYTRKFIR  409

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMAD  1606
              + +C +  G+ SAD I+ I V+SP T P +  + ECCDV     + + A ++ R C  D
Sbjct  410   NMTSC-SFSGNISADPIASIRVFSPKT-PRQGRKVECCDV---EYEGDVATMRLRDCRRD  464

Query  1607  DIIA  1618
             +IIA
Sbjct  465   EIIA  468



>ref|XP_004289025.1| PREDICTED: uncharacterized protein LOC101302208 [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   388 bits (996),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 177/343 (52%), Positives = 240/343 (70%), Gaps = 5/343 (1%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
             S+ PTNLSH+V G++GS   W  ++AYVE+WWRPN T G+L LD+ P  + LPWP S PP
Sbjct  72    SHPPTNLSHIVIGIVGSMNTWQQKKAYVEAWWRPNVTRGYLFLDRAPIKQFLPWPSSFPP  131

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             +RV++N++        V+P   R+V  I+E  R++ +     +RW VM DDDT+ +VDNL
Sbjct  132   FRVNENITGFKVYPKIVSPVQVRIVRTILEMFRESDK----DVRWYVMADDDTVLVVDNL  187

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VLA+YDHTKY+Y+G  SE + +N+ FSF  AF G G  LS+PL  A+A  + +C++RY
Sbjct  188   VEVLAKYDHTKYHYIGTSSECVRSNSDFSFDMAFRGAGYALSYPLVAALATKLDECIERY  247

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              +L  +D     C+ DLGV L+  +GFHQID+HGDISG LS HP +P +SLHH D ++PI
Sbjct  248   PYLGFSDLMLHECLTDLGVALTQEKGFHQIDLHGDISGLLSSHPQSPFLSLHHLDTIDPI  307

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FPSMNR+ES  H M A   D  R+LQQ +C+HRP NWS S++WGYSA+IYE I+PRS LQ
Sbjct  308   FPSMNRSESINHLMKAVTVDPSRLLQQTICYHRPSNWSVSISWGYSAHIYENIIPRSSLQ  367

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE  1372
              PIETF  W  S R P ++F+ R+R + DPC  PH F+ +S+E
Sbjct  368   RPIETFWPWQRSARVPFYMFNTRRR-SKDPCQAPHVFYFDSIE  409



>ref|XP_006399762.1| hypothetical protein EUTSA_v10015782mg [Eutrema salsugineum]
 gb|ESQ41215.1| hypothetical protein EUTSA_v10015782mg [Eutrema salsugineum]
Length=404

 Score =   385 bits (989),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 195/415 (47%), Positives = 266/415 (64%), Gaps = 11/415 (3%)
 Frame = +2

Query  374   VFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRV  553
             +F L+GS + W  RR YVESWWRPN T G + LD  P  E +PW P+ PPY+V++++ ++
Sbjct  1     MFVLVGSSRTWQDRRIYVESWWRPNLTRGNIFLDVEPSKEFMPWSPTFPPYQVNEDLKKL  60

Query  554   VEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHT  733
                    NP   R+   I+E  R    +    +RW + GDDDT+F VDN+VDVL++YDHT
Sbjct  61    RIYPKLPNPIHTRIYRSILENYR---LKQDDGVRWYLTGDDDTLFFVDNIVDVLSKYDHT  117

Query  734   KYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTT  913
             K +Y+G  SE I +N Y SF  AFGGGG  LS+PL  A+   + +C++RY  +   D   
Sbjct  118   KKHYIGMFSETIKSNFYISFDMAFGGGGYALSYPLVEALVAKLDECVERYHFIWGVDHLQ  177

Query  914   GYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESA  1093
               C+AD GV+LS  +GFHQ+D+ GD+SGFLS H NAPL+S HH  +V P+FP M+R  S 
Sbjct  178   SLCLADFGVDLSLEKGFHQMDLRGDVSGFLSSHSNAPLVSFHHLGVVAPLFPGMDRNGSV  237

Query  1094  RHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWG  1273
              H M A N DQ RMLQQ +C  R R+W+FSV+WGYSA++YE+I PRSYL+ PIETF+ W 
Sbjct  238   LHIMKAVNVDQSRMLQQSICHVRARHWTFSVSWGYSAHVYERIFPRSYLKRPIETFRPWL  297

Query  1274  PSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGD  1453
                RPP ++F+ R   + DPC  PH FF +S E+    +EIV +Y R + R + +C+   
Sbjct  298   RG-RPPFYMFNTRP-VSRDPCEAPHWFFFDSSEQ--ENEEIVTSYTRKFPRNMNSCYFS-  352

Query  1454  GDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             G  SAD ++ I V+SP T P +  + ECCDV  +  D   A I+ R C  D+IIA
Sbjct  353   GTISADPLASIRVFSPKT-PKQGRKVECCDVEYEGAD--VANIRLRDCRRDEIIA  404



>ref|XP_007015100.1| Uncharacterized protein TCM_040746 [Theobroma cacao]
 gb|EOY32719.1| Uncharacterized protein TCM_040746 [Theobroma cacao]
Length=689

 Score =   394 bits (1013),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/419 (46%), Positives = 270/419 (64%), Gaps = 8/419 (2%)
 Frame = +2

Query  362   LSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDN  541
             +SH  F L+G  K+W HR+ Y+E+WWRPN T+G + LD PP  E  PW  SSPPY+V+++
Sbjct  279   ISHSRFVLVGCLKSWKHRKPYIEAWWRPNETMGNIFLDSPPTKEFQPWSSSSPPYQVNED  338

Query  542   VSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQ  721
             ++++       NP   R+   I++T R    +    +RW VM DDDT+F VDNLV+VLA+
Sbjct  339   IAKLRTYPILANPVQVRIYRSILDTFRLGDNK---NVRWYVMADDDTLFFVDNLVEVLAK  395

Query  722   YDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSA  901
             YDHTKYYY+G +SE + +N  FSF   +GG G  LS+ L  A+A  + +C++RY H   +
Sbjct  396   YDHTKYYYIGTNSESVKSNYDFSFDMGYGGAGYALSYSLVEALASVMDNCIERYPHFYVS  455

Query  902   DKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNR  1081
             D  +  C ADLGV L+  +G HQID+ GDISG LS HP + LI+LHHFD +N IFPS NR
Sbjct  456   DHLSSSCSADLGVGLTIGKGIHQIDVVGDISGLLSSHPQSSLITLHHFDNINSIFPSKNR  515

Query  1082  AESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETF  1261
             ++S  H M AA  DQ R+LQQ +C+HRP NWS S++WGYSA+IYE I+PRS L+ P+ETF
Sbjct  516   SDSINHLMEAAKIDQSRLLQQTICYHRPTNWSLSISWGYSAHIYENIIPRSVLRKPLETF  575

Query  1262  QTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPAC  1441
               W    RPP ++F+ R   + DPC  PH FF++S++++   + ++ TY  +  R L  C
Sbjct  576   APWKKG-RPPFYMFNTRP-PSNDPCEAPHVFFMDSIKKM-ENNLVLTTYNLTSPRNLQPC  632

Query  1442  FAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
              +  G+ SAD I+KI V+   T   + GR ECC+V         A I  R C+  +IIA
Sbjct  633   -SSSGNHSADSITKIQVFLQATTRKEAGRIECCEVKY-VTGMNVADINLRGCLKGEIIA  689


 Score =   116 bits (291),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = +2

Query  806   GGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHG  985
             GG G  LS+ L   +A  + DCL+RY  ++++D  +  C++DLG+ L+     HQID+ G
Sbjct  126   GGAGYALSYSLVEGLAPLMDDCLERYPFMHTSDYLSFLCLSDLGIGLTVESSIHQIDLLG  185

Query  986   DISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRML----QQLLC  1153
             DISG LS HP +P+++LHHFD ++P+FPS N  ES  H M AA  DQ R++       LC
Sbjct  186   DISGILSSHPQSPIVTLHHFDNIDPLFPSKNCTESINHLMEAAKVDQSRLVLFFFYTFLC  245

Query  1154  FH  1159
              H
Sbjct  246   SH  247



>ref|XP_010492011.1| PREDICTED: uncharacterized protein LOC104769490 [Camelina sativa]
Length=506

 Score =   387 bits (993),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 273/424 (64%), Gaps = 17/424 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPT L+HL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+ 
Sbjct  99    SPTKLTHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGYVFLERPPGRDLLPWPNQSPPFS  158

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             V+ + S     TN    ++      + +++ ++ ++A+   RW V+ DDDT+F +DNLV+
Sbjct  159   VNKDSSI----TNKFKTQIR-----LFQSLHESFKKASKETRWFVIADDDTLFFLDNLVE  209

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  FSF   +GGGG  LS+P  + + + + +C++RY  
Sbjct  210   ALDRYDHKKHYYIGMNSENVWSNAVFSFDMGYGGGGYALSYPTVVTLLNKMEECIRRYLG  269

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
               S D  +  C+ADLG++L+  +G HQIDMHGDISG LS HP  P+ISLHHFD+++PIFP
Sbjct  270   FYS-DLLSFRCLADLGIDLTLEKGMHQIDMHGDISGLLSAHPQCPVISLHHFDVIDPIFP  328

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P
Sbjct  329   GMNRQQSVNHLMKTAKTDQSRVLQQTICYQRGNNWSVSVSWGYSVHIYQSIFPRNHLKRP  388

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             +ETF+ W  S R P++ F+ R R T DPC +PH FF +SV E   +  +   Y+    R 
Sbjct  389   LETFRPW-TSVRIPSYTFNTR-RVTNDPCEMPHQFFFDSVVEDKNQSVVTTIYKMKMARS  446

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMAD  1606
             LP C   +G+ SA  IS++ V +      K+G   ECCDV  +   +E   +K R C  D
Sbjct  447   LPPCVL-NGNHSARNISQVRVIAATMH--KMGEGIECCDVQ-NVNSTEILEVKIRACHKD  502

Query  1607  DIIA  1618
             +++A
Sbjct  503   EVLA  506



>ref|XP_010453326.1| PREDICTED: uncharacterized protein LOC104735268 [Camelina sativa]
Length=491

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 270/424 (64%), Gaps = 16/424 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPT LSHL F ++GS K W +RR Y+E WWRPN T GF+ L++PPG +LLPWP  SPP+ 
Sbjct  83    SPTKLSHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGFVFLERPPGRDLLPWPNQSPPFS  142

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             V+ + S     TN       R+   + E+ +    +A+   RW V+ DDDT+F +DNLV+
Sbjct  143   VNKDSS----ITNQFKTHQIRLFQSLHESFK----KASKDTRWFVIADDDTLFFLDNLVE  194

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  FSF   +GGGG  LS+P  + + + + +C++RY  
Sbjct  195   ALDRYDHKKHYYIGMNSENVWSNAVFSFDMGYGGGGYALSYPTVVTLLNKMEECIRRYLG  254

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
               S D  +  C+ADLG++L+  +G HQID+HGD+SG LS HP  PLISLHHFD+++PIFP
Sbjct  255   FYS-DLLSFRCLADLGIDLTLEKGMHQIDLHGDVSGLLSAHPQCPLISLHHFDVIDPIFP  313

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P
Sbjct  314   GMNRQQSVNHLMKTAKTDQSRVLQQTICYQRGNNWSVSVSWGYSVHIYQSIFPRNHLKRP  373

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             +ETF+ W  + R P++ F+ R R T DPC +P  FF +SV E   +  +  +Y+    R 
Sbjct  374   LETFRPW-KNVRTPSYTFNTR-RVTNDPCEMPRQFFFDSVVEDKNQSMVTTSYKMKMARS  431

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMAD  1606
             LP C   +G+ SA  IS++ V +      K+G   ECC+V   +  +E   +K R C  D
Sbjct  432   LPPCLL-NGNHSARNISQVRVIAATIH--KMGEGIECCNVQYVN-STEILEVKIRACHKD  487

Query  1607  DIIA  1618
             +++A
Sbjct  488   EVLA  491



>ref|XP_010686162.1| PREDICTED: uncharacterized protein LOC104900444 [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score =   384 bits (987),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 271/433 (63%), Gaps = 15/433 (3%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D+N PTN+SH+V G+  S K+W  R++Y+ESWW+PN T G++ LD  P     PWP SSP
Sbjct  67    DTNDPTNISHIVIGIASSIKSWKSRKSYIESWWQPNVTKGYVFLDGEP-TYYRPWPSSSP  125

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PYR+ +N         H      RMV  I+E  R+A       +RW VM DDDTIF +DN
Sbjct  126   PYRIYENTDIYKPYDRHPMKSAIRMVRVIVEIFREA--HNDQGIRWFVMADDDTIFFLDN  183

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             L+++L +YDH KYYY+G +SE + +N   SF+ AFGG G  +S+PLA  +   +  C+KR
Sbjct  184   LMEMLQKYDHKKYYYIGENSECVLSNFANSFEMAFGGAGYAISYPLAEVLVKNMDVCIKR  243

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y ++  +D     CIADLGV+L+  +GFHQID+H D+SG+LS HP  P++SLHH D V+P
Sbjct  244   YPYVYGSDHLMQSCIADLGVSLTHEKGFHQIDLHRDLSGYLSSHPQTPILSLHHLDTVDP  303

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP+M+R+E+  H M AA  DQ R+LQQ +C+   +N SFSVAWGY+A IYEKI+P S L
Sbjct  304   IFPNMSRSEALNHLMKAATEDQSRLLQQTICYDNTKNLSFSVAWGYTAQIYEKIIPPSVL  363

Query  1241  QNPIETFQTWG-PSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             + P+ETF  W   +P+ P ++F+ R   + +PC +PH FF +SVE +T  +EI+  Y R 
Sbjct  364   KKPLETFSAWSFRAPKQP-FMFNTR-WLSKNPCDMPHVFFFQSVERITENNEIITNYTRR  421

Query  1418  WRRGLPACFAGDGDQS------ADRISKIVVYSPVTK-PAKI-GRSECCDVTIDSVDSES  1573
               R +  C +             D I+ I+V SP TK  A++  R ECC V +  V+   
Sbjct  422   TTRNMLHCSSSSSSNGNFSSSLTDDIATIIVVSPATKYSAQVETRRECCHV-LHQVEKNV  480

Query  1574  AVIKTRRCMADDI  1612
               I  R C+ ++I
Sbjct  481   TTINYRTCVKNEI  493



>ref|XP_009121841.1| PREDICTED: uncharacterized protein LOC103846634 [Brassica rapa]
Length=479

 Score =   382 bits (981),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 274/431 (64%), Gaps = 23/431 (5%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
               + TNLSHL+F L+G    W  R+ YVESWWRPN T G++ LD  P  E  PW  + PP
Sbjct  66    KETATNLSHLMFVLVGGSSTWRDRKVYVESWWRPNKTRGYIFLDVEPSEEFQPWSGALPP  125

Query  524   YRVSDNVSRVVEETNHVNPRVARMVH-----GIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              +V++ + ++      + PR+   +H      I+E  R    +    +RW V GDDD++F
Sbjct  126   LKVNEYLKKL-----KICPRLRNRIHTRIYRSILENYR---LKQDEDVRWYVTGDDDSVF  177

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
              VDN+VDVL++YDH + +Y+G  SE I +N YFSF  AFGGGG  LS+PL  A+ + + +
Sbjct  178   FVDNMVDVLSKYDHREKHYIGMFSETIKSNFYFSFDMAFGGGGYALSYPLVEALVEELDN  237

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             C++RY ++   D     C+ADLGV+LS  +GFHQ+D+ GD+SGFLS HP APL+S HHF 
Sbjct  238   CIERYYYIWGVDHLQSMCLADLGVDLSLDKGFHQLDLRGDLSGFLSSHPTAPLVSFHHFG  297

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
              + PIFPSM+   S RH M AAN DQ R++QQ +C  R  +W+FSV+WGYS +IYEKI  
Sbjct  298   SLEPIFPSMDHPGSVRHIMKAANVDQTRIVQQSICHVRATSWTFSVSWGYSVHIYEKIFA  357

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
             RSYL+ PIETF+ W    RPP ++F+ R R + +PC  PH FF +S+E+    D +V +Y
Sbjct  358   RSYLKRPIETFRPWLRG-RPPLYMFNTR-RVSRNPCEAPHWFFFDSIEQ--ENDGVVTSY  413

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDVTIDSVDSESAVIK  1585
              R + R + +C +  G+ SAD ++ I V+SP T KP +  + ECCDV  +  D   A I+
Sbjct  414   TRKFPRNMTSC-SFFGNTSADPLASIRVFSPKTPKPGR--KVECCDVGYEGAD--VANIR  468

Query  1586  TRRCMADDIIA  1618
              R C   +IIA
Sbjct  469   LRDCRRHEIIA  479



>emb|CDX97200.1| BnaC09g44250D [Brassica napus]
Length=480

 Score =   382 bits (981),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/424 (46%), Positives = 271/424 (64%), Gaps = 13/424 (3%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             + TNLSHL+F L+G  + W  R+ YVESWWRPN T G +  D  P  E  PW    PP +
Sbjct  69    TATNLSHLMFVLVGGSRTWRDRKVYVESWWRPNVTRGNIFFDVEPSKEFQPWSRDLPPLK  128

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             V++++ ++       N    R+   I+E  R    +    +RW V GDDD++F VDN+VD
Sbjct  129   VNEDLKKLKIYPKLRNRIHTRIYRSILENYR---LKQDQDVRWYVTGDDDSVFFVDNMVD  185

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDH + +Y+G  SE I +N YFSF  AFGGGG  LS+PL  A+ + + +C++RY +
Sbjct  186   VLSKYDHKEKHYIGMFSETIKSNFYFSFDMAFGGGGYALSYPLVEALVEELDNCIERYYY  245

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             +   D     C+ADLGV+LS  +GFHQ+D+ GD+SGFLS HP APL+S HHF  + PIFP
Sbjct  246   IWGVDHLQSMCLADLGVDLSLDKGFHQLDLRGDLSGFLSSHPTAPLVSFHHFGSLEPIFP  305

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             SM+   S RH M AAN DQ RM+QQ +C  R  +W+FSV+WGYS +IYEKI PRSYL+ P
Sbjct  306   SMDHPGSVRHIMKAANVDQTRMVQQSICHVRATSWTFSVSWGYSVHIYEKIFPRSYLKRP  365

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             IETF+ W    RPP ++F+ R   + +PC  PH FF +S+E+    D +V++Y R + R 
Sbjct  366   IETFRPW-LGGRPPLYMFNTRP-VSRNPCEAPHWFFFDSIEQ--GNDGVVSSYTRKFPRN  421

Query  1430  LPACFAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDVTIDSVDSESAVIKTRRCMAD  1606
             + +C +  G+ SAD ++ I V+SP T KP +  + ECCDV  +  D   A I+ R C   
Sbjct  422   MTSC-SFFGNTSADPLASIRVFSPKTPKPGR--KVECCDVGYEGAD--VANIRLRDCRRH  476

Query  1607  DIIA  1618
             +II+
Sbjct  477   EIIS  480



>emb|CDY53962.1| BnaA10g29940D [Brassica napus]
Length=479

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 192/428 (45%), Positives = 273/428 (64%), Gaps = 17/428 (4%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPP  523
               + TNLSHL+F L+G    W  R+ YVESWWRPN T G++  D  P  E  PW  + PP
Sbjct  66    KETATNLSHLMFVLVGGSSTWRDRKVYVESWWRPNKTRGYIFFDVEPSEEFQPWSRALPP  125

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIM--ETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
              +V++++ ++      + PR+   +H  +    + +   +    +RW V GDDD++F VD
Sbjct  126   LKVNEDLKKL-----KIYPRLRNRIHTRIYRSILENYMLKQDEDVRWYVTGDDDSVFFVD  180

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             N+VDVL++YDH + +Y+G  SE I +N YFSF  AFGGGG  LS+PL  A+ + + +C++
Sbjct  181   NMVDVLSKYDHREKHYIGMFSETIKSNFYFSFDMAFGGGGYALSYPLVEALVEELDNCIE  240

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY ++   D     C+ADLGV+LS  +GFHQ+D+ GD+SGFLS HP APL+S HHF  + 
Sbjct  241   RYYYIWGVDHLQSMCLADLGVDLSLDKGFHQLDLRGDLSGFLSSHPTAPLVSFHHFGSLE  300

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFPSM+   S RH M AAN DQ R++QQ +C  R  +W+FSV+WGYS +IYEKI  RSY
Sbjct  301   PIFPSMDHPGSVRHIMKAANVDQTRIVQQSICHVRATSWTFSVSWGYSVHIYEKIFARSY  360

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ PIETF+ W    RPP ++F+ R R + +PC  PH FF +S+E+    D +V +Y R 
Sbjct  361   LKRPIETFRPWLRG-RPPLYMFNTR-RVSRNPCEAPHWFFFDSIEQ--ENDGVVTSYTRK  416

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDVTIDSVDSESAVIKTRR  1594
             + R + +C +  G+ SAD ++ I V+SP T KP +  + ECCDV  +  D   A I+ R 
Sbjct  417   FPRNMTSC-SFFGNTSADPLASIRVFSPKTPKPGR--KVECCDVGYEGAD--VANIRLRD  471

Query  1595  CMADDIIA  1618
             C   +IIA
Sbjct  472   CRRHEIIA  479



>ref|XP_006399764.1| hypothetical protein EUTSA_v10013507mg [Eutrema salsugineum]
 gb|ESQ41217.1| hypothetical protein EUTSA_v10013507mg [Eutrema salsugineum]
Length=454

 Score =   379 bits (974),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 182/422 (43%), Positives = 270/422 (64%), Gaps = 14/422 (3%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+ HL+F ++GS + W +RR Y+E WWRPN T G + L++PPG  LLPWP  SPP+ V
Sbjct  47    PTNIRHLLFVIVGSTRTWRYRRGYIEPWWRPNITKGHVFLERPPGRNLLPWPQQSPPFSV  106

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             + ++          N +    +  + ++++++ ++A+   RW V+ DDDT+F +DNLV+ 
Sbjct  107   NKDIFIA-------NTKFKTQIR-LFQSLQESFKKASKETRWFVVADDDTLFFLDNLVEA  158

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L +YDH K+YY+G +SE I +N  F+F   +GGGG  LS+P    + + + DC+ RY  +
Sbjct  159   LDRYDHKKHYYIGMNSENIWSNAIFAFDMGYGGGGYALSYPTVETLLNKMEDCIGRYLGV  218

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
              S D  +  C+ADLG++L+  +G HQID+HGDISG LS HP +PLISLHHFD+++PIFP+
Sbjct  219   YS-DLLSFRCLADLGIDLTLEKGMHQIDLHGDISGLLSAHPQSPLISLHHFDVIDPIFPA  277

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P+
Sbjct  278   MNRQQSVNHLMKTAKTDQSRILQQTICYQRAYNWSVSVSWGYSVHIYQSIFPRNHLKRPL  337

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             +TF+ W  + + P + F+ R R T DPC +P  FF +SV E   +  +  TY+    R L
Sbjct  338   QTFRPWK-NVKTPLYTFNTR-RVTNDPCEMPRQFFFDSVVEHMNQSLVTTTYKVKMARSL  395

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P CF  +G+ SA  IS++ V +        G  ECCDV  +   +E   +K R C  D+I
Sbjct  396   PPCF-DNGNHSARNISQVRVIAATIHKMGDG-IECCDVQ-NVNSTEILEVKIRACHKDEI  452

Query  1613  IA  1618
             +A
Sbjct  453   LA  454



>ref|XP_006286708.1| hypothetical protein CARUB_v10002857mg [Capsella rubella]
 gb|EOA19606.1| hypothetical protein CARUB_v10002857mg [Capsella rubella]
Length=442

 Score =   377 bits (969),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/425 (44%), Positives = 275/425 (65%), Gaps = 19/425 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPT++SHL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+ 
Sbjct  35    SPTDISHLFFVIVGSTKTWRYRRGYIEPWWRPNITTGYVFLERPPGRDLLPWPNQSPPF-  93

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
                +V++    TN    ++      + +++ ++ ++A+   RW V+ DDDT+F +DNLV+
Sbjct  94    ---SVNKESFITNKFKTQIR-----LFQSLHESFKKASKETRWFVIADDDTLFFLDNLVE  145

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  F+F   +GGGG  LS+P  + + + + +C+ RY  
Sbjct  146   ALDRYDHKKHYYIGMNSENVWSNAIFAFDMGYGGGGYALSYPTVVTLLNKMEECIGRYLG  205

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             + S D  +  C+ADLG++L+  +G HQID+HGDISG LS HP  PLISLHHFD+++PIFP
Sbjct  206   VYS-DLLSFRCLADLGIDLTLEKGIHQIDLHGDISGLLSAHPQCPLISLHHFDVIDPIFP  264

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P
Sbjct  265   GMNRQQSVNHLMKTAQTDQSRVLQQTICYQRGNNWSVSVSWGYSVHIYQSIFPRNHLKRP  324

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             +ETF+ W    R P++ F+ R R T DPC +P  FF +++ E   +  +   Y+    R 
Sbjct  325   LETFRPWK-DVRIPSYTFNTR-RVTNDPCEMPRQFFFDTIVEDKNQSMVTTMYKMRPARR  382

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDS-ESAVIKTRRCMA  1603
             LP C   +G+ SA  IS++ V +      K+G   ECCDV   SVDS E+  +K R C  
Sbjct  383   LPPCLL-NGNHSARNISEVRVIAATMH--KMGEGIECCDV--QSVDSTETLEVKIRACHK  437

Query  1604  DDIIA  1618
             D+++A
Sbjct  438   DEVLA  442



>ref|XP_010256826.1| PREDICTED: uncharacterized protein LOC104597116 [Nelumbo nucifera]
Length=471

 Score =   376 bits (965),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/422 (46%), Positives = 269/422 (64%), Gaps = 11/422 (3%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
              +PT++SH+VFG+ GS   W  RR Y+E+WWRPN T G++ L++ P  +  PW PSSPP+
Sbjct  57    TTPTDISHIVFGIAGSASTWRSRRNYIEAWWRPNVTRGYVWLERFP-TDYFPWSPSSPPF  115

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             RVS++  R  +   H      RMV  I+ET R+  +     +RW VM DDDT+ ++DNLV
Sbjct  116   RVSEDTGRFKDYDRHGMRFAIRMVRVILETFREDHE----DVRWYVMADDDTVLVIDNLV  171

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
              +L+ YDH  Y Y+G  SE   AN   S++ AFGG G  LS+PLA A+   + +C+KRY 
Sbjct  172   KLLSTYDHNNYLYIGHSSECTSANALNSYEMAFGGAGYALSYPLAKAVVSHLDECVKRYP  231

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
              L  +D     CI++LG++L+  +GFHQID+ GDISGFLS HP  P ISLHH D+V PIF
Sbjct  232   TLFGSDHILQSCISELGISLTHERGFHQIDLRGDISGFLSAHPQVPFISLHHLDVVEPIF  291

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             PSM+R +S RH M AA +D  R+LQQ +C+ +  +WS S++WGYSA+IYE+I   S LQ 
Sbjct  292   PSMDRYQSLRHLMKAAEADSSRLLQQTICYDKNNSWSLSISWGYSAHIYERIQYPSILQM  351

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PIETF+ +    RP  ++F+ R   +  PC  PH FF +SV   +A  E + TY R   R
Sbjct  352   PIETFKPFSSWARPA-FVFNTRP-PSRHPCEAPHVFFFQSVVPASA-TEFLTTYTRRSPR  408

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRRCMA  1603
              LP C + +G+ SADRIS++ V+S   +   IG R ECCD   +S  + S V + R CM 
Sbjct  409   WLPPC-SSNGNHSADRISEVRVFSSAKRLDWIGTRRECCDFVGNSGMNVSEV-RIRTCME  466

Query  1604  DD  1609
             ++
Sbjct  467   NE  468



>ref|XP_010419838.1| PREDICTED: uncharacterized protein LOC104705520 [Camelina sativa]
Length=510

 Score =   377 bits (968),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 182/424 (43%), Positives = 271/424 (64%), Gaps = 17/424 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPT LSHL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+ 
Sbjct  103   SPTKLSHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGYVFLERPPGRDLLPWPNQSPPFS  162

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
              + + S     TN    ++      + +++ ++ ++A+   RW V+ DDDT+F +DNLV+
Sbjct  163   FNKDSSI----TNQFKTQIR-----LFQSLHESFKKASKETRWFVIADDDTLFFLDNLVE  213

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  FSF   +GGGG  LS+P  + + + + +C++RY  
Sbjct  214   ALDRYDHKKHYYIGMNSENVWSNAVFSFDMGYGGGGYALSYPTVVTLLNKMEECIRRYLG  273

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
               S D  +  C+ADLG++L+  +G HQID+ GDISG LS HP  P+ISLHHFD+++PIFP
Sbjct  274   FYS-DLLSFRCLADLGIDLTLEKGMHQIDLLGDISGLLSAHPQCPVISLHHFDVIDPIFP  332

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P
Sbjct  333   GMNRQQSVNHLMKTAKTDQSRVLQQTICYQRGNNWSVSVSWGYSVHIYQSIFPRNHLKRP  392

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             +ETF+ W  + R P++ F+ R R T DPC +P  FF +SV E   +  +   Y+    R 
Sbjct  393   LETFRPW-KNVRTPSYTFNTR-RVTNDPCEMPRQFFFDSVVEDKNQSVVTTIYKMKMARS  450

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMAD  1606
             LP C   +G+ SA  IS++ V +      K+G   ECCDV  +  ++E   +K R C  +
Sbjct  451   LPPCVL-NGNHSARNISQVRVIAATIH--KMGEGIECCDVQ-NVNNTEILEVKIRACHKN  506

Query  1607  DIIA  1618
             +++A
Sbjct  507   EVLA  510



>ref|XP_009593893.1| PREDICTED: uncharacterized protein LOC104090492 [Nicotiana tomentosiformis]
Length=838

 Score =   386 bits (991),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 267/420 (64%), Gaps = 18/420 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP-SSPPY  526
             SPTN+SHLVFG+ GS   W  ++ Y+ SWW+PN T G++ LD+ P  E LPWP  SSPP+
Sbjct  81    SPTNISHLVFGIAGSSNTWGSKKLYIHSWWKPNITRGYVFLDRTPN-EHLPWPSNSSPPF  139

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMET--VRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             R+SD+ SR      H  P   RM+  I ET  V  +P      +RW VM DDDT+ L+DN
Sbjct  140   RISDDNSRYAPYHKHGMPFAIRMLRVIEETFNVEHSP-----GVRWYVMADDDTVLLIDN  194

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LVDVL++YDH KYYY+G +SE + +N   SF+ AFGG G  LS+PLA A+A  +  C+KR
Sbjct  195   LVDVLSKYDHRKYYYVGMNSECLVSNFGMSFQMAFGGAGYALSYPLAQAVAKNMDTCIKR  254

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L  +D     CIADLGV ++   GFHQID+  DISGFLS HP +P +SLHH D+V P
Sbjct  255   YPFLYGSDHILQACIADLGVTITLENGFHQIDLRRDISGFLSAHPQSPFLSLHHLDLVAP  314

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP MN  ++  H M AA  DQ R+LQQ  C+ +  NW+FSV+WGYS NIY KI   S+L
Sbjct  315   IFPLMNHHDAVNHLMTAARVDQSRLLQQSTCYLKKYNWTFSVSWGYSINIYVKIHSPSFL  374

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             + P+ETF  W    RPP ++F+VR+  T D C +PH  F ++VE  T  + IV  Y +  
Sbjct  375   ERPLETFSEWRKGARPP-YMFNVRQ-LTNDSCEIPHVLFFDAVEG-TRLNHIVTRYIKRT  431

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG---RSECCDVTIDSVDSESAVIKTR  1591
              R +PAC    G+ S D +SKI V+SP+ K   +G   R ECCD+ +  +  +S  IK R
Sbjct  432   PRAMPAC-GSSGNHSTDDVSKIRVFSPMHK-LHVGAGNRRECCDI-VQPIGMDSMAIKLR  488



>ref|XP_010262600.1| PREDICTED: uncharacterized protein LOC104601103 isoform X1 [Nelumbo 
nucifera]
Length=494

 Score =   374 bits (960),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/428 (44%), Positives = 271/428 (63%), Gaps = 11/428 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             + +++PT++SH+VFG+ GS   W  ++ Y+E+WW+PN T GF+ L++ P  + LPWP SS
Sbjct  77    DSTDAPTSISHIVFGVAGSVNTWRTKKNYIEAWWKPNETRGFVWLERAP-TDYLPWPSSS  135

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PP+RVS++V R  E   H      RMV  I ET  +  +     +RW VM DDDT+  +D
Sbjct  136   PPFRVSEDVGRFKEFDRHRMRHAIRMVRVIAETFSEDHK----DVRWYVMTDDDTVIFID  191

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV+VL++YDH KY+Y+G +SE + +N + S++ AFGG G  LS+PLA  +A  + +C+K
Sbjct  192   NLVEVLSRYDHNKYFYIGHNSECVDSNFWNSYEMAFGGAGYALSYPLAKLLASNMDECIK  251

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY  L  +D     C+ADLGV L+  +GFHQID+  DISGFLS HP  P +SLHH D+V+
Sbjct  252   RYPFLFGSDHMLQSCVADLGVPLTHERGFHQIDLTRDISGFLSSHPQVPFLSLHHLDVVD  311

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFP+M+R +S RH M AA  D  R+LQQ +C+ +  NW+F+V+WGYSA IY++I     
Sbjct  312   PIFPAMDRYQSLRHLMEAAKVDSSRLLQQSICYDKENNWTFAVSWGYSAQIYQEIFYPCT  371

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             LQ PIETF++W     PP ++ + R   + + C  PH  F ES+E+     +I+  Y R 
Sbjct  372   LQRPIETFKSWRNKGIPP-FMLNTRP-LSNNACEAPHVLFFESIEQAKGA-QIITNYIRK  428

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRR  1594
              +     C +  G+ SA+ + KI V SP  +   +G R ECCDV   S  +    +K R 
Sbjct  429   SQPTRQPC-SSSGNHSANSMLKIRVSSPAMRLNVVGTRRECCDVLRGS-GTNVTELKLRA  486

Query  1595  CMADDIIA  1618
             CM D+++A
Sbjct  487   CMEDEVVA  494



>ref|XP_010314847.1| PREDICTED: uncharacterized protein LOC104645222 [Solanum lycopersicum]
Length=336

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 232/343 (68%), Gaps = 8/343 (2%)
 Frame = +2

Query  593   MVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIH  772
             MVHGI E      Q   G +RWVVMGDDD++F ++N++DVLA+YDH KYYY G  SE+I 
Sbjct  1     MVHGIKELF---DQEHEG-VRWVVMGDDDSMFFLENIIDVLAKYDHNKYYYFGAQSEYIL  56

Query  773   ANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSP  952
             +N +FSF Q FGG G ++SFPLA A+A  I +CL+RY  LNSAD  T  CI DLG   +P
Sbjct  57    SNFWFSFDQGFGGAGFIMSFPLAKALAQDIENCLRRYPFLNSADLITMVCIVDLGFGFTP  116

Query  953   HQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPR  1132
              +G H +DM GDISGFLS HP  PL+SLHH D + PIFP M+R+ S RH M AA  DQ R
Sbjct  117   LKGLHHLDMRGDISGFLSSHPKTPLLSLHHIDSIAPIFPLMDRSNSLRHLMKAAKFDQSR  176

Query  1133  MLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPR-PPNWIFDV  1309
             ++QQ +C HR  NW+FSV+WGYS +IYEKIMPRS+L  PI+TF TW   P+ PP ++F+ 
Sbjct  177   LVQQTICHHRLSNWTFSVSWGYSIHIYEKIMPRSHLIKPIQTFHTWVKKPKSPPYYMFNT  236

Query  1310  RKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIV  1489
             R R   D C  PH FF +++ ++  ++EI  TY RS  RGLP C + DG+  A+ I KI 
Sbjct  237   RPR-VNDSCETPHVFFFKTIGKMKNKNEIWTTYFRSEARGLPTC-SIDGNYPANYIDKIQ  294

Query  1490  VYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             VY+P  K  ++ R ECCD+ I +  S  A IK R C  ++ IA
Sbjct  295   VYTPRAKRTEMDRRECCDI-IHTSGSNKAKIKLRECFTNEKIA  336



>ref|NP_568279.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE66154.1| fringe-like protein [Arabidopsis thaliana]
 gb|AED91813.1| uncharacterized protein AT5G12460 [Arabidopsis thaliana]
Length=441

 Score =   371 bits (952),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/422 (43%), Positives = 268/422 (64%), Gaps = 15/422 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SHL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+  
Sbjct  35    PTNISHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGYVFLERPPGPDLLPWPQQSPPF--  92

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
               +V++    TN    ++ R+ + + E+ +    +A+   RW V+GDDDT+F +DNLV  
Sbjct  93    --SVNKESFITNKFKTQI-RLFYSLQESFK----KASKETRWFVIGDDDTLFFLDNLVKA  145

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L +Y+H K+YY+G +SE + +N  F+F   +GGGG  LS+P  + +   + +C+KRY  +
Sbjct  146   LDRYNHKKHYYVGMNSENVWSNAIFAFDMGYGGGGYALSYPTVVTLLSNMEECIKRYLGV  205

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
              S D  +  C+ADLG++L+  +G HQ D+HGDISG LS HP +PLISLHHFD+++PIFP 
Sbjct  206   YS-DLLSFRCLADLGIDLTLEKGMHQNDLHGDISGLLSAHPQSPLISLHHFDVIDPIFPG  264

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             MNR +S  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PRS+L+ P+
Sbjct  265   MNRQQSVNHLMETAKTDQSRVLQQTICYQRGYNWSVSVSWGYSVHIYQSIYPRSHLKRPL  324

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W    R P + F+ R R T DPC +P  FF +SV E   +  +   Y+    R L
Sbjct  325   ETFRPWK-DVRIPAYGFNTR-RVTNDPCEMPRQFFFDSVVEDKNQSLVTTIYKMKMERRL  382

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P C   +G+ S+  I+++ V +  T    +   ECCDV  +   +E   +K R C  D+ 
Sbjct  383   PPCLL-NGNHSSRNITQVRVIA-TTMHKMVEGIECCDVQ-NVNSTEILEVKIRDCHIDEA  439

Query  1613  IA  1618
             +A
Sbjct  440   LA  441



>ref|XP_002871529.1| hypothetical protein ARALYDRAFT_488094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47788.1| hypothetical protein ARALYDRAFT_488094 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 270/424 (64%), Gaps = 20/424 (5%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPTN+SHL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+ 
Sbjct  34    SPTNISHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGYVFLERPPGRDLLPWPNQSPPF-  92

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
                +V++    TN    ++ R+ + ++E+ + A +      RW V+ DDDT+F +DNLV 
Sbjct  93    ---SVNKESFITNKFKTQI-RLFYSLLESFKKASKET----RWFVIADDDTLFFLDNLVK  144

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  F+F   +GGGG  LS+P  + +   + +C+KRY  
Sbjct  145   ALDRYDHKKHYYIGMNSENVWSNAIFAFDMGYGGGGYALSYPTVVTLLSNMEECIKRYLG  204

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             + S D  +  C+ADLG++L+  +G HQID+HGDISG LS HP +PLISLHHFD+++PIFP
Sbjct  205   VYS-DLLSFRCLADLGIDLTLEKGMHQIDLHGDISGLLSAHPQSPLISLHHFDVIDPIFP  263

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              M R +S  H M    +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PR++L+ P
Sbjct  264   GMTRQQSVNHLM---KTDQSRVLQQTICYQREYNWSVSVSWGYSVHIYQSIFPRNHLKRP  320

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             +ETF+ W  + + P + F+ R R T DPC +P  FF ESV E   +  +   Y+    R 
Sbjct  321   LETFRPWK-NVKIPAYTFNTR-RVTKDPCEMPRQFFFESVVEDKNQSLVTTMYKIKIERR  378

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMAD  1606
             LP C   +G  S+  I+++ V +  T   K+G   ECCDV   +  +E   +K R C  D
Sbjct  379   LPPCLL-NGSHSSRNITQVRVIA--TTMHKMGEGIECCDVQYVN-STEIMEVKIRACHED  434

Query  1607  DIIA  1618
             +++A
Sbjct  435   EVLA  438



>emb|CDX70478.1| BnaC03g05620D [Brassica napus]
Length=463

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 270/416 (65%), Gaps = 10/416 (2%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             + TNLSHL+F L+GS   W +RR Y ESWWRPN T G L LD  P  E  PW P+ PP++
Sbjct  57    TTTNLSHLMFVLVGSSCTWKNRRTYTESWWRPNVTRGNLFLDVEPSKEFQPWSPTLPPFK  116

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             V++++ ++       NP   R+   I++T     Q     +RW VMGDDD++  VDN+VD
Sbjct  117   VNEDLKKLRIYPKLANPVHVRIYRSILDTYYKLKQ--NDGVRWYVMGDDDSLLFVDNIVD  174

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDHTK +Y+G  SE I +N  FSF  A+GG G  LS+PL  A+   + +C++RY  
Sbjct  175   VLSKYDHTKKHYIGTFSETIKSNVRFSFDMAYGGAGYALSYPLVEALVAKLDECIERYHF  234

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             + + D+   +C+AD+GV++   +GFHQID+ GD+SG LS HP  PL+SLHHF+ V PIFP
Sbjct  235   IWAGDQLQSFCLADMGVDVIHEKGFHQIDLLGDLSGLLSSHPTPPLLSLHHFESVAPIFP  294

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +M+R  S  H M AAN DQ RMLQQ +C  R  NW+FSV+WGYSA+IYE I PRSYL+ P
Sbjct  295   NMSRPGSVLHIMKAANVDQSRMLQQSICHVRASNWTFSVSWGYSAHIYENIFPRSYLKRP  354

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             IETF+ W    RPP ++F+ R   + DPC  PH FF +SVEE   ++ +V +Y R + R 
Sbjct  355   IETFRPWLRG-RPPFYMFNTRP-VSRDPCEAPHWFFFDSVEE--EKERVVTSYTRKFPRN  410

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
             + +C +  G+ SAD ++ I V+SP T P +  + ECCDV  D  D   A ++ R C
Sbjct  411   MTSC-SFSGNISADPLALIRVFSPKT-PKEERKVECCDVEYDGAD--VATMRLRDC  462



>ref|XP_010536094.1| PREDICTED: uncharacterized protein LOC104811175 [Tarenaya hassleriana]
Length=493

 Score =   371 bits (953),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/422 (45%), Positives = 277/422 (66%), Gaps = 9/422 (2%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PT++SH+VF ++GS   W HRR Y+ESWWRPN T G + L++PP  +LLPWP +SPP+R+
Sbjct  81    PTDISHVVFVIVGSVTTWKHRRGYIESWWRPNITRGHVFLEQPPKRDLLPWPQTSPPFRI  140

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             + + S        +  + A  ++   +++ D+   A+ ++RW V+ DDDT+F +DNLV+V
Sbjct  141   NKDPSAKPGNYTKLTSQTAIRLY---QSLSDSFFNASDSVRWFVVADDDTLFFLDNLVEV  197

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L +YDH K+YY+G +SE I +N  FS+   +GGGG  LS+    A+   + +C++RY  L
Sbjct  198   LNKYDHKKHYYIGMNSENIWSNEVFSYDMGYGGGGYALSYLTVEALVGRMEECIRRYP-L  256

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D  +  C++D+GV+L+  +GFHQID+HGDISG LS HP++P ISLHHFD++NPIFP+
Sbjct  257   MFSDLLSFLCLSDMGVDLTLEKGFHQIDLHGDISGLLSAHPHSPPISLHHFDVINPIFPT  316

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R ES  + M  A +DQ R+LQQ +C+ R  NWS S++WGYS  IYE I+ RS L+ P+
Sbjct  317   MSRQESVNNLMKTAKTDQTRLLQQTICYRREINWSVSISWGYSVQIYETIIARSQLKRPL  376

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF  W  + +PP + F+ R R T DPC +PH  FL+S  E     E+  TYR    R L
Sbjct  377   ETFTPWR-NVKPPFYRFNTR-RVTKDPCEMPHLLFLDSTVE-ENNGEVSGTYRVKTARRL  433

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             P C   +G+ SA  ++++ V +P T   K GR ECCDV   +  ++   +K R CM D+I
Sbjct  434   PPC-VSNGNHSALVVTQVRVAAP-TLHKKDGRIECCDVRFANNKTDVLDVKIRDCMKDEI  491

Query  1613  IA  1618
             +A
Sbjct  492   LA  493



>ref|XP_006446150.1| hypothetical protein CICLE_v10017944mg [Citrus clementina]
 gb|ESR59390.1| hypothetical protein CICLE_v10017944mg [Citrus clementina]
Length=468

 Score =   367 bits (941),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 200/434 (46%), Positives = 263/434 (61%), Gaps = 47/434 (11%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             NSP NLSH+VF LLGS   W +R+ Y+E+WWR N T G L LD  P  EL+PWP SSP +
Sbjct  72    NSPINLSHIVFVLLGSVNTWKYRKPYIEAWWRKNITRGHLWLDAAPTGELVPWPSSSPAF  131

Query  527   RVSDNVSRVVEETNHVNPRVA---RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             RV+++++R+      VNP+     RM H I E  R    +    ++W VM DDDT+  VD
Sbjct  132   RVNEDITRLA-----VNPKSVVQIRMYHSIFEAFRVENNK---DVKWYVMADDDTLVFVD  183

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV++L +YDHTKYYY+G +SE IH+N Y SF   +GG G  LS+ L  A+A  I  C++
Sbjct  184   NLVELLGKYDHTKYYYIGTNSESIHSNAYISFDMGYGGAGYALSYALVEALASEIDGCIQ  243

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY HL  +D  +  C ADLGV+L   +G HQID+  DISG LS HP++PLISLHHFD ++
Sbjct  244   RYKHLFFSDYISQSCSADLGVDLKIEKGIHQIDLRVDISGLLSSHPSSPLISLHHFDAID  303

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFPS NR+ES  H M  A  DQ R                     YSA+IY+ I PRS+
Sbjct  304   PIFPSKNRSESINHLMKPAKFDQSR---------------------YSAHIYQSIFPRSF  342

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT--ARDEIVAT-Y  1408
             L+ P++TF+ W  S RPP ++F+ R   + +PC  PH FFLESV E     R  +V T Y
Sbjct  343   LRRPLQTFRPWQKS-RPPFFMFNTR-WLSNNPCEAPHVFFLESVIESNNIGRYHVVVTDY  400

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTI----DSVDSESA  1576
              RS    LP C + +G+ SA+ I KI V+SP T   + GR ECCDV      D+VD    
Sbjct  401   TRSSPSNLPICLS-NGNHSANPIHKIQVFSPSTGRKEAGRIECCDVKYVAGEDTVD----  455

Query  1577  VIKTRRCMADDIIA  1618
              +K   CM  +++A
Sbjct  456   -VKLSACMKGEMLA  468



>emb|CDP09272.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 230/312 (74%), Gaps = 8/312 (3%)
 Frame = +2

Query  590   RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFI  769
             RMVHGI+E  R+  +     +RW+VMGDDDTIF VDNLVDVL++YDHTKY+Y+G  SEF+
Sbjct  3     RMVHGILELCREEHE----GVRWIVMGDDDTIFFVDNLVDVLSKYDHTKYFYIGYPSEFV  58

Query  770   HANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLS  949
              +N ++SF QAFGG GI+LS+PLA A+   +  CLK Y+ L SAD  T  C+AD+G +L+
Sbjct  59    LSNYWYSFNQAFGGSGIILSYPLAKALVQDMDRCLKTYASL-SADLMTMRCLADIGADLT  117

Query  950   PHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQP  1129
             P +GFHQID+ GD+SGFLS HP   ++SLHH D V+P FP+M+RA+S  H M AAN DQ 
Sbjct  118   PQKGFHQIDLRGDLSGFLSSHPKDLVLSLHHIDAVDPYFPTMDRAKSTNHLMKAANVDQS  177

Query  1130  RMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDV  1309
             R+ QQ +C HR  NWSFS++WGYS +IYEKIM RS+L+ PIETF+TW  SP  P+++F+V
Sbjct  178   RLFQQTVCHHRQNNWSFSISWGYSTHIYEKIMARSWLRMPIETFKTWQKSPNRPHYMFNV  237

Query  1310  RKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIV  1489
             R R   DPC  PH FF +SV++++ R+EI+  Y RS  R LPAC A  G+ SA+ +S+I 
Sbjct  238   R-RPFGDPCGAPHVFFFQSVKKIS-RNEILTVYSRSASRNLPAC-ASSGNHSAEHVSEIH  294

Query  1490  VYSPVTKPAKIG  1525
             V+SP TK  ++ 
Sbjct  295   VFSPATKRTEVS  306



>emb|CDY53964.1| BnaA10g29960D [Brassica napus]
Length=490

 Score =   365 bits (938),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 189/423 (45%), Positives = 267/423 (63%), Gaps = 16/423 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SHL+F ++GS K W +RR Y+E WWRPN T G + L+KPPG +LLPWP  SPP+ V
Sbjct  83    PTNISHLLFVIVGSTKTWRYRRGYIEPWWRPNITRGHVFLEKPPGRDLLPWPQQSPPFIV  142

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             + + S     TN       R+   + E+  +A +      RW V+ DDDT+F +DNLV  
Sbjct  143   NKDSS----VTNAKFKTQIRLFQSLHESFNNANKDT----RWFVIADDDTLFFLDNLVKA  194

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L QYDH K+YY+G +SE + +N  F F   +GGGG  LS+P    +   + DC+ RY  +
Sbjct  195   LEQYDHKKHYYIGMNSENVWSNAIFGFDMGYGGGGYALSYPTVETLLKRMEDCIARYLGV  254

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
              S D  +  C+ADLG++L+ ++G HQID+HGDISG LS HP +PLISLHHFD++NPIFP+
Sbjct  255   YS-DLLSFRCLADLGIDLTMNKGIHQIDLHGDISGLLSAHPQSPLISLHHFDVINPIFPA  313

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R ES  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS ++Y+ ++PR+YL+ P+
Sbjct  314   MSRQESVNHLMKTAKTDQSRILQQTICYQRGNNWSVSVSWGYSVHVYQSVLPRNYLKRPL  373

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  + R P + F+ R R T DPC +P  FF +SV E   +  +   Y+      L
Sbjct  374   ETFRPWK-NVRIPVYTFNTR-RVTNDPCEMPLQFFFDSVAEDKNQSLVTTMYKVKTLGSL  431

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVTIDSVDSESAVIKTRRCMADD  1609
             P C   + +QSA  IS++ V +      K+G   ECCDV   S  S++  +K R C  D+
Sbjct  432   PPCLP-NVNQSAGNISQVSVIAATMH--KVGEGIECCDVEKAS-SSDTLEVKIRACHKDE  487

Query  1610  IIA  1618
             ++A
Sbjct  488   VLA  490



>ref|XP_009121837.1| PREDICTED: uncharacterized protein LOC103846629 [Brassica rapa]
Length=489

 Score =   363 bits (932),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/423 (45%), Positives = 268/423 (63%), Gaps = 17/423 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SHL+F ++GS K W +RR Y+E WWRPN T G + L+KPPG +LLPWP  SPP+ V
Sbjct  83    PTNISHLLFVIVGSTKTWRYRRGYIEPWWRPNITRGHVFLEKPPGRDLLPWPQQSPPFIV  142

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             + + S     TN       R+   + E+  +A +      RW V+ DDDT+F +DNLV  
Sbjct  143   NKDSS----VTNAKFKTQIRLFQSLHESFNNANKDT----RWFVIADDDTLFFLDNLVKA  194

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L QYDH K+YY+G +SE + +N  F F   +GGGG  LS+P    +   + DC+ RY  +
Sbjct  195   LEQYDHKKHYYIGMNSENVWSNAIFGFDMGYGGGGYALSYPTVETLLKRMEDCIARYLGV  254

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
              S D  +  C+ADLG++L+ ++G HQID+HGDISG LS HP +PLISLHHFD++NPIFP+
Sbjct  255   YS-DLLSFRCLADLGIDLTMNKGIHQIDLHGDISGLLSAHPQSPLISLHHFDVINPIFPA  313

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R ES  H M  A +DQ R+LQQ +C+ R  NWS SV+WGYS ++Y+ ++PR+YL+ P+
Sbjct  314   MSRQESVNHLMKTAKTDQSRILQQTICYQRGNNWSVSVSWGYSVHVYQSVLPRNYLKRPL  373

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  + R P + F+ R R T DPC +P  FF +SV E   +  +   Y+      L
Sbjct  374   ETFRPWK-NVRIPVYTFNTR-RVTNDPCEMPLQFFFDSVAEDKNQSLVTTMYKVKTLGSL  431

Query  1433  PACFAGDGDQSADRISKI-VVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADD  1609
             P C   + +QSA  IS++ V+ + + K   I   ECCDV   S  S++  +K R C  D+
Sbjct  432   PPCLP-NVNQSAGNISQVSVIAATMHKGEGI---ECCDVEKAS-SSDTLEVKIRACHKDE  486

Query  1610  IIA  1618
             ++A
Sbjct  487   VLA  489



>emb|CAC42907.1| putative protein [Arabidopsis thaliana]
Length=415

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/407 (43%), Positives = 256/407 (63%), Gaps = 15/407 (4%)
 Frame = +2

Query  398   KAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRVVEETNHVN  577
             K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+    +V++    TN   
Sbjct  24    KTWRYRRGYIEPWWRPNITKGYVFLERPPGPDLLPWPQQSPPF----SVNKESFITNKFK  79

Query  578   PRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGH  757
              ++ R+ + + E+ +    +A+   RW V+GDDDT+F +DNLV  L +Y+H K+YY+G +
Sbjct  80    TQI-RLFYSLQESFK----KASKETRWFVIGDDDTLFFLDNLVKALDRYNHKKHYYVGMN  134

Query  758   SEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLG  937
             SE + +N  F+F   +GGGG  LS+P  + +   + +C+KRY  + S D  +  C+ADLG
Sbjct  135   SENVWSNAIFAFDMGYGGGGYALSYPTVVTLLSNMEECIKRYLGVYS-DLLSFRCLADLG  193

Query  938   VNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAAN  1117
             ++L+  +G HQ D+HGDISG LS HP +PLISLHHFD+++PIFP MNR +S  H M  A 
Sbjct  194   IDLTLEKGMHQNDLHGDISGLLSAHPQSPLISLHHFDVIDPIFPGMNRQQSVNHLMETAK  253

Query  1118  SDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNW  1297
             +DQ R+LQQ +C+ R  NWS SV+WGYS +IY+ I PRS+L+ P+ETF+ W    R P +
Sbjct  254   TDQSRVLQQTICYQRGYNWSVSVSWGYSVHIYQSIYPRSHLKRPLETFRPW-KDVRIPAY  312

Query  1298  IFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRI  1477
              F+ R R T DPC +P  FF +SV E   +  +   Y+    R LP C   +G+ S+  I
Sbjct  313   GFNTR-RVTNDPCEMPRQFFFDSVVEDKNQSLVTTIYKMKMERRLPPCLL-NGNHSSRNI  370

Query  1478  SKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             +++ V +  T    +   ECCDV  +   +E   +K R C  D+ +A
Sbjct  371   TQVRVIA-TTMHKMVEGIECCDVQ-NVNSTEILEVKIRDCHIDEALA  415



>emb|CDX97203.1| BnaC09g44220D [Brassica napus]
Length=475

 Score =   348 bits (894),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 248/380 (65%), Gaps = 12/380 (3%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SHL+F ++GS K W  RR Y+E WWRPN T G + L+KPPG +LLPWP  SPP+ V
Sbjct  83    PTNISHLLFVIVGSTKTWRFRRGYIEPWWRPNITRGHVFLEKPPGRDLLPWPQQSPPFIV  142

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             +       ++++  N +    +  + +++ ++  +A+   RW V+ DDDT+F +DNLV  
Sbjct  143   N-------KDSSITNAKFKTQIR-LFQSLHESFNKASKDTRWFVIADDDTLFFLDNLVKA  194

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L QYDH K+YY+G +SE + +N  F F   +GGGG  LS+P    + + + DC+ RY  +
Sbjct  195   LEQYDHKKHYYIGMNSENVWSNAIFGFDMGYGGGGYALSYPTVETLLNKMEDCIARYLGV  254

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
              S D  +  C+ADLG++L+ ++G HQID+HGDISG LS HP +PLISLHHFD++NPIFP+
Sbjct  255   YS-DLLSFRCLADLGIDLTMNKGIHQIDLHGDISGLLSAHPQSPLISLHHFDVINPIFPA  313

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R ES  H M  A  DQ R+LQQ +C+ R  NWS SV+WGYS ++Y+ ++PR+YL+ P+
Sbjct  314   MSRQESVNHLMKTAKIDQSRILQQTICYQRGNNWSVSVSWGYSVHVYQSVLPRNYLKRPL  373

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             ETF+ W  + R P + F+ R R T DPC +P  FF ESV E   +  +   Y+      L
Sbjct  374   ETFRPWK-NVRIPVYTFNTR-RVTNDPCEMPRQFFFESVVEDKNQSLVTTMYKVKTLGSL  431

Query  1433  PACFAGDGDQSADRISKIVV  1492
             P C   + +QSA  IS++ V
Sbjct  432   PPCLP-NVNQSAGNISQVRV  450



>ref|XP_006846343.1| hypothetical protein AMTR_s00012p00258210 [Amborella trichopoda]
 gb|ERN08018.1| hypothetical protein AMTR_s00012p00258210 [Amborella trichopoda]
Length=505

 Score =   341 bits (874),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 176/430 (41%), Positives = 258/430 (60%), Gaps = 15/430 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N+  SPT + H++FG+ GS K W +R  Y++ WW PN T G + LD PP     PWP SS
Sbjct  84    NNFRSPTKIGHILFGIAGSSKTWRNRGPYIDLWWEPNKTRGHVWLDSPPTK--YPWPSSS  141

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PP+R+S+N +       H  P   RM   ++E+           +RW VMGDDDT+F VD
Sbjct  142   PPFRISENTAIFNGYNKHEMPFAIRMARVLLESF----NLGLSDVRWFVMGDDDTVFFVD  197

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+YDH KY+Y+GG+SE +  N   S+  AFGGGG  +S+PLA A++    DC++
Sbjct  198   NLVKVLAKYDHNKYFYIGGNSESVVQNMAHSYDMAFGGGGYAVSYPLAKALSRIFDDCIR  257

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY  L  +D     C+A++GV L+   GFHQID+ GDI G LS HP +PL+SLHH D + 
Sbjct  258   RYQTLYGSDHIIQSCVAEVGVRLTKEPGFHQIDLLGDIYGLLSAHPMSPLLSLHHLDYIA  317

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFP M R ++ +  + A+ ++ P++LQQ +C+H+  NWS SV+WGYS  IY+KI P  +
Sbjct  318   PIFPGMTRIQALKVLLKASKANPPQLLQQSICYHKEHNWSISVSWGYSVQIYQKIYPPGF  377

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVAT-YRR  1414
             L  P++TF+ W  S    +++F+ R   +TDPC  P  FF +SV+ V+    ++ T Y  
Sbjct  378   LTIPLQTFKPWRKS-GVLSFMFNTRP-LSTDPCEKPTVFFFDSVKPVSPFVNLIETVYVG  435

Query  1415  SWRRGLPACFAGDGDQSADRI-SKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKT  1588
                R + AC   + +QS   I  ++ ++S +      G R +CC+V + S       I+ 
Sbjct  436   REDRSISAC---NLNQSLPNIVDEVRIFSELQDIRVAGSRRQCCEV-LPSSGMNVTEIRI  491

Query  1589  RRCMADDIIA  1618
             R C+ D+ +A
Sbjct  492   RECLDDENVA  501



>emb|CDX97202.1| BnaC09g44230D [Brassica napus]
Length=437

 Score =   338 bits (866),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 188/424 (44%), Positives = 255/424 (60%), Gaps = 44/424 (10%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
              + TNLSHL+F ++GS + W  RR YVESWWRP+ T G +  D  P  ELLPW P+ PP+
Sbjct  58    ETATNLSHLMFVVVGSPRTWKKRRNYVESWWRPDVTRGNIFFDVKPSEELLPWSPTFPPF  117

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             RVS+NV ++        P   R    I+ET R   +     +RW V GDDD++F VDNLV
Sbjct  118   RVSENVKKLRFYRKLRKPSHTRFYRAILETYRLMDE----GVRWYVTGDDDSLFFVDNLV  173

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
             DVL++YDHT+ +Y+G +SE I +N YF F   FGGGG  LS+ L  A+   + +C+++Y 
Sbjct  174   DVLSKYDHTRQHYIGTNSETIKSNVYFGFNMGFGGGGYALSYALVEALVVKLDECVEKYH  233

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
              + + D+   +C+A+L V+L+  +GFHQ+D+ GDISGFLS H  APL+SLHHF  V+P+F
Sbjct  234   FIWAVDQIQSFCLAELSVDLTLEKGFHQVDLFGDISGFLSSHTTAPLLSLHHFATVSPLF  293

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             P M+R  S  H M AAN DQ RMLQQ +C  R  NW+FSV+WGY  +IYEKI PRS+L+ 
Sbjct  294   PGMDRPGSVLHIMKAANVDQSRMLQQSICHVRESNWTFSVSWGYPVHIYEKIFPRSHLKL  353

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             PIETF+ W    RPP ++F+                                   R + R
Sbjct  354   PIETFRPWYRG-RPPVFMFNT----------------------------------RPFIR  378

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMAD  1606
              + +C +  G+ SAD I+ I V+SP T P +  + ECCDV     + E A IK R C  D
Sbjct  379   NMTSC-SFSGNISADPIASIRVFSPKT-PRQGRKVECCDV---EYEGEVASIKLRDCRRD  433

Query  1607  DIIA  1618
             +IIA
Sbjct  434   EIIA  437



>emb|CDX97197.1| BnaC09g44280D [Brassica napus]
Length=376

 Score =   332 bits (851),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/319 (49%), Positives = 215/319 (67%), Gaps = 13/319 (4%)
 Frame = +2

Query  329   ESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWP  508
             E      +  NLSHL+F L+GS +AW HRR Y+ESWWRPNAT G + LD  P  E  PW 
Sbjct  50    EEAGPKETTANLSHLMFVLVGSSRAWKHRRTYIESWWRPNATRGNIFLDVEPSEEFRPWS  109

Query  509   PSSPPYRVSDNVSRVVEETNHVNPRVARMVH-----GIMETVRDAPQRATGTLRWVVMGD  673
             P+ PP++V++++ ++      + P++A  VH      I+ET R    +    +RW VMGD
Sbjct  110   PTFPPFKVNEDLRKL-----RIYPKLANRVHIRIYRSILETYR---LKQDDDVRWYVMGD  161

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DD++F VDN+VDVL++YDHT+  Y+G  SE   +N   +F+ A+GGGG  LS+P+  A+ 
Sbjct  162   DDSLFFVDNIVDVLSKYDHTEKRYIGMFSESTKSNFRLAFEMAYGGGGYALSYPMVEALV  221

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               + +C+++Y  + + D    YC+ADLG +L P +GFHQ+D+ GD+SG LS HP APL+S
Sbjct  222   AKLDECIEKYHFIWAGDTLQSYCLADLGADLIPEKGFHQMDLRGDLSGLLSSHPTAPLLS  281

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHHF  + P+FP M+R  S    M AAN DQ RMLQQ +C+ R RNW+FSV+WGYSA++Y
Sbjct  282   LHHFGALAPLFPGMDRHGSVLQIMKAANVDQSRMLQQSVCYVRARNWTFSVSWGYSAHVY  341

Query  1214  EKIMPRSYLQNPIETFQTW  1270
             E I PRSYL+ PIETF+ W
Sbjct  342   ENIFPRSYLKLPIETFRPW  360



>emb|CDY53963.1| BnaA10g29950D [Brassica napus]
Length=351

 Score =   317 bits (812),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/345 (47%), Positives = 224/345 (65%), Gaps = 13/345 (4%)
 Frame = +2

Query  584   VARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSE  763
             +AR    I+ET R   +     +RW V GDDD++F VDNLVDVL++YDHT+ +Y+G +SE
Sbjct  20    LARFYRAILETYRLMDE----GVRWYVTGDDDSLFFVDNLVDVLSKYDHTRQHYIGTNSE  75

Query  764   FIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVN  943
              I +N YF F   FGG G  LS+ L  A+   + +C+++Y  + + D     C+ADLGV+
Sbjct  76    TIKSNAYFGFNMGFGGAGYALSYALVEALVVKLDECVEKYHFIWAVDMIQSLCLADLGVD  135

Query  944   LSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSD  1123
             L+  +GFHQ+D+ GDISG LS H  APL+SLHHF  V+P+FP M+R  S  H M AAN D
Sbjct  136   LTLEKGFHQMDLFGDISGLLSSHTTAPLLSLHHFATVSPLFPGMDRPGSVLHIMKAANVD  195

Query  1124  QPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIF  1303
             Q RMLQQ +C  R  NW+FSV+WGYS +IYEKI PRSYL+ PIETF+ W    RPP ++F
Sbjct  196   QSRMLQQSICHVRASNWTFSVSWGYSVHIYEKIFPRSYLKLPIETFRPWYRG-RPPVFMF  254

Query  1304  DVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISK  1483
             + R   + DPC  PH FF +S+E+    D +V +Y R + R + +C +  G+ SAD I+ 
Sbjct  255   NTRP-VSRDPCEAPHWFFFDSIEK--ENDGVVTSYTRKFIRNMTSC-SFSGNISADPIAS  310

Query  1484  IVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             I V+SP T P +  + ECCDV     + + A ++ R C  D+IIA
Sbjct  311   IRVFSPKT-PRQGRKVECCDV---EYEGDVATMRLRDCRRDEIIA  351



>ref|XP_009804547.1| PREDICTED: uncharacterized protein LOC104249759 [Nicotiana sylvestris]
Length=346

 Score =   313 bits (802),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 223/353 (63%), Gaps = 14/353 (4%)
 Frame = +2

Query  566   NHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYY  745
              H  P+  RM   + ET +     A    RW +M DDDTIF +DNLV+VL++YDH KYYY
Sbjct  4     KHPIPQTIRMARVVAETFKMENTSA----RWYIMADDDTIFFLDNLVEVLSKYDHRKYYY  59

Query  746   LGGHSEFIHANNYF-SFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYC  922
             +G +SE  HA+N+  SF  AFGGGG   S+ L  AM + +  C+KRY      D+    C
Sbjct  60    VGMNSE-THASNFVHSFNMAFGGGGYAFSYALVEAMVENLDICIKRYPTFYGGDRILQSC  118

Query  923   IADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHF  1102
             +ADLGV+L+  +GFHQ+D+HGDISGFLS HP +PL+SLHH D ++PIFP MN+++S  H 
Sbjct  119   VADLGVSLTRQKGFHQMDLHGDISGFLSAHPQSPLVSLHHLDFIDPIFPLMNKSQSLNHL  178

Query  1103  MAAAN-SDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPS  1279
             M  A   D+ R+LQQ +C+++P+NW+FS++WGYS  IYE I P S +  P++TF  W   
Sbjct  179   MKVAKLGDESRILQQSICYYKPKNWTFSISWGYSIQIYESIFPPSLITIPLQTFIPWSKL  238

Query  1280  PRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGD  1459
              +P  W     +  + +PC  PH  F ES++++  ++ ++  Y R + R LP C +  G+
Sbjct  239   FKP--WFVFNTRLPSNNPCEAPHLLFFESMQKM--KNYLLINYTRKYPRKLPPC-SFSGN  293

Query  1460  QSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRRCMADDII  1615
              SA+ IS+I V SP+ K   +G R ECCDV +   D+    IK R CM ++II
Sbjct  294   HSANHISEIHVLSPMKKLDSVGSRRECCDV-VYKADTNVTEIKLRDCMQNEII  345



>ref|XP_010262601.1| PREDICTED: uncharacterized protein LOC104601103 isoform X2 [Nelumbo 
nucifera]
Length=453

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/428 (39%), Positives = 242/428 (57%), Gaps = 52/428 (12%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             + +++PT++SH+VFG+ GS   W  ++ Y+E+WW+PN T GF+ L++ P  + LPWP SS
Sbjct  77    DSTDAPTSISHIVFGVAGSVNTWRTKKNYIEAWWKPNETRGFVWLERAP-TDYLPWPSSS  135

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PP+RVS++V R  E   H      RMV  I ET  +  +     +RW VM DDDT+  +D
Sbjct  136   PPFRVSEDVGRFKEFDRHRMRHAIRMVRVIAETFSEDHK----DVRWYVMTDDDTVIFID  191

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV+VL++YDH KY+Y+G +SE + +N + S++ AFGG G  LS+PLA  +A  + +C+K
Sbjct  192   NLVEVLSRYDHNKYFYIGHNSECVDSNFWNSYEMAFGGAGYALSYPLAKLLASNMDECIK  251

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY  L  +D     C+ADLGV L+  +GFHQID+  DISGFLS HP              
Sbjct  252   RYPFLFGSDHMLQSCVADLGVPLTHERGFHQIDLTRDISGFLSSHP--------------  297

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
                                        QQ +C+ +  NW+F+V+WGYSA IY++I     
Sbjct  298   ---------------------------QQSICYDKENNWTFAVSWGYSAQIYQEIFYPCT  330

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             LQ PIETF++W     PP ++ + R   + + C  PH  F ES+E+     +I+  Y R 
Sbjct  331   LQRPIETFKSWRNKGIPP-FMLNTRP-LSNNACEAPHVLFFESIEQAKGA-QIITNYIRK  387

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSESAVIKTRR  1594
              +     C +  G+ SA+ + KI V SP  +   +G R ECCDV   S  +    +K R 
Sbjct  388   SQPTRQPC-SSSGNHSANSMLKIRVSSPAMRLNVVGTRRECCDVLRGS-GTNVTELKLRA  445

Query  1595  CMADDIIA  1618
             CM D+++A
Sbjct  446   CMEDEVVA  453



>ref|XP_010262898.1| PREDICTED: uncharacterized protein LOC104601308 [Nelumbo nucifera]
Length=504

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 159/426 (37%), Positives = 240/426 (56%), Gaps = 27/426 (6%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH+VFG+ GS K W  RR Y E WW+PN T GF+ LD+ P  E  PWP   PPYRVS
Sbjct  91    TNVSHIVFGIGGSAKTWKDRRHYSELWWKPNITRGFVWLDENPDGEE-PWPEILPPYRVS  149

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             +N SR    + + +    R+   ++E+ R   +     +RW VMGDDDT+F V+NLV VL
Sbjct  150   ENSSRFKYTSWYGSRSAVRIARIVLESFRLGLE----NVRWFVMGDDDTVFFVENLVSVL  205

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH + YY+GG+SE +  N   S+  AFGGGG  +S+PLA  +A  +  C+ RY+ L 
Sbjct  206   SKYDHNQMYYVGGNSESVEQNVIHSYDTAFGGGGFAISYPLAAELAKVLDVCIDRYASLY  265

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV L+   GFHQID+ GD  G L+ HP APL+SLHH D V P+FP+ 
Sbjct  266   GSDQKIQACMSEIGVPLTKEAGFHQIDIRGDPYGLLASHPVAPLVSLHHLDYVKPLFPTS  325

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             NR +S    + A  +D  R LQ+  C+   RNWS SV+WGY+  IY   +    L   ++
Sbjct  326   NRRDSLTKLLGAYKADPGRTLQRSFCYDLERNWSVSVSWGYTIQIYPFFLTAKMLDTTLQ  385

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF+TW      P + F+ R R +  PC  P  +FL+ VE+     + + +Y++       
Sbjct  386   TFRTWKSRSTQP-FTFNTR-RVSGQPCNRPLIYFLDRVEDEVEGGQTLTSYKK-------  436

Query  1436  ACFAGDGDQSADR--------ISKIVVYSPVTKPAKIG---RSECCDVTIDSVDSESAVI  1582
               F G+  +   R        +  + V +P  +P +     + +CC+++     +    +
Sbjct  437   --FMGENAKICKRPSYLPALTVHSVNVSAPKLEPDEWKTAPQRQCCEISRAHGLNSVLHV  494

Query  1583  KTRRCM  1600
             + R C+
Sbjct  495   RIRSCI  500



>ref|XP_009762736.1| PREDICTED: uncharacterized protein LOC104214722 [Nicotiana sylvestris]
Length=493

 Score =   303 bits (776),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 168/431 (39%), Positives = 247/431 (57%), Gaps = 23/431 (5%)
 Frame = +2

Query  326   LESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPW  505
             +E+ +     T +SH++FG+ GS K W +R  Y E WWRPN T GF+ LD+ P  E  PW
Sbjct  33    VENISKEEEETKISHILFGIAGSAKTWTNRSRYSELWWRPNVTRGFVWLDEKP-QENEPW  91

Query  506   PPSSPPYRVSDNVSRVVEET----NHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGD  673
             P +SPPYRVS++ S   E T    N    R+AR+V       +++ +     +RW VMGD
Sbjct  92    PETSPPYRVSEDTSNF-EYTCWFGNRTAVRIARIV-------KESFELGLKNVRWFVMGD  143

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DDT+F  +NLV VLA+YDH + YY+GG+SE +  N   S+  A+GGGGI +S+PLA  + 
Sbjct  144   DDTVFFPENLVTVLAKYDHNQMYYIGGNSESVEQNVICSYTMAYGGGGIAISYPLAAELV  203

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               +  C+ RY +L ++D+  G C+A++GV L+   GFHQ+D++G   G L+ HP APL+S
Sbjct  204   KILDGCINRYHYLCNSDQRIGGCMAEIGVPLTNEHGFHQMDINGSARGLLAAHPVAPLVS  263

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHH DM+ P+ PSM+R ES +  + A N D  R +Q  LC+   RNWS SV+WGY+  +Y
Sbjct  264   LHHLDMLYPLIPSMSRVESVKKVIEAYNKDPSRTMQHSLCYDLKRNWSVSVSWGYTVQLY  323

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
               +M    L+ PI TF+TW  S  P  + F+ R     + C  P  ++L+ V ++    E
Sbjct  324   PWLMNVKELETPIRTFKTWIGSKEP--FTFNTRP-NYVELCKRPIEYYLDQVVDL-PNGE  379

Query  1394  IVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVD  1564
              + +Y          C      + A  +  + V +P+  P    K  R +CC+V I+ + 
Sbjct  380   TLISYSTIIGESNEQC-ENQHYKPALAVHMVNVTAPMLSPKVWRKAPRRQCCEV-INDIG  437

Query  1565  SESAVIKTRRC  1597
             S    IK R C
Sbjct  438   S-VLHIKIRGC  447



>ref|XP_010313583.1| PREDICTED: uncharacterized protein LOC101258725 [Solanum lycopersicum]
Length=201

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = +2

Query  593   MVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIH  772
             MVHGIME VR+A +     +RWVVMGDDD+IF VDN+VD+LAQYDHT+YYY GGHSEFI 
Sbjct  1     MVHGIMEVVREAHE----GVRWVVMGDDDSIFFVDNMVDILAQYDHTQYYYFGGHSEFIM  56

Query  773   ANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSP  952
             AN +FSF QAFGG GI+LS+PLA A A+ ++ CLKRY++  SAD+TT  C AD+GVNLSP
Sbjct  57    ANYFFSFHQAFGGAGIILSYPLARAFANNVISCLKRYAYFRSADRTTMSCTADIGVNLSP  116

Query  953   HQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPR  1132
              +G HQID+ GD+SGFLS HP + L+SLHHFD ++PIFPSM+RA+S  H + AA  DQ R
Sbjct  117   LRGSHQIDLRGDLSGFLSSHPKSLLVSLHHFDTIDPIFPSMDRAQSGYHLLNAAKFDQSR  176

Query  1133  MLQQLLCFHRPRNWSFSVAWGYSAN  1207
             MLQQ +C+ R  NW+FS++WGYS N
Sbjct  177   MLQQTICYKRSNNWTFSISWGYSTN  201



>ref|XP_009803528.1| PREDICTED: uncharacterized protein LOC104248872 [Nicotiana sylvestris]
Length=504

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/430 (38%), Positives = 244/430 (57%), Gaps = 16/430 (4%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             +DS SPTN+SH+VFG+ GS + W +R+ Y E WW+P  T GF+ LD+ P      WP +S
Sbjct  87    DDSLSPTNISHIVFGIAGSTQTWKNRKHYSELWWKPTVTRGFVWLDEEPDLNST-WPGTS  145

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYR+S +  +     +    R++R+   I+++ R     A    RW VMGDDDT+F  +
Sbjct  146   PPYRISSDWKKFKFTNSQSAVRISRV---IVDSFRVGLPNA----RWFVMGDDDTVFFTE  198

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+Y+H + YY+GG+SE +  N   S+  AFGGGG  +S+PLA  +   +  CL 
Sbjct  199   NLVTVLAKYNHREMYYIGGNSESVEQNVMHSYDMAFGGGGFAISYPLAAELVRIMDGCLN  258

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY +   +D+    C+ ++GV L+   GFHQID+  D  G L+ HP APL+SLHH + V 
Sbjct  259   RYFNFYGSDQRVWACVGEVGVTLTREGGFHQIDIRDDPFGLLAAHPMAPLVSLHHLEYVQ  318

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             P+FP+ ++ ES R    A   D  R +QQ  C++R   WS SV+W Y+  IY  ++    
Sbjct  319   PLFPNQSQIESLRMLTTAYEVDPARTMQQSFCYYRRSKWSISVSWAYAVQIYPWLLSAKD  378

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P++TF+TW      P + F+ R   +++PC  P  F+L S++E   + ++V  Y++S
Sbjct  379   LETPLQTFRTWRSWSSGP-FTFNTRP-MSSEPCERPVIFYLHSIKE-DEKGKMVTIYKKS  435

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAVIKT  1588
               +    C   +  + A  I KIVV S    P    K+ R +CC+ +     S +  IK 
Sbjct  436   PIKQEKKCNLANYAR-AFAIEKIVVSSLKMDPEKWKKVPRRQCCEAS-KGFWSNTMTIKI  493

Query  1589  RRCMADDIIA  1618
             R C   + I 
Sbjct  494   RNCKHRETIT  503



>ref|XP_009619659.1| PREDICTED: uncharacterized protein LOC104111623 [Nicotiana tomentosiformis]
Length=504

 Score =   299 bits (765),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/430 (37%), Positives = 244/430 (57%), Gaps = 16/430 (4%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             +DS SPTN+SH+VFG+ GS + W +R+ Y E WW+P  T GF+ LD+ P      WP +S
Sbjct  87    DDSLSPTNISHIVFGIAGSAQTWKNRKHYSELWWKPTVTRGFVWLDEEPDPNST-WPGTS  145

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYR+S +  +    ++    R++R++        D+        RW VMGDDDT+F  +
Sbjct  146   PPYRISSDWKKFKFTSSQSAVRISRVI-------VDSFGVGLPNARWFVMGDDDTVFFTE  198

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+Y+H + YY+GG+SE +  N   ++  AFGGGG  +S+PLA  +   +  CL 
Sbjct  199   NLVTVLAKYNHREMYYIGGNSESVEQNVMHAYDMAFGGGGFAISYPLAAELVRIMNRCLN  258

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             +Y +   +D+    C+ ++GV L+P +GFHQID+  D  G L+ HP APL+SLHH + V 
Sbjct  259   QYFNFYGSDQRVWACVGEVGVTLTPERGFHQIDIRDDPFGLLAAHPMAPLVSLHHLEYVQ  318

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             P+FP+ ++ ES R    A   D  R +QQ  C+++   WS SV+W Y+  IY  ++    
Sbjct  319   PLFPNQSQLESLRMLTTAYKVDPSRTMQQAFCYYQRYKWSISVSWAYAVQIYPWLLSAKD  378

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P++TF+TW      P + F+ R   +++PC  P  F+L+S++E   + + V TY++ 
Sbjct  379   LETPLQTFRTWRSWSSGP-FTFNTRP-MSSEPCERPLIFYLDSIKE-DEKGKTVTTYKKP  435

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAVIKT  1588
               +    C   +  + A  I KIVV S    P    K+ R +CC+ +     S +  +K 
Sbjct  436   PIKQEKKCNQANYAR-AFAIEKIVVSSLKMDPEKWKKVPRRQCCEAS-KGFWSNTMTVKI  493

Query  1589  RRCMADDIIA  1618
             R C   + I 
Sbjct  494   RNCKNRETIT  503



>ref|XP_009143455.1| PREDICTED: uncharacterized protein LOC103867167 [Brassica rapa]
Length=511

 Score =   298 bits (764),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 220/369 (60%), Gaps = 8/369 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N S S +  +N S+  T++SH+ FG+ GS + W  R  Y E WWRPN T GF+ LD+ P 
Sbjct  77    NSSSSAIGQKNQSSEATDISHIFFGIGGSIQTWRERSRYTELWWRPNDTRGFVWLDEEPP  136

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
               +  W P+ PPY+VS++ SR      +      RM   I E+           +RW VM
Sbjct  137   LNMT-WLPTYPPYKVSEDTSRFNYTCWYGTRSAIRMARIIKESF----DLGLTNVRWFVM  191

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDDT+F VDNL+ VL++YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ 
Sbjct  192   GDDDTVFFVDNLITVLSKYDHNQMYYIGGNSESVEQSIVHSYAMAYGGGGIAISYPLAVE  251

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +   +  C+ RY+ L  +D+    CI+ +GV L+   GFHQID+ G+  G L+ HP APL
Sbjct  252   LVKILDGCIDRYASLYGSDQKIEACISGIGVPLTKELGFHQIDIRGNPYGILAAHPVAPL  311

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHH D V+PIFP+  + ++ R  +++  +D  R+LQ   C  + RNWS SV+WGY+  
Sbjct  312   VSLHHLDYVDPIFPASTQIDALRRLISSYKTDPSRILQHSFCHDQTRNWSVSVSWGYTIQ  371

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IY  ++    L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV   
Sbjct  372   IYPSLVTARELETPFLTFKSWRTSSSEP-FTFDTRP-ISEDPCERPIVYFLDRVYEV-GS  428

Query  1388  DEIVATYRR  1414
             ++ + TYR+
Sbjct  429   NQTLTTYRK  437



>emb|CDY68083.1| BnaAnng26110D [Brassica napus]
Length=510

 Score =   298 bits (762),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 219/369 (59%), Gaps = 8/369 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N S S +  +N S+  T++SH+ FG+ GS + W  R  Y E WWRPN T GF+ LD+ P 
Sbjct  76    NSSSSAIGQKNQSSEATDISHIFFGIGGSIQTWRERSRYTELWWRPNDTRGFVWLDEEPP  135

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
               +  W P+ PPY+VS++ SR      +      RM   I E+           +RW VM
Sbjct  136   LNMT-WLPTYPPYKVSEDTSRFNYTCWYGTRSAIRMARIIKESF----DLGLTNVRWFVM  190

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDDT+F VDNL+ VL++YDH + YY+GG+SE +      S+  A+GGGGI +S+PLA+ 
Sbjct  191   GDDDTVFFVDNLITVLSKYDHNQMYYIGGNSESVEQAIVHSYAMAYGGGGIAISYPLAVE  250

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +   +  C+ RY+ L  +D+    CI+ +GV L+   GFHQID+ G+  G L+ HP APL
Sbjct  251   LVKILDGCIDRYASLYGSDQKIEACISGIGVPLTKELGFHQIDIRGNPYGILAAHPVAPL  310

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHH D V+PIFP+  + ++ R  +++  +D  R+LQ   C  + RNWS SV+WGY+  
Sbjct  311   VSLHHLDYVDPIFPASTQIDALRRLISSYKTDPSRILQHSFCHDQTRNWSVSVSWGYTIQ  370

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IY  ++    L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV   
Sbjct  371   IYPSLVTARELETPFLTFKSWRTSSSEP-FTFDTRP-ISEDPCERPIVYFLDRVYEV-GS  427

Query  1388  DEIVATYRR  1414
             ++ + TYR+
Sbjct  428   NQTLTTYRK  436



>gb|KFK36662.1| hypothetical protein AALP_AA4G153700 [Arabis alpina]
Length=865

 Score =   306 bits (785),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/427 (38%), Positives = 246/427 (58%), Gaps = 12/427 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T G++ LD+ P   +  W  +
Sbjct  88    QNQSSEATDVSHIVFGIGGSIQTWRDRSRYSELWWRPNVTRGYVWLDEEPPLNM-TWLAT  146

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPY+VS + SR     N+     +R    I   ++++ +     +RW VMGDDDT+F V
Sbjct  147   SPPYQVSGDTSRF----NYTCSFGSRSAIRIARIIKESFELGLTNIRWFVMGDDDTVFFV  202

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNLV VL++YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ +   +  C+
Sbjct  203   DNLVTVLSKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAVELVKILDGCI  262

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RY+ L  +D+    CI+++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHH D V
Sbjct  263   DRYASLYGSDQKIEACISEIGVPLTKELGFHQVDIRGNPYGLLAAHPLTPLVSLHHLDYV  322

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             +PIFP   + ++ R  M+A  +D  R+LQ   C    RNWS SV+WGY+  IY  ++   
Sbjct  323   DPIFPGTTQIDALRRLMSAYKTDPSRILQHSFCNDLTRNWSISVSWGYTIQIYPSLVTAK  382

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
              L+ P  TF++W  S   P + FD +   + DPC  P  +FL+ V EV    + + TYR+
Sbjct  383   ELETPFLTFKSWRTSSSEP-FSFDTQP-ISEDPCERPIVYFLDRVYEVGTSGQTLTTYRK  440

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA--KIG-RSECCDVTIDSVDSESAV-I  1582
                     C + D  + A+ I  I V +    P   K+  R +CC++     DSES + +
Sbjct  441   HVEVSETQCESPDYYR-ANPIEFIDVSATKWMPELWKMAPRRQCCEILNSEEDSESVINV  499

Query  1583  KTRRCMA  1603
             K R C A
Sbjct  500   KLRHCSA  506



>emb|CDP00131.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   297 bits (760),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/441 (38%), Positives = 248/441 (56%), Gaps = 18/441 (4%)
 Frame = +2

Query  305   DNESRSELESRNDS-NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKP  481
             DN SR+   +     +SPTN++H+VFG+ GS   W+ R  Y   WW+ + T GF+ LDK 
Sbjct  70    DNISRTACNTEEGPISSPTNITHIVFGIGGSTSTWNDRSHYSALWWQDSVTRGFVWLDKE  129

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
             P A+  PWP +SPPYRVS + +R    ++    R++R+V        D+ +     +RW 
Sbjct  130   PDADT-PWPENSPPYRVSSDWTRFRYTSSQSAVRLSRIV-------VDSFRVGLPDVRWF  181

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             VMGDDDT+F  DNLV VLA+YDH + YY+GG+SE +  +   S+  AFGGGGI +S+PLA
Sbjct  182   VMGDDDTVFFPDNLVTVLAKYDHRQMYYVGGNSESVEQDTTHSYDMAFGGGGIAISYPLA  241

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +   +  CL RY +   +D+    CI +LGV+L+  +GFHQID+ GD+ G L+ HP  
Sbjct  242   AELVRVMDGCLDRYYNFYGSDERVWACIKELGVSLTRERGFHQIDIRGDLFGLLAAHPMV  301

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             PL+SLHH D V P+FP++ + ES  + + A + D  +++QQ  C+H    WS S++WGY+
Sbjct  302   PLVSLHHLDHVKPLFPNLTQHESLENLIQAYHMDPAQIMQQSFCYHGWYKWSVSISWGYA  361

Query  1202  ANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT  1381
             A IY  ++    L+ P++TF+TW      P +IF+ R     DPC  P  +++E + E  
Sbjct  362   AQIYPSLVIAGDLEKPLQTFRTWRSWSNGP-FIFNTRP-VNPDPCERPAVYYIEGIGE-D  418

Query  1382  ARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPV--TKPAKIGRSECCDVTID  1555
                  + +Y RS     P    G     A  I +++V +     K  K  R  CC+  I 
Sbjct  419   GNGGTLTSYTRSIAE--PENCRGGHQGHAVGIERVLVSALKMDQKEWKSPRRRCCE--IK  474

Query  1556  SVDSESAVIKTRRCMADDIIA  1618
             S    +  +  RRC   + I 
Sbjct  475   SSKDGTLKVLIRRCNQQESIT  495



>emb|CDY65114.1| BnaC04g53660D [Brassica napus]
Length=511

 Score =   297 bits (760),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/369 (40%), Positives = 219/369 (59%), Gaps = 8/369 (2%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
             N S S +  +N S+  T++SH+ FG+ GS + W  R  Y E WWRPN T GF+ LD+ P 
Sbjct  77    NSSSSAIGQKNQSSEATDISHIFFGIGGSIQTWRERSRYTELWWRPNDTRGFVWLDEEPP  136

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
               +  W P+ PPY+VS++ SR      +      RM   I E+     +     +RW VM
Sbjct  137   LNMT-WLPTYPPYKVSEDTSRFNYTCWYGTRSAIRMARIIKESF----ELGLTNVRWFVM  191

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDDT+F VDNL+ VL++YDH + YY+GG+SE +      S+  A+GGGGI +S+PLA+ 
Sbjct  192   GDDDTVFFVDNLITVLSKYDHNQMYYIGGNSESVEQAIVHSYAMAYGGGGIAISYPLAVE  251

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             +   +  C+ RY+ L  +D+    CI+ +GV L+   GFHQID+ G+  G L+ HP APL
Sbjct  252   LVKILDGCIDRYASLYGSDQKIEACISGIGVPLTKELGFHQIDLRGNPYGILAAHPVAPL  311

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             +SLHH D V+PIFP+  + ++ R  ++A  +D  R+LQ   C  + RNWS SV+WGY+  
Sbjct  312   VSLHHLDYVDPIFPASTQIDALRRLISAYKTDPSRILQHSFCHDQTRNWSVSVSWGYTIQ  371

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IY  ++    L+ P  TF++W  S   P + FD  K  + DPC  P  +FL+ V  V   
Sbjct  372   IYPSLVTARELETPFLTFKSWRTSSSEP-FTFDT-KPISEDPCERPFVYFLDRVYGV-GS  428

Query  1388  DEIVATYRR  1414
             ++ + TYR+
Sbjct  429   NQTLTTYRK  437



>ref|XP_002271331.1| PREDICTED: uncharacterized protein LOC100242633 [Vitis vinifera]
 emb|CBI30510.3| unnamed protein product [Vitis vinifera]
Length=519

 Score =   296 bits (759),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 236/429 (55%), Gaps = 20/429 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH++FG+ GS   W  RR Y E WW+PN T GF+ LD+ P AE   WP +SPPY+VS
Sbjct  90    TNISHILFGIGGSTATWSERRRYCELWWKPNVTRGFVWLDEKP-AENETWPETSPPYQVS  148

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + S     +   +    R    I   V+++ +     +RW VMGDDDT+F  +NLV VL
Sbjct  149   GDTSGFKYPSWSGSASAVR----IARIVKESFELGLENVRWFVMGDDDTVFFTENLVAVL  204

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A+YDH + YY+GG SE +  N   S+  AFGGGG  +S+PLA  +   + +C+ RY    
Sbjct  205   ARYDHNQMYYIGGSSESVEQNMIHSYNMAFGGGGFAISYPLATELVRVLDECIDRYYLFY  264

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    CI+++GV L+   GFHQ+D+ GD  GFL+ HP APL+SLHH D V  +FPSM
Sbjct  265   GSDQKIHGCISEIGVPLTKELGFHQVDIRGDPYGFLAAHPVAPLVSLHHIDFVESLFPSM  324

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              + ES +  + A   D  R LQQ +C+   RN S SVAWGYS  +Y  ++    L+ P +
Sbjct  325   TQIESLKRLVRAYEVDPGRTLQQSICYDFSRNRSVSVAWGYSVQLYPSLVTTEELETPFQ  384

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TFQTW      P + F+ R   + +PC  P  +FL+ V+      + + TY R     L 
Sbjct  385   TFQTWRSWGSQP-FTFNTRP-MSQEPCERPVIYFLDRVQMTGINGQTLTTYER-----LG  437

Query  1436  ACFAGDGDQS----ADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-IKTR  1591
                  D +QS       +    V +   +P    K  R +CC+V   +   ES V +K R
Sbjct  438   FQPEKDCNQSHYAPLSAVHSFNVSAFQLRPESWEKARRRQCCEVVDGTDGVESVVQVKIR  497

Query  1592  RCMADDIIA  1618
              C   +I++
Sbjct  498   ECSHGEILS  506



>ref|XP_006410964.1| hypothetical protein EUTSA_v10017530mg [Eutrema salsugineum]
 gb|ESQ52417.1| hypothetical protein EUTSA_v10017530mg [Eutrema salsugineum]
Length=514

 Score =   296 bits (758),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 159/429 (37%), Positives = 245/429 (57%), Gaps = 13/429 (3%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             E+  +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T GF+ LD+ P   +  
Sbjct  83    EILRQNQSSEATDVSHIVFGIGGSIQTWRDRSRYSELWWRPNNTRGFVWLDEEPPLNMT-  141

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
             W P+SPPY+VS N SR     N+     +R    +   ++++ +     +RW VMGDDDT
Sbjct  142   WLPTSPPYQVSANTSRF----NYTCWYGSRSAIRMARIIKESFELGLTNVRWFVMGDDDT  197

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F VDNLV VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +
Sbjct  198   VFFVDNLVTVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAAELVKIL  257

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C+ RY+ L  +D+    CI+++GV ++   GFHQID+ G+  G L+ HP APL+SLHH
Sbjct  258   DGCIDRYASLYGSDQKIEACISEIGVPVTKELGFHQIDIRGNPYGLLAAHPVAPLVSLHH  317

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D V+PIFP+  + ++ R  ++A  +D  R+LQ   C    RNWS SV+WGY+  IY  +
Sbjct  318   LDYVDPIFPATTQLDALRRLISAYKTDPSRILQHSFCHDPTRNWSVSVSWGYTIQIYPSL  377

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKR-TTTDPCLVPHAFFLESVEEVTARDEIV  1399
             +    L+    TF++W  S   P   F +  R  + DPC  P  +FL+ V EV    + +
Sbjct  378   VTAKELETLFLTFKSWRTSSSEP---FSLDTRPISEDPCERPIFYFLDRVYEV-GSGQTL  433

Query  1400  ATYRRSWRRGLPACFAGDGDQ-SADRISKIVVYSPVTKPAKIG-RSECCDVTIDSVDSES  1573
              TYR+        C + +  + S+     + V   + +  K+  R +CC++     +SE+
Sbjct  434   TTYRKHVEVSDTQCDSSEYSRASSVEFIDVSVTKWMPEIWKMAPRRQCCEIVNSEEESEN  493

Query  1574  AV-IKTRRC  1597
              + +K R C
Sbjct  494   VINVKIRHC  502



>gb|KFK25520.1| hypothetical protein AALP_AA8G125800 [Arabis alpina]
Length=323

 Score =   290 bits (741),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 141/323 (44%), Positives = 203/323 (63%), Gaps = 8/323 (2%)
 Frame = +2

Query  653   RWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSF  832
             RW V+GDDDT+F +DNLV+ L +YDH K YY+G +SE +  N  F+F   +GGGG  LS+
Sbjct  8     RWFVIGDDDTLFFLDNLVEALGRYDHKKDYYIGMNSENVWCNAIFAFDMGYGGGGYALSY  67

Query  833   PLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYH  1012
             P    + + + +C+ RY  + S D  +  C++DLG++L+  +G HQID+HGDISG LS H
Sbjct  68    PTVEKLLNKMEECIGRYIGVFS-DLLSFRCLSDLGIDLTLEKGIHQIDLHGDISGLLSAH  126

Query  1013  PNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAW  1192
             P +PLISLHHFD+++ IFP MNR ES  H M  A +DQ R+LQQ +C+ +  NWS SV+W
Sbjct  127   PQSPLISLHHFDVIDAIFPGMNRQESVNHLMKTAKTDQSRVLQQTICYEKANNWSVSVSW  186

Query  1193  GYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE  1372
             GYS +IY+ I PR++L+ P+ETF  W      P + F+ R R T DPC +P  FF +SV 
Sbjct  187   GYSVHIYQSIFPRNHLKRPLETFLPW-KRVHAPLYTFNTR-RVTNDPCEMPRQFFFDSVV  244

Query  1373  EVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS-ECCDVT  1549
             E  ++  +   Y+      LP C   +G+ S   IS++ V +      K+G   ECCDV 
Sbjct  245   EDQSQSSVTTMYKVKTASSLPPCLL-NGNHSTSNISQVRVIAATMH--KMGEGIECCDVQ  301

Query  1550  IDSVDSESAVIKTRRCMADDIIA  1618
              +   +E   +K R C+ D+++A
Sbjct  302   -NVSSTEILEVKIRACLNDELLA  323



>ref|XP_002881548.1| hypothetical protein ARALYDRAFT_902953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57807.1| hypothetical protein ARALYDRAFT_902953 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   296 bits (758),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 160/423 (38%), Positives = 243/423 (57%), Gaps = 13/423 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T GF+ L++ P   +  W P+
Sbjct  89    QNQSSEATDISHIVFGIGGSIQTWRDRSRYSELWWRPNVTRGFVWLEEEPPLNMT-WLPT  147

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPY+VS + SR     N+     +R    +   ++++       +RW VMGDDDT+F V
Sbjct  148   SPPYQVSADTSRF----NYTCWFGSRSAIRMARIIKESFGLGLTNVRWFVMGDDDTVFFV  203

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNLV VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ +   +  C+
Sbjct  204   DNLVTVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAVELVKILDGCI  263

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RY+ L  +D+    CI+++GV L+   GFHQ+D+ G+  G L+ HP APL++LHH D V
Sbjct  264   DRYASLYGSDQKIEACISEIGVPLTKELGFHQVDIRGNPYGLLAAHPVAPLVTLHHLDYV  323

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             +PIFP+  + ++ R  ++A  +D  R+LQ   C    R+W  SV+WGY+  IY  ++   
Sbjct  324   DPIFPATTQIDALRRLVSAYKTDPRRILQHSFCHDPTRDWFVSVSWGYTIQIYPSLVTAK  383

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
              L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV    + + TYR+
Sbjct  384   ELETPFLTFKSWRTSSSEP-FSFDTRP-ISEDPCERPIVYFLDRVYEV-GSGQTLTTYRK  440

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-I  1582
                 G   C + D  + A+ +  I V +    P       R +CC+V     DSES + +
Sbjct  441   HVDVGETQCKSLDYSR-ANSVEFIDVSATTWMPDLWKMAPRRQCCEVVNSEEDSESVINV  499

Query  1583  KTR  1591
             K R
Sbjct  500   KIR  502



>ref|XP_010256824.1| PREDICTED: uncharacterized protein LOC104597114 [Nelumbo nucifera]
Length=504

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 158/432 (37%), Positives = 233/432 (54%), Gaps = 13/432 (3%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S    N    +SH++FG+ GS K W  RR Y E WW+PN T GF+ LD  P  +  PWP 
Sbjct  73    SSEGYNERMGVSHILFGIGGSLKTWKDRRYYSELWWKPNITRGFVWLDDEPDNKD-PWPE  131

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             +SPPYRVSD+ S +     + +    R+   ++E+     Q     +RW VMGDDDT+F 
Sbjct  132   TSPPYRVSDHSSTLKYAKLYCSRPALRLARIVLESF----QLGLENVRWFVMGDDDTVFF  187

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             V+NLV VL++YDH + YY+GG+SE +  +   S+  AFGGGG  +S+PLA  +   +  C
Sbjct  188   VENLVSVLSKYDHNQMYYVGGNSESVEQDVMHSYDMAFGGGGFAISYPLAAEVVKVLDGC  247

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             + RY+ L  AD+    C++++GV L+   GFHQ+D+ GD  G L+ HP APL+SLHH D 
Sbjct  248   IDRYASLYGADQMIQACLSEIGVPLTKESGFHQVDIRGDPYGLLASHPVAPLVSLHHLDY  307

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             V P FP+  + ES R    A  +D  R LQ+  C+    NWS SV+WGY+A IY  ++  
Sbjct  308   VKPFFPTETQLESVRRLYGAYKADPGRTLQRSFCYDIKHNWSVSVSWGYTAQIYPYLLTA  367

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESV--EEVTARDEIVAT  1405
               +++ ++TFQTW      P + F+ R  +   PC  P  + LE V  +E+  R + + T
Sbjct  368   KEMESALQTFQTWRSWSNGP-FTFNTRPLSGLAPCERPLIYLLEQVNNDEIGQR-QTLTT  425

Query  1406  YRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT----KPAKIGRSECCDVTIDSVDSES  1573
             Y+R      P          A   +  V  S       +  K  R +CC++   +     
Sbjct  426   YKRFVEDPGPGVVCNQSIYGAALAAYYVSVSASKFDGGEWKKAPRRQCCEIIHTNGTDSI  485

Query  1574  AVIKTRRCMADD  1609
               +K R C  ++
Sbjct  486   VQVKIRSCKPNE  497



>ref|XP_004253290.1| PREDICTED: uncharacterized protein LOC101251270 [Solanum lycopersicum]
Length=533

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 158/424 (37%), Positives = 237/424 (56%), Gaps = 15/424 (4%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N S+  T++SH+ FG+ GS + W  R  Y E WWRPN T GF+ LD+ P   +  W  +S
Sbjct  90    NQSSEATDISHIAFGIGGSIQTWRDRSRYSELWWRPNVTRGFIWLDEEPPLNMT-WLSTS  148

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPY+VS + SR      + +    RM   I ET     +     +RW +MGDDDT+F VD
Sbjct  149   PPYQVSADTSRFSYTCWYGSRSAIRMARIIKETF----ELGLTDVRWFIMGDDDTVFFVD  204

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NL+ VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ +   +  C+ 
Sbjct  205   NLITVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAVELVKLLDGCID  264

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY+ L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APL++LHH D V+
Sbjct  265   RYASLYGSDQKIEACLSEIGVPLTKELGFHQVDIRGNPYGLLAAHPVAPLVTLHHLDYVD  324

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFP   + ++ R  ++A  +D  R+LQ   C  + RNW  SV+WGY+  IY  ++    
Sbjct  325   PIFPGTTQIDALRRLVSAYKTDPSRILQHSFCHDQTRNWYVSVSWGYTIQIYPTLVTAKE  384

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV    + + TYR+ 
Sbjct  385   LETPFLTFKSWRTSSSEP-FSFDTRP-ISEDPCERPLVYFLDRVYEV-GSGQTLTTYRKH  441

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG-----RSECCDVTIDSVDSESAV-  1579
                G  +      D S     + +  S  T    +G     R +CC++     DSES + 
Sbjct  442   VEVG-ESTQCNSPDYSRANPVEFIDVSTTTLTPDLGKWLAPRRQCCEIVNSEEDSESVIN  500

Query  1580  IKTR  1591
             +K R
Sbjct  501   VKIR  504



>emb|CDY53960.1| BnaA10g29920D [Brassica napus]
Length=285

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 195/289 (67%), Gaps = 6/289 (2%)
 Frame = +2

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAM  844
             MGDDD++F VDN+VDVL++YDHT+  Y+G  SE   +N   +F+ A+GGGG  LS+PL  
Sbjct  1     MGDDDSLFFVDNIVDVLSKYDHTEKRYIGMFSESTKSNFRLAFEMAYGGGGYALSYPLVE  60

Query  845   AMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAP  1024
             A+   + +C+++Y  + + DK   YC+ADLG +L P +GFHQ+D+ GD+SG LS HP AP
Sbjct  61    ALVAKLDECIEKYHFIWAGDKLQSYCLADLGADLIPEKGFHQMDLRGDLSGLLSSHPTAP  120

Query  1025  LISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSA  1204
             L+SLHHFD V P+FP MNR  S    M AAN DQ RMLQQ +C+ R  NW+FSV+WGYSA
Sbjct  121   LLSLHHFDAVAPLFPGMNRHGSVLQIMKAANVDQSRMLQQSICYVRASNWTFSVSWGYSA  180

Query  1205  NIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
             ++YEKI PRSYL+ PIETF+ W     P  +     +R + +PC  PH FF +S+E+V  
Sbjct  181   HVYEKIFPRSYLKLPIETFRPWLRGWFP--FYMSNTRRVSRNPCEAPHWFFFDSIEQVDG  238

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS  1531
                +V +Y R + R + +C +   D SAD ++ I V+SP+T P ++  S
Sbjct  239   --GVVTSYTRKFIRNMTSC-SFSCDISADPLASIRVFSPIT-PKEVSSS  283



>ref|XP_006602605.1| PREDICTED: uncharacterized protein LOC100813750 [Glycine max]
Length=458

 Score =   293 bits (749),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 160/424 (38%), Positives = 233/424 (55%), Gaps = 14/424 (3%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             +  + TN+SHL+FG+ GS   W  RR Y E WWRP AT GF+ L+  P  +   WP +SP
Sbjct  35    EEKASTNISHLLFGIGGSSATWQTRRQYSELWWRPGATRGFVWLESHP-PDNTTWPETSP  93

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PYRVS + S V + T     R A  +  I   V+++ +     +RW VMGDDDT+F  DN
Sbjct  94    PYRVSGDTS-VFKYTCSYGSRSAIRIARI---VKESFELGLENVRWFVMGDDDTVFFTDN  149

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VL++YDH + YY+GG+SE +  +    +  AFGGGG  +S+PLA  +   +  C+ R
Sbjct  150   LVTVLSKYDHNEMYYVGGNSESVEQDVIHFYTMAFGGGGFAISYPLAKELVRILDGCIDR  209

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y+    +D+    CI+++GV ++   GFHQ+D+HG+  G L+ HP APL+SLHH D V+P
Sbjct  210   YAEFYGSDQKIQSCISEIGVQVTKEPGFHQVDIHGNPYGLLAAHPVAPLVSLHHLDYVDP  269

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP+  R  + +  + A   D  R LQ+  C+   RNWS SV+WGYS  +Y  +     L
Sbjct  270   IFPNTTRVNAVKKLITAYKMDPGRTLQKSFCYDLRRNWSVSVSWGYSVELYPSLRTSKEL  329

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             +   ETF+TW      P + F+ R   + D C  PH + L+ V  V   D   + YR++ 
Sbjct  330   ETAFETFRTWRTWHDGP-FTFNTRP-VSVDTCERPHVYVLDGVRNVDG-DMTRSWYRKTV  386

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVT--IDSVDSESAVIK  1585
                   C A +    A  +  + VY+    P    K  R +CC++    D V+S    +K
Sbjct  387   DASGKEC-AREEYARALEVQYVDVYASRFVPDKWKKAPRRQCCEIMDGADGVNSSVVRVK  445

Query  1586  TRRC  1597
              R C
Sbjct  446   IRGC  449



>ref|NP_565869.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC23643.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AEC09440.1| uncharacterized protein AT2G37730 [Arabidopsis thaliana]
 gb|AHL38801.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=532

 Score =   294 bits (753),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 156/422 (37%), Positives = 235/422 (56%), Gaps = 12/422 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N S+  T++SH+ FG+ GS + W  R  Y E WWRPN T GF+ LD+ P   +  W  +S
Sbjct  90    NQSSEATDISHIAFGIGGSIQTWRDRSRYSELWWRPNVTRGFIWLDEEPPLNMT-WLSTS  148

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPY+VS + SR      + +    RM   I ET     +     +RW +MGDDDT+F VD
Sbjct  149   PPYQVSADTSRFSYTCWYGSRSAIRMARIIKETF----ELGLTDVRWFIMGDDDTVFFVD  204

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NL+ VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ +   +  C+ 
Sbjct  205   NLITVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAVELVKLLDGCID  264

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY+ L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APL++LHH D V+
Sbjct  265   RYASLYGSDQKIEACLSEIGVPLTKELGFHQVDIRGNPYGLLAAHPVAPLVTLHHLDYVD  324

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFP   + ++ R  ++A  +D  R++Q   C  + RNW  SV+WGY+  IY  ++    
Sbjct  325   PIFPGTTQIDALRRLVSAYKTDPSRIIQHSFCHDQTRNWYVSVSWGYTIQIYPTLVTAKE  384

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV    + + TYR+ 
Sbjct  385   LETPFLTFKSWRTSSSEP-FSFDTRP-ISEDPCERPLVYFLDRVYEV-GSGQTLTTYRKH  441

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-IK  1585
                G            A+ +  I V +    P       R +CC++     DSES + +K
Sbjct  442   VEVGESTQCNSPDYSRANPVEFIDVSTTTLTPDLWKMAPRRQCCEIVNSEEDSESVINVK  501

Query  1586  TR  1591
              R
Sbjct  502   IR  503



>ref|XP_011077633.1| PREDICTED: uncharacterized protein LOC105161594 [Sesamum indicum]
Length=502

 Score =   293 bits (750),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/404 (37%), Positives = 226/404 (56%), Gaps = 11/404 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T +SH++FG+ GS + W  RR Y E WW+PN T G++ LD+ PG    PWP +SPPY+VS
Sbjct  87    TTISHILFGIGGSAETWSSRRHYCELWWKPNVTRGYVWLDEEPGKTGEPWPKTSPPYKVS  146

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + SR      + N   +R    I   V+++ +     +RW V+GDDDT+F  +NLV+VL
Sbjct  147   ADTSRF----KYTNWYGSRSAIRIARIVKESFELGLENVRWFVLGDDDTVFFTENLVNVL  202

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
              +YDH + YY+GG+SE +  N   S+   +GGGG  +S+PLA  +   +  C+ RY+   
Sbjct  203   NKYDHKQMYYIGGNSESVEQNLVHSYTMGYGGGGFAISYPLAAELVRILDGCIDRYAEFY  262

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D   G C++++GV ++   GFHQ+D+ G   G LS HP APL+SLHH D V  +FP  
Sbjct  263   GSDLKIGGCMSEIGVPVTKELGFHQMDIRGSPFGLLSAHPLAPLVSLHHLDYVQSLFPGT  322

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             NR +S +  + A  SD  R LQQ  C+   RNWS SV+WGY+  +Y  ++    L  P++
Sbjct  323   NRVDSVKRLIQAYKSDPSRTLQQSFCYDPIRNWSISVSWGYNVQLYPFLVTAKDLSTPLQ  382

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF T+G   + P + F+ R   +  PC  P  F+ + VE        +  YRR  +    
Sbjct  383   TFLTFGSWSQEP-FTFNTRV-MSLKPCERPIIFYFDRVEGF-GHGRTLTMYRRPRQDNRR  439

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDS  1558
              C  G+   +A  +    V +P+  P    K  R ECC++  D+
Sbjct  440   QC-DGENYAAAYSVKGFNVSAPLLHPTIWNKAPRRECCEIMKDA  482



>ref|XP_011007127.1| PREDICTED: uncharacterized protein LOC105112918 [Populus euphratica]
Length=501

 Score =   292 bits (748),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/372 (41%), Positives = 216/372 (58%), Gaps = 11/372 (3%)
 Frame = +2

Query  305   DNESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KP  481
             D+   +  E    S   TN+SH++FG+ GS K W+ RR Y E WW PN T G++ LD KP
Sbjct  68    DHREITNGEVSGYSYEKTNISHILFGIGGSAKTWNKRRHYTEVWWMPNITRGYVWLDQKP  127

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
             PG +   WP +SP Y+VS + SR    +++ +    R    I   V+++       +RW+
Sbjct  128   PGND--TWPLTSPSYKVSADTSRFKYTSSYGSRSALR----IARIVKESFDLGLENVRWL  181

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             VMGDDDT+F ++NLV VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA
Sbjct  182   VMGDDDTVFFIENLVLVLAKYDHNQMYYIGGNSESVEQDEIHSYAMAYGGGGFAISYPLA  241

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +   +  CL RY+    +D+    CI+++GV L+   GFHQ+D+ GD  G L+ HP A
Sbjct  242   KELVRILDGCLDRYASFYGSDQKVQGCISEIGVPLTKELGFHQVDIRGDPYGLLAAHPLA  301

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             PL+SLHH D V  IFP ++R +S    + A  +D  R LQ   C+   RNWS S +WGY+
Sbjct  302   PLVSLHHLDYVQSIFPGLSRFDSVNKLITAYKTDPGRTLQYSFCYDLTRNWSVSASWGYT  361

Query  1202  ANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT  1381
               +Y  ++    LQ    TFQTW      P + F+ R     DPCL P  +FL+ VE V 
Sbjct  362   VQLYPALLTAMQLQTVFRTFQTWRRWSEGP-FTFNTRP-MNVDPCLRPVVYFLDRVERVG  419

Query  1382  ARDEIVATYRRS  1417
               D  + TY+RS
Sbjct  420   --DGTLTTYKRS  429



>ref|XP_009783166.1| PREDICTED: uncharacterized protein LOC104231809 [Nicotiana sylvestris]
Length=502

 Score =   292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/417 (38%), Positives = 242/417 (58%), Gaps = 17/417 (4%)
 Frame = +2

Query  365   SHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNV  544
             SH+VFG+ GS KAW++R  Y E WWRPN T GF+ LD+ P  +  PW  + PPYRVS + 
Sbjct  72    SHIVFGIRGSAKAWNNRSRYSELWWRPNVTRGFVWLDEKP-HDNEPWSETFPPYRVSQDT  130

Query  545   SRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQY  724
             S+  + T     R A  +  I   V+++ +     +RW VMGDDDT+F  +NLV VLA+Y
Sbjct  131   SKF-KYTCWFGDRSAVRIARI---VKESFELGLKNVRWFVMGDDDTVFFPENLVTVLAKY  186

Query  725   DHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSAD  904
             DH + YY+GG+SE +  +  FS+  A+GGGG  +S+PLA  +   +  C+ RY +L S+D
Sbjct  187   DHNQMYYIGGNSESVETDVVFSYSMAYGGGGFAISYPLAADLVKILDSCINRYHYLFSSD  246

Query  905   KTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD--MVNPIFPSMN  1078
             +  G C+A++GV+L+   GFHQ+D+HG   G L+ HP APL+SLHH D  ++ P+ PSM+
Sbjct  247   QKIGSCVAEIGVSLTKEPGFHQMDIHGSPRGLLAAHPVAPLVSLHHLDVYVLQPLIPSMS  306

Query  1079  RAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIET  1258
             R ES +  + A N D  R LQ  LC+   RNWS SV+WG+S  +Y  +M    L+ P++T
Sbjct  307   RFESVKKVIEAYNKDPSRTLQHSLCYDLKRNWSLSVSWGFSVQLYPWLMNARELEMPMQT  366

Query  1259  FQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPA  1438
             F+TW  S  P  + F+ R     +PC  P  ++L+ V ++    E + +Y      G+  
Sbjct  367   FKTWKGSEEP--FTFNTRP-NNVEPCKSPIEYYLDQVLDLR-NGETLTSYNTI--TGINK  420

Query  1439  CFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAV-IKTRRC  1597
                    + A  +  + + + +  P    +  R +CC+V  +     S++ I+ R C
Sbjct  421   QCENQNYRPALAVHMVNITASMLSPEVWRQAPRRQCCEVINEEDGIRSSLHIRIRGC  477



>ref|XP_010658534.1| PREDICTED: uncharacterized protein LOC100244414 [Vitis vinifera]
 ref|XP_010658535.1| PREDICTED: uncharacterized protein LOC100244414 [Vitis vinifera]
 emb|CBI31635.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 241/422 (57%), Gaps = 15/422 (4%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
              D+   TN+SH+ FG+ GS   W  RR Y E WW+PN + G++ LD  P A + PWP SS
Sbjct  82    GDNLGETNISHVQFGIAGSVATWKDRRHYSELWWKPNVSRGYVWLDGKPDAAV-PWPKSS  140

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYRVS++ SR    ++    R+AR+V    E+ R         +RW VMGDDDT+F  +
Sbjct  141   PPYRVSEDWSRFKYSSSQSAVRIARIVS---ESFR----VGLPNVRWFVMGDDDTVFFTE  193

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+YDH + YY+G +SE +  +   S+  AFGGGG  +S+ LA  +A  +  CL 
Sbjct  194   NLVSVLAKYDHRQVYYIGANSESVEQDVMHSYGMAFGGGGFAVSYGLAAKLATMLDGCLD  253

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY     +D+    C++++GV+L+  +GFHQ+D+ GD  G L+ HP APL+SLHH D V+
Sbjct  254   RYYRFYGSDQRIWACVSEIGVSLTAERGFHQMDIRGDPYGLLAAHPVAPLVSLHHIDAVS  313

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             P+FPS    +S +    A   D  R+LQQ  C+   RNWS SV+WGY+A +Y   +P   
Sbjct  314   PMFPSHTHLDSLKSLFRAYQVDPARILQQSFCYDHRRNWSISVSWGYTAQLYPWFVPAHI  373

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L  P++TFQTW    + P + F+ R+  T+DPC  P  +FLE V EV A+ E +++Y R+
Sbjct  374   LDKPLQTFQTWRSRSQGP-FTFNTRQ-VTSDPCEQPVIYFLEEVREV-AKGETMSSYGRA  430

Query  1418  WRRGLPACFAGDGD--QSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
               +   AC   D     +  RI    +        K  R +C ++    +   +  +K R
Sbjct  431   VAQPEKACQRPDYAPVMAVQRIKVSTLKMSPQDWKKAPRRQCSEIV--KLKDSTLQVKIR  488

Query  1592  RC  1597
              C
Sbjct  489   SC  490



>ref|XP_004503166.1| PREDICTED: uncharacterized protein LOC101513286 isoform X2 [Cicer 
arietinum]
Length=490

 Score =   291 bits (744),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 241/427 (56%), Gaps = 16/427 (4%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D++ PTN++H+VFG+ GS   WH R  Y + WW PN   GF+ LDK P   +L       
Sbjct  78    DNSVPTNITHIVFGIAGSANTWHDRSNYGKLWWNPNTCRGFVWLDKRP--NILQRDDMLI  135

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PY++S   ++     +    R+AR+V+       ++ +     +RW VMGDDDT+F  +N
Sbjct  136   PYKISHGWTQFKHLHSASAVRIARIVY-------ESFRLGLPNVRWFVMGDDDTVFFTEN  188

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV+VL +YDH++ YY+GG+SE +  +   S+  AFGGGG  +S+ LA  +A  +  CL R
Sbjct  189   LVNVLGKYDHSQLYYIGGNSESVEQDLMHSYDMAFGGGGFAISYALAARLAKIMDSCLHR  248

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y +   +D+    C+ +LGV L+   GFHQ+D+HG+  G L+ HP APL+SLHH D +N 
Sbjct  249   YFYFYGSDQRVWACVNELGVPLTRESGFHQLDIHGNPYGLLAAHPMAPLVSLHHLDQLNS  308

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             +FP  ++  S R  ++A + D  R++QQ +C+   R WS S++WGY+  IY  ++  + L
Sbjct  309   LFPDHSQMHSLRKLISAYHLDPARIVQQSICYDHLRKWSISISWGYTIQIYTSLLITADL  368

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             Q P++TFQTW  S   P + F+ R    +D C  P  FFL+ V +V+     V TY+R  
Sbjct  369   QMPLQTFQTWRSSSDGP-FTFNTRP-MNSDLCQQPTIFFLDQVRKVSTGS--VTTYKRYV  424

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTI-DSVDSESAVIKTRRC  1597
              +    C   DG+    ++S +++     K   +   +CC +    S+   S  I+ R+C
Sbjct  425   DKEEKTCKRADGEVQIIKVSALMLDPGYWK--NVPHRQCCQLMDGGSIKDGSVHIRIRKC  482

Query  1598  MADDIIA  1618
              A + I 
Sbjct  483   RAQETIT  489



>gb|ABR17242.1| unknown [Picea sitchensis]
Length=492

 Score =   290 bits (743),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 157/427 (37%), Positives = 231/427 (54%), Gaps = 16/427 (4%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             + T+L H+VFG+  S   W  R+ Y++ WW P  T GF+ LD+P         P  PP R
Sbjct  76    TATSLDHIVFGIAASAHKWKQRKPYIDLWWEPGRTRGFVWLDRPVNET----SPPGPPIR  131

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             +S++ S+     N+ +P+  R    I   V +  +     +RW VMGDDDT+FL  NLV 
Sbjct  132   ISEDTSQF----NYTHPQGMRSAIRISRIVSEIFRLGLPDVRWFVMGDDDTLFLPQNLVR  187

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VLA+YDH +YYY+G +SE    N   S+  A+GGGG  +S+PLA  +A    DCL RY H
Sbjct  188   VLAKYDHNQYYYIGSNSESTDQNAMHSYGMAYGGGGFAISYPLARDLAQVQDDCLHRYPH  247

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D+    C+A+LGV L+   GFHQ D+HG++ G L+ HP APL+SLHH + V P+FP
Sbjct  248   LYGSDQRVQACLAELGVPLTKEPGFHQFDIHGNLFGLLAAHPIAPLVSLHHLESVAPVFP  307

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +M R  + RH M AA  D  R LQQ +C+   R W+ SV+WGY   + ++I     L+ P
Sbjct  308   NMTRVGALRHLMEAARVDPDRALQQSICYDARRKWTVSVSWGYCVQVLDRIELPRVLEFP  367

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             ++TF  WG S + P ++F+ R     +PC      F+E+       +++V+ Y +     
Sbjct  368   LQTFVAWGHSMKTP-FLFNTRP-VPRNPCQRATVLFMENAASGNFSEDVVSRYTKLQPPE  425

Query  1430  L--PACFAGDGDQSADRISKIVVYSPVTKP--AKIGRSECCDVTIDSVDSESAVIKTRRC  1597
             L    C  G      + + KI V+S   +P      R  CC+V   S       I+ R C
Sbjct  426   LINSNCSRGHDGDHPNSLQKITVFSKKMRPDWTMAPRRHCCEVI--SSTKSGMEIEIRSC  483

Query  1598  MADDIIA  1618
                + ++
Sbjct  484   RDGEAVS  490



>ref|XP_004503165.1| PREDICTED: uncharacterized protein LOC101513286 isoform X1 [Cicer 
arietinum]
Length=494

 Score =   290 bits (743),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 241/427 (56%), Gaps = 16/427 (4%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D++ PTN++H+VFG+ GS   WH R  Y + WW PN   GF+ LDK P   +L       
Sbjct  82    DNSVPTNITHIVFGIAGSANTWHDRSNYGKLWWNPNTCRGFVWLDKRP--NILQRDDMLI  139

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PY++S   ++     +    R+AR+V+       ++ +     +RW VMGDDDT+F  +N
Sbjct  140   PYKISHGWTQFKHLHSASAVRIARIVY-------ESFRLGLPNVRWFVMGDDDTVFFTEN  192

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV+VL +YDH++ YY+GG+SE +  +   S+  AFGGGG  +S+ LA  +A  +  CL R
Sbjct  193   LVNVLGKYDHSQLYYIGGNSESVEQDLMHSYDMAFGGGGFAISYALAARLAKIMDSCLHR  252

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y +   +D+    C+ +LGV L+   GFHQ+D+HG+  G L+ HP APL+SLHH D +N 
Sbjct  253   YFYFYGSDQRVWACVNELGVPLTRESGFHQLDIHGNPYGLLAAHPMAPLVSLHHLDQLNS  312

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             +FP  ++  S R  ++A + D  R++QQ +C+   R WS S++WGY+  IY  ++  + L
Sbjct  313   LFPDHSQMHSLRKLISAYHLDPARIVQQSICYDHLRKWSISISWGYTIQIYTSLLITADL  372

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             Q P++TFQTW  S   P + F+ R    +D C  P  FFL+ V +V+     V TY+R  
Sbjct  373   QMPLQTFQTWRSSSDGP-FTFNTRP-MNSDLCQQPTIFFLDQVRKVSTGS--VTTYKRYV  428

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTI-DSVDSESAVIKTRRC  1597
              +    C   DG+    ++S +++     K   +   +CC +    S+   S  I+ R+C
Sbjct  429   DKEEKTCKRADGEVQIIKVSALMLDPGYWK--NVPHRQCCQLMDGGSIKDGSVHIRIRKC  486

Query  1598  MADDIIA  1618
              A + I 
Sbjct  487   RAQETIT  493



>ref|XP_010505370.1| PREDICTED: uncharacterized protein LOC104782203 [Camelina sativa]
Length=520

 Score =   291 bits (745),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 158/423 (37%), Positives = 241/423 (57%), Gaps = 13/423 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T GF+ LD+ P   +  W P+
Sbjct  89    KNQSSEATDVSHIVFGIGGSIQTWGDRSRYSELWWRPNVTRGFVWLDEEPPLNMT-WLPT  147

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPY+VS + SR      + +    RM   I ET           +RW VMGDDDT+F V
Sbjct  148   SPPYQVSADTSRFNYTCWYGSRSAIRMARIIKETF----ALGLTNVRWFVMGDDDTVFFV  203

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNL+ VL +YDH + YY+GG+SE +  +   S+  A+GGGG+ +S+PLA+ +   +  C+
Sbjct  204   DNLITVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGMAISYPLAVELVKILDGCI  263

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RY+ L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APLI+LHH D V
Sbjct  264   DRYASLYGSDQKIEACLSEIGVPLTKELGFHQVDIRGNPYGLLAAHPVAPLITLHHLDYV  323

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             + IFP+ N+ ++ R  M+A  +D  R++Q   C    RNWS SV+WGY+  IY  ++   
Sbjct  324   DSIFPATNQIDALRRLMSAYKTDPSRIIQHSFCHDPSRNWSVSVSWGYTIQIYPSLVTGK  383

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
              L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V E+    + + TYR+
Sbjct  384   ELETPFLTFKSWRTSSLEP-FSFDTRP-ISGDPCERPIVYFLDRVYEI-GSGQTLTTYRK  440

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-I  1582
                 G   C +    + A+ +  I V +   +P       R + C++     DS++ + +
Sbjct  441   HVDVGEAQCDSPHYSR-ANSVEFIDVSATTWRPNLWKMAPRRQFCEIVNSEGDSKNVIHV  499

Query  1583  KTR  1591
             K R
Sbjct  500   KIR  502



>ref|XP_008442515.1| PREDICTED: uncharacterized protein LOC103486366 [Cucumis melo]
Length=493

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 155/429 (36%), Positives = 234/429 (55%), Gaps = 26/429 (6%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             ++++ +    PTN+SHLVFG+ GS K W+ RR Y E WW+ N T GF+ L++ P      
Sbjct  66    KVKAFDAGEQPTNISHLVFGIGGSVKTWNERRHYCELWWKKNVTRGFVWLEEKPE---YA  122

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
             WP SSPPYR+S + S+     N+      R    +   +++  +     +RW VMGDDDT
Sbjct  123   WPESSPPYRISADTSKF----NYTCWYGFRSAIRVARIIKETYEMGLENVRWFVMGDDDT  178

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F VDNL+D+L +YDH + YY+G +SE +  +   S+  A+GGGG  +S+PLA  +   +
Sbjct  179   VFFVDNLIDMLGRYDHNQMYYIGANSESVEQDVVHSYAMAYGGGGFAISYPLATVLVQIL  238

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C+ RY+H+  +D+    CI ++GV L+   GFHQ+D+ G+  G L+ HP APL+SLHH
Sbjct  239   DGCIDRYAHMYGSDQKIQGCITEIGVPLTKELGFHQLDIRGNPYGILAAHPIAPLVSLHH  298

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D V  IFP+M + +S +    A  +D  R LQ   C+   RNWS SV+WGYS  +Y  +
Sbjct  299   LDYVQSIFPAMTQPDSLKKLYKAYETDPSRALQHSFCYDTVRNWSVSVSWGYSVQLYPWL  358

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD-EIV  1399
             +    ++    T+QTW  +   P + FD +   ++DPC  P  +FL S E + +R    +
Sbjct  359   VTAKEMETAFLTYQTWKTNSNEP-FTFDTQP-VSSDPCKRPILYFLNSTERLGSRQWRTL  416

Query  1400  ATYRRSWRRG-------LPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTID-  1555
              TY+R             PA      + SA    + +         +  R +CC+V  D 
Sbjct  417   TTYQRYTEEARCDRPDYAPALAVESFNVSAPEFDRRLW-------NQAPRRQCCNVVHDK  469

Query  1556  -SVDSESAV  1579
              SVD E  V
Sbjct  470   NSVDGEVEV  478



>ref|XP_011006392.1| PREDICTED: uncharacterized protein LOC105112393 [Populus euphratica]
 ref|XP_011006393.1| PREDICTED: uncharacterized protein LOC105112393 [Populus euphratica]
Length=505

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 235/421 (56%), Gaps = 19/421 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+S ++FG+ GS K W+ RR Y E WW PN T G++ LD+ P  E + WP +SP Y+VS
Sbjct  88    TNISQILFGIGGSAKMWNKRRHYTELWWMPNITRGYVWLDQKP-PENVTWPETSPEYKVS  146

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + SR     ++ +    R    I   V+++ +     +RW VMGDDDT+F ++NLV VL
Sbjct  147   ADTSRFKYTCSYGSRSALR----IARIVKESFELGEENVRWFVMGDDDTVFFIENLVMVL  202

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ RY+ L 
Sbjct  203   AKYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLAKELVRVLDSCIDRYASLY  262

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV L+   GFHQ+D+ GD  G L+ HP APL+SLHH D V  IFP +
Sbjct  263   GSDQKIQGCMSEIGVPLTKELGFHQVDIRGDPYGLLAAHPLAPLVSLHHLDYVQSIFPKL  322

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             NR +S +  +++   D  R+LQ   C+   RNWS S +WGY+  I+  +M    L++   
Sbjct  323   NRIDSVKKLISSYKMDPGRVLQYSFCYDLTRNWSVSASWGYTIQIHPSLMTAKQLESAFR  382

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TFQTW      P + F+ R   +  PCL P  +FL+ VE V   D  + TY+RS +    
Sbjct  383   TFQTWRSWSNGP-FTFNTRP-MSQHPCLRPVVYFLDRVERVG--DGTLTTYKRSVQEFGQ  438

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKPAK------IGRSECCDVTIDSVDSESAV-IKTRR  1594
              C   D  + A  ++  +V    +   K        R +CC+V    V   S V +  R 
Sbjct  439   VC---DLPEYAPVLAVKLVNVTTSTSLKPEIWNLAPRRQCCEVIKGEVGLNSVVQVNIRG  495

Query  1595  C  1597
             C
Sbjct  496   C  496



>ref|XP_010509283.1| PREDICTED: uncharacterized protein LOC104785714 [Camelina sativa]
Length=520

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 218/369 (59%), Gaps = 8/369 (2%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T GF+ LD+ P   +  W  +
Sbjct  89    KNQSSEATDVSHIVFGIGGSIQTWGDRSRYSELWWRPNVTRGFVWLDEEPPLNMT-WLST  147

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPY+VS + SR      + +    RM   I ET           +RW VMGDDDT+F V
Sbjct  148   SPPYQVSADTSRFNYTCWYGSRSAIRMARIIKETF----ALGLTNVRWFVMGDDDTVFFV  203

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNL+ VL++YDH + YY+GG+SE +  +   S+  A+GGGG+ +S+PLA+ +   I  C+
Sbjct  204   DNLITVLSKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGMAISYPLAVELVKIIDGCI  263

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RY+ L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APL++LHH D V
Sbjct  264   DRYASLYGSDQKIEACLSEIGVPLTKELGFHQVDVRGNPYGLLAAHPVAPLVTLHHLDYV  323

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             + IFP+ N+ ++ R  M+A  +D  R++Q   C    RNWS SV+WGY+  IY  ++   
Sbjct  324   DSIFPATNQIDALRRLMSAYKTDPSRIIQHSFCHDPSRNWSVSVSWGYTIQIYPSLVTGK  383

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
              L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV    + + TYR+
Sbjct  384   ELETPFLTFKSWRTSSLEP-FSFDTRP-ISGDPCERPIVYFLDRVYEV-GSGQTLTTYRK  440

Query  1415  SWRRGLPAC  1441
                 G   C
Sbjct  441   HVDVGEAQC  449



>ref|XP_006429145.1| hypothetical protein CICLE_v10011508mg [Citrus clementina]
 ref|XP_006480856.1| PREDICTED: uncharacterized protein LOC102629768 [Citrus sinensis]
 gb|ESR42385.1| hypothetical protein CICLE_v10011508mg [Citrus clementina]
Length=514

 Score =   289 bits (740),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/437 (37%), Positives = 241/437 (55%), Gaps = 19/437 (4%)
 Frame = +2

Query  314   SRSELESRNDS---NSP-TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKP  481
             S+ +L +R ++   N P TN+SH+VFG+ GS   W  RR Y E WW+P  T GF+ LD+ 
Sbjct  79    SQKKLLTRQNTTLYNEPKTNVSHIVFGIGGSANTWDDRRHYCELWWKPGLTRGFVWLDEK  138

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
             P      WP +SPPY+VS + SR    + +      R+   I ET R       G +RW 
Sbjct  139   PNKT---WPATSPPYKVSQDTSRFQYTSWYGTRSAIRIARIIKETFR----LGLGDVRWF  191

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             V+GDDDT+F ++NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA
Sbjct  192   VLGDDDTVFFLENLVTVLGRYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLA  251

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +   +  C+ RY+    +D+    C+A++GV ++   GFHQID+ GD  G L+ HP A
Sbjct  252   AELVRVLDGCIDRYASFYGSDQKVQGCMAEIGVPVTKELGFHQIDIRGDPYGLLAAHPLA  311

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             P++SLHH D V PIFP+M++ ES +  M A  +D  R +QQ  C+   RNW+ SV+WGY+
Sbjct  312   PIVSLHHLDYVLPIFPNMSQIESLKKLMGAYKTDPNRAVQQSFCYDLSRNWTVSVSWGYT  371

Query  1202  ANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEV-  1378
               +Y  +     L+    TF++W      P + F+  +  + +PC  P  +FL+ V++V 
Sbjct  372   VQLYPSLETAKRLETAYLTFKSWRSWSDEP-FTFNT-QYFSPNPCERPIIYFLDRVQKVG  429

Query  1379  TARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA--KIG-RSECCDVT  1549
               +D+ + TY R        C        A  + +  V +    P   K+  R +CC+V 
Sbjct  430   KGKDQTLTTYERVKSEHDKDC-DNKAYAPALAVKRFQVSASTLDPDHWKLAPRRQCCEVI  488

Query  1550  IDSVDSESAV-IKTRRC  1597
                    SAV IK R C
Sbjct  489   NGGGSRNSAVRIKIREC  505



>gb|KEH22967.1| transferring glycosyl group transferase [Medicago truncatula]
Length=510

 Score =   288 bits (738),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 235/424 (55%), Gaps = 14/424 (3%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             ++  PTN+SH++FG+ GS   W  RR Y E WWR N T GF+ LD  P      WP +SP
Sbjct  87    EAEEPTNISHILFGIGGSSATWQARRHYNELWWRQNTTKGFVWLDTKPSKNET-WPETSP  145

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PY+VS + S       + +    R    I   ++++ +     +RW VMGDDDT+F  DN
Sbjct  146   PYKVSADTSSFKYTCWYGSRSAIR----IARILKESFELGLDNVRWFVMGDDDTVFFPDN  201

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VL++YDH + YY+GG+SE +  +    +  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  202   LVTVLSKYDHNQMYYIGGNSESVEQDVVHFYTMAYGGGGFAISYPLAAELVKILDGCINR  261

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             YS    +D+    CI+++GV ++   GFHQ+D+ G+  G L+ HP APL+SLHH D V+P
Sbjct  262   YSEYYGSDQKIQSCISEIGVQITKEPGFHQVDIRGNPYGLLASHPVAPLVSLHHLDYVDP  321

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP+M R ES +  + A  SD  R +QQ  C+   +NWS S++WGYS  +Y  +    YL
Sbjct  322   IFPNMERVESVKKLVTAYKSDPGRTIQQSFCYDHTKNWSISISWGYSVELYPYLPTAKYL  381

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             +   +TF+TW      P + F+ R   + D C+ P  +F++ +E +  R    + Y+R  
Sbjct  382   EMVSQTFKTWRTWSDAP-FTFNTRP-VSQDSCVKPVVYFMDRIEGLD-RGLTRSGYKRYD  438

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDV--TIDSVDSESAVIK  1585
                   C   D  + A  I  + V +P+  P    +  R +CC++   +D ++S    +K
Sbjct  439   DGSGKECDKVDY-KVAHGIHYVHVSAPMLLPHYWKQAPRRQCCEIINNVDGLNSTVINVK  497

Query  1586  TRRC  1597
              R C
Sbjct  498   IRGC  501



>gb|KDP35680.1| hypothetical protein JCGZ_09118 [Jatropha curcas]
Length=506

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 155/419 (37%), Positives = 232/419 (55%), Gaps = 18/419 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH++FG+ GS K W+ RR Y E WW+PN T G++ L++ P +E   WP +SP Y+VS
Sbjct  92    TNISHILFGIGGSAKTWNDRRRYCELWWKPNVTRGYVWLEEKP-SETETWPETSPAYKVS  150

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ SR     ++     +R    I   V+++ +     +RW VMGDDDT+F ++NLV +L
Sbjct  151   EDTSRFKYSCSYG----SRSALHIARIVKESFELGLDNVRWFVMGDDDTVFFLENLVMIL  206

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
              +YDH + YY+GG+SE +  N   S+  A+GGGG  +S+PLA  +   +  CL RY    
Sbjct  207   GKYDHNQMYYIGGNSESVEQNVIHSYTMAYGGGGFAISYPLAEELVKILDGCLDRYDTFY  266

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    CI+++GV L+   GFHQ+D+ G   G L+ HP APLISLHH D V PIFP M
Sbjct  267   GSDQKVQACISEIGVPLTKELGFHQVDIRGSPYGLLAAHPLAPLISLHHLDYVQPIFPGM  326

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              + +S +  +     D  R LQ   C    RNWS SV+WGY+  +Y  ++    L+    
Sbjct  327   TQIDSLKKLVKPYEMDPGRTLQHSFCHDFNRNWSVSVSWGYTIQLYPSLVMAKQLEMAFR  386

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TFQTW      P + F+ R   + DPC  P  +FL+ +E V  R + +  YRR      P
Sbjct  387   TFQTWRTWSNEP-YTFNTRP-ISQDPCERPVVYFLDRIERV-GRSKTLTVYRRHVE---P  440

Query  1436  ACFAGDGDQSA--DRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAVIKTRRC  1597
             A  + D  +    + +  + V S   KP       R +CC++   + ++E   +K R C
Sbjct  441   ADMSCDRPEYGVIEAVQFVNVTSSTLKPDIWNMAPRRQCCEII--NRENEVVEVKIRGC  497



>ref|XP_002323517.1| fringe-related family protein [Populus trichocarpa]
 gb|EEF05278.1| fringe-related family protein [Populus trichocarpa]
Length=503

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/372 (40%), Positives = 215/372 (58%), Gaps = 11/372 (3%)
 Frame = +2

Query  305   DNESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDK-P  481
             D+   +  E    S   TN+SH++FG+ GS K W+ RR Y E WW PN T G++ LD+ P
Sbjct  69    DHRKITNGEVSGYSYEKTNISHILFGIGGSAKTWNKRRHYTEVWWMPNITRGYVWLDQNP  128

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
             PG +   WP +SPPY+VS + SR     ++ +    R    I   V+++ +     +RW+
Sbjct  129   PGND--TWPLTSPPYKVSADTSRFKYTCSYGSRSALR----IARIVKESFELGLENVRWL  182

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             V+GDDDT+F ++NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA
Sbjct  183   VLGDDDTVFFIENLVTVLTKYDHNQMYYIGGNSESVEQDAIHSYTMAYGGGGFAISYPLA  242

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +   +  CL RY+    +D+    CI+++GV L+   GFHQ+D+ GD  G L+ HP A
Sbjct  243   KELVRVLDGCLDRYASFYGSDQKVQGCISEIGVPLTKELGFHQVDIRGDPYGLLAAHPLA  302

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             PL+SLHH D V  IFP ++R +S    + A  +D  R LQ   C+   RNWS S +WGY+
Sbjct  303   PLVSLHHLDYVQSIFPGLSRFDSVNKLITAYKTDPGRTLQYSFCYDLTRNWSVSASWGYT  362

Query  1202  ANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVT  1381
               +Y  ++    LQ    TFQTW      P + F+ R      PCL P  +FL+ VE V 
Sbjct  363   IQLYPALLTAMQLQTVFRTFQTWRRWGEGP-FTFNTRP-MNQHPCLRPVVYFLDRVERVG  420

Query  1382  ARDEIVATYRRS  1417
               D  + TY+RS
Sbjct  421   --DGTLTTYKRS  430



>ref|XP_002309080.2| hypothetical protein POPTR_0006s09010g [Populus trichocarpa]
 gb|EEE92603.2| hypothetical protein POPTR_0006s09010g [Populus trichocarpa]
Length=505

 Score =   287 bits (735),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/421 (37%), Positives = 235/421 (56%), Gaps = 19/421 (5%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D    TN+SH++FG+ GS K W+ RR Y E WW PN T G++ LD+ P  E   WP +SP
Sbjct  83    DFYEKTNISHILFGIGGSAKTWNKRRHYTELWWMPNITRGYVWLDQKP-PENRTWPETSP  141

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              Y+VS + SR     ++ +    R    I   V+++ +     +RW VMGDDDT+F ++N
Sbjct  142   EYKVSADTSRFKYTCSYGSRSALR----IARIVKESFELGEENVRWFVMGDDDTVFFIEN  197

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  198   LVMVLAKYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLAKELVRVLDGCIDR  257

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y+    +D+    C++++GV L+   GFHQ+D+ GD  G L+ HP APL+SLHH D V  
Sbjct  258   YASFYGSDQKIQGCMSEIGVPLTKELGFHQVDIRGDPYGLLAAHPLAPLVSLHHLDYVQS  317

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP +NR +S +  +++   D  R LQ   C+   RNWS S +WGY+  I+  +M    L
Sbjct  318   IFPKLNRIDSVKKLISSYKMDPGRALQYSFCYDLTRNWSVSASWGYTIQIHPSLMTAKQL  377

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             ++   TFQTW      P + F+ R   +  PCL P  +FL+ VE V   D  + TY+RS 
Sbjct  378   ESAFRTFQTWRSWSNGP-FTFNTRP-MSQHPCLRPVVYFLDRVERVG--DGTLTTYKRSL  433

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAK------IGRSECCDVTIDSVDSESAVI  1582
             +     C   D  + A  ++  +V    +   K        R +CC+V I   D  ++V+
Sbjct  434   QEFGQVC---DLPEYAPVLAVKLVNVTTSTSLKPDIWNLAPRRQCCEV-IKGEDGVNSVV  489

Query  1583  K  1585
             +
Sbjct  490   Q  490



>gb|KEH34744.1| transferring glycosyl group transferase [Medicago truncatula]
Length=489

 Score =   286 bits (731),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 155/423 (37%), Positives = 237/423 (56%), Gaps = 16/423 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SH+VFG+ GS K WH R  Y + WW P A  GF+  DK P   L P      PY++
Sbjct  81    PTNISHIVFGIAGSSKMWHSRSNYSKLWWNPTACRGFVWFDKKP-KNLKP-DNMLIPYKI  138

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S   ++     +    R++R+V+       ++ +     +RW VMGDDDT+F  +NLV V
Sbjct  139   SQGWTKFRYLHSASAVRISRIVY-------ESFRLGLPNVRWFVMGDDDTVFFPENLVTV  191

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L +YDH + YY+GG+SE +  +   S+  AFGGGGI +S+ LA  +A+ +  CL RY + 
Sbjct  192   LGKYDHNQLYYIGGNSESVEQDVMHSYDMAFGGGGIAISYALAAKLANIMDSCLHRYYYF  251

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D+    C+ +LGV+L+  +GFHQ+D+ G+  G L+ HP APL+SLHH D +NP+FP 
Sbjct  252   YGSDQRIWACVNELGVSLTRERGFHQLDIRGNPYGLLAAHPLAPLVSLHHLDQLNPVFPD  311

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
              ++  S +  ++A   D  R++QQ +C+   R WS S++WGY+  IY  ++  + LQ P 
Sbjct  312   QSQISSLKKLISAYEIDPARIVQQSVCYDHRRRWSISISWGYTIQIYTSLLITADLQMPF  371

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             +TF+TW  S   P + F+ R     D C  P  FFL+ V E  AR   V TY+R   +  
Sbjct  372   QTFKTWRSSSDGP-FTFNTR-WMNPDVCQQPSIFFLDQVSE--ARTGSVTTYKRYADKDG  427

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCD-VTIDSVDSESAVIKTRRCMADD  1609
               C   DG+    ++S + +     K   + R +CC+ +   S+   S  I+ R+C   +
Sbjct  428   KKCKRADGEVQRIKVSALKLDPEYWK--NVPRRQCCNFMDGGSIKDGSVHIRIRKCRPQE  485

Query  1610  IIA  1618
              I 
Sbjct  486   TIT  488



>ref|XP_004170734.1| PREDICTED: uncharacterized LOC101203954 [Cucumis sativus]
Length=490

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/365 (38%), Positives = 215/365 (59%), Gaps = 10/365 (3%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             ++++ +    PTN+SHLVFG+ GS K W+ RR Y E WW+ N T GF+ +++ P      
Sbjct  63    KMKAFDAGEQPTNISHLVFGIGGSVKTWNERRHYCELWWKKNVTRGFVWIEEKPE---FS  119

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
             WP SSPPYRVSD+ S+     N+      R    +   +++  +     +RW VMGDDDT
Sbjct  120   WPESSPPYRVSDDTSKF----NYTCWYGFRSAIRVARIIKETYEMGLENVRWFVMGDDDT  175

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F ++NL+D+L +YDH + YY+G +SE +  +   S+  A+GGGG  +S+PLA  +   +
Sbjct  176   VFFMENLIDMLGRYDHNQMYYIGANSESVEQDVVHSYTMAYGGGGFAISYPLATVLVQIL  235

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C+ RY+H+  +D+    CI+++GV L+   GFHQ+D+ G+  G L+ HP APL+SLHH
Sbjct  236   DGCINRYAHMYGSDQKIQGCISEIGVPLTKEHGFHQLDIRGNPYGILAAHPIAPLVSLHH  295

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D V  IFP+M + +S +    A   D  R LQ   C+    NWS S++WGYS  +Y ++
Sbjct  296   LDYVQTIFPTMTQPDSLKKLHKAYEMDPSRALQHTFCYDTVWNWSVSISWGYSVQLYPRL  355

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD-EIV  1399
             +    ++    T+QTW  +   P + FD +   ++DPC  P  +FL S E +  R  + +
Sbjct  356   VTAKEMETAFLTYQTWRTNSNEP-FTFDTQP-VSSDPCQRPILYFLNSAERLGNRRWQTL  413

Query  1400  ATYRR  1414
              TY+R
Sbjct  414   TTYQR  418



>ref|XP_004137929.1| PREDICTED: uncharacterized protein LOC101203954 [Cucumis sativus]
Length=570

 Score =   288 bits (736),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/365 (38%), Positives = 216/365 (59%), Gaps = 10/365 (3%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             ++++ +    PTN+SHLVFG+ GS K W+ RR Y E WW+ N T GF+ +++ P      
Sbjct  143   KMKAFDAGEQPTNISHLVFGIGGSVKTWNERRHYCELWWKKNVTRGFVWIEEKPE---FS  199

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
             WP SSPPYRVSD+ S+     N+      R    +   +++  +     +RW VMGDDDT
Sbjct  200   WPESSPPYRVSDDTSKF----NYTCWYGFRSAIRVARIIKETYEMGLENVRWFVMGDDDT  255

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F ++NL+D+L +YDH + YY+G +SE +  +   S+  A+GGGG  +S+PLA  +   +
Sbjct  256   VFFMENLIDMLGRYDHNQMYYIGANSESVEQDVVHSYTMAYGGGGFAISYPLATVLVQIL  315

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C+ RY+H+  +D+    CI+++GV L+   GFHQ+D+ G+  G L+ HP APL+SLHH
Sbjct  316   DGCINRYAHMYGSDQKIQGCISEIGVPLTKEHGFHQLDIRGNPYGILAAHPIAPLVSLHH  375

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D V  IFP+M + +S +    A  +D  R LQ   C+    NWS S++WGYS  +Y ++
Sbjct  376   LDYVQTIFPTMTQPDSLKKLHKAYETDPSRALQHTFCYDTVWNWSVSISWGYSVQLYPRL  435

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD-EIV  1399
             +    ++    T+QTW  +   P + FD +   ++DPC  P  +FL S E +  R  + +
Sbjct  436   VTAKEMETAFLTYQTWRTNSNEP-FTFDTQP-VSSDPCQRPILYFLNSAERLGNRRWQTL  493

Query  1400  ATYRR  1414
              TY+R
Sbjct  494   TTYQR  498


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 15/100 (15%)
 Frame = +2

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M + ES R   +  + D  + LQQ  C+   RNWS SV+WGY+  +Y  +    Y++   
Sbjct  1     MTQIESLRALKSDYDLDPDQTLQQSFCYDSARNWSISVSWGYTVQLYPWLATPKYMKKSF  60

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE  1372
             +TF T               +    DP  +P  F L+ VE
Sbjct  61    QTFNT---------------RSVQLDPYQIPILFLLDPVE  85



>ref|XP_006601991.1| PREDICTED: uncharacterized protein LOC100802549 isoform X1 [Glycine 
max]
 ref|XP_006601992.1| PREDICTED: uncharacterized protein LOC100802549 isoform X2 [Glycine 
max]
 gb|KHN07585.1| hypothetical protein glysoja_019692 [Glycine soja]
Length=491

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 151/425 (36%), Positives = 233/425 (55%), Gaps = 13/425 (3%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             N PTN+SHL FG+ GS   WH R  Y + WW PN T G++ LDK P  ++L      PPY
Sbjct  78    NRPTNISHLQFGIAGSANTWHGRSNYTKLWWDPNTTRGYVWLDKKP--KILHSDILVPPY  135

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             ++S   +R     +    R+AR+V+       ++ +     +RW VMGDDDT+F  +NLV
Sbjct  136   QISRGWTRFKHVHSASAVRIARIVY-------ESFKLGLPNVRWFVMGDDDTVFFTENLV  188

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
              VL +YDH + YY+GG+SE +  +   S+  AFGGGG  +S+ LA  +A  +  CL RY 
Sbjct  189   TVLGKYDHNEMYYIGGNSESVEQDVMHSYNMAFGGGGFAISYALAAQLAKIMDGCLSRYF  248

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
             +   +D+    CI ++GV L+   GFHQ D+ G+  GFL+ HP  PL+SLHH D ++P F
Sbjct  249   YFYGSDQRVWACIHEIGVPLTRENGFHQFDIRGNPYGFLAAHPLVPLVSLHHLDQLSPFF  308

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             P+  +  S +  ++A + D  R++QQ +C+   R WS S++WGY+  IY K++  + LQ 
Sbjct  309   PNQTQLHSMKKLISAYHIDPARIVQQSICYDHKRRWSISISWGYTIQIYTKLLIAADLQM  368

Query  1247  PIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRR  1426
             P++TFQTW      P +IF+ R   ++DPC  P  FFL+   +V  +   +  Y+R   +
Sbjct  369   PLQTFQTWRSWKDGP-FIFNTRP-MSSDPCQQPARFFLDQATKV-GKSGSITIYKRHEGK  425

Query  1427  GLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVT-IDSVDSESAVIKTRRCMA  1603
                    G  ++   RI    +         + R  CC +    S+ + S  I+ ++C  
Sbjct  426   EAKCNREGTNNEEVQRIRVSALKLDPEYWKNVPRRHCCQLLGGGSIKNGSMNIRIKKCRP  485

Query  1604  DDIIA  1618
              + I 
Sbjct  486   HETIT  490



>ref|XP_007140496.1| hypothetical protein PHAVU_008G117500g [Phaseolus vulgaris]
 gb|ESW12490.1| hypothetical protein PHAVU_008G117500g [Phaseolus vulgaris]
Length=507

 Score =   286 bits (731),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 162/422 (38%), Positives = 230/422 (55%), Gaps = 16/422 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SHL FG+ GS   W  RR Y + WWR   T GF+ LD  P      WP SSPPY+V
Sbjct  86    PTNISHLFFGIGGSVATWDTRRQYSDMWWRRGVTRGFVWLDSHPSGNA-TWPESSPPYKV  144

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S + S   + T     R A  V  I   V+++ +     +RW VMGDDDT+F  DNLV V
Sbjct  145   SGDTS-AFQYTCSYGSRSAIRVARI---VKESFELGVENVRWFVMGDDDTVFFTDNLVMV  200

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH + YY+GG+SE +  +    +  AFGGGG  +S+PLA  +   +  C+ RY+  
Sbjct  201   LSKYDHNEMYYVGGNSESVEQDVIHFYTMAFGGGGFAISYPLAKVLVRILDGCIDRYAEF  260

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D+    CI+++GV ++   GFHQ+D+ G   G L+ HP APL+SLHH D V+PIFP+
Sbjct  261   YGSDQKIQSCISEIGVQVTKEPGFHQVDIRGKPYGLLASHPVAPLVSLHHMDYVDPIFPN  320

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M R ++ +  + A   D  R LQ+  C+   RNWS SV+WGYS  IY  +     L+   
Sbjct  321   MTRVDAVKKLVTAYERDSGRALQKSFCYDLRRNWSVSVSWGYSVEIYPTLRRAKELETAF  380

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF+TW      P +IF+ R    +DPC  P  F L+ V  V   D+  + YRR      
Sbjct  381   RTFRTWRSWSDGP-FIFNTRP-VGSDPCEKPVLFMLDRVLNV-GEDKTRSIYRRHEDTVG  437

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVT--IDSVDSESAV--IKTR  1591
               C   +  Q+ D +  + V +P   P    K  R +CC++    D V + ++V  +K R
Sbjct  438   NVCKRDEYAQALD-VQYVNVLAPRFMPDEWKKAPRRQCCEIVNASDGVMNNNSVVGVKIR  496

Query  1592  RC  1597
              C
Sbjct  497   GC  498



>ref|XP_010047935.1| PREDICTED: uncharacterized protein LOC104436758 [Eucalyptus grandis]
Length=522

 Score =   286 bits (732),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 159/425 (37%), Positives = 236/425 (56%), Gaps = 24/425 (6%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL--PWPPSSPPYR  529
             TNLSH++FG+ GS K W  RR Y E WWRPN T GF+ LD+ P       P P  SPP+R
Sbjct  91    TNLSHVLFGIGGSAKTWDERRRYSELWWRPNVTRGFVWLDQEPSLSSGGGPSPAGSPPFR  150

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             +S N S    E  +     +R    I   V+++       +RW VMGDDDT+F ++NLVD
Sbjct  151   ISANTS----EFKYTCWYGSRSAIRIARIVKESFDLGLEGVRWFVMGDDDTVFFLENLVD  206

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VLA+YDH++ YY+G +SE +  +   S+  A+GGGG  +S+PLA  +A  +  C+ RY+ 
Sbjct  207   VLARYDHSQMYYIGANSESVEQDVIHSYTMAYGGGGFAVSYPLAAELARVLDGCIDRYAG  266

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             +  +D+    C++++GV ++   GFHQ+D+ G+  G L+ HP APL+SLHH D V+PIFP
Sbjct  267   MYGSDQKVQGCLSEIGVPITKELGFHQLDIRGNPYGLLAAHPLAPLVSLHHLDYVDPIFP  326

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              +++ +S +    A  SD  R LQ   C+   RNWS SV+WGY+  +Y  +M    L+  
Sbjct  327   GLDQIDSLKKLRTAFESDPGRTLQHSFCYDLARNWSVSVSWGYTVQLYPSLMTAKELETA  386

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             ++TFQTW      P + F+ R+    +PC  P  +FL+ V  V    +++ TY R     
Sbjct  387   MQTFQTWRSWSSEP-FTFNTRQ-LGQNPCERPVVYFLDQVHRV-GDGQMLTTYVRR----  439

Query  1430  LPACFAGDGD----QSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVD--SESAVI  1582
              P+    D D      A  +    V S   +P    K  R +CC+V I+  D    +  +
Sbjct  440   -PSADEKDCDLPQYAPALAVQSFNVSSSTFRPNMWKKALRRQCCEV-INGTDLTGRTVEV  497

Query  1583  KTRRC  1597
             + R C
Sbjct  498   EIRGC  502



>ref|XP_006295581.1| hypothetical protein CARUB_v10024689mg, partial [Capsella rubella]
 gb|EOA28479.1| hypothetical protein CARUB_v10024689mg, partial [Capsella rubella]
Length=628

 Score =   288 bits (738),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 151/380 (40%), Positives = 217/380 (57%), Gaps = 8/380 (2%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE  493
             S S +  +N S+  T++SH+VFG+ GS + W  R  Y E WWRPN T GF+ LD+ P   
Sbjct  77    SSSTILRQNQSSEATDVSHIVFGIGGSIQTWRDRSRYSELWWRPNVTRGFVWLDEEPPLN  136

Query  494   LLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGD  673
             +  W  +SPPY+VS + SR             RM   I ET     +     +RW VMGD
Sbjct  137   M-TWLSTSPPYQVSADTSRFNYTCWFGTRSAIRMARIIKETF----ELGLTNVRWFVMGD  191

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DDT+F VDNL+ VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA+ + 
Sbjct  192   DDTVFFVDNLITVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGIAISYPLAVELV  251

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
               +  C+ RY+ L  +D+    CI+++GV L+   GFHQ+D+ G+  G L+ HP APL++
Sbjct  252   KILDGCIDRYASLYGSDQKIEACISEIGVPLTKELGFHQVDIRGNPYGLLAAHPVAPLVT  311

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHH D V+PIFP+  + +S R  M+A   D  R+LQ   C    R  S SV+WGY+  IY
Sbjct  312   LHHLDYVDPIFPAATQTDSLRRLMSAYKMDPSRILQHSFCHDPTRGLSISVSWGYTIQIY  371

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
               ++    L+ P  TF++W  S   P + FD R   + DPC  P  +F + V EV    +
Sbjct  372   PSLVTAKELETPFLTFKSWRTSSLEP-FSFDTRP-ISEDPCEKPIIYFFDRVYEV-GSGQ  428

Query  1394  IVATYRRSWRRGLPACFAGD  1453
              + TYR+    G   C + D
Sbjct  429   TLTTYRKHDEEGETQCDSPD  448



>ref|XP_009606983.1| PREDICTED: uncharacterized protein LOC104101239 [Nicotiana tomentosiformis]
Length=528

 Score =   286 bits (731),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/433 (35%), Positives = 245/433 (57%), Gaps = 33/433 (8%)
 Frame = +2

Query  329   ESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWP  508
             + RN     TN++H++FG+ GS K W++R++Y E WW+PN T GF+ LD+ P  E  PWP
Sbjct  98    KERNIKEEETNITHILFGIGGSAKTWNNRKSYSELWWKPNVTQGFVWLDENP-QENEPWP  156

Query  509   PSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              +SPPY+VS++ S   + T     R A  +  I   V+++ +     +RW VMGDDDTIF
Sbjct  157   DTSPPYKVSEDTSSF-KYTCWFGDRSAVRIARI---VKESFELGLKNVRWFVMGDDDTIF  212

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               +NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  
Sbjct  213   FTENLVTVLGKYDHNQMYYIGGNSESVEQDLVHSYGMAYGGGGIAISYPLAEILVKILDG  272

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             C+ RY  +  +D+  G C++++G+ L+   GFHQ+D+ G   G L+ HP AP++SLHH  
Sbjct  273   CINRYHDVYGSDQKIGGCMSEIGIPLTKELGFHQMDIQGSPRGLLAAHPLAPIVSLHHIG  332

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
             +++ + P M+R +S +  + A   D  R +QQ  C+   +NWS SV+WGYS  +Y  +M 
Sbjct  333   VIHSLIPLMDRVDSVKKVIEAYKKDPSRTMQQSFCYDLNKNWSVSVSWGYSIQLYPNLMN  392

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
                L+ P+ TF+TW     P  + F+ R     +PC  P  ++L+ V E+    E + +Y
Sbjct  393   PKELETPMRTFETWKGFEEP--FTFNTRP-NYIEPCQRPIEYYLDQVFEI-ENGETLTSY  448

Query  1409  RRSWRRGLPACFAGDGDQSADR--------ISKIVVYSPVTKPAKIGRS----ECCDVTI  1552
             +R           GD ++  +         +  + V + V  P +I R     +CC+V +
Sbjct  449   KR----------IGDYNRQCENENYAPALAVQMVNVTAAVLSP-QIWRQAPHRQCCEV-M  496

Query  1553  DSVDSESAVIKTR  1591
             +  DS   V++ R
Sbjct  497   NGEDSIETVLQIR  509



>gb|KDO52371.1| hypothetical protein CISIN_1g044015mg, partial [Citrus sinensis]
Length=478

 Score =   283 bits (725),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/372 (39%), Positives = 219/372 (59%), Gaps = 14/372 (4%)
 Frame = +2

Query  314   SRSELESRNDS---NSP-TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKP  481
             S+ +L +R ++   N P TN+SH+VFG+ GS   W  RR Y E WW+P  T GF+ LD+ 
Sbjct  79    SQKKLLTRQNTTLYNEPKTNVSHIVFGIGGSANTWDDRRHYCELWWKPGLTRGFVWLDEK  138

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
             P      WP +SPPY+VS + SR    + +      R+   I ET R       G +RW 
Sbjct  139   PNKT---WPATSPPYKVSQDTSRFQYTSWYGTRSAIRIARIIKETFR----LGLGDVRWF  191

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             V+GDDDT+F ++NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA
Sbjct  192   VLGDDDTVFFLENLVTVLGRYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLA  251

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +   +  C+ RY+    +D+    C+A++GV ++   GFHQID+ GD  G L+ HP +
Sbjct  252   AELVRVLDGCIDRYASFYGSDQKVQGCMAEIGVPVTKELGFHQIDIRGDPYGLLAAHPLS  311

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             P++SLHH D V PIFP+M++ ES +  M A  +D  R +QQ  C+   RNW+ SV+WGY+
Sbjct  312   PIVSLHHLDYVLPIFPNMSQIESLKKLMGAYKTDPNRAVQQSFCYDLSRNWTVSVSWGYT  371

Query  1202  ANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEV-  1378
               +Y  +     L+    TF++W      P + F+  +  + +PC  P  +FL+ V++V 
Sbjct  372   VQLYPSLETAKRLETAYLTFKSWRSWSDEP-FTFNT-QYFSPNPCERPIIYFLDRVQKVG  429

Query  1379  TARDEIVATYRR  1414
               +D+ + TY R
Sbjct  430   KGKDQTLTTYER  441



>ref|XP_004492173.1| PREDICTED: uncharacterized protein LOC101494656 [Cicer arietinum]
Length=484

 Score =   283 bits (724),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 154/419 (37%), Positives = 238/419 (57%), Gaps = 23/419 (5%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDK-PPGAELLPWPPSSPPYR  529
             PTN+SH++FG+ GS   WH RR Y E WW+PN T GF+ LDK PP  E   WP +SP ++
Sbjct  66    PTNISHILFGIGGSTSTWHTRRYYSELWWQPNTTRGFVWLDKEPPKNE--TWPETSPSFK  123

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             VS + S       + +    R    I   ++++ +     +RW VMGDDDT+F   NLV 
Sbjct  124   VSGDTSSFKYTCWYGSRSAIR----IARIIKESFELGLDNVRWFVMGDDDTVFFTHNLVT  179

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDH + YY+GG+SE +  +    +  A+GGGG  +S+PLA  +   +  C+ RYS 
Sbjct  180   VLSKYDHNQMYYIGGNSESVEQDVIHFYTMAYGGGGFAISYPLAAELVKILDGCIDRYSD  239

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
                +D+    CI+++GV ++   GFHQ+D+ G+  G L+ HP APL+SLHH D V+PIFP
Sbjct  240   FYGSDQKIQSCISEIGVQITKEPGFHQVDIRGNPYGLLAAHPVAPLVSLHHLDYVDPIFP  299

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +M R +S +  + A  SD  R +QQ  C+   RNWS SV+WGYSA ++  +     L+  
Sbjct  300   NMTRVDSVKKLITAYESDPGRTVQQSFCYDHTRNWSVSVSWGYSAELFPFLPTAKDLEMA  359

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR----S  1417
              +TF+TW      P + F+ R     DPC     +F++ V+++  R    ++Y+R    +
Sbjct  360   SKTFKTWRTWSDGP-FTFNTRA-VKNDPCENSLTYFMDRVDDL-GRGLTRSSYKRYNDVT  416

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAVIK  1585
             W+    + FA      A  +  I V +P+  P    +  R +CC++ I+  D ++ VI+
Sbjct  417   WKDCERSDFA-----PALAVQYINVSAPLLMPHTWKEAPRRQCCEI-INHGDGDNKVIE  469



>ref|XP_009762592.1| PREDICTED: uncharacterized protein LOC104214596 [Nicotiana sylvestris]
Length=528

 Score =   284 bits (726),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/432 (35%), Positives = 243/432 (56%), Gaps = 31/432 (7%)
 Frame = +2

Query  329   ESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWP  508
             + +N     TN+++++FG+ GS K W++R++Y E WW PN T GF+ LD+ P  E  PWP
Sbjct  98    KEKNIKEEETNITNILFGIGGSAKTWNNRKSYSELWWEPNVTRGFVWLDENP-QENEPWP  156

Query  509   PSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              +SPPY+VSD+ S   + T     R A  +  I   V+++ +     +RW VMGDDDTIF
Sbjct  157   DTSPPYKVSDDTSSF-KYTCWFGDRSAVRIARI---VKESFELGLENVRWFVMGDDDTIF  212

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               +NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  
Sbjct  213   FTENLVTVLGKYDHNQMYYIGGNSESVEQDLVHSYGMAYGGGGIAISYPLAEVLVKILDG  272

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             C+ RY  +  +D+  G C++++G+ L+   GFHQ+D+ G   G L+ HP AP++SLHH  
Sbjct  273   CINRYHDVYGSDQKIGGCMSEIGIPLTKELGFHQMDIQGSPRGLLAAHPLAPIVSLHHIG  332

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
             +++ + P M+R +S +  + A   D  R +QQ  C+   +NWS SV+WGYS  +Y  +M 
Sbjct  333   VIHSLIPLMDRVDSVKKVIEAYKKDPSRTMQQSFCYDLNKNWSVSVSWGYSIQLYPNLMN  392

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
                L+ P+ TF+TW    +P  + F+ R     +PC  P  ++L+ V E+    E + +Y
Sbjct  393   AKELETPLRTFETWKGFEQP--FTFNTRP-NYIEPCQRPIEYYLDQVIEL-ENGETLTSY  448

Query  1409  RRSWRRGLPACFAGDGDQSADR--------ISKIVVYSPVTKP---AKIGRSECCDVTID  1555
             +R           GD ++  +         +  + V S +  P    +    +CC+V ++
Sbjct  449   KR----------IGDYNKQCENENYAPAIAVQMVNVTSAILSPHVWRQAPHRQCCEV-MN  497

Query  1556  SVDSESAVIKTR  1591
               DS   V++ R
Sbjct  498   GEDSIETVLQIR  509



>ref|XP_009405843.1| PREDICTED: uncharacterized protein LOC103988895 [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   283 bits (723),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 172/438 (39%), Positives = 242/438 (55%), Gaps = 34/438 (8%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPP--GAELLPWPPSSPP  523
             SPTNLSH+VFG+ GS + W  RR Y E WWRP  T G + LDK P  GA    WP  SPP
Sbjct  80    SPTNLSHIVFGIGGSARTWSRRRGYSELWWRPGVTRGHVWLDKAPPEGA----WPAMSPP  135

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             YRVS N SR  E  +    R+AR+V    E+ R         +RW VMGDDDT+F VDNL
Sbjct  136   YRVSANASRFRERAS--ASRIARIV---AESQR--LHAGDAGVRWFVMGDDDTVFFVDNL  188

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V +L +YDH + YY+G  SE +  +   S+  A+GGGG  +S P A  +A  +  CL RY
Sbjct  189   VAMLGKYDHEEMYYVGAPSESVEQDVMHSYGLAYGGGGFAVSAPAAAELARALDGCLDRY  248

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             + L  +D+    C+++LGV L+   GFHQ+D+ GD  G L+ HP APL+SLHH D + PI
Sbjct  249   AQLYGSDQRVHSCLSELGVPLTREPGFHQLDIRGDAYGLLAAHPVAPLVSLHHLDYLAPI  308

Query  1064  FP-SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRN--WSFSVAWGYSANIYEKIMPRS  1234
              P   +R  + R  M AA  D  R+LQQ  C+   R   WS SV+WGY+  +Y +++  +
Sbjct  309   TPRGGDRLGALRTLMDAARLDPARILQQCFCYEAQRGFAWSVSVSWGYTVQLYPRVLAAN  368

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVAT---  1405
              ++ P+ TF+TW      P + F+ R+     PC  P  +FL SV++   +D   +T   
Sbjct  369   DMEVPLRTFKTWRSFGDGP-FTFNTRQVAPDRPCDRPLLYFLSSVKKKNGQDGSGSTMSE  427

Query  1406  ---YRRSWR-RGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVD  1564
                YR   R +GLP      G  +A ++  + V++P   PA   +  R +CC  T  S  
Sbjct  428   YSRYREDGRCKGLP------GYGAALKVETVKVFAPKMAPAAWRRAPRRQCCR-TRRSWW  480

Query  1565  SESAVIKTRRCMADDIIA  1618
               +  ++ R C   +I +
Sbjct  481   GRTLEVRIRNCRPGEITS  498



>gb|ACN40918.1| unknown [Picea sitchensis]
Length=513

 Score =   283 bits (723),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 160/433 (37%), Positives = 238/433 (55%), Gaps = 19/433 (4%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             ++ S + + S T L ++VFG+  S + W+ R+ YV+ WW+P    GF+ LD+  G    P
Sbjct  95    KIISSDTTPSNTTLYNIVFGIASSARKWNQRKRYVDLWWKPGVMRGFVWLDQEIGE---P  151

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
                S P  +VS++ SR             R+   + ET R         + W VMGDDDT
Sbjct  152   QSASLPQLKVSEDTSRFRYTFKKGLRSAIRISRIVSETFR----LNLSDVHWFVMGDDDT  207

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F  +NL+ VL++YDH +YYY+G +SE +  N   S+  A+GGGG  +S+PLA A+    
Sbjct  208   VFFPENLLQVLSKYDHNQYYYIGTNSESVEQNVLHSYGMAYGGGGFAISYPLAKALEKMQ  267

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               CL RYS+L  +D     C+ADLGV L+   GFHQ+D  G++ G+LS HP APL+SLHH
Sbjct  268   DSCLDRYSYLYGSDARIHACLADLGVPLTKEPGFHQVDFRGNLLGWLSAHPLAPLVSLHH  327

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D + PIFP MN+ ++  H   A   D  R+LQQ +C+ + R  S SV+WGYS ++++ I
Sbjct  328   LDAMAPIFPKMNQTQAFEHLFEAVKVDSSRILQQTICYDKVRQGSLSVSWGYSVHVFDSI  387

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
                  L++P +TF  W  +     ++F+ R   + +PCL P   FLESV   T    I  
Sbjct  388   QFPRELESPQQTFMHWRKT-MTDQFMFNTRN-VSRNPCLRPAVLFLESVS--TGSKGITT  443

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP--AKIGRSECCDVTIDSVDSESA  1576
             TY    R+   +C  G     A  + +I V SP ++    +  R  CCDV   S+++ S 
Sbjct  444   TYT---RQTGASCQLGKSALQA--LQQIRVLSPKSQLNWKQSPRRHCCDVLPSSLNN-SL  497

Query  1577  VIKTRRCMADDII  1615
              I  R C+  ++I
Sbjct  498   EILMRSCLDGEVI  510



>ref|XP_004246866.1| PREDICTED: uncharacterized protein LOC101253314 [Solanum lycopersicum]
Length=479

 Score =   281 bits (720),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 241/437 (55%), Gaps = 38/437 (9%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N+    TN++H++FG+ GS K W +R+ Y + WW PN T GF+ LD+ P  E   WP  S
Sbjct  54    NEKEDITNITHILFGIGGSAKTWKNRKNYSDLWWEPNVTRGFVWLDEKP-RENDTWPEYS  112

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYRVS++ SR  + T     R A  +  I   V+++ +     +RW VMGDDDT+F   
Sbjct  113   PPYRVSEDTSRF-KYTCWFGDRSAVRIARI---VKESFELGLENVRWFVMGDDDTVFFTK  168

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VL++YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  C+ 
Sbjct  169   NLVTVLSKYDHNQMYYIGGNSESVEQDLVHSYGMAYGGGGIAISYPLAEVLVKFLDGCIN  228

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY     +D+  G C+A++GV L+   GFHQ+D+ G   G L+ HP AP++SLHH  +++
Sbjct  229   RYHDFYGSDQKIGGCMAEIGVPLTRELGFHQMDIRGSARGLLAAHPLAPIVSLHHLGVIH  288

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
              + P M+R +S +  + A   D  R +QQ  C+   +NWS SV+WGYS  +Y  +M    
Sbjct  289   SLIPLMDRVDSIKKVIEAYKKDSSRTMQQSFCYDLKKNWSISVSWGYSIQLYPNLMNGKE  348

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P+ TF+TW     P  + F+ R     +PC  P  ++L+ V E+    E + +Y+R 
Sbjct  349   LETPMRTFETWKGFEEP--FTFNTRP-NYIEPCQRPIEYYLDRVFELD-NGETLTSYKR-  403

Query  1418  WRRGLPACFAGDGDQSADR--------ISKIVVYSPVTKPAKIGRS----ECCDVTIDSV  1561
                       GD ++  D         I  + V + +  P +I R     +CC+V I+  
Sbjct  404   ---------IGDYNKQCDNENYSPALAIQMVNVTAKILSP-QIWRQAPHRQCCEV-INGE  452

Query  1562  DSESAV-----IKTRRC  1597
             D+ + +     I+ R C
Sbjct  453   DNSNIIDTVLQIRIRSC  469



>ref|XP_010256825.1| PREDICTED: uncharacterized protein LOC104597115 [Nelumbo nucifera]
Length=508

 Score =   282 bits (722),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 239/421 (57%), Gaps = 19/421 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH++FG+ GS K W  RR Y E WW+PN T GF+ LD+ P  E  PWP +SPPYRVS
Sbjct  91    TNVSHILFGIGGSAKTWKDRRHYSELWWKPNITRGFVWLDEKPD-EKEPWPENSPPYRVS  149

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ SR    + + +    R+   ++E+ R   +     +RW VMGDDDT+  V+ LV VL
Sbjct  150   EDSSRFKYTSRYGSRSAVRIARIVLESFRLGLE----NVRWFVMGDDDTVLFVETLVSVL  205

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH + YY+GG+SE +  +   S+  AFGGGG  +S+PLA  +   + +C+ RY+ L 
Sbjct  206   SKYDHNQMYYIGGNSESVEQDVIHSYGMAFGGGGFAISYPLAAELVKVLDECIDRYASLY  265

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV ++   GFHQ+D+ GD  G L+ HP APL+SLHH   V P+FP+ 
Sbjct  266   GSDQKIQACLSEIGVPVTKELGFHQVDIRGDPYGLLASHPVAPLVSLHHLGYVKPLFPNQ  325

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              + ES R    A  +D  R LQQ  C+   RNWS SV+WGY+A IY  ++    L+  ++
Sbjct  326   TQLESLRSLFGAYKADPGRTLQQSFCYDLDRNWSVSVSWGYTAQIYPYLLTAKELETALQ  385

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF+TW      P + F+ R   +  PC  P  +FL+ V +     + + +Y+R       
Sbjct  386   TFRTWRSWSNEP-FTFNTRP-LSARPCERPLIYFLDRVNDQVGPGQTLTSYKRFVEDPGK  443

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVT----IDSVDSESAVIKTRR  1594
              C     D +A  +  + V + + +     K  R +CC++T    +DSV      I+ R 
Sbjct  444   VCNQSYYD-AALTVRSVNVSASIFETDEWKKAPRRQCCEITHAHGVDSV----VQIRIRS  498

Query  1595  C  1597
             C
Sbjct  499   C  499



>ref|XP_006341206.1| PREDICTED: uncharacterized protein LOC102579489 [Solanum tuberosum]
Length=451

 Score =   280 bits (717),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/359 (39%), Positives = 213/359 (59%), Gaps = 9/359 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
             N+ +  TN++H++FG+ GS K W++R+ Y + WW PN T GF+ LD+ PG E   WP  S
Sbjct  26    NEKDDITNITHILFGIGGSAKTWNNRKNYSDLWWEPNVTRGFVWLDENPG-ENDTWPEYS  84

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             PPYRVS++ S   + T     R A  +  I   V+++ +     +RW VMGDDDT+F   
Sbjct  85    PPYRVSEDTS-AFKYTCWFGDRSAVRIARI---VKESFELGLENVRWFVMGDDDTVFFTK  140

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VL +YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  C+ 
Sbjct  141   NLVTVLNKYDHNQMYYIGGNSESVEQDLVHSYGMAYGGGGIAISYPLAEVLVKILDGCIN  200

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY     +D+  G C+A++GV L+   GFHQ+D+ G   G L+ HP AP++SLHH  +++
Sbjct  201   RYHDFYGSDQKIGGCMAEIGVPLTRELGFHQMDIRGSARGLLATHPLAPIVSLHHLGVIH  260

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
              + P M+R +S +  + A   D  R +QQ  C+   +NWS SV+WGYS  +Y  +M    
Sbjct  261   SLIPLMDRVDSIKKVIEAYKKDSSRTMQQSFCYDVKKNWSISVSWGYSIQLYPNLMNGKE  320

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
             L+ P+ TF+TW     P  + F+ R     +PC  P  ++L+ V E+    E + +Y+R
Sbjct  321   LETPMRTFETWKGFEEP--FTFNTRP-NYIEPCQRPIEYYLDRVFELD-NGETLTSYKR  375



>ref|XP_010691179.1| PREDICTED: uncharacterized protein LOC104904586 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010691187.1| PREDICTED: uncharacterized protein LOC104904586 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/432 (36%), Positives = 234/432 (54%), Gaps = 28/432 (6%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDK-PPGAELLPWPPSSPPYR  529
             PT L+H+VFGL GS K W  RRAY + WW PN T G++ LD  PPG       P+ PPYR
Sbjct  89    PTQLTHIVFGLGGSSKTWEARRAYSQLWWDPNLTRGYVYLDDDPPGNGP---NPAFPPYR  145

Query  530   VSDNV------SRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             VS          R   ++N    R+AR++       +++ +     +RW VMGDDDT+F 
Sbjct  146   VSSRAWFGLGSGRKHSDSN----RMARIL-------KESFELGLSNVRWFVMGDDDTVFF  194

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
              +NLV VL++YDH + YY+GG SE +  +    ++ AFGGGG  +S+ LA  M   +  C
Sbjct  195   PENLVRVLSKYDHREMYYIGGSSESVEQDVMHGYETAFGGGGFAVSYGLACEMVRILDGC  254

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             ++RY     +D+    C+A+LGV L+   GFHQ+D+ GD  GFL+ HP APL+SLHH   
Sbjct  255   IRRYHDFYGSDEKVSACVAELGVPLTKEPGFHQLDIRGDPYGFLAAHPVAPLVSLHHLVG  314

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
               P+FP  N+ +S R  + A + D    +QQ +C+   R WS S++WGY+  +Y  ++  
Sbjct  315   AQPLFPGENQLDSLRRLLRAYHVDPGLTIQQSICYDHSRKWSVSISWGYTVQLYPSLISS  374

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
               L  P++TF+TW      P ++F+ R     DPC  P  ++L+ V+E T   + ++TY 
Sbjct  375   KVLGMPLQTFRTWRSGSEGP-FVFNTRP-MRDDPCERPIIYYLDQVKE-TGDGKTISTYM  431

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVI  1582
             R+       C   +  + A  +  I V +  T P    K  R ECC++      + +  I
Sbjct  432   RAAAADGKECMQ-EAYKDAVLVENITVSATKTDPQKWMKASRRECCNIRESQTRNGNMRI  490

Query  1583  KTRRCMADDIIA  1618
             + R C   + I 
Sbjct  491   QIRSCKPRETIT  502



>ref|XP_010032376.1| PREDICTED: uncharacterized protein LOC104421911 isoform X2 [Eucalyptus 
grandis]
 gb|KCW51781.1| hypothetical protein EUGRSUZ_J01232 [Eucalyptus grandis]
Length=501

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 169/441 (38%), Positives = 245/441 (56%), Gaps = 28/441 (6%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             +   PTN+SH++FG+ GS +AW  R  Y   WW PN+T GF+ LDK P  E    P  S 
Sbjct  79    NGTGPTNISHILFGIGGSLRAWRDRSRYSSLWWDPNSTRGFVWLDKEP-EENFSRPGGSI  137

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVR-DAPQRATGTLRWVVMGDDDTIFLVD  697
             PYRVS++ +R    ++   PR+AR+V   +E+ R + P      +RW VMGDDDT+F   
Sbjct  138   PYRVSEDATRFKSSSSKSAPRIARIV---LESFRLELPD-----VRWFVMGDDDTVFFPQ  189

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+YDH + +Y+GG+SE +  +    +  AFGGGG  +S+PLA  + D +  CL 
Sbjct  190   NLVTVLAKYDHRQMWYIGGNSESVEQDLMHGYGVAFGGGGFAISYPLAAELVDMLDGCLD  249

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RYSH   +D+    C+ ++GV L+  +GFHQID+ GD  G L+ HP APL+SLHH D V+
Sbjct  250   RYSHFYGSDERVCACVQEVGVPLTIERGFHQIDIRGDAYGILAAHPVAPLVSLHHVDDVD  309

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PI P   + ++ +  M     D  R+LQQ  C+   R WS S++WGY+  IY  ++    
Sbjct  310   PILPHQTQIDALKALMEPYRIDPARILQQSFCYDPKRKWSVSISWGYTIQIYPSLVTADV  369

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P + F+TW      P + F+ R   + DPC  P  +F++ V EV  R   + TY RS
Sbjct  370   LEMPFQMFKTWRSWADGP-FAFNTRS-VSPDPCSQPVIYFVDRVWEV-GRTGSLTTYERS  426

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG--------RSECCDVT-IDSVDSE  1570
               +G      G G + AD    + V S      K+G          +CC++    S+ S 
Sbjct  427   DLKG------GRGCKRADYARVLAVQSIAVSSMKMGPDYWNKAPHRQCCEIMDRGSIKSR  480

Query  1571  SAVIKTRRCMADDIIA*FFRH  1633
             S  I+ R+C A ++ A  F H
Sbjct  481   SMRIRVRKCRAHEMKASPFHH  501



>gb|EYU26604.1| hypothetical protein MIMGU_mgv1a023492mg [Erythranthe guttata]
Length=511

 Score =   281 bits (720),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/415 (36%), Positives = 228/415 (55%), Gaps = 15/415 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T++SH++FG+ GS + W  RR Y E WW+PN T G++ LD+ P     PWP +SPPY+VS
Sbjct  96    TDISHILFGIGGSAETWGQRRRYCELWWKPNVTRGYVWLDEEPAK---PWPETSPPYKVS  152

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ +R      + N   +R    I   V+++ +     +RW VMGDDDT+F  +NLV++L
Sbjct  153   EDTTRF----KYTNWDGSRSAVRIARIVKESFELGLDDVRWFVMGDDDTVFFTENLVNLL  208

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
              +YD+ + YY+GGHSE +  +   S+   +GGGG  +S+PLA  +   +  C+ RY+   
Sbjct  209   NRYDYKQMYYIGGHSESVEQDMAHSYTMGYGGGGFAISYPLAAELVKILDGCIDRYAEFY  268

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     CI ++GV ++   GFHQ+D+ G   G LS HP APLISLHH D + P+FP  
Sbjct  269   GSDHKIESCINEIGVPVTREPGFHQMDIRGSPYGLLSAHPLAPLISLHHLDYLQPVFPGR  328

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             NR  S +  + A  SD  R+LQQ  C+   RNWS SV+WGY+  +Y  ++    L  P++
Sbjct  329   NRVGSIKRLIHAYESDPGRVLQQSFCYDLTRNWSVSVSWGYNVQLYPFLVRAKDLSTPLQ  388

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF TWG   + P + F+ R   +  PC  P  ++   V+  +   + +  YRR       
Sbjct  389   TFLTWGTWSQEP-FTFNTRV-LSLKPCERPIIYYFAGVDG-SGSGKTLTWYRRPHPEQRR  445

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVIKTR  1591
              C  G+   +   +    V + +  P    K  R +CC+V +   D    V++ R
Sbjct  446   QC-KGENYGAGYTVKGFNVSAALLDPGIWNKAPRRQCCEV-MSGGDRVDGVVQVR  498



>ref|XP_002515719.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF46666.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=476

 Score =   280 bits (715),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 161/437 (37%), Positives = 237/437 (54%), Gaps = 26/437 (6%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S  D N+PTNL H+VFG+  ++K+W  R+ YV+ WW P    G + L+  P  +      
Sbjct  53    SLEDFNAPTNLGHVVFGIASNQKSWPKRKEYVKLWWNPQQMRGCVFLEDMPQDDANDTTS  112

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             S PP  +S++ SR      +      R+   + ETV+         +RW V GDDDT+F 
Sbjct  113   SLPPVCISEDTSRFRYTFRNGLRSAIRVARVVSETVK----LNHSDVRWYVFGDDDTVFF  168

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
              +NLV  L++YDH  +YY+G +SE +  N YFSF+ AFGG G  +S+PLA  +A     C
Sbjct  169   TENLVKTLSKYDHGLWYYIGSNSENLEQNRYFSFEMAFGGAGFAISYPLAKVLAKVFDSC  228

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
              +RY HL  +D     C+A+LGV L+   GFHQ+D+ G++ G L+ HP +PL+SLHHFD 
Sbjct  229   TERYPHLYGSDSRISSCLAELGVGLTREPGFHQVDLRGNMFGLLTSHPLSPLVSLHHFDD  288

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK--IM  1225
             ++PIFP+M    S  H   A   D  R+LQ+ +C+ R  +W+ SVAWGY+  IY K   +
Sbjct  289   LDPIFPNMTTINSLEHLFKAVTVDSQRVLQKTVCYDRWFSWTISVAWGYAVEIYGKHIFL  348

Query  1226  PRSYLQNPIE-TFQTW--GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEI  1396
             P +    P++ TFQ W    S     + F+V K    DPC  P  FFL+ V   ++RD I
Sbjct  349   PDTL---PVQVTFQKWIKKGSLLAGAYTFNV-KEPHPDPCQRPTIFFLDHVS--SSRDGI  402

Query  1397  VATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT----KPAKIGRSECCDVTIDSVD  1564
                Y++S+              S  ++ +I V+S       K     R +CCDV + S  
Sbjct  403   TTHYKKSYTN------CSYDKASPRKLEEIKVFSHKLDLSDKQLWSPRRQCCDV-LRSSG  455

Query  1565  SESAVIKTRRCMADDII  1615
             S++  I  R C  +++I
Sbjct  456   SKTMEIGIRECKEEELI  472



>ref|XP_008369934.1| PREDICTED: uncharacterized protein LOC103433448 [Malus domestica]
Length=499

 Score =   280 bits (716),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 150/429 (35%), Positives = 232/429 (54%), Gaps = 24/429 (6%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D +  TN+SH++FG+ GS ++W  RR Y E WW+PN T GF+ LD+ P      W  + P
Sbjct  76    DGHEKTNISHILFGIGGSVESWDKRRRYTELWWKPNVTRGFVWLDEKPSPNX-TWLETLP  134

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              YRVS++ SR      +  P  +R    +   V+++ +     +RW VMGDDDT++  DN
Sbjct  135   QYRVSEDTSRF----KYSCPYGSRSAVRMARIVKESFELGLENVRWFVMGDDDTVYFPDN  190

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  191   LVSVLAKYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLAAELVKILDGCIDR  250

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHHFD V  
Sbjct  251   YDKLYGSDQKIQGCLSEIGVPLTKELGFHQLDIRGNPYGLLAAHPVTPLVSLHHFDYVES  310

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++N  +S +  ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  311   IFPNLNPIDSVKKLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKL  370

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +  ++TF TW       NW  D R  T      ++DPC     + L+ VE V   + +  
Sbjct  371   ETALQTFWTW------KNW--DARLFTFNTQPVSSDPCERSVVYMLDRVESVGGGETLTT  422

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSES  1573
               R +  +G   C   D    A ++    V +P   P    K  R +CC +  D+  ++ 
Sbjct  423   YKRYNIDKGQNDCIRSDYTH-ALKVEVFNVSAPKFNPDLWNKAPRRQCCKIINDTEGADR  481

Query  1574  AV-IKTRRC  1597
              V ++ R C
Sbjct  482   VVQVQIRSC  490



>ref|XP_010449958.1| PREDICTED: uncharacterized protein LOC104732128 [Camelina sativa]
Length=487

 Score =   280 bits (715),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 166/434 (38%), Positives = 236/434 (54%), Gaps = 23/434 (5%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             +R+ S  PT   HL+F +  S  +W  R +YV  W+ P +T   + LD+     L P  P
Sbjct  69    ARSLSVFPTRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDR---GGLEP-DP  124

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             + PP  VS +VSR      +  P   R    +   V++   R    +RW V GDDDT+F 
Sbjct  125   TLPPVVVSKDVSRF----PYNFPGGLRSAIRVARVVKEIVDRGDKDVRWFVFGDDDTVFF  180

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             VDNLV VL++YDH K+YY+G +SEF   N  +SF  AFGGGG  +S  LA  +A  +  C
Sbjct  181   VDNLVKVLSKYDHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSC  240

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             L RYSH+  +D     C+A+LGV L+   GFHQ+D+ GDI G L  HP +PL+SLHH D 
Sbjct  241   LMRYSHMYGSDSRIFSCLAELGVTLTHEPGFHQMDVRGDIFGLLCAHPLSPLVSLHHLDA  300

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIM  1225
             V+P FP MNR ES    + A++ D  R+LQQ +C+      + SV WGY+  +YE  K++
Sbjct  301   VDPFFPKMNRTESVARLIGASSLDTGRILQQSVCYDSLNTVTVSVVWGYAIQVYEGNKLL  360

Query  1226  PRSYLQNPIETFQTW-GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             P   L    +TF TW   S    N++F  R     DPC  P  FFL+SV      D    
Sbjct  361   PE--LLTLQKTFSTWRRGSGVQSNYMFSTRD-YPRDPCARPLVFFLDSV----GSDGTEG  413

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG--RSECCDVTIDSVDSESA  1576
             T+   +   +  C   +  +  +RI +++         ++G  R +CCD  I S  ++S 
Sbjct  414   TWSNYYLHRVGHCHRAEAVKRLERI-RVLSRKLELGAEQMGSPRRQCCD--ISSSYNKSM  470

Query  1577  VIKTRRCMADDIIA  1618
             VI  R+CM+D++IA
Sbjct  471   VINVRQCMSDELIA  484



>ref|XP_010517049.1| PREDICTED: uncharacterized protein LOC104792565 [Camelina sativa]
Length=520

 Score =   280 bits (716),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 215/369 (58%), Gaps = 8/369 (2%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             +N  +  T++SH+VFG+ GS + W  R  Y E W RPN T GF+ LD+ P   +  W  +
Sbjct  89    KNKPSEATDVSHIVFGIGGSIQTWGDRSRYSELWGRPNVTRGFVWLDEEPPLNM-TWLST  147

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
             SPPY+VS + SR      + +    RM   I ET           +RW VMGDDDT+F V
Sbjct  148   SPPYQVSADTSRFNYTCWYGSRSAIRMARIIKETF----ALGLTNVRWFVMGDDDTVFFV  203

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNL+ VL +YDH + YY+GG+SE +  +   S+  A+GGGG+ +S+PLA+ +   +  C+
Sbjct  204   DNLITVLNKYDHNQMYYIGGNSESVEQDIVHSYAMAYGGGGMAISYPLAVELVKILDGCI  263

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RY+ L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APL++LHH D V
Sbjct  264   DRYASLYGSDQKIEACLSEIGVPLTKELGFHQVDVRGNPYGLLAAHPVAPLVTLHHLDYV  323

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
             + IFP+ N+ ++ R  M+A  +D  R++Q   C    RNWS SV+WGY+  IY  ++   
Sbjct  324   DSIFPATNQIDALRRLMSAYKTDPSRIIQHSFCHDPSRNWSVSVSWGYTIQIYPSLVTGK  383

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
              L+ P  TF++W  S   P + FD R   + DPC  P  +FL+ V EV    + + TYR+
Sbjct  384   ELETPFLTFKSWRTSSLEP-FSFDTRP-ISGDPCERPIVYFLDRVYEV-GLGQTLTTYRK  440

Query  1415  SWRRGLPAC  1441
                 G   C
Sbjct  441   HVDVGEAQC  449



>gb|KDP22111.1| hypothetical protein JCGZ_25942 [Jatropha curcas]
Length=271

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 183/274 (67%), Gaps = 5/274 (2%)
 Frame = +2

Query  800   AFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDM  979
              FGG G  LS+PLA A+A  +  C++RY +L  +D     C+AD+GV ++  +G HQID+
Sbjct  2     GFGGAGYALSYPLAKALAAKLDACIERYPYLYVSDHMAQSCLADMGVAINLEKGIHQIDL  61

Query  980   HGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFH  1159
             H DISG LS HP +PL+SLHHFD +NPIFPSM+R ESARH M AAN DQ R+LQQ +C+ 
Sbjct  62    HHDISGLLSAHPQSPLLSLHHFDSINPIFPSMDRYESARHLMKAANFDQSRLLQQTICYQ  121

Query  1160  RPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCL  1339
             R  NWSFSV+WGYS +IYE I+PRS L+ P+ETF+ W  + + P ++F+ R     DPC 
Sbjct  122   RESNWSFSVSWGYSTHIYENIIPRSILRKPLETFRPWAKNDKRPFFMFNTR-LLNNDPCQ  180

Query  1340  VPHAFFLESVEEVTARDEIVATYRRSWRRGLPAC-FAGDGDQSADRISKIVVYSPVTKPA  1516
              PH FF +S+E   + + I+ +Y R+  R LPAC FA  G+ SAD IS+I V SP T   
Sbjct  181   APHVFFFDSIEYTASGNRILTSYIRASPRNLPACSFA--GNHSADSISRIQVLSPATIRK  238

Query  1517  KIGRSECCDVTIDSVDSESAVIKTRRCMADDIIA  1618
               G  ECCDV    V+  +  IK R C+ D+++A
Sbjct  239   TAGVIECCDVEY-KVEINTTEIKIRPCVKDEVLA  271



>ref|XP_007026944.1| Uncharacterized protein TCM_021877 [Theobroma cacao]
 gb|EOY07446.1| Uncharacterized protein TCM_021877 [Theobroma cacao]
Length=509

 Score =   279 bits (714),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 229/420 (55%), Gaps = 17/420 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KPPGAELLPWPPSSPPYRV  532
             T+LSH+ FG+ GS K W+ RR Y E WWRPN T GF+ LD KPP  E LP  P+SPPY++
Sbjct  92    TDLSHIQFGIGGSAKTWNERRRYCELWWRPNVTRGFVWLDEKPPNDEKLP--PTSPPYKI  149

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S + SR    + + +    R    I   V+++ +     +RW VMGDDDT+F ++NLV V
Sbjct  150   SQDTSRFKYTSWYGSRSAVR----IARIVKESFELGLDNVRWFVMGDDDTVFFLENLVTV  205

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L +YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ RY+  
Sbjct  206   LNKYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLAAELVKVLDGCIDRYASF  265

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D+    C++++G+ ++   GFHQ+D+ G+  G L+ HP APL+SLHH D +  IFP 
Sbjct  266   YGSDQKIQGCMSEIGIPVTKELGFHQVDIRGNPYGLLAAHPLAPLVSLHHLDYIQSIFPG  325

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
               +  S +  ++A   D  R LQ   C+   RNWS SV+WGY+  +Y  ++    L+   
Sbjct  326   RTQIYSIKKLLSAYEKDPSRALQHSFCYDLKRNWSVSVSWGYTVQLYPSLVTAKKLETAF  385

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF++W      P + F+ R     DPC  P  +FL+  E VT  D  + TY R      
Sbjct  386   LTFKSWRSWNDEP-FTFNTRP-VGQDPCERPVIYFLDRTERVTG-DRTLTTYIRYVDGSE  442

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVI--KTRRC  1597
               C   D   +   +    V S    PA      R +CC+V I+  D E  +I  K R C
Sbjct  443   TECDKPDYAPTL-AVQFFHVSSARLNPAIWRMAPRRQCCEV-INGGDGEDNLIQVKIRGC  500



>ref|XP_001751279.1| predicted protein [Physcomitrella patens]
 gb|EDQ83596.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/408 (38%), Positives = 228/408 (56%), Gaps = 22/408 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T++S +VFG+ G+   W  R+ Y++ WW+P+   GF+ LD+ P  +   W    PPYR+S
Sbjct  1     TDISRIVFGIAGARDMWWGRKEYLKLWWKPSKMRGFVFLDEKPYGDY--WIDDWPPYRIS  58

Query  536   DNVSRVVEETNHVNPRVARMVHGIM-ETVR-DAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             +N S   E T     R A  +  I+ E +R D P      + W VMGDDDT+F  DNLV 
Sbjct  59    ENTSHF-EYTYKGGSRSAIRISRILSEMLRMDLP-----NVDWFVMGDDDTLFFEDNLVQ  112

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDHTK YY+G +SE    N +FS+  AFGGGG  +S+PLA A+     DCL RY H
Sbjct  113   VLSKYDHTKMYYIGSNSESHLQNIHFSYNMAFGGGGFAISYPLAKALEKIQDDCLARYPH  172

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D     C+A+LG+ L+   GFHQ+D+ GDISG L+ HP APL++LHH ++V PIFP
Sbjct  173   LFGSDDRMQACMAELGIPLTKEPGFHQLDVVGDISGLLAAHPAAPLVTLHHLEIVQPIFP  232

Query  1070  -----SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRS  1234
                  +  R E+ +H + AA  +   +LQQ +C+ R   WSFS++WGY   +++  +   
Sbjct  233   NTATKNFTRVEALKHLLKAAEVEAASILQQSICYDRFLKWSFSISWGYVVQVHKGFVSPR  292

Query  1235  YLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE--EVTARDEIVATY  1408
              LQ P +TF++W        + F+ R     + C  P  FF+ESV+   V +  E+   +
Sbjct  293   ELQIPQKTFKSWHKDQNKVTFPFNTRD-YPENVCQQPTRFFMESVKPTAVNSEGEMEGVF  351

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA--KIGRSECCDV  1546
             +R +      C   +  Q    + +I V      P+  ++ R  CC +
Sbjct  352   QREYYEKKYTC--AETLQPLSTVHRIRVLRKKIDPSWYQMPRRSCCRI  397



>ref|XP_011091510.1| PREDICTED: uncharacterized protein LOC105171936 [Sesamum indicum]
Length=488

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 160/428 (37%), Positives = 227/428 (53%), Gaps = 21/428 (5%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             +SPTN+SH+ FG+  S   W  R  Y + WW+PN T GF+ L+K P     P   S   +
Sbjct  77    HSPTNISHIAFGIGASTGTWEKRLHYSDIWWKPNITRGFVFLEKNPD----PRTASEIRH  132

Query  527   RVSDNVSRVVEETNHVNP-RVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             RVS +  R        +  R+AR+V  +              +RW VMGDDDT+F  +NL
Sbjct  133   RVSSDWKRFKRSAGSESAVRLARVVVDLFRA-------GLPNVRWFVMGDDDTVFFPENL  185

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V VL +YDH +  Y+GG+SE +  +   ++  AFGGGG  +S+PLA  +   +  CL RY
Sbjct  186   VTVLGKYDHRRMVYVGGNSESVEQDVMHAYDMAFGGGGFAISYPLAAQLVSLMDGCLNRY  245

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              +   +D+    C+ +LGV LS   GFHQID+ GD  G L+ HP APL+SLHH D V P+
Sbjct  246   HYFYGSDQRVWACVGELGVGLSRELGFHQIDIRGDPFGLLAAHPLAPLVSLHHLDYVKPL  305

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP+  + ES +  M A   D  R+LQQ  C+ R   WS S++WGY   IY  ++    L+
Sbjct  306   FPNKTQLESLQVLMKAYEVDPSRILQQSFCYQRRHKWSVSISWGYVVQIYPTLLTAKELE  365

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P+ TF+TW      P + F+ R   + DPC  P  F+L SV E +A D +   YR+   
Sbjct  366   MPLLTFRTWRSWKEGP-FTFNTRP-WSYDPCQQPIIFYLNSVREDSAGDTL-TMYRKFAV  422

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPA--KIG-RSECCDVTIDSVDSESAVIKTRR  1594
                  C  G    SA  I  I+V +P   P   K G R +CC++   S+   +  I+ RR
Sbjct  423   ETDKKC--GRQYASAMAIENIIVSAPKMDPEEWKQGTRRQCCEIN-GSISQGTMRIRIRR  479

Query  1595  CMADDIIA  1618
             C   + + 
Sbjct  480   CQQSETVT  487



>ref|XP_002274436.1| PREDICTED: uncharacterized protein LOC100241450 [Vitis vinifera]
 ref|XP_010657328.1| PREDICTED: uncharacterized protein LOC100241450 [Vitis vinifera]
Length=468

 Score =   276 bits (706),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 157/435 (36%), Positives = 231/435 (53%), Gaps = 19/435 (4%)
 Frame = +2

Query  329   ESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWP  508
             +S    ++PT+L HLVFG+  ++ +W  ++ YV+ WW+P    G + +D  PG E     
Sbjct  44    DSSQGVSAPTSLEHLVFGIASNQDSWLEKKNYVKHWWKPQQMRGCVFVDSMPGNESSYND  103

Query  509   PSS-PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTI  685
              SS PP  +S++ S+      H  P   R+   + ETV          +RW V GDDDTI
Sbjct  104   SSSLPPVCISEDTSQFRYTYRHGLPSAIRVARVVPETV----ALNHSGVRWFVFGDDDTI  159

Query  686   FLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIM  865
             F  +NLV  L++YDH  +YY+G +SE    N  FSF  AFGG G  +S+PLA  +A    
Sbjct  160   FFPENLVKTLSKYDHELWYYIGTNSEIYEQNRLFSFDMAFGGAGFAISYPLAKVLAKVFD  219

Query  866   DCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHF  1045
              CL+RY HL  +D     C+A+LGV L+   GFHQ+D+ G+  G L+ HP APL+S HH 
Sbjct  220   SCLERYPHLYGSDSRVYTCLAELGVGLTREPGFHQVDVRGETFGLLAAHPLAPLVSFHHL  279

Query  1046  DMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIM  1225
             D V+PIFP+M   ++  H   A   D  R+LQQ +C+ R  +W+ SV+WGY+  ++E   
Sbjct  280   DHVDPIFPNMTANQAIEHLFEAVKVDSERVLQQTVCYDRWFSWTISVSWGYAVQVFENHQ  339

Query  1226  PRSYLQNPIETFQTWGP-SPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
                 +    +TF+ W   S    ++ F+ R+    DPC  P  FF++SV   + RD I +
Sbjct  340   FLPDVLRARKTFRQWKKGSVLSESYTFNTRE-LHIDPCRRPTIFFMDSVS--SGRDGIES  396

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSP----VTKPAKIGRSECCDVTIDSVDSE  1570
             +YRR    G     A     S  R+ +I V+S       K  +  R  CCDV + S    
Sbjct  397   SYRRDASDGCTLHMA-----SPKRLEEIKVFSHKLDLKIKQLQAPRRHCCDV-LPSSQGN  450

Query  1571  SAVIKTRRCMADDII  1615
                +  R C  +++I
Sbjct  451   VLELAIRECKEEELI  465



>ref|XP_007206381.1| hypothetical protein PRUPE_ppa017976mg [Prunus persica]
 gb|EMJ07580.1| hypothetical protein PRUPE_ppa017976mg [Prunus persica]
Length=512

 Score =   277 bits (709),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 149/426 (35%), Positives = 234/426 (55%), Gaps = 18/426 (4%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             + +  TN+SH++F + GS K+W+ RR Y + WW+PN T GF+ LD+ P   +  WP + P
Sbjct  80    EGHEQTNISHILFSIGGSVKSWNKRRHYSQLWWKPNVTRGFVWLDEKPFPNM-TWPETIP  138

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PY+VS++ SR      + +    R    I   V+++ +     +RW VMGDDDT+F   N
Sbjct  139   PYKVSEDTSRFKYSCWYGSRSAVR----IARIVKESFELGLPNVRWFVMGDDDTVFFTHN  194

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  195   LVSVLAKYDHNQMYYIGGNSESVEQDVTHSYTMAYGGGGFAVSYPLAAELVKILDGCIDR  254

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y     +D+    C++++GV ++   GFHQ+D+ G   G L+ HP APL+SLHH D +  
Sbjct  255   YDKFYGSDQRIQACLSEIGVPVTKELGFHQLDIRGSPYGLLAAHPVAPLVSLHHLDYLES  314

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++NR +S +  ++    D  R+LQQ  C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  315   IFPNLNRIDSVKKLVSGYKVDPGRILQQSFCYDLNRNWSVSVSWGYTVRLYPFLVTAKKL  374

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             +  +ETF+TW      P + F+ R   ++D    P  F L+ VE V     +    R S 
Sbjct  375   ETAVETFRTWRSWDAGP-FTFNTRP-VSSDKYERPVVFMLDRVESVDGGKTLTGYKRYSM  432

Query  1421  ---RRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-  1579
                 +  P C       SA  +    V +P   P    K  R +CC++  D+  +++ V 
Sbjct  433   GKEEKDRPKC----NYTSALAVQFFNVSAPKFNPDLWNKAPRRQCCEIINDTDGADNVVH  488

Query  1580  IKTRRC  1597
             ++ R C
Sbjct  489   VQIRGC  494



>ref|XP_008371981.1| PREDICTED: uncharacterized protein LOC103435367 [Malus domestica]
Length=509

 Score =   277 bits (708),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 156/429 (36%), Positives = 234/429 (55%), Gaps = 24/429 (6%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN++H++FG+  S   W +R    E WW PN   GFL LD  P  E       S PYRV
Sbjct  95    PTNITHILFGIGASLTTWRNRSLSAELWWDPNTIRGFLWLDAEPQNETDF--SGSIPYRV  152

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S++ +R    ++    R+AR+V+       ++ +     +RW VMGDDDT+F  DNLV V
Sbjct  153   SEDWTRFSYSSSQSAVRIARIVY-------ESFKLGLPNVRWFVMGDDDTVFFSDNLVSV  205

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD-CLKRYSH  889
             LA+YDH   YY+GG+SE +  N   ++  A+GGGG  +S+PLA  +  G+MD CL+RYS+
Sbjct  206   LARYDHDLTYYIGGNSESVEQNVAHAYDMAYGGGGFAISYPLAARLV-GLMDGCLERYSN  264

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
                +D+    C++++GV L+   GFHQ+D+ GD  G L+ HP  PL+SLHH D + P+FP
Sbjct  265   FYGSDQRVSACVSEMGVPLTKLGGFHQLDIRGDPYGILAAHPLTPLVSLHHLDSMKPMFP  324

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             S    +S +  + A   D  R+LQQ +C+   R WS SV+WGY+  +Y  ++    LQ P
Sbjct  325   SQTHLDSLKSLLRAYRLDPGRILQQSICYDHRRKWSISVSWGYTIQLYPSLIGARELQMP  384

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             ++TF+TWG     P + F+ R   ++DPC  P  +FL+ V  +  R   V  Y+R     
Sbjct  385   LQTFKTWGTWSDGP-FTFNTRP-VSSDPCQQPIIYFLDQV--IFVRGGSVTIYKRFVASE  440

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSESAV-IKTR  1591
                C   +   +A R   IVV S    P         R +CC++    + +   + ++ R
Sbjct  441   GKQCGRAEYAHAAQR---IVVSSKKMDPRYWTKEAAPRRQCCEIKNQGIITNGDLEVRIR  497

Query  1592  RCMADDIIA  1618
              C   + I 
Sbjct  498   TCKPTESIT  506



>ref|XP_008343572.1| PREDICTED: uncharacterized protein LOC103406357 [Malus domestica]
 ref|XP_008354126.1| PREDICTED: uncharacterized protein LOC103417744 [Malus domestica]
Length=504

 Score =   276 bits (707),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 153/434 (35%), Positives = 232/434 (53%), Gaps = 34/434 (8%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN SH++FG+  S   WH R    E WW PN T GF+ LD  P  E       S PYRVS
Sbjct  91    TNXSHILFGIGASLTTWHDRSRSGELWWDPNTTRGFVWLDAKPKNETDF--SGSIPYRVS  148

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ +R    ++    R+AR+V+       ++ +     +RW VMGDDDT+F  +NLV VL
Sbjct  149   EDXTRFRYSSSQSAVRIARIVY-------ESFKVGLPNVRWFVMGDDDTVFFTENLVSVL  201

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A+YDH + YY+GG+SE +  +   ++  AFGGGG  +S+PLA  + + +  CL+RY +  
Sbjct  202   ARYDHDRMYYIGGNSESVEQDVMHAYDMAFGGGGFAISYPLAARLVEMMDGCLERYYNFY  261

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV L+ H GFHQ D+ GD  G L+ HP APL+SLHH D + P+FP  
Sbjct  262   GSDQRVWACVSEMGVPLTKHXGFHQFDIRGDPYGVLAAHPLAPLVSLHHLDSMKPMFPDQ  321

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
                +S +  + A   D  R+LQQ  C+   R WS S++WGY+  +Y  ++    LQ P++
Sbjct  322   THLDSLKSLLRAYRVDPGRILQQSFCYDHRRKWSMSISWGYTIQLYPSLIGAMDLQMPLQ  381

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF+TW      P + F+ R   ++DPC  P  +FLE V     +  IV  Y+R       
Sbjct  382   TFKTWRSXSNGP-FTFNTRP-VSSDPCQQPIIYFLEQV--AVGKSGIVTIYKR-------  430

Query  1436  ACFAGDGDQSADR-------ISKIVVYSPVTKP-----AKIGRSECCDV-TIDSVDSESA  1576
                A +G+Q   +       + +I V S    P      +  R ECC++    S+ +   
Sbjct  431   -FVANEGNQCKXKEYAHAMAVQRIEVSSEKMDPHYWTKEEAPRRECCEIKNRGSIKNGGM  489

Query  1577  VIKTRRCMADDIIA  1618
              ++ R C   + I 
Sbjct  490   GLRIRACKPKESIT  503



>ref|XP_011094901.1| PREDICTED: uncharacterized protein LOC105174478 [Sesamum indicum]
Length=476

 Score =   275 bits (704),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/420 (36%), Positives = 226/420 (54%), Gaps = 18/420 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH++FG+ G+   W  RR Y E WW+PN T GF+ LD  P     PWP +SPPY+VS
Sbjct  60    TNISHILFGIGGTASMWSRRRHYCELWWKPNVTRGFVWLDNEPALGDEPWPQTSPPYKVS  119

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + +R    + + +    R    I   V++  Q     +RW VMGDDDT+F  +NLV+VL
Sbjct  120   ADTARFKYTSWYGSRSAVR----IARIVKENFQLGLDNVRWFVMGDDDTVFFTENLVNVL  175

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA-MADGIMDCLKRYSHL  892
              +YD+ + YY+GG SE +  +   S+   +GG G  ++ P  +  + DG   C+ RY+ L
Sbjct  176   NKYDYKQMYYIGGISESVEQDVEHSYTMGYGGAGFAITLPAELVRILDG---CIDRYAEL  232

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D+  G C++++GV ++   GFHQ+D+ G   G LS HP APL+SLHH D + P+FP 
Sbjct  233   YGSDQKIGGCMSEIGVPITKELGFHQLDIRGSPYGLLSAHPLAPLVSLHHLDYLQPLFPG  292

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M+R  S R  M A   D  R LQQ  C+   RNWS SV+WGY+  +Y  ++    L  P+
Sbjct  293   MDRVASIRKLMNAYKYDSGRALQQSFCYDLTRNWSVSVSWGYTVQLYPFLVRAKDLNTPL  352

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR----SW  1420
             +TF TW    + P + F+ R     +PC  P  F+ +  +E+      V  YRR     W
Sbjct  353   QTFLTWRTWSQEP-FTFNTRV-LRMEPCERPVIFYFDGAQEL-GNGNTVTWYRRPQSMQW  409

Query  1421  RRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAV-IKTRRC  1597
             ++     FA      +  +S   + S +   A   R +CC++   S   +  V ++ R C
Sbjct  410   KQCDRNNFAAAYMVKSFNVSATYLNSRLWTKAP--RRQCCEIMGGSDHQDGHVRVRIRGC  467



>ref|XP_008355675.1| PREDICTED: uncharacterized protein LOC103419333 [Malus domestica]
Length=483

 Score =   275 bits (703),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/364 (38%), Positives = 209/364 (57%), Gaps = 20/364 (5%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D +  TN+SH++FG+ GS K W+ RR Y E WW+PN T GF+ +D+ P    + W  + P
Sbjct  76    DGHEKTNISHVLFGIGGSVKTWNERRHYTELWWKPNVTRGFVWMDQIP-TPFMTWVETLP  134

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              Y+VS + SR      +  P  +R    +   V+++ +     +RW VMGDDDT++  DN
Sbjct  135   QYKVSGDTSRF----KYSCPYGSRSAVRLARIVKESFELGLENVRWFVMGDDDTVYFPDN  190

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             L+ VLA+YDH + YY+GG+SE +  +  FS+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  191   LLSVLAKYDHNQMYYIGGNSESVEQDEIFSYTXAYGGGGFAISYPLAAELVKILDGCIDR  250

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L   D+    C++++GV L+   GFHQ+D+ G+  G LS HP  PL+SLHHFD V  
Sbjct  251   YDKLYGGDQKIQGCLSEIGVPLTKELGFHQLDIWGNPYGLLSAHPVTPLVSLHHFDSVES  310

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++N+ +S +  ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  311   IFPNLNQIDSVKKLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKL  370

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +  ++TF TW       NW  D R  T      ++DPC     + L+ VE V    E + 
Sbjct  371   ETALQTFWTW------KNW--DARLFTFNTQPVSSDPCERSVVYMLDGVENVGG-GETLT  421

Query  1403  TYRR  1414
             TY+R
Sbjct  422   TYKR  425



>ref|XP_010906683.1| PREDICTED: uncharacterized protein LOC105033526 [Elaeis guineensis]
Length=476

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 167/433 (39%), Positives = 232/433 (54%), Gaps = 31/433 (7%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T++ HL+FG+  S ++W  RR Y+  WWRP    GF+ LD   G  +       PP RVS
Sbjct  60    TSVRHLLFGIASSARSWPRRRDYLRLWWRPALMRGFVFLDSSVGGGV---ADDLPPTRVS  116

Query  536   DNVSRV---VEETNHVNPRVARMVHGIMETV--RDAPQRATGTLRWVVMGDDDTIFLVDN  700
              + SR     +       RVAR+   ++E V  R AP    G +RW+V+GDDDT+F  +N
Sbjct  117   ADASRFPYSFKGGLRSAVRVARIAKELVEAVDGRFAP----GDVRWIVLGDDDTVFFPEN  172

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             L   LA+YD  ++YY+GG SE +  N   SF  AFGGGG+ +S+PLA  +A  +  CL R
Sbjct  173   LAGTLAKYDWERWYYVGGRSEGLQQNMAHSFGMAFGGGGLAISYPLARVLAKVLDSCLVR  232

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y+HL  +D     CI +LGV L+   GFHQ+D+ GD+ G LS HP APL+SLHH D V P
Sbjct  233   YAHLYGSDARIFACITELGVGLTYEPGFHQVDLRGDLLGMLSAHPLAPLVSLHHLDNVEP  292

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             +FPSMNR  + +H   A N D  R+LQQ +C+   +  + SV+WGY+  ++E       L
Sbjct  293   LFPSMNRTMALKHLFEAVNVDPARILQQTVCYDSLKMLTISVSWGYTVQVFEG---NQLL  349

Query  1241  QNPIETFQTWGPSPRPPN-----WIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVAT  1405
              + +   QT+ P  R  N     +IF+ R+    DPC  P  FFLESV      D I + 
Sbjct  350   PDLLSLQQTFTPWRRNRNIVSGLYIFNTRE-FPRDPCERPVIFFLESVS--FGSDRINSN  406

Query  1406  YRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA--KIGRSECCDVTIDSVDSESAV  1579
             Y R        C    G +    + +I V S        +  R +CCDV + S       
Sbjct  407   YSRHVTND---CL--QGRRLTKNLQQIRVSSQKLNHEIWQAPRRQCCDV-LPSFTDMVLK  460

Query  1580  IKTRRCMADDIIA  1618
             I  R+C  D++IA
Sbjct  461   IDIRKCKDDELIA  473



>ref|XP_009346405.1| PREDICTED: uncharacterized protein LOC103938134 [Pyrus x bretschneideri]
Length=465

 Score =   274 bits (700),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/429 (35%), Positives = 232/429 (54%), Gaps = 28/429 (7%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D +  TN+SH++FG+ GS + W  RR Y E WW+PN T GF+ LD+ P +  + W  + P
Sbjct  46    DGHEKTNISHVLFGIGGSVETWDKRRHYTELWWKPNVTRGFVWLDQIP-SPFMTWVETLP  104

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              Y+VS N SR      +  P  +R    +   V+++ +     +RW VMGDDDT++  DN
Sbjct  105   QYKVSGNTSRF----KYSCPYGSRSAVRLARIVKESFELGLENVRWFVMGDDDTVYFPDN  160

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             L+ VLA+YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  C+ R
Sbjct  161   LLSVLAKYDHNQMYYIGGNSESVEQDEIHSYTMAYGGGGIAISYPLAAELVKILDGCIDR  220

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHH D V  
Sbjct  221   YDKLYGSDQKIQGCLSEIGVPLTKELGFHQLDIRGNPYGLLAAHPVTPLVSLHHLDYVES  280

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++N  +S +  ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  281   IFPNLNPIDSVKKLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKL  340

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +  ++TF TW       NW  D R  T      ++DPC     + L+ VE      E + 
Sbjct  341   ETALQTFWTW------KNW--DTRLFTFNTQPVSSDPCERSVVYMLDRVEN-GGGGETLT  391

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSES  1573
             TY+   R G   C   D   + + +    V +P   P    K  R +CC++   +  ++ 
Sbjct  392   TYK---RYGENDCIRSDYTHALE-VEVFNVSAPKFNPDLWNKAPRRQCCEIINGTEGADR  447

Query  1574  AV-IKTRRC  1597
              V ++ R C
Sbjct  448   VVQVQIRSC  456



>ref|XP_006435632.1| hypothetical protein CICLE_v10031336mg [Citrus clementina]
 ref|XP_006486404.1| PREDICTED: uncharacterized protein LOC102629034 [Citrus sinensis]
 gb|ESR48872.1| hypothetical protein CICLE_v10031336mg [Citrus clementina]
Length=492

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 158/441 (36%), Positives = 243/441 (55%), Gaps = 19/441 (4%)
 Frame = +2

Query  317   RSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE-  493
             R + ES  D   PTN+SH++F + GS   WH R  Y+  WW+PN T GF+ LD+ P  + 
Sbjct  63    RLKSESTPD-REPTNISHILFSISGSAATWHDRTRYINLWWKPNRTRGFVWLDEEPREKN  121

Query  494   -LLPWPPSSPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVM  667
                    ++ PYRVSD   +R    ++    R+AR++        D+ +     +RW VM
Sbjct  122   RASSTIANTIPYRVSDPGWTRFRYSSSRSAVRIARIIW-------DSFKLNLPNVRWFVM  174

Query  668   GDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMA  847
             GDDDT+F  DNL+ VL +YDH + +Y+G +SE +  N   ++  AFGGGG  +S+PLA  
Sbjct  175   GDDDTVFFTDNLLSVLTRYDHNQMWYIGCNSESVEQNVMHAYDMAFGGGGFAVSYPLAEK  234

Query  848   MADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPL  1027
             + + +  CL+RY +   +D+    CI+++GV+L+P +GFHQ+D+ GD  G L  HP APL
Sbjct  235   LVNALDGCLERYYYFYGSDQRIWACISEIGVSLTPERGFHQLDIRGDPYGLLGAHPIAPL  294

Query  1028  ISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSAN  1207
             ++LHH D +N +FP+  + +S    + A   D  R+LQQ LC+   R WS S++WGY+  
Sbjct  295   VTLHHIDYLNSLFPNRTQLDSLETLIHAYRIDPNRILQQSLCYDTKREWSISISWGYTIQ  354

Query  1208  IYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             IY   +  + L  P++TF+TW  S R   +IF+ R   + DPC  P  +FL+SVE V   
Sbjct  355   IYPLFLSANNLAMPLQTFKTWR-SWRDGPFIFNTRS-VSPDPCDHPVVYFLDSVENV-GL  411

Query  1388  DEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTI-D  1555
                  TY +       +C    G   A  +  I+V S    P    K  + +CC++    
Sbjct  412   TGTRTTYTKYGPLLGKSC-DKPGFVKAMEVKTIIVSSLKLDPKYWQKATQRQCCEIMDGG  470

Query  1556  SVDSESAVIKTRRCMADDIIA  1618
             S+   +  I+ R+C   + +A
Sbjct  471   SITDGTMRIRVRKCRPKETMA  491



>ref|XP_009346419.1| PREDICTED: uncharacterized protein LOC103938144 [Pyrus x bretschneideri]
Length=508

 Score =   275 bits (703),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 150/430 (35%), Positives = 233/430 (54%), Gaps = 26/430 (6%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D +  TN+SH++FG+ GS ++W  RR+Y E WW+ N T GF+ LD+ P   +  W  + P
Sbjct  85    DGHEKTNISHILFGIGGSVESWDKRRSYTELWWKLNVTRGFVWLDEKPSPNM-TWLETLP  143

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              YR S++ SR      +  P  +R    +   V+++ Q     +RW VMGDDDT++  DN
Sbjct  144   QYRASEDTSRF----KYSCPYGSRSAVRMARIVKESFQLGLENVRWFVMGDDDTVYFPDN  199

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV  LA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  200   LVSALAKYDHNQMYYIGGNSESVEQDVIHSYTMAYGGGGFAISYPLAAELVKILDGCIDR  259

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L  +D+    C+ ++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHH D V  
Sbjct  260   YDKLYGSDQKIQGCLTEIGVPLTKELGFHQLDIRGNPYGLLAAHPVTPLVSLHHLDYVES  319

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++N  +S +  ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  320   IFPNLNPIDSVKKLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKL  379

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +  ++TF TW       NW  D R  T      ++DPC     + L+ VE V  R E + 
Sbjct  380   ETALQTFWTW------KNW--DARLFTFNTQPVSSDPCERSVVYMLDRVESV-GRGETLT  430

Query  1403  TYRR-SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSE  1570
             TY+R +  +G   C   D    A ++    V +P   P    K  R +CC++   +  ++
Sbjct  431   TYKRYNIDKGENDCIRSDYTH-ALKVEAFNVSAPKFNPDLWNKAPRRQCCEIINGTKGAD  489

Query  1571  SAV-IKTRRC  1597
               V ++ R C
Sbjct  490   RVVQVQIRSC  499



>ref|XP_002314204.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa]
 gb|EEE88159.1| hypothetical protein POPTR_0009s03140g [Populus trichocarpa]
Length=499

 Score =   275 bits (702),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 150/420 (36%), Positives = 218/420 (52%), Gaps = 18/420 (4%)
 Frame = +2

Query  308   NESRSELES-----RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQL  472
             NE  S  ES     +      T L H+VFG+  S   W  R+ YV+ WWRP  T G + +
Sbjct  64    NEQDSNFESPPILSKKSQEYNTELKHIVFGIAASADLWQKRKEYVKVWWRPKQTRGIVWM  123

Query  473   DKPPGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTL  652
             D+   +   P     P  R+S + SR        +    R+   + ET+R   +     +
Sbjct  124   DRQVRS---PSDEGLPQIRISADTSRFKYSNKKGHRSALRISRVVSETLRLGLK----DV  176

Query  653   RWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSF  832
             RW VMGDDDT+F+VDN+V +L++YDH + YY+G  SE    N YFS+  A+GGGG  +S 
Sbjct  177   RWFVMGDDDTVFIVDNVVRILSKYDHRQLYYVGSSSESHLQNIYFSYSMAYGGGGFAISQ  236

Query  833   PLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYH  1012
             PLA  +A     C++RY  L  +D     C+A++GV LS   GFHQ D++GD+ G L+ H
Sbjct  237   PLAQELAKMQDRCIRRYPGLYGSDDRIQACMAEIGVPLSKESGFHQYDVYGDLLGLLAAH  296

Query  1013  PNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAW  1192
             P APL SLHH D+V PIFP M+RA + +H   +   D   ++QQ +C+ + R WS SV+W
Sbjct  297   PVAPLASLHHIDVVQPIFPGMSRARALQHLFKSVQLDSASVMQQSICYDKNRYWSISVSW  356

Query  1193  GYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE  1372
             GY   I+  ++    L+ P  TF  W        + F+ R   T  PC+ P  F++ + +
Sbjct  357   GYVVQIWRGVVSPRELETPARTFLNWYRKADYTAYTFNTRP-VTKHPCMKPFVFYMSTSK  415

Query  1373  EVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYS--PVTKPAKIGRSECCDV  1546
                A+   +  Y    RR  P+ +      S +RI  IVV       +  K  R +CC V
Sbjct  416   YDRAKKRAIGVYT---RRKSPSPYCRWKMASPERIDSIVVLKRPDTLRWLKSPRRDCCRV  472



>ref|XP_004305187.1| PREDICTED: uncharacterized protein LOC101309470 [Fragaria vesca 
subsp. vesca]
Length=690

 Score =   279 bits (714),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 155/428 (36%), Positives = 229/428 (54%), Gaps = 20/428 (5%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D    TN+SH++FG+ GS K+W+ R+ Y+E WW+PN T GF+  D+ P   +  W  + P
Sbjct  267   DGFKKTNISHILFGIGGSVKSWNKRKQYIELWWKPNITRGFVWFDQKPFPNM-TWTETLP  325

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              Y+VS   SR     N+     +R    I   V+++ +     +RW VMGDDDT+F  +N
Sbjct  326   RYKVSGETSRF----NYTCWYGSRSAIRIARIVKESFELGLENIRWFVMGDDDTVFFTEN  381

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VL +YDH + YY+GG+SE +  +   S+  A+GG G  +S+ LA+ +   +  CL R
Sbjct  382   LVTVLTKYDHNQMYYIGGNSESVEQDMVHSYATAYGGAGFAISYALAVELVRILDGCLNR  441

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y     +D     C++++GV L+   GFHQ+D+ G   G L+ HP APL+SLHH D V P
Sbjct  442   YHEFYGSDSKIQGCMSEIGVPLTKELGFHQMDIRGHPYGLLASHPVAPLVSLHHLDDVQP  501

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFPS    ES +  ++   +D  R LQ   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  502   IFPSQTSMESLKRLISGYKADPGRTLQHNFCYDLRRNWSVSVSWGYTVMLYPSLVTAKQL  561

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR--  1414
             +  ++TFQTWG     P + F++R   + D C  P  + L+ VE V  R E + TY R  
Sbjct  562   ETALQTFQTWGSRQGGP-FTFNIRT-VSYDHCERPLVYLLDRVENV-GRAETLTTYHRYL  618

Query  1415  --SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV  1579
               S  R    C       SA  +    V +    P    K  R +CC++   S   +S V
Sbjct  619   PWSSNRECGHC----NCTSALAVEFFNVSASKFSPDLWNKAPRRQCCEIINGSEGVDSVV  674

Query  1580  -IKTRRCM  1600
              ++ R CM
Sbjct  675   QVQIRDCM  682



>ref|XP_008387853.1| PREDICTED: uncharacterized protein LOC103450296 [Malus domestica]
Length=491

 Score =   274 bits (700),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 225/415 (54%), Gaps = 14/415 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN++H++FG+ GS  +W  R+ Y E WW+PN T G++ LD+ P   +  W  + PPYRVS
Sbjct  75    TNITHILFGIGGSVNSWKDRQHYSELWWKPNVTRGYVWLDQKPDPNM-TWSETLPPYRVS  133

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ SR      +  PR A  +  I   V+++ +     +RW V+GDDDT++  +NLV VL
Sbjct  134   EDTSRFKYSCLN-GPRSAVRIARI---VKESFELGLEKVRWFVLGDDDTVYFTENLVAVL  189

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A+YDH + YY+GG SE +  N   S+  A+GGGG  +S+PLA  +   +  C+ RY    
Sbjct  190   ARYDHNQMYYIGGISESVEQNVGHSYNMAYGGGGFAISYPLASELVKILDGCINRYDQFY  249

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C++++GV L+   GFHQ D+ G   G L+ HP APL+SLHH D V  IFP+ 
Sbjct  250   GSDIRIQACLSEIGVPLTKEPGFHQFDIRGSPLGLLAAHPLAPLVSLHHLDYVQSIFPNH  309

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              R +S +  +  +  D  R LQ    +   RNWS SV+WGY+  +Y K++    L+  ++
Sbjct  310   TRVDSVKKLIRVSKIDPGRTLQHNFGYDLRRNWSISVSWGYTVQLYPKLVAAKMLETALQ  369

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TFQTW  S  P  + FD R      PC  P  +  + VE     DE V TY+R ++ G+ 
Sbjct  370   TFQTWSSSMGP--FTFDTRS-IMLQPCERPIMYLXDQVER-XGEDETVTTYKR-YKSGVE  424

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVIKTR  1591
                     + A  I    V +P   P    K  R +C +V I+  +    VIK +
Sbjct  425   INCVNCDCRPALEIEFFKVSAPKLNPKLWDKAPRRQCVEV-INGTEGVDNVIKLQ  478



>ref|XP_009630351.1| PREDICTED: uncharacterized protein LOC104120315 [Nicotiana tomentosiformis]
Length=467

 Score =   273 bits (697),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/437 (36%), Positives = 247/437 (57%), Gaps = 19/437 (4%)
 Frame = +2

Query  320   SELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL  499
             S + +  + NSPT ++HLVF +  S K +  R+  +  W++PN+T  ++ LD  P ++  
Sbjct  43    STITAATNKNSPTTVNHLVFSIASSSKTFSKRKELLPLWYKPNSTKAYVFLDHTP-SDNS  101

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             P     P   + +N SR      + + + AR   GI   ++    R    +RW + GDDD
Sbjct  102   PKNIDLPQILIYENTSRFP----YTHRKGARYAIGITCMIKQVVARDDPNVRWYIFGDDD  157

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADG  859
             T+F VDNLV  L +YDH ++YY+G +SE    N YFSF  AFGGGG  +S PLA A+A  
Sbjct  158   TVFFVDNLVKTLEKYDHNEWYYIGSNSESYAQNAYFSFDMAFGGGGYAISRPLAKALAGV  217

Query  860   IMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLH  1039
             +  CL RY +L  +D     C+A+LGV+L+   GFHQ D+ G++ G LS HP +PL+SLH
Sbjct  218   LDSCLMRYPNLYGSDARIFSCLAELGVSLTHEPGFHQDDLWGNLFGLLSSHPLSPLLSLH  277

Query  1040  HFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK  1219
             H + ++ IFP+M + ++ +H   AAN+D  R+ QQ +C+ R  + S S+AWGY+  +YE 
Sbjct  278   HVERMHSIFPNMTKIQALKHLFKAANADPTRISQQTICYDRKNSLSVSIAWGYAIQVYEG  337

Query  1220  IMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIV  1399
              +    L   + TF+ W    + P+++F  R   + DPC    A FL+SV+     + + 
Sbjct  338   NIKLPDLITVLRTFEPWDKDKKRPHFMFRTRVE-SNDPCKKMVA-FLKSVDSYG--NNVW  393

Query  1400  ATYRRSWRRGLPACFAGDGDQSADRISKIVVYS----PVTKPAKIGRSECCDVTIDSVDS  1567
               Y R +R G   C A DG++  + + +I V+S      T+  +  R +CCDV++ S  +
Sbjct  394   TNYTR-YRVG-KTC-AKDGNKIKN-LEEIRVFSRKLDADTRQVRAPRRQCCDVSLSS--N  447

Query  1568  ESAVIKTRRCMADDIIA  1618
             +S  I+ R C  D+ I 
Sbjct  448   KSMDIQIRPCGIDEFIT  464



>ref|XP_011041961.1| PREDICTED: uncharacterized protein LOC105137785 [Populus euphratica]
Length=500

 Score =   274 bits (700),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/414 (36%), Positives = 216/414 (52%), Gaps = 13/414 (3%)
 Frame = +2

Query  311   ESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA  490
             ES   + S+      T L H+VFG+  S   W  R+ YV+ WWRP  T G + +D+   +
Sbjct  71    ESPPPILSKKSQEYNTELKHIVFGIAASADLWQKRKEYVKVWWRPKQTRGIVWMDRQVRS  130

Query  491   ELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMG  670
                P     P  R+S + SR        +    R+   + ET+R         +RW VMG
Sbjct  131   ---PSNEGLPQIRISADTSRFKYSNKKGHRSALRISRVVSETLR----LGLKDVRWFVMG  183

Query  671   DDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAM  850
             DDDT+F+VDN+V +L++YDH + YY+G  SE    N YFS+  A+GGGG  +S PLA  +
Sbjct  184   DDDTVFIVDNVVRILSKYDHRQLYYVGSSSESHLQNIYFSYSMAYGGGGFAISQPLAQEL  243

Query  851   ADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLI  1030
             A     C++RY  L  +D     C+A++GV LS   GFHQ D++GD+ G L+ HP APL 
Sbjct  244   AKMQDRCIRRYPGLYGSDDRIQACMAEIGVPLSKESGFHQYDVYGDLLGLLAAHPVAPLA  303

Query  1031  SLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANI  1210
             SLHH D+V PIFP M+RA + +H   +   D   ++QQ +C+ + R WS SV+WGY   I
Sbjct  304   SLHHIDVVQPIFPGMSRARALQHLFKSVQLDSASIMQQSICYDKNRYWSISVSWGYVVQI  363

Query  1211  YEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD  1390
             +  ++    L+ P  TF  W        + F+ R   T  PC+ P  F++ + +   A+ 
Sbjct  364   WRGVVSPRELETPARTFLNWYRKADYTAYTFNTRP-VTKHPCMKPFVFYMSTSKYDRAKK  422

Query  1391  EIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYS--PVTKPAKIGRSECCDV  1546
               +  Y    RR  P+ +      S +RI  IVV       +  K  R +CC V
Sbjct  423   RAIGVYT---RRKSPSPYCRWKMASPERIDSIVVLKRPDTLRWLKSPRRDCCRV  473



>ref|XP_002873576.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=290

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 181/268 (68%), Gaps = 13/268 (5%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
             SPTN+SHL F ++GS K W +RR Y+E WWRPN T G++ L++PPG +LLPWP  SPP+ 
Sbjct  35    SPTNISHLFFVIVGSTKTWRYRRGYIEPWWRPNITKGYVFLERPPGRDLLPWPNQSPPF-  93

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
                +V++    TN    ++ R+ + ++E+ + A +      RW V+ DDDT+F +DNLV 
Sbjct  94    ---SVNKESFITNKFKTQI-RLFYSLLESFKKASKET----RWFVIADDDTLFFLDNLVK  145

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
              L +YDH K+YY+G +SE + +N  F+F   +GGGG  LS+P  + +   + +C+KRY  
Sbjct  146   ALDRYDHKKHYYIGMNSENVWSNAIFAFDMGYGGGGYALSYPTVVTLLSNMEECIKRYLG  205

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             + S D  +  C+ADLG++L+  +G HQID+HGDISG LS HP +PLISLHHFD+++PIFP
Sbjct  206   VYS-DLLSFRCLADLGIDLTLEKGMHQIDLHGDISGLLSAHPQSPLISLHHFDVIDPIFP  264

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLC  1153
              M R +S  H M    +DQ R+LQQ +C
Sbjct  265   GMTRQQSVNHLM---KTDQSRVLQQTIC  289



>ref|XP_009347931.1| PREDICTED: uncharacterized protein LOC103939549 [Pyrus x bretschneideri]
Length=495

 Score =   273 bits (698),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/429 (35%), Positives = 232/429 (54%), Gaps = 28/429 (7%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             D +  TN+SH++FG+ GS + W  RR Y E WW+PN T GF+ LD+ P +  + W  + P
Sbjct  76    DGHEKTNISHVLFGIGGSVETWDKRRHYTELWWKPNVTRGFVWLDQIP-SPFMTWVETLP  134

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
              Y+VS N SR      +  P  +R    +   V+++ +     +RW VMGDDDT++  DN
Sbjct  135   QYKVSGNTSRF----KYSCPYGSRSAVRLARIVKESFELGLENVRWFVMGDDDTVYFPDN  190

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             L+ VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  191   LLSVLAKYDHNQMYYIGGNSESVEQDEIHSYTMAYGGGGFAISYPLAAELVKILDGCIDR  250

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y  L  +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHH D V  
Sbjct  251   YDKLYGSDQKIQGCLSEIGVPLTKELGFHQLDIRGNPYGLLAAHPVTPLVSLHHLDYVES  310

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++N  +S ++ ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  311   IFPNLNPIDSVKNLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKL  370

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +  ++TF TW       NW  D R  T      ++DPC     + L+ VE      E + 
Sbjct  371   ETALQTFWTW------KNW--DTRLFTFNTQPVSSDPCERSVVYMLDRVEN-GGGGETLT  421

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSES  1573
             TY+   R G   C   D    A ++    V +P   P    K  R +CC++   +  ++ 
Sbjct  422   TYK---RYGENDCIRSDYTH-ALKVEVFNVSAPKFNPDLWNKAPRRQCCEIINGTEAADR  477

Query  1574  AV-IKTRRC  1597
              V ++ R C
Sbjct  478   VVQVQIRSC  486



>ref|XP_009343841.1| PREDICTED: uncharacterized protein LOC103935754 [Pyrus x bretschneideri]
Length=502

 Score =   273 bits (698),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 234/434 (54%), Gaps = 34/434 (8%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T++SH++FG+  S   WH R    E WW P+ T GF+ L+  P  E       S PYRVS
Sbjct  89    TSISHILFGIGASLTTWHDRSRSGELWWDPSTTRGFVWLEAKPEKETDF--SGSIPYRVS  146

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ +R    ++    R+AR+V+       ++ +     +RW VMGDDDT+F  +NLV VL
Sbjct  147   EDWTRFRYSSSQSAVRIARIVY-------ESFKVGLPNVRWFVMGDDDTVFFTENLVSVL  199

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A YDH + YY+GG+SE +  +   ++  AFGGGG  +S+PLA  + + +  CL+RY +  
Sbjct  200   ASYDHDRMYYIGGNSESVEQDVMHAYDMAFGGGGFAISYPLAARLVEMMDGCLERYYNFY  259

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV L+ H GFHQ D+ GD  G L+ HP APL+SLHH D + P+FP  
Sbjct  260   GSDQRVWACVSEMGVPLTKHGGFHQYDIRGDPYGVLAAHPLAPLVSLHHLDSMKPMFPDQ  319

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
                +S +  + A   D  R+LQQ  C+   R WS SV+WGY+  +Y  ++    LQ P++
Sbjct  320   THLDSLKSLLRAYRVDPGRILQQSFCYDHRRKWSMSVSWGYTIQLYPSLIGAMDLQMPLQ  379

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF+TW      P + F+ R   ++DPC  P  +FLE V  V  +  IV  Y+R       
Sbjct  380   TFKTWRSWSNGP-FTFNTRP-VSSDPCQQPIIYFLEQV--VVGKSGIVTIYKR-------  428

Query  1436  ACFAGDGDQSADR-------ISKIVVYSPVTKP-----AKIGRSECCDV-TIDSVDSESA  1576
                A +G+Q   +       + +IVV S    P      +  R +CC++    S+ +   
Sbjct  429   -FMANEGNQCKKKEYAHAMAVQRIVVSSEKMDPHYWTKEEAPRRQCCEIKNRGSIKNGGM  487

Query  1577  VIKTRRCMADDIIA  1618
              ++ R C   + I 
Sbjct  488   GLRIRACKPKESIT  501



>ref|XP_009351426.1| PREDICTED: uncharacterized protein LOC103942953 [Pyrus x bretschneideri]
Length=497

 Score =   272 bits (696),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/428 (36%), Positives = 230/428 (54%), Gaps = 23/428 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN++H++FG+  S   W  R    E WW PN T GF+ LD  P  E       + PYRVS
Sbjct  83    TNITHILFGIGASLTTWRDRSLSAELWWDPNTTRGFVWLDAKPKNETDF--SGTIPYRVS  140

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ +R    ++    R+AR+V+       ++ +     +RW VMGDDDT+F  DNLV VL
Sbjct  141   EDWTRFRYSSSQSAVRIARIVY-------ESFKLGLPNVRWFVMGDDDTVFFTDNLVSVL  193

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD-CLKRYSHL  892
             A+YDH + YY+GG+SE +  +   ++  AFGGGG  +S+PLA  +   +MD CL+RYS+ 
Sbjct  194   ARYDHGRMYYIGGNSESVEQDVMHAYDMAFGGGGFAISYPLAAQLLVELMDGCLERYSNF  253

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D+    C++++GV L+   GFHQ D+ GD  G L+ HP  PL+SLHH D + PIFP+
Sbjct  254   YGSDERVSACVSEMGVPLTKLGGFHQFDIRGDPYGILAAHPLTPLVSLHHLDSMKPIFPN  313

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
                 +S +  + A   D  R+LQQ  C+     WS SV+WGY+  +Y  ++    LQ P+
Sbjct  314   QTHLDSLKSLLRAYRLDPGRILQQSFCYDHRSKWSMSVSWGYTIQLYPSLIGAMDLQMPL  373

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
             +TF+TWG     P + F+ R   ++DPC  P  +FL+ V  +  R   V  YRR      
Sbjct  374   QTFKTWGTWSDGP-FTFNTRP-VSSDPCQQPIIYFLDQV--IFVRGGSVTIYRRFVASEG  429

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSESAV-IKTRR  1594
               C   +  + A    +IVV S    P         R +CC++    V +   + I+ R 
Sbjct  430   KQC---ERAEYAHATQRIVVSSKKMDPRYWTKEAAPRRQCCEIKNRGVITNGDLEIRIRT  486

Query  1595  CMADDIIA  1618
             C   + I 
Sbjct  487   CKPTESIT  494



>ref|XP_010685940.1| PREDICTED: uncharacterized protein LOC104900256 [Beta vulgaris 
subsp. vulgaris]
Length=513

 Score =   273 bits (698),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 148/438 (34%), Positives = 228/438 (52%), Gaps = 15/438 (3%)
 Frame = +2

Query  308   NESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG  487
              E+   L+   +   PT L H+VFG+  S   W  R+ Y++ WWRPN T G + LDK   
Sbjct  84    TETNGSLDDDEEKEEPTQLKHIVFGIAASSFLWDKRKEYIKQWWRPNHTRGVVWLDKEVR  143

Query  488   AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVV  664
              +        P  R+S++ S++   TN +  R A R+   + ET++         +RW V
Sbjct  144   TDK---NEKLPEIRLSEDTSKL-RYTNRLGSRSALRISRVVSETLK----LGMKDVRWFV  195

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAM  844
             MGDDDT+F+VDN+V +L +YDH +YYY+G +SE    N  FS+  A+GGGG  +S+PLA 
Sbjct  196   MGDDDTVFVVDNVVRILEKYDHHQYYYIGSNSESHVQNIIFSYAMAYGGGGFAISYPLAQ  255

Query  845   AMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAP  1024
              +A     C++RY  L  +D     C+A+LGV L+  QGFHQ D++GD+ G LS HP  P
Sbjct  256   ELAKMQDRCIQRYPALYGSDDRIQACMAELGVPLTKEQGFHQYDVYGDLLGLLSAHPVTP  315

Query  1025  LISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSA  1204
             L+S+HH D+V P+FP M R ++  H   + N D   ++QQ +C+ + R WS SV+WGY+ 
Sbjct  316   LVSIHHLDVVEPVFPGMARPQAIGHLFESVNLDSASIMQQSICYDKKRFWSISVSWGYTV  375

Query  1205  NIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTA  1384
              I   ++    L+ P  TF  W        + F+ R   T  PC  P  +++        
Sbjct  376   QIIRGVVSPRELEMPTRTFLNWYKRADYTGYSFNTRP-VTRHPCQSPFIYYMSRTRYDRG  434

Query  1385  RDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYS--PVTKPAKIGRSECCDVTIDS  1558
               + +  YR   R   P C      ++ ++I  +V++      +  K  R +CC V +DS
Sbjct  435   SKQTIGIYRAHDRYKHPYCRW--KMENPEKIDSVVIFKRPDHLRWQKSPRRDCCRV-VDS  491

Query  1559  VDSESAVIKTRRCMADDI  1612
                    +    C   ++
Sbjct  492   KKRSVLYVWVGSCRGGEV  509



>ref|XP_009350453.1| PREDICTED: uncharacterized protein LOC103941982 [Pyrus x bretschneideri]
Length=495

 Score =   272 bits (695),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 148/424 (35%), Positives = 230/424 (54%), Gaps = 28/424 (7%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             TN+SH++FG+ GS + W  RR Y E WW+PN T GF+ LD+ P +  + W  + P Y+VS
Sbjct  81    TNISHVLFGIGGSVETWDKRRHYTELWWKPNVTRGFVWLDQIP-SPFMTWVETLPQYKVS  139

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              N SR      +  P  +R    +   V+++ +     +RW VMGDDDT++  DNL+ VL
Sbjct  140   GNTSRF----KYSCPYGSRSAVRLARIVKESFELGLENVRWFVMGDDDTVYFPDNLLSVL  195

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             A+YDH + YY+GG+SE +  +   S+  A+GGGGI +S+PLA  +   +  C+ RY  L 
Sbjct  196   AKYDHNQMYYIGGNSESVEQDEIHSYTMAYGGGGIAISYPLAAELVKILDGCIDRYDKLY  255

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP  PL+SLHH D V  IFP++
Sbjct  256   GSDQKIQGCLSEIGVPLTKELGFHQLDIRGNPYGLLAAHPVTPLVSLHHLDYVESIFPNL  315

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             N  +S +  ++    D  R +Q   C+   RNWS SV+WGY+  +Y  ++    L+  ++
Sbjct  316   NPIDSVKKLVSGYKVDPGRTVQHSFCYDLRRNWSVSVSWGYTVQLYPFLVTAKKLETALQ  375

Query  1256  TFQTWGPSPRPPNWIFDVRKRT------TTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             TF TW       NW  D R  T      ++DPC     + L+ VE      E + TY+  
Sbjct  376   TFWTW------KNW--DTRLFTFNTQPVSSDPCERSVVYMLDRVEN-GGGGETLTTYK--  424

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-IK  1585
              R G   C   D   + + +    V +P   P    K  R +CC++   +  ++  V ++
Sbjct  425   -RYGENDCIRSDYTHALE-VEVFNVSAPKFNPDLWNKAPRRQCCEIINGTEAADRVVQVQ  482

Query  1586  TRRC  1597
              R C
Sbjct  483   IRSC  486



>ref|XP_004487057.1| PREDICTED: uncharacterized protein LOC101496794 [Cicer arietinum]
Length=546

 Score =   273 bits (698),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 147/399 (37%), Positives = 215/399 (54%), Gaps = 12/399 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S   W+ R+ Y++ WWRP  T G + LDK             P  R+S
Sbjct  134   TALKHIVFGIAASSNLWNVRKEYIKIWWRPKQTRGVVWLDKSISTRS---NEGLPEIRIS  190

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + SR    TNH   R A  +  I   V +  +     +RW VMGDDDT+F+VDN+V +L
Sbjct  191   SDTSRF-RYTNHQGQRSALRISRI---VTETLKLGLKDVRWFVMGDDDTVFVVDNVVRIL  246

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH  +YY+G  SE    N +FS+  A+GGGG  +S+PLAM +A     C++RY  L 
Sbjct  247   SKYDHRHFYYVGSSSESHVQNIHFSYAMAYGGGGFAISYPLAMELAKMQDRCIQRYPALY  306

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ D++GD+ G L  HP APL+SLHH D+V PIFP M
Sbjct  307   GSDDRIQACMAELGVPLTREAGFHQYDVYGDLLGLLGAHPVAPLVSLHHLDVVQPIFPRM  366

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             +R +S +H M + N D   ++QQ +C+ + R WS SV+WG+   I   ++    L+ P  
Sbjct  367   SRVQSLKHLMESINQDSGSIMQQSICYDKNRYWSISVSWGFMVQILRGVLSPRELEMPSR  426

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R      PC  P  +++      ++  +IV+ Y R  +   P
Sbjct  427   TFLNWYRRADYTAYAFNTRP-VAKHPCQKPFVYYMSKTHYDSSSKQIVSVYARDNKSKSP  485

Query  1436  ACFAGDGDQSADRISKIVVYSPV--TKPAKIGRSECCDV  1546
              C       S ++I+ IVV      ++  K  R +CC V
Sbjct  486   FCRWKMN--SPEKITNIVVTKRRDPSRWKKSPRRDCCRV  522



>ref|XP_003597290.1| hypothetical protein MTR_2g095970 [Medicago truncatula]
 gb|AES67541.1| transferring glycosyl group transferase [Medicago truncatula]
Length=543

 Score =   273 bits (698),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 147/400 (37%), Positives = 218/400 (55%), Gaps = 15/400 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S   W+ R+ Y++ WWRP  T G + LD+    +        P  R+S
Sbjct  132   TELKHIVFGIAASSNLWNTRKEYIKIWWRPKQTRGVVWLDQRVSTQR---NEGLPDIRIS  188

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             D+ S+      + N +  R    I   V +  +     +RW VMGDDDT+F+VDN+V +L
Sbjct  189   DDTSKF----RYTNRQGQRSALRISRVVTETLKLGLKDVRWFVMGDDDTVFVVDNVVRIL  244

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH  +YY+G  SE    N +FS+  A+GGGG  +S+PLA+ +A     C++RY  L 
Sbjct  245   SKYDHRHFYYVGSSSESHVQNIHFSYAMAYGGGGFAISYPLAVELATMQDRCIQRYPALY  304

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ D++GD+ G L  HP APL+SLHH D+V PIFPSM
Sbjct  305   GSDDRMQACMAELGVPLTKEAGFHQYDVYGDLLGLLGAHPVAPLVSLHHLDVVQPIFPSM  364

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             +RA+S +H M + N D   ++QQ +C+ + R WS SV+WG+   I   ++    L+ P  
Sbjct  365   SRAQSIKHLMESINQDSSSIMQQSICYDKNRFWSISVSWGFMVQILRGVLSPRELEMPSR  424

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R      PC  P  +++      TA  +IV  Y R   +  P
Sbjct  425   TFLNWYRRADYTAYAFNTRP-VAKHPCQKPFVYYMSKTHFDTASRQIVGVYSRDQTKS-P  482

Query  1436  ACFAGDGDQSADRISKIVVYS---PVTKPAKIGRSECCDV  1546
              C      +S ++I+ IVV     P+ +  K  R +CC V
Sbjct  483   FCRW--RMESPEKITSIVVTKRRDPL-RWKKSPRRDCCRV  519



>ref|NP_193259.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83575.1| uncharacterized protein AT4G15240 [Arabidopsis thaliana]
 gb|AHL38698.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=488

 Score =   271 bits (693),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 168/446 (38%), Positives = 237/446 (53%), Gaps = 29/446 (7%)
 Frame = +2

Query  308   NESRSELES--RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKP  481
             N  R ++ S  R+ S   T   HL+F +  S  +W  R +YV  W+ P +T   + LD+ 
Sbjct  60    NFRREQISSIARSLSVFSTRRRHLLFSIAASHDSWLRRSSYVRLWYSPESTRAVVFLDRG  119

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWV  661
                  L    + PP  VS +VSR      +  P   R    +   V++   R    +RW 
Sbjct  120   G----LESDLTLPPVIVSKDVSRF----PYNFPGGLRSAIRVARVVKETVDRGDKDVRWF  171

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLA  841
             V GDDDT+F VDNLV VL++YDH K++Y+G +SEF   N  +SF  AFGGGG  +S  LA
Sbjct  172   VFGDDDTVFFVDNLVTVLSKYDHRKWFYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLA  231

Query  842   MAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNA  1021
               +A  +  CL RYSH+  +D     C+A+LGV L+   GFHQID+ G+I G L  HP +
Sbjct  232   KVLAKVLDSCLMRYSHMYGSDSRIFSCVAELGVTLTHEPGFHQIDVRGNIFGLLCAHPLS  291

Query  1022  PLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYS  1201
             PL+SLHH D V+P FP  NR ES  H + AA+ D  R+LQQ +C+      + SV WGY+
Sbjct  292   PLVSLHHLDAVDPFFPKRNRTESVAHLIGAASFDSGRILQQSVCYDSLNTVTVSVVWGYA  351

Query  1202  ANIYE--KIMPRSYLQNPIETFQTW-GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE  1372
               +YE  K++P   L    +TF TW   S    N++F  R+    DPC  P  FFL+SV 
Sbjct  352   VQVYEGNKLLPD--LLTLQKTFSTWRRGSGVQSNYMFSTRE-YPRDPCGRPLVFFLDSV-  407

Query  1373  EVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECC  1540
                  D    T+       +  C      ++ +R+ +I V SP      +   + R +CC
Sbjct  408   ---GSDGTEGTWSNYNIHRVGHCHRA---EAVERLERIRVLSPKLERNVEQMGLPRRQCC  461

Query  1541  DVTIDSVDSESAVIKTRRCMADDIIA  1618
             D  I S  ++S VI  R+CM D++IA
Sbjct  462   D--ISSPYNKSMVINIRQCMPDELIA  485



>ref|XP_002975764.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23393.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=595

 Score =   274 bits (700),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 158/441 (36%), Positives = 241/441 (55%), Gaps = 23/441 (5%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE  493
             +++E+ +   +++ T L ++VFG+  S + W  RR YV+ WW+ +   GF+ LDK    +
Sbjct  172   AKTEIHTSTSTSTATTLYNIVFGIAASSRLWDRRREYVKLWWKSSQMRGFVWLDKKVRRK  231

Query  494   LLPWPPSS-PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMG  670
                W  +  PP+R+S + +      N+ N   AR    I   V +  +     + W VMG
Sbjct  232   ---WSKTDYPPFRISSSTAAF----NYTNKMGARAAIRISRIVSETFRIGLPDVHWFVMG  284

Query  671   DDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAM  850
             DDDTIF+ +NLV +L++YDHTKYYY+G  SE    N +FS+  A+GGGG  +S+PLA A+
Sbjct  285   DDDTIFIPENLVKLLSKYDHTKYYYIGSSSESHTQNLHFSYNMAYGGGGFAISYPLARAL  344

Query  851   ADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLI  1030
                   CL RY +L  +D     C+A+LGV L    GFHQ D++GD SG LS HP +PLI
Sbjct  345   ERMQDGCLHRYPYLFGSDDRIQACMAELGVPLVKEPGFHQFDIYGDASGLLSAHPVSPLI  404

Query  1031  SLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANI  1210
             S+HH D+++P+FP+M + ++ +H   +   D P +LQQ +C+ + R WSFSV+WGY+  +
Sbjct  405   SIHHLDVIHPVFPNMTQVQALKHLSRSIKVDAPGILQQSICYDKWRKWSFSVSWGYAVQV  464

Query  1211  YEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD  1390
             Y  I+P   L+ P  TF +W        + F  R+  + +PC  P  F++++V    +  
Sbjct  465   YRGILPPRELELPARTFISWYRRTEDSGFPFSTRE-ISRNPCEQPTIFYMDNVGHKNSSR  523

Query  1391  EIVATYRRSWRRGLPAC---FAGDGDQSADRISKIVVYSPVTKPA--KIGRSECCDVTID  1555
                   R + RRG   C    A  G      I  I+VY   T+       R  CC V I+
Sbjct  524   SYSTYARETKRRG--DCRWKMASPGG-----IDSIMVYRDRTEGNWHTAPRRHCCRV-IN  575

Query  1556  SVDSESAVIKTRRCMADDIIA  1618
             S D  +  I+  +C   + IA
Sbjct  576   S-DKRNVEIEVGQCRTGEFIA  595



>ref|XP_006846344.1| hypothetical protein AMTR_s00012p00258400 [Amborella trichopoda]
 gb|ERN08019.1| hypothetical protein AMTR_s00012p00258400 [Amborella trichopoda]
Length=544

 Score =   272 bits (696),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 153/423 (36%), Positives = 232/423 (55%), Gaps = 14/423 (3%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
              + N  TN SHL+FG+ GS K W  R+ Y E WW P  T GF+ LD+ P    + WP + 
Sbjct  124   TEKNIKTNFSHLLFGIGGSAKTWQKRQGYTELWWEPGKTRGFVWLDEKPEENEI-WPKTL  182

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
             P +++S + S+      + N   +R    I   V ++       +RW VMGDDDT+F  +
Sbjct  183   PKFKISGDTSKF----PYTNAWGSRSAIRIARIVLESFALGLDGIRWFVMGDDDTVFFTE  238

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NL +VL +Y+H + YY+GG+SE +  +   S+  AFGGGG  +S+PLA A+   +  C++
Sbjct  239   NLAEVLGKYNHEEMYYIGGNSESVEQDIIHSYGMAFGGGGFAISYPLAAALVTILDRCIE  298

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RY+    +D+    C++++GV L+   GFHQ+D+ G+  G L+ HP APL+SLHH D V+
Sbjct  299   RYNFFYGSDERIRACMSEMGVPLTREPGFHQVDIRGEPYGLLAAHPVAPLVSLHHLDYVS  358

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
              IFP   +  S +  + A+ +D  R+LQQ LC+     WS SV+WGY+  IY  I+  + 
Sbjct  359   SIFPGQTQLASLQTLIQASKTDPGRILQQTLCYEPELKWSVSVSWGYTVQIYPSIVLPNI  418

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRS  1417
             L+ P +TF+TW      P + F+ R     DPC  P  FFL+ V    +R  +  TY+R 
Sbjct  419   LEKPFQTFKTWRTYQSEP-FTFNTRP-IDADPCNKPAVFFLKEVGRNGSR-RLSTTYKR-  474

Query  1418  WRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVIKT  1588
                  P+    +    +  +  + V S   +P    K  R +CCDV + S D  S  I+ 
Sbjct  475   -YSSDPSKICKESGYPSFELQMVRVSSEKMEPGDWQKAARRQCCDVVV-SKDQRSTDIRI  532

Query  1589  RRC  1597
             R+C
Sbjct  533   RKC  535



>ref|XP_002961368.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ36628.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=568

 Score =   273 bits (697),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/363 (37%), Positives = 211/363 (58%), Gaps = 10/363 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L+++VFG+  S K W  R+ YV+ WWRP    GF+ LDK   +    W  + PP R+S
Sbjct  157   TGLANIVFGIAASAKLWEKRQEYVKLWWRPGEMRGFVWLDKAVSS----WSKALPPMRIS  212

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ ++     N+ N +  R    I   V +  ++    + W VMGDDDT+F+ +NLV +L
Sbjct  213   EDTAKF----NYTNKKGGRSGIRISRVVSETFRQNLTDVHWFVMGDDDTMFVPENLVRIL  268

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH K+YY+G HSE    N +FS+  A+GGGG  +S+PLA A+A     C+ +Y +L 
Sbjct  269   SKYDHRKFYYIGSHSESHTQNIHFSYNMAYGGGGFAISYPLAKALAKVQDRCIMKYPYLY  328

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+++LGV L+   GFHQ D++GD  G L+ HP  PL+S+HH D+++P+FP+ 
Sbjct  329   GSDDRIQACLSELGVPLTKEPGFHQFDIYGDAFGLLAAHPVTPLVSIHHLDLIDPVFPNT  388

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              + E+ RHF ++   D   +LQQ +C+ + + WS SV+WGY+  +Y  I+P   L+ P+ 
Sbjct  389   TQIEALRHFKSSMRVDPGGVLQQSICYDKYKRWSISVSWGYAVQVYRGILPPRLLELPMR  448

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR-RGL  1432
             TF +W        + F+ R    + PC  P  F+++ V       E +++Y R  R RG 
Sbjct  449   TFLSWYRRMDDIGFPFNTRPFLKS-PCEQPTIFYMKEVGYGDEAGETISSYSRDRRQRGG  507

Query  1433  PAC  1441
               C
Sbjct  508   GEC  510



>ref|XP_008240551.1| PREDICTED: uncharacterized protein LOC103339050 [Prunus mume]
Length=503

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/426 (34%), Positives = 232/426 (54%), Gaps = 18/426 (4%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             + +  TN+SH++FG+ GS K+W+ RR Y + WW+P+ T GF+ LD+ P   +  WP + P
Sbjct  80    EGHEQTNISHILFGIGGSVKSWNKRRHYSQLWWKPSVTRGFVWLDEKPFPNM-TWPGTVP  138

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             PY+VS++ SR      + +    R    I   V+++ +     +RW VMGDDDT+F  DN
Sbjct  139   PYKVSEDTSRFKYSCWYGSRSAVR----IARIVKESFELGLPNVRWFVMGDDDTVFFTDN  194

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VLA+YDH + YY+GG+SE +  +   S+  A+GGGG  +S+PLA  +   +  C+ R
Sbjct  195   LVSVLAKYDHNQMYYIGGNSESVEQDVTHSYTMAYGGGGFAISYPLAAELVKILDGCIDR  254

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             Y     +D+    C++++GV ++   GFHQ+D+ G   G L+ HP APL+SLHH D +  
Sbjct  255   YDKFYGSDQRIQACLSEIGVPVTKELGFHQLDIRGSPYGLLAAHPTAPLVSLHHLDYLES  314

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYL  1240
             IFP++ R +S    ++    D  R+LQ   C+   RNWS SV+WGY+  +Y  ++    L
Sbjct  315   IFPNLTRIDSVEKLVSGYEVDPGRILQHSFCYDLNRNWSVSVSWGYTVRLYPFLVTAKKL  374

Query  1241  QNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
             +  +ETFQTW      P + F+ +   ++D    P  F L+ VE V     +    + + 
Sbjct  375   ETALETFQTWRSWHAGP-FTFNTQP-VSSDKYERPIVFMLDRVESVDESKTLTGYKKYNI  432

Query  1421  RR---GLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTIDSVDSESAV-  1579
              +     P C       SA  +    V +P   P    K  R +CC++   +  ++S V 
Sbjct  433   GKEENDCPKC----NYTSALAVQFFNVSAPKFNPDLWNKAPRRQCCEIINGTDGADSVVH  488

Query  1580  IKTRRC  1597
             ++ R C
Sbjct  489   VQIRGC  494



>ref|XP_010674122.1| PREDICTED: uncharacterized protein LOC104890362 [Beta vulgaris 
subsp. vulgaris]
Length=492

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/425 (36%), Positives = 225/425 (53%), Gaps = 13/425 (3%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYR  529
              PTNL H+VFG+  +   W  R+ +++ WWRPN T GF+ LD+             P   
Sbjct  69    EPTNLRHVVFGIGAAANKWGRRKDFIKLWWRPNITRGFVFLDRHVNLSENEGLDDYPILE  128

Query  530   VSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             VS++ SR        +    RM   + E VR         +RW VMGDDDT+F  DNLV 
Sbjct  129   VSEDTSRFGYSYRRGSRSALRMTRIVSEMVR----MDLEDVRWFVMGDDDTVFFPDNLVK  184

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL +YDH   YY+G +SE    N YF++  AFGGGG  +S+PLA+A+      C++RY+ 
Sbjct  185   VLQKYDHNNMYYIGSNSETHIQNIYFTYDMAFGGGGFAISYPLALAIEKIQDTCIQRYTG  244

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D     C+A+LGV L+   GFHQ D++G + G L+ HP APL+SLHH ++V+P+FP
Sbjct  245   LYGSDDRIQACLAELGVPLTKEPGFHQCDVYGSLFGLLTAHPVAPLVSLHHIEIVDPLFP  304

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              M R ES +H  A    D   ++QQ +C+ R RNW+ SV+WGY+  I    +    +Q  
Sbjct  305   YMGRLESLQHLEAPMKLDSEALMQQSICYDRSRNWTISVSWGYAVQIIRGFVTPRDMQRA  364

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
               TF  W     P  + F+ R   +  PC  P+ ++L +V   +  +  V+ Y    R  
Sbjct  365   TRTFLNWHKRDEPTGFSFNTRS-FSKHPCQKPYIYYLSNVLLNSNANVTVSDYVHQ-RMP  422

Query  1430  LPACFAGDGDQSADRISKIVVYSPVT--KPAKIGRSECCDVTIDSVDSESAV-IKTRRCM  1600
              P C+     ++ ++I ++ VY  +   K  +  R +CC V   + D ES V I    C 
Sbjct  423   HPWCWW--KVENPEKIHRVEVYKKLNPHKWDQAPRRDCCKVL--NTDKESTVAIDVGECT  478

Query  1601  ADDII  1615
               ++I
Sbjct  479   EGEVI  483



>ref|XP_010435042.1| PREDICTED: uncharacterized protein LOC104718913 [Camelina sativa]
Length=487

 Score =   270 bits (691),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/427 (38%), Positives = 227/427 (53%), Gaps = 23/427 (5%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PT   HL+F +  S  +W  R +YV  W+ P +T   + LD+      L  PP      V
Sbjct  76    PTRRRHLLFSIAASHDSWLRRSSYVRLWYTPESTRAVVFLDRGGFEPDLTLPPVV----V  131

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
             S +VSR      +  P   R    +   V++   R    +RW V GDDDT+F VDNLV V
Sbjct  132   SKDVSRF----PYNFPGGLRSAIRVARVVKEIVDRGDKDVRWFVFGDDDTVFFVDNLVKV  187

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH K+YY+G +SEF   N  +SF  AFGGGG  +S  LA  +A  +  CL RYSH+
Sbjct  188   LSKYDHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSCLMRYSHM  247

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+A+LGV L+   GFHQ+D+ G+I G L  HP +PL+SLHH D V+P FP 
Sbjct  248   YGSDSRIFSCLAELGVTLTHEPGFHQVDVRGNIFGLLCAHPLSPLVSLHHLDAVDPFFPK  307

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIMPRSYLQN  1246
             MNR ES    + A+  D  R+LQQ +C+      + SV WGY+  +YE  K++P   L  
Sbjct  308   MNRTESVARLIGASGLDTGRILQQSVCYDSLNTVTVSVVWGYAIQVYEGNKLLPE--LLT  365

Query  1247  PIETFQTW-GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
               +TF TW   S    N++F  R     DPC  P  FFL+SV      D    T+   + 
Sbjct  366   LQKTFSTWRRGSGVQSNYMFSTRD-YPRDPCGRPLVFFLDSV----GSDGNEGTWSNYYL  420

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG--RSECCDVTIDSVDSESAVIKTRRC  1597
               +  C   +  +  +RI +++         ++G  R +CCD  I S  ++S VI  R+C
Sbjct  421   HRVGNCHRAEAVKRLERI-RVLSRKLELGAEQMGSPRRQCCD--ISSSYNKSMVINIRQC  477

Query  1598  MADDIIA  1618
             M D++IA
Sbjct  478   MPDELIA  484



>ref|XP_002312114.1| fringe-related family protein [Populus trichocarpa]
 gb|EEE89481.1| fringe-related family protein [Populus trichocarpa]
Length=495

 Score =   270 bits (691),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/433 (35%), Positives = 226/433 (52%), Gaps = 22/433 (5%)
 Frame = +2

Query  320   SELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELL  499
             + +E++  S+ PTN+ H++F + GS   WH R  Y  +WW PN T GF+ LD+   +   
Sbjct  69    TRIETQLRSSQPTNIFHILFCIGGSAATWHDRSRYSSTWWVPNVTRGFVWLDQETNST--  126

Query  500   PWPPSSPPYRVSDNVSRVV---EETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMG  670
                      + + NV  V+    E        +R    I   + D+ +     +RW VMG
Sbjct  127   ---------QTNKNVPAVMVSSPEWTRFKFSSSRSAVRIARVISDSVKLRLPRVRWFVMG  177

Query  671   DDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAM  850
             DDDT++  DNLV VL++YDH + +Y+GG+SE +  +   S+  AFGGGG  LS+PLA  +
Sbjct  178   DDDTVYYTDNLVSVLSRYDHNQMWYIGGNSESVEQDVMHSYDMAFGGGGFALSYPLAERL  237

Query  851   ADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLI  1030
                +  CL RY +   +D+    CI+++GV L+   GFHQ D+ G + G L+ HP APL+
Sbjct  238   VSMLDGCLDRYYYFYGSDQRIWACISEIGVPLTREPGFHQFDIRGSVYGLLAAHPLAPLV  297

Query  1031  SLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANI  1210
             SLHH D + P+FP  +R +S +    A  +D PR+ QQ  C    R WS S+AWGY+  +
Sbjct  298   SLHHLDNLEPLFPDHSRIDSLKTINRAYQADPPRIFQQTFCHDYKRKWSISIAWGYTVQL  357

Query  1211  YEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARD  1390
             Y  ++P   LQ P+ TF+TW      P + F+ R  T  D C  P  F LE  +EV    
Sbjct  358   YTLLLPAKDLQTPVRTFKTWRSWSDGP-FTFNTRP-TEADHCKQPVVFMLEQAKEVGING  415

Query  1391  EIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDV-TIDS  1558
              + + Y R  ++    C      Q A  + +I+V S    P    K  R  CC++    S
Sbjct  416   SLTS-YTRIVQKPGKTCNTASYAQ-AMSVQRILVSSLKVGPDYWKKAPRRYCCELMNKGS  473

Query  1559  VDSESAVIKTRRC  1597
             +   S  I+ R+C
Sbjct  474   IKKSSMQIRIRKC  486



>ref|XP_010267798.1| PREDICTED: uncharacterized protein LOC104604918 [Nelumbo nucifera]
Length=475

 Score =   270 bits (689),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/437 (36%), Positives = 236/437 (54%), Gaps = 26/437 (6%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS--PPY  526
             PT L HLVFG+  + ++W +R+ YV  WW+P +  G + +D  P   +     SS  PP 
Sbjct  56    PTTLDHLVFGIASTAQSWPNRKEYVRLWWKPQSMRGCVFVDSMPPTTVDKHNDSSTLPPI  115

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
              +S++ S              R+   + ETV       TG +RW V GDDDT+F  +NLV
Sbjct  116   CISEDTSHFRYTYRGGLRSAIRVARAVSETVS---LNHTG-VRWFVFGDDDTVFFPENLV  171

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYS  886
               L++YDH  +YY+G +SE    N+ FSF+ AFGGGG  +S+PLA  +A     CL RY 
Sbjct  172   KTLSKYDHNLWYYIGTNSESSKQNSLFSFEMAFGGGGFAISYPLARVLAKVFDSCLVRYP  231

Query  887   HLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIF  1066
             HL  +D     C+A+LGV L+   GFHQ+D  GD  G L+ HP  PL+SLHH + ++PIF
Sbjct  232   HLYGSDARIFSCLAELGVGLTHEPGFHQVDFRGDAFGLLAAHPLRPLVSLHHLNYIDPIF  291

Query  1067  PSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQN  1246
             P+MN  ++  H + A   D  R+LQQ +C+ R  +W+ SV+WGY+  ++E+ +    +  
Sbjct  292   PNMNSKQALEHLLEAVKFDPARILQQTVCYDRWFSWTISVSWGYAVQLFERDILLPDVLP  351

Query  1247  PIETFQTWGP--SPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSW  1420
                TF  W    +  P  ++FD R+    DPC  P  FFLES   +++  +++   R ++
Sbjct  352   VQHTFTVWNKRETITPSPYMFDTRE-LPEDPCRRPTLFFLES---LSSNGQVI---RSNY  404

Query  1421  RRGLP-ACFAGDGDQSADRISKIVVYSPVTK----PAKIGRSECCDVTIDSVDSESAVIK  1585
             RR +   C    G  ++ ++ KI V+S   K      +  R  CCD+   SV  E   I 
Sbjct  405   RRSISDKCLESKG--ASKKLEKIRVFSKKLKLDIRQLQAPRRHCCDILPSSV-GEVLEIG  461

Query  1586  TRRCMADDIIA*FFRHA  1636
              R C  +++I   F HA
Sbjct  462   IRECGEEEMI---FMHA  475



>ref|XP_002973713.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ25373.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=592

 Score =   273 bits (697),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 231/425 (54%), Gaps = 23/425 (5%)
 Frame = +2

Query  362   LSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS-PPYRVSD  538
             L ++VFG+  S + W  RR YV+ WW+ +   GF+ LDK    +   W  +  PP+R+S 
Sbjct  185   LYNIVFGIAASSRLWDRRREYVKLWWKSSQMRGFVWLDKKVRRK---WSKTDYPPFRISS  241

Query  539   NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLA  718
             + +      N+ N   AR    I   V +  +     + W VMGDDDTIF+ +NLV +L+
Sbjct  242   STAAF----NYTNKMGARAAIRISRIVSETFRIGLPDVHWFVMGDDDTIFIPENLVKLLS  297

Query  719   QYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNS  898
             +YDHTKYYY+G  SE    N +FS+  A+GGGG  +S+PLA A+      CL RY +L  
Sbjct  298   KYDHTKYYYIGSSSESHTQNLHFSYNMAYGGGGFAISYPLARALERMQDGCLHRYPYLFG  357

Query  899   ADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMN  1078
             +D     C+A+LGV L    GFHQ D++GD SG LS HP +PLIS+HH D+++PIFP+M 
Sbjct  358   SDDRIQACMAELGVPLVKEPGFHQFDIYGDASGLLSAHPVSPLISIHHLDVIHPIFPNMT  417

Query  1079  RAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIET  1258
             + ++ +H   +   D P +LQQ +C+ + R WSFSV+WGY+  +Y  I+P   L+ P  T
Sbjct  418   QVQALKHLSRSIKVDAPGILQQSICYDKWRKWSFSVSWGYAVQVYRGILPPRELELPART  477

Query  1259  FQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPA  1438
             F +W        + F  R+  + +PC  P  F++++V    +        R + RRG   
Sbjct  478   FISWYRRTEDSGFPFSTRE-ISRNPCEPPTIFYMDNVGHKNSSRSYSTYARETKRRG--D  534

Query  1439  C---FAGDGDQSADRISKIVVYSPVTKPA--KIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
             C    A  G      I  I+VY   T+       R  CC V I+S D  +  I+  +C  
Sbjct  535   CRWKMASPGG-----IDSIMVYRDRTEGNWHTAPRRHCCRV-INS-DKRNVEIEVGQCRT  587

Query  1604  DDIIA  1618
              + IA
Sbjct  588   GEFIA  592



>ref|XP_010255246.1| PREDICTED: uncharacterized protein LOC104595986 [Nelumbo nucifera]
Length=522

 Score =   271 bits (692),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 151/435 (35%), Positives = 227/435 (52%), Gaps = 20/435 (5%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
              LE    S   T L  +VFG+  S + W  R+ Y++ WWRP+   G + LDKP       
Sbjct  100   RLEENRKSPQATGLHQIVFGIAASARLWEQRKHYIKVWWRPDKMRGIVWLDKPVKTHK--  157

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
                  PP ++SD  S+        +    R+   + ET+R         +RW VMGDDDT
Sbjct  158   -DEGLPPLKISDETSQFPYTNRQGHRSAIRISRIVSETLR----LGMKNVRWFVMGDDDT  212

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F+ +NLV VL++YDH ++YY+G  SE    N YFS+  A+GGGG  +S+PLA A+    
Sbjct  213   VFIPENLVRVLSKYDHNQFYYIGSLSESHLQNIYFSYGMAYGGGGFAISYPLAKALDKMQ  272

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++RY  L  +D     C+A+LGV L+   GFHQ D++G++ G L+ HP  PL+SLHH
Sbjct  273   DRCIQRYPGLYGSDDRMQACMAELGVPLTKELGFHQYDVYGNLFGLLAAHPVTPLVSLHH  332

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D+V PIFP++ R E+ +  M     D   ++QQ +C+ +P++W+ SV+WG++  I   +
Sbjct  333   IDVVEPIFPNVTRVEALQRLMVPKKLDSAGLMQQSICYDKPKSWTVSVSWGFAVQIIRGV  392

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +    ++ P  TF  W        + F+ R   T +PC  P  F+L +     A  + V+
Sbjct  393   LSPREMEMPSRTFLNWYRRADYTAYAFNTRP-VTRNPCQKPFVFYLSTARYDPATKQTVS  451

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDS  1567
              Y R  +   PAC     D +   +  +VVY    +P      K  R  CC + + SV S
Sbjct  452   EYLRH-QVPHPACRWKMPDPAG--VESVVVYK---RPDPHLWDKSPRRNCCRI-LPSVKS  504

Query  1568  ESAVIKTRRCMADDI  1612
             ES VI    C   +I
Sbjct  505   ESMVIDVGVCREGEI  519



>ref|XP_008441391.1| PREDICTED: uncharacterized protein LOC103485521 [Cucumis melo]
Length=496

 Score =   270 bits (690),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 159/431 (37%), Positives = 227/431 (53%), Gaps = 21/431 (5%)
 Frame = +2

Query  338   NDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS  517
              +S SPTN+SH+VFG+  S + W  R  Y   WW  N   GF  LD  PG    P     
Sbjct  82    KNSTSPTNISHIVFGIGASVQTWKDRTLYTHLWWNRNRNRGFAWLDGKPGKTGNP-----  136

Query  518   PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
              PY+VSD              R+AR+V        ++ +     +RW VMGDDDT+F  +
Sbjct  137   VPYKVSDWCFGSGYSCKSSAVRIARIV-------VESYKLGLENVRWFVMGDDDTVFFTE  189

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+YDH + YY+GG+SE +  +   S+  AFGGGG  +S+PLA  +   +  CL 
Sbjct  190   NLVTVLAKYDHNQMYYIGGNSESVEQDQMHSYGMAFGGGGFAISYPLAAELVKVMDGCLH  249

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             RYS    +D+    CIA+LGV L+  +GFHQ D+ GD  G L+ HP APL+SLHH D V 
Sbjct  250   RYSFFYGSDQRVWACIAELGVPLTTERGFHQFDIRGDPYGILAAHPLAPLVSLHHLDHVE  309

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             P+FP+  R +S    M A   D  R+LQQ +C+ R + WS S+AWGY+  IY  ++  + 
Sbjct  310   PLFPNQTRVDSLDLLMQAYRVDSSRILQQTVCYDRRKEWSISIAWGYAVQIYPFMVTATD  369

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKR-TTTDPCLVPHAFFLESVEEVTARDEIVATYRR  1414
             +Q P +TF+TW  S   P   F+   R  ++DPC  P  +FL+ V+EV  R     TY R
Sbjct  370   MQIPFQTFKTWRSSSDGP---FNFNTRPVSSDPCWQPVVYFLKQVQEVDTRG-TKTTYER  425

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDSESAVIK  1585
                + +  C   D  +    + ++ V S         K  + +CC++     D     ++
Sbjct  426   FVVKDVKVCERNDYARVM-AVKQVTVSSMKMDTQLWMKAPQRQCCEIMDKWGDDNHIWVR  484

Query  1586  TRRCMADDIIA  1618
              R+C   + I 
Sbjct  485   LRKCRKSETIT  495



>ref|XP_009111499.1| PREDICTED: uncharacterized protein LOC103836932 [Brassica rapa]
 emb|CDY07231.1| BnaCnng02460D [Brassica napus]
Length=511

 Score =   270 bits (690),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/448 (35%), Positives = 231/448 (52%), Gaps = 31/448 (7%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELL  499
              L S    +  T L H+VFG+  S   W  R  YV++WWRPN  + GF+ LDKP    + 
Sbjct  75    RLGSGQQPDEKTELKHIVFGIAASSSLWKRRSEYVKTWWRPNGEMKGFVWLDKPVNDTVS  134

Query  500   PWPP-SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGT-----LRWV  661
              +P  + P  ++S + S         +    R+   + ETVR       GT     +RWV
Sbjct  135   SFPSWAFPEIKISSDTSSFKYRYRSGHRSAIRITRIVSETVR----MLNGTEHEKHVRWV  190

Query  662   VMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNY--FSFKQAFGGGGIVLSFP  835
             VMGDDDT+F  +NL+ VL +YDH ++YY+G  SE  H  N   FS+  A+GGGG  +S+P
Sbjct  191   VMGDDDTVFFAENLLRVLRKYDHKQFYYIGAPSE-SHLQNLHQFSYGMAYGGGGFAISYP  249

Query  836   LAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHP  1015
             LA A+      C++RYS L  +D     C+A++GV L+   GFHQ D++G++ G LS HP
Sbjct  250   LAKALEKIQDRCIERYSDLYGSDDRIHACMAEIGVPLTREAGFHQFDVYGNLLGLLSVHP  309

Query  1016  NAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWG  1195
               P++S+HH D+V PIFP  NR  + +  M  A  D   ++QQ +C+   R W+ S++WG
Sbjct  310   QVPIVSIHHLDVVEPIFPRTNRVNAVKRLMIPAKLDSASLVQQSICYDTTRQWTMSISWG  369

Query  1196  YSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEE  1375
             Y+ ++    MP   ++ P  TF  W       N  F+ R  T TD C  P  F+L     
Sbjct  370   YTVHVTRTYMPARMMEVPTRTFNDWHKRHDFTNVAFNTRPVTYTD-CQRPRVFYLSRALN  428

Query  1376  VTARDEIVATYRR--SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSE  1534
              ++    ++ Y R   W    P C  G  D S   I++I VY    KP      K  R +
Sbjct  429   DSSSGTTISEYLRHNEWN---PKCEWGIQDPSD--INRIFVYK---KPNPDRWTKAPRRD  480

Query  1535  CCDVTIDSVDSESAVIKTRRCMADDIIA  1618
             CC + + +    + VI    C  D+I+A
Sbjct  481   CCRL-LPTTKKGTMVINVTACENDEIVA  507



>gb|KHN09296.1| Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 
1 [Glycine soja]
Length=484

 Score =   269 bits (687),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/367 (36%), Positives = 198/367 (54%), Gaps = 11/367 (3%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE  493
             S  +L  R D    T L H+VFG+  S   W  R+ Y++ WW+PN T G + LD     +
Sbjct  91    SLDQLSQRQD----TKLKHIVFGIAASSNLWDIRKEYIKVWWKPNQTRGVVWLDSKVRTQ  146

Query  494   LLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGD  673
                     P  R+S + S+      + N +  R    I   V +  +     +RW +MGD
Sbjct  147   A---NEGLPEIRISGDTSKF----KYTNTQGQRSALRISRVVTETLKLGMEDVRWFMMGD  199

Query  674   DDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMA  853
             DDTIF+VDN+V +L++YDHT++YY+G  SE    N +FS+  A+GGGG  +S+PLA  +A
Sbjct  200   DDTIFIVDNVVRILSKYDHTQFYYVGSSSESHVQNIHFSYAMAYGGGGFAISYPLAKELA  259

Query  854   DGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLIS  1033
                  C++RY  L  +D     C+A+LGV L+   GFHQ D++GD+ G L  HP APL++
Sbjct  260   KMQDRCIQRYPALYGSDDRMQACMAELGVPLTKEPGFHQYDVYGDLLGLLGAHPVAPLVT  319

Query  1034  LHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIY  1213
             LHH D+V PIFP MNR +S +  M +   D   ++QQ +C+ + R W+ S++WGY   + 
Sbjct  320   LHHLDVVQPIFPMMNRVQSLQQLMKSVKQDSGSVMQQSICYDKKRYWTISISWGYVVQVL  379

Query  1214  EKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE  1393
               ++    L+ P  TF  W        + F+ R  T  +PC     F++        R +
Sbjct  380   RGVLSPRELEMPTRTFLNWYKRADYTAYSFNTRPVTNKNPCQKAFLFYMNRTRYDPVRKQ  439

Query  1394  IVATYRR  1414
             I+ TY R
Sbjct  440   IIGTYYR  446



>ref|XP_010112315.1| hypothetical protein L484_011181 [Morus notabilis]
 gb|EXC33204.1| hypothetical protein L484_011181 [Morus notabilis]
Length=511

 Score =   270 bits (689),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 153/421 (36%), Positives = 223/421 (53%), Gaps = 22/421 (5%)
 Frame = +2

Query  305   DNESRSELESRND-SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKP  481
             +NE R  +    + S S T L H+VFG+  S   W  RR Y+++WWR   T G + LDK 
Sbjct  82    ENEDRKLVMVHGEQSGSDTKLKHIVFGIAASSNLWDKRREYIKAWWRAGETRGVVWLDKK  141

Query  482   PGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRW  658
                         P  R+S + S+  + TN    R A R+   + ET+R         +RW
Sbjct  142   VRIRR---DEGLPEIRISGDTSKF-KYTNRQGRRSALRISRVVSETLR----LGMKDVRW  193

Query  659   VVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPL  838
              VMGDDDT+F+VDNLV VL++YDH ++YY+G  SE    N YFS+  A+GGGG  +S+PL
Sbjct  194   FVMGDDDTVFVVDNLVRVLSKYDHNQFYYVGSSSESHVQNIYFSYGMAYGGGGFAISYPL  253

Query  839   AMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPN  1018
             A  +      C++RY  L  +D     C+A+LGV L+   GFHQ D++GD+ G L  HP 
Sbjct  254   AKELEKMQDRCIQRYPGLYGSDDRMQACMAELGVPLTKEAGFHQYDVYGDLLGLLGAHPV  313

Query  1019  APLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGY  1198
              PL+SLHH D+V P+FP   R ++ +    +   D   ++QQ +C+ + R+WS SV+WGY
Sbjct  314   TPLLSLHHIDVVEPLFPRTTRVKALQRLFQSVKHDSASIMQQSICYDKRRSWSISVSWGY  373

Query  1199  SANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEV  1378
             +  I   ++    L+ P  TF  W P      + F+ R   T  PC  P  F++ +V   
Sbjct  374   AVQILRGVLSPRELETPTRTFLNWYPRADYTAYAFNTRP-VTKHPCQKPFVFYMNNVRYD  432

Query  1379  TARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCD  1543
              ++ ++V  Y R  R   P C      +S D+I  IVV   + +P      K  R +CC 
Sbjct  433   RSKRQVVGVYARD-RSRHPYCRW--KMESPDKIDSIVV---LKRPDPLRWQKSPRRDCCR  486

Query  1544  V  1546
             V
Sbjct  487   V  487



>ref|XP_010488062.1| PREDICTED: uncharacterized protein LOC104765960 [Camelina sativa]
Length=541

 Score =   270 bits (691),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 152/402 (38%), Positives = 220/402 (55%), Gaps = 18/402 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA---ELLPWPPSSPPY  526
             T L H+VFG+  S   W  R+ Y++SWWRP  T G + +DK       E LP        
Sbjct  124   TTLDHIVFGIAASSVLWETRKEYIKSWWRPGKTRGVVWIDKRVRTYRNEPLP------EI  177

Query  527   RVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             R+S++ SR    T+ V  R A R+   + ET+R   +     +RW VMGDDDT+FLVDN+
Sbjct  178   RISEDTSRF-RYTHPVGDRSAVRLTRVVTETLRLGKE----GVRWFVMGDDDTVFLVDNV  232

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VL++YDHT++YY+G  SE    N +FS+  AFGGGG  +S+ LA+ ++     C++RY
Sbjct  233   VNVLSKYDHTQFYYVGSSSEAHVQNIFFSYSMAFGGGGFAISYALALELSRMQDRCIQRY  292

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+ +LGV L+   GFHQ D++GD+ G L  HP APL+SLHH D+V PI
Sbjct  293   PGLYGSDDRIQACMTELGVPLTKEPGFHQYDVYGDLLGLLGAHPVAPLVSLHHIDVVQPI  352

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP M RA + RH M++A  D   + QQ +C+ + R WS SV+WG+   I   I+    L+
Sbjct  353   FPKMKRAHALRHLMSSAVLDPASIFQQSICYDQNRFWSISVSWGFVVQIIRGIISPRELE  412

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P  TF  W        + F+ R   +  PC  P  F+L S +    R +++  Y     
Sbjct  413   MPSRTFLNWFRKADYIGYAFNTRP-VSRHPCQRPFVFYLNSAKYDEGRRQVIGYYNLDKT  471

Query  1424  RGLPAC-FAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDV  1546
             R +P C +  D     D +  +    P+ +  K  R +CC V
Sbjct  472   RRIPGCRWRLDSPGKIDSVVVLKRPDPL-RWHKSPRRDCCRV  512



>gb|KEH18823.1| transferring glycosyl group transferase [Medicago truncatula]
Length=489

 Score =   269 bits (687),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 149/442 (34%), Positives = 234/442 (53%), Gaps = 25/442 (6%)
 Frame = +2

Query  314   SRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPG--  487
             ++   E      + TN+SH+VFG+  S K W  R+ Y++ WW+PN   G + L++     
Sbjct  63    TQKPFEDEEKKQTKTNISHIVFGIGASAKLWKKRKEYIKLWWKPNQMRGIVWLEQKVKID  122

Query  488   ---AELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRW  658
                 +LLP        ++S++ S+   + +  +    R+   + ETVR   +     +RW
Sbjct  123   SNDEDLLPL------LKISEDTSKFKYKNSKGHRSAIRISRIVSETVRLGME----NVRW  172

Query  659   VVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPL  838
              VMGDDDT F+ +NLV+VL +YDH ++YY+G +SE    N YFS+  A+GGGG  +S+PL
Sbjct  173   FVMGDDDTFFVAENLVNVLKKYDHNQFYYIGSNSESHLQNIYFSYNMAYGGGGFAISYPL  232

Query  839   AMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPN  1018
             A+A+      C++RY  L  +D     C+A+LG+ L+  +GFHQ D++G++ G L+ HP 
Sbjct  233   AVALEKMQDRCIQRYPGLYGSDDRIQACMAELGIPLTKEKGFHQFDVYGNLFGLLAAHPV  292

Query  1019  APLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGY  1198
              PL+SLHH D+V PIFP+++R ++ +   A  N D   ++QQ +C+ + R W+ SV+WGY
Sbjct  293   TPLVSLHHLDVVEPIFPNVSRVQALKRLTAPMNLDPAGLIQQSICYDKTRTWTISVSWGY  352

Query  1199  SANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEV  1378
             +  IY  I     ++ P  TF  W        + F+ R   + + C  P  ++L +    
Sbjct  353   AVQIYRGIFSAREMEMPARTFLNWYKRADYTAYPFNTRP-VSRNVCQKPFVYYLSNAVYD  411

Query  1379  TARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVT  1549
                DE  + Y R   +  P C     D S  +I  IVVY   T P    K  R  CC + 
Sbjct  412   KDTDETASRYVRV--QSNPDCKWKMEDPS--QIKLIVVYKK-TNPNLWDKSPRRNCCRIQ  466

Query  1550  IDSVDSESAVIKTRRCMADDII  1615
              DS    + VI    C  D+ +
Sbjct  467   -DSKRKGTMVIDVGECREDEAV  487



>ref|XP_002314080.2| hypothetical protein POPTR_0009s05640g [Populus trichocarpa]
 gb|EEE88035.2| hypothetical protein POPTR_0009s05640g [Populus trichocarpa]
Length=406

 Score =   266 bits (680),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 157/429 (37%), Positives = 226/429 (53%), Gaps = 80/429 (19%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             S N + +P + S +VFG++ S   W +R++Y ESWWRPN T G++ L + P     PWP 
Sbjct  58    SVNITTTPASFSRIVFGVVSSVNTWKNRKSYAESWWRPNVTRGYIFLGRAPTLRYHPWPS  117

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             SSPP+R++              P  +R+ H          ++    +RW VM DDD +  
Sbjct  118   SSPPFRINA-------------PIKSRIKH----------KQGDKDVRWYVMADDDNVLF  154

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             +DNLV+VLA+YDHT+Y+Y+G +SE + +N  FSF+ AFGG G  LS+PL  A++  +  C
Sbjct  155   IDNLVEVLAKYDHTEYFYIGTNSECVSSNIIFSFEMAFGGAGYALSYPLVEALSTKVGGC  214

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             +++Y +  S+D     C+AD GV+L+  +GF QID+HGDISG LS HP +P++ LH    
Sbjct  215   VQQYPNY-SSDFILQACLADFGVSLTHRRGFLQIDLHGDISGLLSAHPQSPILFLH----  269

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
                                         L + LC H+P       A    A        R
Sbjct  270   ----------------------------LHEPLCVHKP------CATEGKATERHLDHGR  295

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
              +               +PP ++ + R   T DPC  PH FFLESVE+ T  +++V TY 
Sbjct  296   RF--------------SKPPFFMLNTRS-LTNDPCETPHEFFLESVEK-TRGNQVVTTYV  339

Query  1412  RSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTR  1591
             RS  R +P C + D + SAD +SKI V+S  T   + G  ECCDV  ++ D   A IK+R
Sbjct  340   RSSPRNVPPCSSND-NHSADHMSKIEVFSSSTTIKQAGLMECCDVE-ETADMNIAHIKSR  397

Query  1592  RCMADDIIA  1618
              CM + IIA
Sbjct  398   ACMKNAIIA  406



>ref|XP_010651091.1| PREDICTED: uncharacterized protein LOC104879559 [Vitis vinifera]
Length=517

 Score =   269 bits (688),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/421 (36%), Positives = 226/421 (54%), Gaps = 14/421 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S K W  R+ Y++ WWRP  T G + LDKP            P  ++S
Sbjct  104   TELKHIVFGIAASSKLWEQRKQYIKQWWRPRVTRGVVWLDKPVRTRR---NEGLPLIQIS  160

Query  536   DNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
              + SR  + TN    R A R+   + ET+R         +RW VMGDDDT+F+VDN+V +
Sbjct  161   RDTSRF-KYTNRQGDRSALRISRVVSETLR----LGMKDVRWFVMGDDDTVFVVDNVVRI  215

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH ++YY+G  SE    N +FS+  A+GGGG  +S+PLA+ +A     C++RY  L
Sbjct  216   LSKYDHRQFYYIGSSSESHTQNIFFSYAMAYGGGGFAISYPLAIELAKVQDRCIQRYPGL  275

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+A+LGV L+   GFHQ D++GD+ G L+ HP  PL+S+HH D+V+PIFP 
Sbjct  276   YGSDDRMQACMAELGVPLTREAGFHQYDVYGDLLGLLAAHPVTPLVSIHHLDVVDPIFPG  335

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M++ +S +    +   D   ++QQ +C+ + R+WS S++WGY   I   I+    L+ P 
Sbjct  336   MSQVKSLQRLFESIKLDSSSIMQQSICYDKKRSWSISISWGYVVQILRGIVSPRELEMPT  395

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF  W        + F+ R   T  PC  P  F++ +     AR + V  Y R  R   
Sbjct  396   RTFLNWYRKADYTAYAFNTRP-VTKHPCQKPFIFYMSTTRLDRARRQTVGVYSRH-RGRH  453

Query  1433  PAC-FAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADD  1609
             PAC +  D  +  D I+ ++      +  +  R +CC V + S  S S  +    C   +
Sbjct  454   PACRWKMDSPEKIDSIT-VLKRPDDLRWQRSPRRDCCRV-LPSRRSSSMYLWVGNCRESE  511

Query  1610  I  1612
             I
Sbjct  512   I  512



>gb|KCW89425.1| hypothetical protein EUGRSUZ_A01724 [Eucalyptus grandis]
Length=422

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/434 (37%), Positives = 240/434 (55%), Gaps = 34/434 (8%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPW---PPSSP  520
             +PT+  HL+F +  S  ++  RR Y+  W+ PN+T     LD+      LP+    P  P
Sbjct  9     TPTSRRHLLFAVASSSLSFPRRRPYLRLWYSPNSTRALAFLDR------LPYGGPAPDLP  62

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             P  VS++ SR      +  P   R    +   V++   R    +RW V GDDDT+F VDN
Sbjct  63    PTLVSEDTSRF----PYTFPGGLRSAIRVARVVKEVADRGEPGVRWYVFGDDDTVFFVDN  118

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VL++YDHTK+YY+G +SE    N  +SF  AFGGGG  +S  LA+A+A  +  CL R
Sbjct  119   LVSVLSKYDHTKWYYVGSNSESYDQNINYSFDMAFGGGGFAISGSLAVALARVLDSCLVR  178

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             YSHL  +D     C+A+LGV L+   GFHQ+DM G++ G L+ HP +PL+SLHH D V+P
Sbjct  179   YSHLYGSDARIFSCLAELGVGLTHEPGFHQVDMRGNLFGLLTAHPLSPLVSLHHLDAVDP  238

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIMPRS  1234
             IFP+MN+ ++      A N D  R+LQQ +C+ R ++ S SV+WGY+  +YE  +++P  
Sbjct  239   IFPNMNKTQALELLFEAVNVDPARVLQQSVCYDRTKSLSISVSWGYAVQVYEGNELLPD-  297

Query  1235  YLQNPIETFQTW--GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
              L     TF  W    S     ++F+ R+    DPC  P  FFL S+  ++  + + ++Y
Sbjct  298   -LLALQRTFTPWRRSISAGSSRYMFNTRE-FPKDPCKRPVTFFLHSI--LSDENGVRSSY  353

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDSESA  1576
                    +  C  G+  ++   + KI V+S       +  K  R +CCDV    + + S 
Sbjct  354   EGQI---VGHCIRGNALKN---LKKITVFSRKLEHDIEQMKALRRQCCDVL--PIINGSM  405

Query  1577  VIKTRRCMADDIIA  1618
             VI  R+C  +++I+
Sbjct  406   VIHIRQCGDNELIS  419



>ref|XP_010554886.1| PREDICTED: uncharacterized protein LOC104824478 [Tarenaya hassleriana]
Length=459

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 231/424 (54%), Gaps = 36/424 (8%)
 Frame = +2

Query  377   FGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRVV  556
             + LL  ++       Y   WWRPN T GF+ LD+ P   +  WP +SPPYR+S + SR  
Sbjct  49    YVLLSGDRGGCSVDCYSGLWWRPNRTRGFVWLDEKPPRNMT-WPETSPPYRISGDTSRFN  107

Query  557   EETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTK  736
                 + +    RM   + ET     Q     +RW VMGDDDT+F +DNLV VL +YDH +
Sbjct  108   YTCWYGSRSAIRMARIVKETFELGLQ----NVRWFVMGDDDTVFFLDNLVTVLNKYDHNQ  163

Query  737   YYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTG  916
              YY+GG+SE +  +   S+  A+GGGG+ +S+PLA  +   +  C+ RY+    +D+   
Sbjct  164   MYYVGGNSESVEQDIVHSYAMAYGGGGLAISYPLAAELVRILDGCIDRYASFYGSDQKIE  223

Query  917   YCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESAR  1096
              CI+++GV ++   GFHQ+D+ G+  G L+ HP APL+SLHH D V+ IFPS ++ +S +
Sbjct  224   GCISEIGVPITKELGFHQVDIRGNPYGLLAAHPVAPLVSLHHLDYVDAIFPSTSQVDSLK  283

Query  1097  HFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGP  1276
               M++  SD  R+LQ   C+   RNWS SV+WGY+  IY  ++    L+  + TF++W  
Sbjct  284   RLMSSFRSDPNRILQHSFCYDPTRNWSVSVSWGYTVQIYPSLLTAKELETTLLTFKSWRT  343

Query  1277  SPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR--------------  1414
             S   P + FD R   + DPCL P  +FL+ V E  +  + + TYR+              
Sbjct  344   SSSEP-FTFDTRP-VSDDPCLRPVVYFLDRVYEFGS-GQTLTTYRKFVELNEENQCEDSP  400

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESA---VIK  1585
              + R L   F    D +A +++     S V K A   R +CC+V I+  D E+     +K
Sbjct  401   EYSRALAVEFI---DVTASKLN-----SDVWKKAP--RRQCCEV-INGGDEEAGNVLNVK  449

Query  1586  TRRC  1597
              R C
Sbjct  450   IRHC  453



>ref|XP_007009274.1| Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, putative 
isoform 1 [Theobroma cacao]
 gb|EOY18084.1| Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, putative 
isoform 1 [Theobroma cacao]
 gb|EOY18085.1| Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, putative 
isoform 1 [Theobroma cacao]
Length=492

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/439 (36%), Positives = 227/439 (52%), Gaps = 32/439 (7%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA----  490
             ++ S    NSPTN+SHL+FG+ GS K W  RRA+   WW   +T GF  LD+ P      
Sbjct  64    KMGSETPDNSPTNISHLLFGIGGSAKTWKERRAFSSLWWDVESTRGFFWLDEKPDETGTV  123

Query  491   -ELLPWPPSSPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVV  664
              +       S PYR+S    +R    ++    R+AR+V+       D+       +RW V
Sbjct  124   NDFDAEAGVSLPYRISGPEWTRFKYSSSRYAVRIARIVY-------DSFNLKLPNVRWFV  176

Query  665   MGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAM  844
             MGDDDT+F   NLV VLA+YDH + +Y+GG+SE +  N   ++  AFGGGG  +S+PLA 
Sbjct  177   MGDDDTVFFTHNLVSVLARYDHRQMWYIGGNSESVEQNVMHAYDMAFGGGGFAVSYPLAE  236

Query  845   AMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAP  1024
              +   +  CL+RY +   +D+    CI+++GV L+   GFHQ D+ GD  G L+ HP AP
Sbjct  237   KLVKALDGCLERYYYFYGSDQRIWACISEIGVPLTREPGFHQFDIRGDPYGLLAAHPMAP  296

Query  1025  LISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSA  1204
             L+S HH D + P+FP+  R +S +  M     D  R+LQQ  C+   R WS  +AWGY+ 
Sbjct  297   LVSFHHLDGLVPMFPNKTRIDSLKTLMKGYRVDHGRILQQSFCYDSKRKWSIVIAWGYTI  356

Query  1205  NIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVE----  1372
              IY +++  S L  P++TF+TW      P + F+ R     DPC  P  +FL+ VE    
Sbjct  357   QIYPRVVTASDLHMPLQTFKTWRSWSNGP-FTFNTRP-MPADPCEWPIIYFLDQVEVGMS  414

Query  1373  EVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCD  1543
                 R +I  + +   R       A         ++ I V S    P    K    +CC+
Sbjct  415   GTRTRYKIAKSGKTCNRTDYGLAMA---------VNSITVSSMKMAPDYWQKAPHRQCCE  465

Query  1544  VT-IDSVDSESAVIKTRRC  1597
             +    S+ S S  I+ R C
Sbjct  466   IMDRGSIKSGSMRIRIRNC  484



>ref|XP_010475561.1| PREDICTED: uncharacterized protein LOC104754961 [Camelina sativa]
Length=542

 Score =   270 bits (689),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/403 (38%), Positives = 221/403 (55%), Gaps = 20/403 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA---ELLPWPPSSPPY  526
             T L H+VFG+  S   W  R+ Y++SWWRP  T G + +DK       E LP        
Sbjct  125   TTLDHIVFGIAASSVLWETRKEYIKSWWRPGKTRGVVWIDKRVRTYRNEPLP------EI  178

Query  527   RVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             R+S++ SR    T+ V  R A R+   + ET+R   +     +RW VMGDDDT+FLVDN+
Sbjct  179   RISEDTSRF-RYTHPVGDRSAVRLTRVVTETLRLGKE----GVRWFVMGDDDTVFLVDNV  233

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VL++YDHT++YY+G  SE    N +FS+  AFGGGG  +S+ LA+ ++     C++RY
Sbjct  234   VNVLSKYDHTQFYYVGSSSEAHVQNIFFSYSMAFGGGGFAISYALALELSRMQDRCIQRY  293

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+ +LGV L+   GFHQ D++GD+ G L  HP APL+SLHH D+V PI
Sbjct  294   PGLYGSDDRIQACMTELGVPLTKEPGFHQYDVYGDLLGLLGAHPVAPLVSLHHIDVVQPI  353

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP M RA + RH M++A  D   + QQ +C+ + R WS SV+WG+   I   I+    L+
Sbjct  354   FPKMKRAHALRHLMSSAVLDPASIFQQSICYDQNRFWSISVSWGFVVQIIRGIISPRELE  413

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P  TF  W        + F+ R   +  PC  P  F+L S +    R +++  Y     
Sbjct  414   MPSRTFLNWFRKADYIGYAFNTRP-VSRHPCQRPFVFYLNSAKYDEGRRQVIGYYNLDKT  472

Query  1424  RGLPAC-FAGDGDQSADRISKIVVYSPVT-KPAKIGRSECCDV  1546
             R +P C +  D     D  S +V+  P   +  K  R +CC V
Sbjct  473   RRIPGCRWRLDSPGKID--SVVVLKRPDNLRWHKSPRRDCCRV  513



>gb|KDP44147.1| hypothetical protein JCGZ_05614 [Jatropha curcas]
Length=442

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/399 (36%), Positives = 212/399 (53%), Gaps = 13/399 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S   W  R+ YV+ WWRP  T G + +DK   +         P  RVS
Sbjct  31    TELKHIVFGIAASANLWEKRKEYVKIWWRPKETRGIVWIDKKVRSRR---NEGLPEIRVS  87

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + S+        +    R+   + ET+R   +     +RW VMGDDDT+F+VDN+V +L
Sbjct  88    ADTSKFKYSNRQGDRSAIRISRVVSETLRLGLK----DVRWFVMGDDDTVFVVDNVVRIL  143

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             +++DH ++YY+G  SE    N YFS+  A+GGGG  +SFPLA  +A     C++RY  L 
Sbjct  144   SKFDHRQFYYIGSSSESHLQNIYFSYAMAYGGGGFAISFPLAQELAKMQDTCIQRYPGLY  203

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A++GV L+   GFHQ D++GD+ G L  HP  P+ SLHH D+V P+FP M
Sbjct  204   GSDDRIQACMAEIGVPLTREAGFHQYDVYGDLLGLLGAHPVTPMASLHHLDVVEPVFPGM  263

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              RA++ +H   +   D   ++QQ +C+   R WS SV+WG+   I+  ++    L+ P  
Sbjct  264   TRAKAIQHLFESVKLDSASIMQQSICYDTKRYWSISVSWGFVVQIWRGVVSPRELEMPTR  323

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R   T  PCL P  F++ + +   AR + V  Y R   R  P
Sbjct  324   TFLNWYRKADYTAYAFNTRP-VTKHPCLKPFVFYMTTSKYDRARKQTVGVYSR--HRARP  380

Query  1436  ACFAGDGDQSADRISKIVVYS--PVTKPAKIGRSECCDV  1546
               F      S ++I+ IVV     + +  +  R +CC V
Sbjct  381   P-FCRWRMASPEKINSIVVLKRPDINRWQQSPRRDCCRV  418



>ref|XP_010032375.1| PREDICTED: uncharacterized protein LOC104421911 isoform X1 [Eucalyptus 
grandis]
Length=522

 Score =   269 bits (687),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 169/462 (37%), Positives = 245/462 (53%), Gaps = 49/462 (11%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSP  520
             +   PTN+SH++FG+ GS +AW  R  Y   WW PN+T GF+ LDK P  E    P  S 
Sbjct  79    NGTGPTNISHILFGIGGSLRAWRDRSRYSSLWWDPNSTRGFVWLDKEP-EENFSRPGGSI  137

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVR-DAPQRATGTLRWVVMGDDDTIFLVD  697
             PYRVS++ +R    ++   PR+AR+V   +E+ R + P      +RW VMGDDDT+F   
Sbjct  138   PYRVSEDATRFKSSSSKSAPRIARIV---LESFRLELPD-----VRWFVMGDDDTVFFPQ  189

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VLA+YDH + +Y+GG+SE +  +    +  AFGGGG  +S+PLA  + D +  CL 
Sbjct  190   NLVTVLAKYDHRQMWYIGGNSESVEQDLMHGYGVAFGGGGFAISYPLAAELVDMLDGCLD  249

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQ---------------------IDMHGDIS  994
             RYSH   +D+    C+ ++GV L+  +GFHQ                     ID+ GD  
Sbjct  250   RYSHFYGSDERVCACVQEVGVPLTIERGFHQRNCLDSARYLRQYVSHLVPQKIDIRGDAY  309

Query  995   GFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNW  1174
             G L+ HP APL+SLHH D V+PI P   + ++ +  M     D  R+LQQ  C+   R W
Sbjct  310   GILAAHPVAPLVSLHHVDDVDPILPHQTQIDALKALMEPYRIDPARILQQSFCYDPKRKW  369

Query  1175  SFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAF  1354
             S S++WGY+  IY  ++    L+ P + F+TW      P + F+ R   + DPC  P  +
Sbjct  370   SVSISWGYTIQIYPSLVTADVLEMPFQMFKTWRSWADGP-FAFNTRS-VSPDPCSQPVIY  427

Query  1355  FLESVEEVTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIG---  1525
             F++ V EV  R   + TY RS  +G      G G + AD    + V S      K+G   
Sbjct  428   FVDRVWEV-GRTGSLTTYERSDLKG------GRGCKRADYARVLAVQSIAVSSMKMGPDY  480

Query  1526  -----RSECCDVT-IDSVDSESAVIKTRRCMADDIIA*FFRH  1633
                    +CC++    S+ S S  I+ R+C A ++ A  F H
Sbjct  481   WNKAPHRQCCEIMDRGSIKSRSMRIRVRKCRAHEMKASPFHH  522



>ref|XP_010457994.1| PREDICTED: uncharacterized protein LOC104739370 [Camelina sativa]
Length=542

 Score =   269 bits (688),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 206/366 (56%), Gaps = 16/366 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA---ELLPWPPSSPPY  526
             T L H+VFG+  S   W  R+ Y++SWWRP  T G + +DK       E LP        
Sbjct  125   TTLDHIVFGIAASSVLWETRKEYIKSWWRPGKTRGVVWIDKRVRTYRNEPLP------EI  178

Query  527   RVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
             R+S++ SR    T+ V  R A R+   + ET+R   +     +RW VMGDDDT+FLVDN+
Sbjct  179   RISEDTSRF-RYTHPVGDRSAVRLTRVVTETLRLGKE----GVRWFVMGDDDTVFLVDNV  233

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V+VL++YDHT++YY+G  SE    N +FS+  AFGGGG  +S+ LA+ ++     C++RY
Sbjct  234   VNVLSKYDHTQFYYVGSSSEAHVQNIFFSYSMAFGGGGFAISYALALELSRMQDRCIQRY  293

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+ +LGV L+   GFHQ D++GD+ G L  HP APL+SLHH D+V PI
Sbjct  294   PGLYGSDDRIQACMTELGVPLTKEPGFHQYDVYGDLLGLLGAHPVAPLVSLHHIDVVQPI  353

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP M RA + RH M++A  D   + QQ +C+ + R WS SV+WG+   I   I+    L+
Sbjct  354   FPKMKRAHALRHLMSSAVLDPASIFQQSICYDQNRFWSISVSWGFVVQIIRGIISPRELE  413

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P  TF  W        + F+ R   +  PC  P  F+L S +    R +++  Y     
Sbjct  414   MPSRTFLNWFRKADYIGYAFNTRP-VSRHPCQRPFVFYLNSAKYDEGRRQVIGYYNLDKT  472

Query  1424  RGLPAC  1441
             R +P C
Sbjct  473   RRIPGC  478



>ref|XP_002882730.1| hypothetical protein ARALYDRAFT_478479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58989.1| hypothetical protein ARALYDRAFT_478479 [Arabidopsis lyrata subsp. 
lyrata]
Length=505

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/435 (36%), Positives = 240/435 (55%), Gaps = 27/435 (6%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS---  514
             S  P N+SH++F + G+ + W  R  Y+  WWR N+T GF+ LD+P     +P   S   
Sbjct  87    SVGPINISHILFSIAGAAETWIDRSQYISLWWR-NSTRGFVWLDEPVK---IPENHSDVR  142

Query  515   -SPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              S P RVSD   +R    ++    R+AR++        D+ +     +RW VMGDDDT+F
Sbjct  143   FSIPTRVSDPGWTRFKFSSSRAAVRIARIIW-------DSYRLNLPNIRWFVMGDDDTVF  195

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               +NLV VL++YDH + +Y+GG+SE +  +   ++  AFGGGG  +S PLA  +A  + D
Sbjct  196   FTENLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRPLAARLAGAMDD  255

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             CL+RY +   +D+    C++++GV  +  +GFHQ+D+ GD  GFL+ HP APL+SLHH  
Sbjct  256   CLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIRGDPYGFLAAHPLAPLVSLHHLV  315

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
              ++P+FP+ N  ES +  M   N D  R+LQQ+ C  R R WS S++WGYS  IY   + 
Sbjct  316   YLDPMFPNKNPIESLQTLMKPYNLDPNRILQQINCHDRKRQWSISISWGYSIQIYTYFLT  375

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
              + L  P++TF+TW  S   P ++F+ R     DPC  P  +F++  E+V  R     T+
Sbjct  376   ATELTTPLQTFKTWRSSSDGP-FVFNTRP-LKPDPCERPVTYFMDGAEDV--RGSGTKTW  431

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVTIDSVDS---E  1570
                  +    C   +  Q   ++ +I+V S  T P    K  R +CC+V          +
Sbjct  432   YSIADKNYGHCEKSEHIQ-LTKVKRILVTSMKTDPEYWNKAPRRQCCEVMEGGGRKRMEK  490

Query  1571  SAVIKTRRCMADDII  1615
               +I+ R+C + + I
Sbjct  491   EMLIRIRKCRSLEKI  505



>emb|CDY67284.1| BnaAnng23960D [Brassica napus]
Length=509

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 161/435 (37%), Positives = 236/435 (54%), Gaps = 28/435 (6%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS---  514
             S  P N+SH+ F + G+ + W  R  Y   WWR N T GF+ LDKP     LP   S   
Sbjct  92    SLGPINISHVQFCIAGAAETWLDRSRYTSLWWR-NTTRGFVWLDKPVK---LPKNNSDNR  147

Query  515   -SPPYRVSDNV-SRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              S P RVSD+  +R    ++    R+AR       T+ D+ Q     +RW VMGDDDTIF
Sbjct  148   FSIPVRVSDSGWTRFRFSSSRAAVRIAR-------TIWDSYQLNLPDVRWFVMGDDDTIF  200

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               DNLV VLA+YDH + +Y+GG+SE +  +   ++  AFGGGG  +S PLA  +A+ +  
Sbjct  201   FTDNLVKVLAKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRPLAARLANAMDG  260

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             CL+RY +   +D+    C++++GV  +  +GFHQ+D+ GD  GFL+ HP  PL+SLHH  
Sbjct  261   CLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIRGDPFGFLAAHPLTPLVSLHHLV  320

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
              ++ IFP+ N  ES +      N D  R+LQQ+ C  R R WS S++WGYS  IY   + 
Sbjct  321   FLDSIFPNKNPIESLQTLTKPYNLDPHRILQQVNCHDRKRQWSISISWGYSIQIYSYFLS  380

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
                L+ P++TF+TW  S R   + F+ R     DPC  P  +F++  E+V  RD    T+
Sbjct  381   AKELEKPLQTFKTWR-SLRNGPFTFNTRP-LKPDPCQRPVTYFMDGAEDV--RDSGTKTW  436

Query  1409  RRSWRRGLPACFAGDGDQS-ADRISKIVVYSPVTKPA---KIGRSECCDVTIDS--VDSE  1570
                  +    C  G  + S   R+ +I+V S    P    K  R +CC+V         +
Sbjct  437   YSVGDKNYGYC--GKREHSRVTRVKRILVTSMKMAPEYWNKAPRRQCCEVMDGGGRRKEK  494

Query  1571  SAVIKTRRCMADDII  1615
             + +I+ R+C + + I
Sbjct  495   AMLIRIRKCRSSETI  509



>ref|XP_010240967.1| PREDICTED: uncharacterized protein LOC104585698 isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   267 bits (682),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 153/425 (36%), Positives = 232/425 (55%), Gaps = 25/425 (6%)
 Frame = +2

Query  368   HLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KPPGAELLPWPPSSPPYRVSDNV  544
             HL F +  S K+W +RR YV  WW+P    G++ LD KPP +       S PP  +S++ 
Sbjct  75    HLAFAIASSSKSWPNRRHYVRLWWKPQLMRGYVFLDRKPPDSATTNTTESLPPVLISEDT  134

Query  545   SR---VVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             SR     +       RV+R+V  I+        R    +RW V GDDDT+F  +NL   L
Sbjct  135   SRFPYTYKGGLRSAIRVSRIVSEIVA-------RNLSDVRWFVFGDDDTVFFPENLAKTL  187

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH ++YY+G  SE    N+ FSF+ AFGGGG  +S+PLA  +A  +  CL RYSHL 
Sbjct  188   SKYDHNRWYYVGSSSESFEQNSRFSFEMAFGGGGFAISYPLARVLARVMDSCLMRYSHLY  247

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ+D+ G++ G LS HP AP+ISLHH D V+PIFP+ 
Sbjct  248   GSDSRIFSCLAELGVGLTHESGFHQVDIRGNLFGLLSAHPLAPIISLHHLDSVDPIFPNR  307

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             ++ ++  H     N D  R+LQQ +C+ +  + + SV+WGY+  ++E I     L     
Sbjct  308   SQIQALEHLFNVVNVDPARILQQTVCYDQSNSQTVSVSWGYAVQVFEGIQLLPDLILMQR  367

Query  1256  TFQTWGPS--PRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             TF  W  S      +++F++R     DPC  P  FFL +V  +T  +   + Y +   R 
Sbjct  368   TFMPWRRSLNVNLSHFMFNMRV-FPKDPCKRPSIFFLGNV--LTNTNVTQSNYSKDTIR-  423

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP--AKIGRSECCDVTIDSVDSESAVIKTRRCMA  1603
               +C      Q+ ++I    V+SP  +    +  R  CCD+ + S   +   I+ R+C+ 
Sbjct  424   --SCLKKSASQNLEQIK---VFSPKLELDYGQAPRRHCCDI-LPSSSEKVMKIRIRQCLD  477

Query  1604  DDIIA  1618
             ++II+
Sbjct  478   EEIIS  482



>ref|XP_004493031.1| PREDICTED: uncharacterized protein LOC101513883 [Cicer arietinum]
Length=487

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/429 (34%), Positives = 223/429 (52%), Gaps = 25/429 (6%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS----PP  523
             TN+SH+VFG+  S K W HR+ Y++ WWR N T G + LDK    E     PS     P 
Sbjct  73    TNISHIVFGIGASSKLWKHRKEYIKLWWRNNETRGIVWLDKEVKIE-----PSEENLVPT  127

Query  524   YRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNL  703
              ++S + S+   E  H +    R+   + ETVR   +     +RW+VMGDDDT F++DNL
Sbjct  128   LKISSDTSKFKYENTHGDRSGIRISRIVSETVRLGME----NVRWIVMGDDDTFFVIDNL  183

Query  704   VDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             V VL +YDH ++YY+G  SE  + N YFS+  A+GGGG  +S+PLA+ +      C++RY
Sbjct  184   VKVLQKYDHNQFYYIGAVSESHYQNIYFSYNMAYGGGGFAISYPLAVELEKMQDRCIQRY  243

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
               L  +D     C+A+LGV L+  +GFHQ D++G + G L+ H   PL+SLHH D++ PI
Sbjct  244   PKLYGSDDRVQACMAELGVPLTLEKGFHQFDVYGSVFGLLAAHRVTPLVSLHHLDLIEPI  303

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP+M++ ++ + F      D   ++QQ +C+     W+ SV+WGY+  I+  I     ++
Sbjct  304   FPNMSQVQALQKFKDPIKMDSYGLMQQSICYDENHQWTVSVSWGYAVQIFRGIFSARDME  363

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P  TF  W        + F+ R  +  D C  P  F L +       +E V  Y +   
Sbjct  364   RPARTFLNWYREANYKGYPFNTRSFSRND-CQKPFIFHLSNATYDVMTNETVTRYIKIQP  422

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSESAVIKT  1588
             +  P C     D +  +I  + VY    KP      K  R  CC V     D  + VI  
Sbjct  423   KPNPKCKWKMEDPA--QIQMVEVYK---KPDPYLWDKSPRRNCCRVQSKKEDG-TLVIDV  476

Query  1589  RRCMADDII  1615
              +C   +++
Sbjct  477   GKCREHEVV  485



>ref|XP_009380306.1| PREDICTED: uncharacterized protein LOC103968722 [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   270 bits (689),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/430 (37%), Positives = 221/430 (51%), Gaps = 22/430 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S K W  R+AY++ WWRP    GF+ LDKP   EL    P  P  ++S
Sbjct  156   TGLQHIVFGIAASAKLWEKRKAYIKVWWRPRRMRGFVWLDKPV-KELKATDPGLPLLKIS  214

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + SR        +    R+   + ET R         +RW VMGDDDT+F  DNL  +L
Sbjct  215   GDTSRFPYTHRKGDRSAIRISRIVSETFR----LRLPNVRWFVMGDDDTVFFPDNLACIL  270

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             +++DH + YY+G HSE    N YFS+  A+GGGG  +S PLA A+A     CL RY  L 
Sbjct  271   SRFDHRQPYYIGSHSESHLQNIYFSYNMAYGGGGFAISAPLAAALARVQDKCLYRYPALY  330

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+ H GFHQ D++GD+ G L+ HP APLISLHH D+V P+FP  
Sbjct  331   GSDDRIQACMAELGVPLTRHPGFHQYDVYGDLLGLLAAHPVAPLISLHHLDVVQPLFPGA  390

Query  1076  NRAESA--RHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
                 +A  R F      D   ++QQ +C+ R + W+ SVAWG++  +   +M    ++ P
Sbjct  391   GSRAAAIRRLFDGPVRLDSGGVMQQSICYERRQLWTVSVAWGFAVTVVRGVMSPREMEMP  450

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
               TF  W P      + F+ R     +PC  P  ++L S     AR   V  Y+R  R  
Sbjct  451   ARTFLNWYPRADYTAYAFNTRP-VARNPCQKPFVYYLASARYDNARQTTVTEYKRH-RET  508

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSE----SAVI  1582
              P C     D SA  + +IVV+    KP      +  R  CC V     D++    S VI
Sbjct  509   HPLCKWRMADPSA-LVDRIVVHK---KPDPGLWDRAPRRNCCRVLSSPKDAKKRDRSMVI  564

Query  1583  KTRRCMADDI  1612
                 C  D+I
Sbjct  565   DVGTCQEDEI  574



>ref|XP_009776276.1| PREDICTED: uncharacterized protein LOC104226084 [Nicotiana sylvestris]
Length=498

 Score =   267 bits (682),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 197/350 (56%), Gaps = 12/350 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE-----LLPWPPSSP  520
             T L H+VFG+  S   W++R+ YV+ WW+PN   GF+ LDKP  ++      +    S P
Sbjct  83    TQLHHIVFGIGSSRTTWNYRKEYVKLWWKPNKMRGFVWLDKPAMSKNNQSTSIYNVTSLP  142

Query  521   PYRVSDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVD  697
               ++S N SR  + TN    R   R+   I ETVR         +RW VMGDDDT F+ +
Sbjct  143   EIKISSNTSRF-KYTNQKGDRSGIRISRIISETVR----MDLKNVRWFVMGDDDTFFVPE  197

Query  698   NLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLK  877
             NLV VL +YDH +YYY+G  SE    N+ FS+  A+GGGG  +S+PLA A+      C++
Sbjct  198   NLVRVLRKYDHNQYYYIGSVSETHWQNHEFSYNMAYGGGGFAISYPLAKALEKIQDKCIE  257

Query  878   RYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVN  1057
             +Y HL  +D     C+A+LGV L+   GFHQ D+HG + GFLS HP APL+SLHH D V 
Sbjct  258   KYPHLYGSDDRIQACLAELGVPLTKEVGFHQFDLHGSVMGFLSAHPVAPLVSLHHLDKVQ  317

Query  1058  PIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSY  1237
             PIFP ++R E+ R        D   ++QQ +C+ R R W+ SV+WGYS  I   I+P   
Sbjct  318   PIFPKLSRVEALRRLNKPIKLDSAGLMQQSICYDRSRGWTVSVSWGYSVQINRGILPARE  377

Query  1238  LQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTAR  1387
             ++ PI TF  W  +    ++ F+ R     + C  P  + L +    T R
Sbjct  378   MEKPITTFNDWYATGDENSFTFNTRP-YHKNACQRPFFYLLSNAYVTTNR  426



>ref|XP_010240965.1| PREDICTED: uncharacterized protein LOC104585698 isoform X1 [Nelumbo 
nucifera]
Length=486

 Score =   266 bits (681),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 153/427 (36%), Positives = 232/427 (54%), Gaps = 27/427 (6%)
 Frame = +2

Query  368   HLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLD-KPPGAELLPWPPSSPPYRVSDNV  544
             HL F +  S K+W +RR YV  WW+P    G++ LD KPP +       S PP  +S++ 
Sbjct  75    HLAFAIASSSKSWPNRRHYVRLWWKPQLMRGYVFLDRKPPDSATTNTTESLPPVLISEDT  134

Query  545   SR---VVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             SR     +       RV+R+V  I+        R    +RW V GDDDT+F  +NL   L
Sbjct  135   SRFPYTYKGGLRSAIRVSRIVSEIVA-------RNLSDVRWFVFGDDDTVFFPENLAKTL  187

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH ++YY+G  SE    N+ FSF+ AFGGGG  +S+PLA  +A  +  CL RYSHL 
Sbjct  188   SKYDHNRWYYVGSSSESFEQNSRFSFEMAFGGGGFAISYPLARVLARVMDSCLMRYSHLY  247

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ+D+ G++ G LS HP AP+ISLHH D V+PIFP+ 
Sbjct  248   GSDSRIFSCLAELGVGLTHESGFHQVDIRGNLFGLLSAHPLAPIISLHHLDSVDPIFPNR  307

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             ++ ++  H     N D  R+LQQ +C+ +  + + SV+WGY+  ++E I     L     
Sbjct  308   SQIQALEHLFNVVNVDPARILQQTVCYDQSNSQTVSVSWGYAVQVFEGIQLLPDLILMQR  367

Query  1256  TFQTWGPS--PRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
             TF  W  S      +++F++R     DPC  P  FFL +V  +T  +   + Y +   R 
Sbjct  368   TFMPWRRSLNVNLSHFMFNMRV-FPKDPCKRPSIFFLGNV--LTNTNVTQSNYSKDTIR-  423

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTK----PAKIGRSECCDVTIDSVDSESAVIKTRRC  1597
               +C      Q+ ++I    V+SP  +      +  R  CCD+ + S   +   I+ R+C
Sbjct  424   --SCLKKSASQNLEQIK---VFSPKLELDYGQLQAPRRHCCDI-LPSSSEKVMKIRIRQC  477

Query  1598  MADDIIA  1618
             + ++II+
Sbjct  478   LDEEIIS  484



>ref|XP_010051124.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051130.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051137.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
 ref|XP_010051142.1| PREDICTED: uncharacterized protein LOC104439805 [Eucalyptus grandis]
Length=473

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 159/434 (37%), Positives = 240/434 (55%), Gaps = 34/434 (8%)
 Frame = +2

Query  350   SPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPW---PPSSP  520
             +PT+  HL+F +  S  ++  RR Y+  W+ PN+T     LD+      LP+    P  P
Sbjct  60    TPTSRRHLLFAVASSSLSFPRRRPYLRLWYSPNSTRALAFLDR------LPYGGPAPDLP  113

Query  521   PYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDN  700
             P  VS++ SR      +  P   R    +   V++   R    +RW V GDDDT+F VDN
Sbjct  114   PTLVSEDTSRF----PYTFPGGLRSAIRVARVVKEVADRGEPGVRWYVFGDDDTVFFVDN  169

Query  701   LVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKR  880
             LV VL++YDHTK+YY+G +SE    N  +SF  AFGGGG  +S  LA+A+A  +  CL R
Sbjct  170   LVSVLSKYDHTKWYYVGSNSESYDQNINYSFDMAFGGGGFAISGSLAVALARVLDSCLVR  229

Query  881   YSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNP  1060
             YSHL  +D     C+A+LGV L+   GFHQ+DM G++ G L+ HP +PL+SLHH D V+P
Sbjct  230   YSHLYGSDARIFSCLAELGVGLTHEPGFHQVDMRGNLFGLLTAHPLSPLVSLHHLDAVDP  289

Query  1061  IFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIMPRS  1234
             IFP+MN+ ++      A N D  R+LQQ +C+ R ++ S SV+WGY+  +YE  +++P  
Sbjct  290   IFPNMNKTQALELLFEAVNVDPARVLQQSVCYDRTKSLSISVSWGYAVQVYEGNELLPD-  348

Query  1235  YLQNPIETFQTW--GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
              L     TF  W    S     ++F+ R+    DPC  P  FFL S+  ++  + + ++Y
Sbjct  349   -LLALQRTFTPWRRSISAGSSRYMFNTRE-FPKDPCKRPVTFFLHSI--LSDENGVRSSY  404

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDSESA  1576
                    +  C  G+  ++   + KI V+S       +  K  R +CCDV    + + S 
Sbjct  405   EGQI---VGHCIRGNALKN---LKKITVFSRKLEHDIEQMKALRRQCCDVL--PIINGSM  456

Query  1577  VIKTRRCMADDIIA  1618
             VI  R+C  +++I+
Sbjct  457   VIHIRQCGDNELIS  470



>ref|XP_009121140.1| PREDICTED: uncharacterized protein LOC103845975 [Brassica rapa]
Length=509

 Score =   267 bits (683),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 161/435 (37%), Positives = 233/435 (54%), Gaps = 28/435 (6%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS---  514
             S  P N+SH+ F + G+ + W  R  Y   WWR N T GF+ LDKP     LP   S   
Sbjct  92    SLGPINISHVQFCIAGAAETWLDRSRYTSLWWR-NTTRGFVWLDKPVK---LPKNNSDNR  147

Query  515   -SPPYRVSDNV-SRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              S P RVSD+  +R    ++    R+AR       T+ D+ Q     +RW VMGDDDTIF
Sbjct  148   FSIPVRVSDSGWTRFRFSSSRAAVRIAR-------TIWDSYQLKLPDVRWFVMGDDDTIF  200

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               DNLV VL++YDH + +Y+GG+SE +  +   ++  AFGGGG  +S PLA  +A  +  
Sbjct  201   FTDNLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRPLAARLAGAMDG  260

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             CL+RY +   +D+    C++++GV  +  +GFHQ+D+ GD  GFL+ HP  PL+SLHH  
Sbjct  261   CLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIRGDPFGFLAAHPLTPLVSLHHLG  320

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
              ++ IFP+ N  ES R      N D  R+LQQ+ C  R R WS S++WGYS  IY   + 
Sbjct  321   FLDSIFPNKNPIESLRTLTKPYNLDPHRILQQVNCHDRKRQWSISISWGYSIQIYSYFLS  380

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
                L+ P++TF+TW  S R   + F+ R     DPC  P  +F++  E+V  RD    T+
Sbjct  381   AKELEKPLQTFKTW-RSLRNGPFTFNTRP-LKPDPCQRPVTYFMDGAEDV--RDSGTKTW  436

Query  1409  RRSWRRGLPACFAGDGDQS-ADRISKIVVYSPVTKPA---KIGRSECCDVTIDS--VDSE  1570
                  +    C  G  + S   R+ +I+V S    P    K  R +CC+V         +
Sbjct  437   YSVGDKNYGYC--GKREHSRVTRVKRILVTSMKMAPEYWNKAPRRQCCEVMDGGGRRKEK  494

Query  1571  SAVIKTRRCMADDII  1615
                I+ R+C + + I
Sbjct  495   EMSIRIRKCRSSETI  509



>ref|XP_007163444.1| hypothetical protein PHAVU_001G235100g [Phaseolus vulgaris]
 gb|ESW35438.1| hypothetical protein PHAVU_001G235100g [Phaseolus vulgaris]
Length=490

 Score =   266 bits (681),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/429 (35%), Positives = 230/429 (54%), Gaps = 22/429 (5%)
 Frame = +2

Query  347   NSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPY  526
             + PTN+SH++FG+ GS   WH R  Y + WW+PN T GF+ LDK P  E+L       PY
Sbjct  78    SGPTNISHILFGIAGSSNTWHDRSNYSKLWWKPNTTRGFVWLDKKP--EILH-DDMLLPY  134

Query  527   RVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLV  706
             ++S    R     +    R+AR+V+       ++ +     +RW VMGDDDT+F  +NLV
Sbjct  135   QISQGWRRFQYVHSASAVRIARIVY-------ESFKLGLPNVRWFVMGDDDTVFFTENLV  187

Query  707   DVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD-CLKRY  883
              VL +YDH + YY+GG SE +  +   S+  AFGGGG  +S+ LA A  D +MD CL RY
Sbjct  188   TVLGKYDHNQMYYIGGSSESVEQDVMHSYNMAFGGGGFAISYALA-AQLDKMMDGCLSRY  246

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
              +   +D+    C+ ++GV L+   GFHQ+D+ GD  G L+ HP  PL+SLHH   +N +
Sbjct  247   YYFYGSDQRVWACVNEIGVPLTREVGFHQLDIRGDPYGLLAAHPLVPLLSLHHLGQLNSL  306

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP+  +  S    ++A ++D  R++QQ  C+     WS S++WGY+  IY  ++  + LQ
Sbjct  307   FPNQTQFHSMEKLISAYDADPARIVQQSFCYDHKHRWSISISWGYTIQIYPLLLVAADLQ  366

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWR  1423
              P++TF+TW      P + F+ R   ++DPC  P  FFL+ V +V     +    R    
Sbjct  367   MPLQTFKTWRSWKDGP-FTFNTRP-MSSDPCQKPAVFFLDEVTKVGKSGSVTIYKRHEGN  424

Query  1424  RGLPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDVTI-DSVDSESAVIKTR  1591
              G   C   D +     + +I V +    P     + R  CC +    S+ + S  I+ R
Sbjct  425   EG--KCTRKDINNV--EVERIRVSALKLDPEYWKNVLRRHCCQLLWGGSIKNGSMHIRIR  480

Query  1592  RCMADDIIA  1618
             +C   + + 
Sbjct  481   KCRPQETVT  489



>ref|XP_007016624.1| Uncharacterized protein TCM_041982 [Theobroma cacao]
 gb|EOY34243.1| Uncharacterized protein TCM_041982 [Theobroma cacao]
Length=511

 Score =   267 bits (683),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 214/428 (50%), Gaps = 30/428 (7%)
 Frame = +2

Query  359   NLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVSD  538
              L H+ FG+  S   W  R+ Y++ WWRP  T G + +DK             P  RVS 
Sbjct  94    ELKHIAFGIAASSNLWDIRKEYIKVWWRPTETRGVVWMDKQVRTRR---NEGLPEIRVSQ  150

Query  539   NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVLA  718
             + S+      + N + +R    I   V +  +     +RW VMGDDDT+F+VDN+V VL+
Sbjct  151   DTSKF----KYTNKQGSRSALRISRVVSETLKLGMKDIRWFVMGDDDTVFIVDNVVRVLS  206

Query  719   QYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLNS  898
             +YDHT++YY+G  SE    N +FS+  AFGGGG  +S+PLA  +A     C++RY  L  
Sbjct  207   KYDHTQFYYVGSASESHIQNIFFSYAMAFGGGGFAISYPLAKELAKMQDRCIQRYPALYG  266

Query  899   ADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMN  1078
             +D     C+A+LGV L+   GFHQ D++G++ G L  HP  PL+SLHH D+V PIFP M 
Sbjct  267   SDDRIQACMAELGVPLTRELGFHQYDVYGELLGLLGAHPVTPLVSLHHLDVVEPIFPGMK  326

Query  1079  RAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIET  1258
             RA +  H + AA  D   ++QQ +C+   R WS SV+WGY   I   +M    L+ P  T
Sbjct  327   RARALAHLLEAAKEDSASLVQQSICYDSKRFWSISVSWGYVVQISRGVMSPRELEMPTRT  386

Query  1259  FQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRR--------  1414
             F  W        + F+ R      PC  P  F++  ++   AR + +  Y R        
Sbjct  387   FLNWYRRADYTAYAFNTRP-VERHPCQKPFVFYMSKIKYDRARKQTIGVYYRHKTRSRYC  445

Query  1415  SWRRGLPACFAGDGDQSADRISKIVVYSPV--TKPAKIGRSECCDVTIDSVDSESAVIKT  1588
              WR   P           +RI  +VV       +  K  R +CC V + S  + + V+  
Sbjct  446   RWRMASP-----------ERIYSVVVLKKRDDLRWQKSPRRDCCRV-LPSRKNNTMVLSV  493

Query  1589  RRCMADDI  1612
               C   ++
Sbjct  494   GNCREGEV  501



>ref|XP_010480127.1| PREDICTED: uncharacterized protein LOC104758861 isoform X1 [Camelina 
sativa]
Length=509

 Score =   267 bits (682),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/429 (35%), Positives = 227/429 (53%), Gaps = 16/429 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPPSSPPYRV  532
             T+L H+VFG+  S K W HRR YV+ WW+PN  + G + LDK           + PP R+
Sbjct  83    TDLKHVVFGIAASAKLWKHRRDYVKLWWKPNGEMNGVVWLDKHIAQNDNVSMTTLPPIRI  142

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDA-PQRATGTLRWVVMGDDDTIFLVDNLVD  709
             S + SR   +  +      R+   + ETVR      +   +RW+VMGDDDT+F  +NLV 
Sbjct  143   SSDTSRFKYKYPNGLRSAIRITRIVSETVRLLNGTESEKNVRWIVMGDDDTVFFPENLVK  202

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL +YDH ++YY+G  SE    N  FS+  A+GGGG  +S+PLA A+      C++RYS 
Sbjct  203   VLRKYDHKQFYYIGSPSESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSE  262

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D     C+++LGV L+   GFHQID++G + G LS HP APL+S+HH D+V+P+FP
Sbjct  263   LYGSDDRIHACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLVDPVFP  322

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +M R  + + FM +A  D   + QQ +C+ +   W+ SV+WGY+  I   ++    +  P
Sbjct  323   NMGRVNAMQRFMVSARLDSASLAQQSICYDKAHRWTVSVSWGYTVQIIRGVLSAKEMLIP  382

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
               TF  W       ++ F+ R   + + C  P  ++L +     A     + Y R +   
Sbjct  383   TRTFIDWYKRAEEKSYAFNTR-HFSKNACQRPRVYYLSNALPDLALHRTASEYVRWYDMW  441

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP-------AKIGRSECCDVTIDSVDSESAVIKT  1588
              P C     D S   I +++VY    KP        +  R +CC V + +  + + VI  
Sbjct  442   DPECDWHMSDPS--EIERVIVYK---KPDPDRWNRDRAPRRDCCRV-LPTKKNGTMVIDV  495

Query  1589  RRCMADDII  1615
               C  D+I+
Sbjct  496   GACKDDEIV  504



>ref|XP_002868218.1| hypothetical protein ARALYDRAFT_493365 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44477.1| hypothetical protein ARALYDRAFT_493365 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   266 bits (680),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 164/436 (38%), Positives = 230/436 (53%), Gaps = 27/436 (6%)
 Frame = +2

Query  332   SRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPP  511
             +R+ S   T   HL+F +  S  +W  R +YV  W+ P +T   + LD+      L    
Sbjct  70    ARSLSVFSTRRRHLLFSIAASHDSWLRRSSYVRLWYSPESTRAVVFLDRGG----LESDL  125

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
             + PP  VS +VSR      +  P   R    +   V++        +RW V GDDDT+F 
Sbjct  126   TLPPVIVSKDVSRF----PYNFPGGLRSAIRVARVVKETVDLGDKDVRWFVFGDDDTVFF  181

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
             VDNLV VL++YDH K+YY+G +SEF   N  +SF  AFGGGG  +S  LA  +A  +  C
Sbjct  182   VDNLVTVLSKYDHRKWYYVGSNSEFYDQNVRYSFDMAFGGGGFAISASLAKVLAKVLDSC  241

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             L RYSH+  +D     C+A+LGV L+   GFHQID+ G+I G L  HP +PL+SLHH D 
Sbjct  242   LMRYSHMYGSDSRIFSCVAELGVTLTHEPGFHQIDVRGNIFGLLCAHPLSPLVSLHHLDA  301

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIM  1225
             V+P FP  NR ES  H + AA+ D  R+LQQ +C+      + SV WGY+  +YE  K++
Sbjct  302   VDPFFPKRNRTESVAHLIGAASFDSARILQQSVCYDSLNTVTVSVVWGYAVQVYEGNKLL  361

Query  1226  PRSYLQNPIETFQTW-GPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             P   L    +TF TW   S    N++F  R+    DPC  P  FFL+SV      D    
Sbjct  362   PD--LLTLQKTFSTWRRGSGVQSNYMFSTRE-YPRDPCGRPLVFFLDSV----GSDGTEG  414

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTK----PAKIGRSECCDVTIDSVDSE  1570
             T+       +  C      ++ +R+ ++ V S   K         R +CCD  I S  ++
Sbjct  415   TWSNYNLHRVGNCHRA---EAVERLERVRVLSRKLKHDVEQMVAPRRQCCD--ISSPYNK  469

Query  1571  SAVIKTRRCMADDIIA  1618
             S VI  R+CM D++IA
Sbjct  470   SMVINIRQCMPDELIA  485



>emb|CDY01988.1| BnaC02g27390D [Brassica napus]
Length=501

 Score =   266 bits (681),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 152/434 (35%), Positives = 227/434 (52%), Gaps = 14/434 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPP  511
             +N +   T L H+VFG+  S   W HRR YV++WW+PN  + G + LDKP   + L    
Sbjct  72    QNHTEVKTELKHIVFGIAASSNLWKHRREYVKTWWKPNGEMKGAVWLDKPAVNDSLS--S  129

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAP-QRATGTLRWVVMGDDDTIF  688
             + P  R+S + S         +    R+   + +TVR      +   +RW+VMGDDDT+F
Sbjct  130   ALPEIRISSDTSSFKYRYRRGHRSAIRITRIVSDTVRMLKGTESERNVRWIVMGDDDTVF  189

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNY--FSFKQAFGGGGIVLSFPLAMAMADGI  862
               +NLV VL +YDH ++YY+G  SE  H  N   FS+  A+GGGG  +S+PLA A+    
Sbjct  190   FPENLVRVLRKYDHKQFYYIGAPSE-SHLQNLQQFSYGMAYGGGGFAISYPLAKALEKMQ  248

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++ YS L  +D     C+A+LGV L+   GFHQ D++G++ G LS HP AP++S+HH
Sbjct  249   DRCIESYSDLYGSDDRIHACMAELGVPLTREVGFHQFDVYGNLLGLLSVHPQAPIVSIHH  308

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D+V PIFP M+R +     M +A  D   ++QQ +C+ R   W+ S++WGY+  I    
Sbjct  309   LDVVEPIFPKMDRVKGVERLMISAKLDSASLVQQSICYDRTHQWTMSISWGYTVQITRTY  368

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             MP   ++ P  TF  W       N  F+ R  T TD C  P  F++      ++    + 
Sbjct  369   MPARMMEVPTRTFSDWHKRHDFNNLAFNTRPITYTD-CQRPRVFYMSRTLGDSSSSTTIT  427

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT--KPAKIGRSECCDVTIDSVDSESA  1576
              Y R      P C  G  D S   I++I V+      +  K  R +CC + + +    + 
Sbjct  428   EYLRHNELN-PKCEWGIPDPSD--INRIFVHKESNPYRWNKAPRRDCCRL-LPATKKGTM  483

Query  1577  VIKTRRCMADDIIA  1618
             +IK   C  D+I A
Sbjct  484   MIKVAPCENDEIAA  497



>ref|XP_010551745.1| PREDICTED: uncharacterized protein LOC104822287 [Tarenaya hassleriana]
Length=488

 Score =   266 bits (680),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 165/435 (38%), Positives = 234/435 (54%), Gaps = 28/435 (6%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS  514
             R+ S   T   HL+F +  S  +W  R +YV  W+ P +T   + LD+  G E     PS
Sbjct  72    RSLSVYATRRRHLLFSIAASHDSWLRRSSYVRLWYSPKSTRALVFLDRG-GFE---SDPS  127

Query  515   SPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLV  694
              PP  VS++VSR      +  P   R    +   V++A  R    +RW V GDDDT+F V
Sbjct  128   LPPVIVSEDVSRF----PYTFPGGLRSAIRVARVVKEAVDRGDLDVRWFVFGDDDTLFFV  183

Query  695   DNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCL  874
             DNL+ VL++YD+ K+YY+G +SE    N  +SF  AFGGGG  +S  LA  +A  +  CL
Sbjct  184   DNLLRVLSKYDYRKWYYVGSNSESYDQNVRYSFDMAFGGGGFAISASLARVLAKVLDSCL  243

Query  875   KRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMV  1054
              RYSH+  +D     C+A+LGV L+   GFHQID+ G++ G L  HP +PL+SLHH D V
Sbjct  244   MRYSHMYGSDSRIFSCLAELGVALTHEPGFHQIDIRGNLFGLLCAHPLSPLVSLHHLDAV  303

Query  1055  NPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE--KIMP  1228
             +PIFP +NR+E+  H M A N D  R+LQQ +C+ +  + + SV WGY+  +YE  K++P
Sbjct  304   DPIFPKLNRSEAMDHLMEAVNVDSTRILQQSVCYDQANSLTVSVVWGYAIQVYEGNKLLP  363

Query  1229  RSYLQNPIETFQTWGPSPR-PPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVAT  1405
                L +  +TF TW    R   N++F+ R     DPC  P  FFL+ V    +      T
Sbjct  364   D--LLSLQKTFTTWRRGSRVQSNYMFNTRD-YPRDPCERPLVFFLDGVGSDGS----GGT  416

Query  1406  YRRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDSES  1573
             +    R  +  C           + +I + SP      +  K  R  CCD++  S D+  
Sbjct  417   WSNYTRHVVGNCRRA----KVKLLEQIRILSPKMELDIEQMKSPRRHCCDIS-PSYDAL-  470

Query  1574  AVIKTRRCMADDIIA  1618
              VI  R CM D+IIA
Sbjct  471   MVINVRECMGDEIIA  485



>emb|CDP08959.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   266 bits (681),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 141/421 (33%), Positives = 222/421 (53%), Gaps = 14/421 (3%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+ FG+  S   W  R+ Y++ WWRP  T G + LDK             P  ++S
Sbjct  100   TELKHIAFGIAASSNLWDKRKEYIKLWWRPGETRGAVWLDKKVSTGR---NEGLPDIKIS  156

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              N S    E  + N +  R    I   V +  +     +RW VMGDDDT+F+V+N++ VL
Sbjct  157   GNTS----EFKYTNRQGKRSALRISRVVSETLRLGMKDVRWFVMGDDDTVFVVENVLRVL  212

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH +YYY+G  SE    N +FS+  A+GGGG  +S+PLA+ +      C++RY  L 
Sbjct  213   SKYDHNQYYYIGSSSESHIQNIFFSYAMAYGGGGFAISYPLALEIEKMQDRCIQRYPGLY  272

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ D++G++ G L  HP  PL+SLHH D+V PIFP +
Sbjct  273   GSDDRIQACMAELGVPLTREPGFHQYDVYGNLLGLLGAHPVTPLVSLHHLDVVAPIFPQL  332

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             NR +S +H   +   D   ++QQ +C+ + R WS SV+WGY   I+  ++    L+ P  
Sbjct  333   NRVQSLQHLFESVKQDSASIIQQSICYDKKRYWSISVSWGYVVQIFRGVISPRELEMPTR  392

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R   T  PC  P  +++ S +    R++I+  Y R ++   P
Sbjct  393   TFLNWYKRADYTAYAFNTRP-VTKHPCQKPFLYYMSSTKYDEGRNQIIGVYSR-FKESSP  450

Query  1436  ACFAGDGDQSADRISKIVVYS--PVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADD  1609
              C      +S ++++ ++V      ++  K  R +CC V + S  S +  I   +C   +
Sbjct  451   YCRW--TMESPEKLNTVIVLKRPDSSRWQKSPRRDCCRV-LPSKRSTNMYIWVGKCRMGE  507

Query  1610  I  1612
             +
Sbjct  508   V  508



>ref|XP_009128480.1| PREDICTED: uncharacterized protein LOC103853310 isoform X1 [Brassica 
rapa]
Length=501

 Score =   266 bits (680),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 151/434 (35%), Positives = 229/434 (53%), Gaps = 14/434 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPP  511
             +N +   T L+H+VFG+    K W HRR YV++WW+PN  + G + LDKP   + L    
Sbjct  72    QNHTEDKTELNHIVFGIAAFSKLWKHRREYVKTWWKPNGEMKGAVWLDKPTVNDSLS--S  129

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAP-QRATGTLRWVVMGDDDTIF  688
             + P  R+S + S         +    R+   + +TVR      +   +RW+VMGDDDT+F
Sbjct  130   ALPEIRISSDTSSFKYRYRRGHRSAIRITRIVSDTVRMLKGTESERNVRWIVMGDDDTVF  189

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNY--FSFKQAFGGGGIVLSFPLAMAMADGI  862
               +NLV VL +YDH ++YY+G  SE  H  N   FS+  A+GGGG  +S+PLA A+    
Sbjct  190   FPENLVRVLRKYDHKQFYYIGAPSE-SHLQNLQQFSYGMAYGGGGFAISYPLAKALEKMQ  248

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++ Y+ L  +D     C+A+LGV L+   GFHQ D++G++ G LS HP AP++S+HH
Sbjct  249   DRCIESYADLYGSDDRIHACMAELGVPLTREVGFHQFDVYGNLLGLLSVHPQAPIVSIHH  308

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D+V PIFP M+R ++    M +A  D   ++QQ +C+ R   W+ S++WGY+  I    
Sbjct  309   LDVVEPIFPKMDRVKAVERLMISAKLDSASLVQQSICYDRTHQWTMSISWGYTVQITRTY  368

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             MP   ++ P  TF  W       N  F+ R  T TD C  P  F++      ++    + 
Sbjct  369   MPARMMEVPTRTFSDWHKRHDFNNLAFNTRPITYTD-CQRPRVFYMSRTLGDSSSSTTIT  427

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT--KPAKIGRSECCDVTIDSVDSESA  1576
              Y R      P C  G  D S   I++I V+      +  K  R +CC + + +    + 
Sbjct  428   EYLRHNELN-PQCEWGIPDPSD--INRIFVHKESNPDRWNKAPRRDCCRL-LPATKKGTM  483

Query  1577  VIKTRRCMADDIIA  1618
             +IK   C  D+I A
Sbjct  484   MIKVAPCENDEIAA  497



>ref|XP_010457107.1| PREDICTED: uncharacterized protein LOC104738639 isoform X1 [Camelina 
sativa]
Length=508

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/429 (35%), Positives = 230/429 (54%), Gaps = 17/429 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPPSSPPYRV  532
             T+L H+VFG+  S K W HRR YV+ WW+PN  + G + LDK   A+      + PP ++
Sbjct  83    TDLKHVVFGIAASAKLWKHRRDYVKLWWKPNGEMNGVVWLDKHI-AQNDNVSATLPPIKI  141

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDA-PQRATGTLRWVVMGDDDTIFLVDNLVD  709
             S + SR   +  +      R+   + ETVR      +   +RW+VMGDDDT+F  +NLV 
Sbjct  142   SSDTSRFKYKYPNGLRSAIRITRIVSETVRLLNGTESEKNVRWIVMGDDDTVFFPENLVK  201

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL +YDH ++YY+G  SE    N  FS+  A+GGGG  +S+PLA A+      C++RYS 
Sbjct  202   VLRKYDHKQFYYIGSPSESHIQNLKFSYGMAYGGGGFAISYPLAKALEKMQDRCIQRYSE  261

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D     C+++LGV L+   GFHQID++G + G LS HP APL+S+HH D+V+P+FP
Sbjct  262   LYGSDDRIHACMSELGVPLTKEVGFHQIDLYGKLLGLLSAHPLAPLVSIHHLDLVDPVFP  321

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             +M R  + + FM +A  D   + QQ +C+ + R W+ SV+WGY+  I   ++    +  P
Sbjct  322   NMGRVNAMQRFMVSAKLDSASLAQQSICYDKARRWTVSVSWGYTVQIIRGVLSAKEMLIP  381

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
               TF  W       ++ F+ R   + + C  P  ++L +     A     + Y R +   
Sbjct  382   TRTFIDWYKRAEEKSYAFNTRP-FSKNACQRPRVYYLSNALPDLALHRTASEYVRWYDMW  440

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP-------AKIGRSECCDVTIDSVDSESAVIKT  1588
              P C     D S   I +++VY    KP        +  R +CC V + +  + + VI  
Sbjct  441   DPECDWHMSDPS--EIERVIVYK---KPDPDRWNRDRAPRRDCCRV-LPTKKNGTMVIDV  494

Query  1589  RRCMADDII  1615
               C  D+I+
Sbjct  495   GACKDDEIV  503



>ref|XP_006407449.1| hypothetical protein EUTSA_v10020559mg [Eutrema salsugineum]
 gb|ESQ48902.1| hypothetical protein EUTSA_v10020559mg [Eutrema salsugineum]
Length=504

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 160/438 (37%), Positives = 238/438 (54%), Gaps = 34/438 (8%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS---  514
             S  P N+SH+ F + G+   W  R  Y   WWR N+T GF+ LDKP     + +P +   
Sbjct  87    SVGPINISHIQFCIAGAADTWLDRSRYTSLWWR-NSTRGFVWLDKP-----VRFPKNHSD  140

Query  515   ---SPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
                S P RVSD   +R    ++    R+AR++        D+ +     +RW VMGDDDT
Sbjct  141   SRFSIPIRVSDPGWTRFRFSSSRAAVRIARIIW-------DSYRLNLPDVRWFVMGDDDT  193

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F  DNLV VL++YDH + +Y+GG+SE +  +   ++  AFGGGG  +S PLAM +A G+
Sbjct  194   VFFTDNLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRPLAMRLAAGM  253

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               CL+RY +   +D+    C+ ++GV  +  +GFHQ+D+ GD  GFL+ HP APL+SLHH
Sbjct  254   DGCLQRYFYFYGSDQRIAACVCEIGVPFTEERGFHQLDIRGDPFGFLAAHPLAPLVSLHH  313

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
                ++P+FP+ N  ES +  M   N D  R+LQQ+ C  R R WS S++WGYS  IY   
Sbjct  314   LVYLDPMFPNKNPIESLQTLMKPYNLDPHRILQQIHCHDRKRQWSISISWGYSIQIYTYF  373

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +    L  P++TF+TW  S   P + F+ R     DPC  P  +F++  E+V  RD    
Sbjct  374   LTAKELDTPLQTFKTWRSSSDGP-FTFNTRP-LKPDPCERPVTYFMDGAEDV--RDSGTK  429

Query  1403  TYRRSWRRGLPACFAGDGDQS-ADRISKIVVYSPVTKPA---KIGRSECCDVTIDS---V  1561
             T+     +    C  G  + S   ++ +I+V S    P    K  R +CC+V        
Sbjct  430   TWYSVADKNYGHC--GKSEHSRLTQVKRILVTSMKMDPEYWNKAPRRQCCEVLEGGGRRK  487

Query  1562  DSESAVIKTRRCMADDII  1615
             D E + I+ R+C + + I
Sbjct  488   DKEMS-IRIRKCRSSEKI  504



>ref|XP_002315207.1| hypothetical protein POPTR_0010s20760g [Populus trichocarpa]
 gb|EEF01378.1| hypothetical protein POPTR_0010s20760g [Populus trichocarpa]
Length=496

 Score =   266 bits (679),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/420 (36%), Positives = 225/420 (54%), Gaps = 18/420 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SH++F + GS   W  R  Y   WW PN T GF+ L+K   +       + P  +V
Sbjct  79    PTNISHVLFCIGGSTATWRDRSLYSSIWWVPNVTRGFVWLEKKIISHQTN--KNVPAVKV  136

Query  533   SD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             S    +R    ++    R+AR++        D+ +     +RW VMGDDDT++  DNLV 
Sbjct  137   SSPEWTRFKYSSSRSAVRIARIIS-------DSVKLRLPDVRWFVMGDDDTVYYTDNLVS  189

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDH + +Y+GG+SE +  +   S+  AFGGGG  LS+PLA  +   +  CL RY +
Sbjct  190   VLSRYDHNQMWYIGGNSESVEQDVIHSYDMAFGGGGFALSYPLAERLVSILDGCLDRYYY  249

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
                +D+    CI+++GV LS  +GFHQ D+ G   G L+ HP APL+SLHH D + P+FP
Sbjct  250   FYGSDQRIWACISEIGVPLSRERGFHQFDIRGSAYGLLAAHPLAPLVSLHHLDNLEPLFP  309

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             + NR +S +    A   D PR+ QQ  C    R WS S+AWGY+  +Y  ++P + LQ P
Sbjct  310   NHNRIDSLKSINQAYQVDPPRIFQQTFCHDSKRKWSISIAWGYTVQLYPLLLPANGLQTP  369

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
              +TF+TW      P + F+ R  T  DPC  P  F LE  +E      + ++Y+R     
Sbjct  370   EQTFKTWRSWSDGP-FTFNTRP-TEPDPCKQPVVFMLEQAKEGGVNGSL-SSYKRIVHEP  426

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDV-TIDSVDSESAVIKTRRC  1597
                C      Q A  + +I+V S   +P    K  R  CC++    S+ + S  ++ RRC
Sbjct  427   GKTCKTTQYAQ-AMSVQRILVSSLKMEPDYWKKAPRRYCCELMNKGSIKNSSMQLRIRRC  485



>ref|XP_003547038.2| PREDICTED: uncharacterized protein LOC100794154 [Glycine max]
Length=419

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/424 (34%), Positives = 217/424 (51%), Gaps = 19/424 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+ GS   WH R+ Y++ WWRP  T G + LDK   ++        P   +S
Sbjct  7     TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKETRGVVWLDKKVRSQS---NEGLPDIYIS  63

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
              + S+      + N +  R    I   V +  +     +RW VMGDDDT+F+VDN+V +L
Sbjct  64    GDTSKF----RYTNRQGQRSALRISRVVTETFKLGMKDVRWFVMGDDDTMFMVDNVVRIL  119

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH  +YY+G  SE    N +FS+  A+GGGG  +S+PLA  +A     C++RY  L 
Sbjct  120   SKYDHRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQDRCIQRYPALY  179

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ D++GD+ G L  HP +PL+SLHH D+V PIFP M
Sbjct  180   GSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHHLDVVQPIFPRM  239

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
              R  + RH M + N D   ++QQ +C+ +   WS SV+WGY   I   ++    L+ P  
Sbjct  240   TRVRALRHLMESVNQDSGSIMQQSICYDKQNFWSISVSWGYVVQILRGVLSPRELEMPSR  299

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R      PC  P  +++ +    +   ++V  Y R  +   P
Sbjct  300   TFLNWYKRADYTAYAFNTRP-VAKHPCQKPFVYYMTNTHYDSTTKQVVGVYSRD-KSKSP  357

Query  1436  ACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSESAVIKTRRCM  1600
              C       S ++I+ +VV     KP      K  R +CC +      +++  I    C 
Sbjct  358   FCRWRMN--SPEKITSVVV---TKKPDPLRWKKSPRRDCCRILSSRKSTDTLYIWVGNCQ  412

Query  1601  ADDI  1612
               ++
Sbjct  413   EGEV  416



>ref|XP_009605991.1| PREDICTED: uncharacterized protein LOC104100467 [Nicotiana tomentosiformis]
Length=474

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 234/436 (54%), Gaps = 27/436 (6%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE-----LL  499
              +D +SPT L H+VFG+  +EK+W  R+  V+ W++ N   G + L+K P +      LL
Sbjct  53    EHDLSSPTTLQHVVFGIASNEKSWSKRKELVKLWYKSNEMKGCVFLEKMPNSSTNDSLLL  112

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             P      P  +S+++SR        NP   R+   + ETV          +RW V GDDD
Sbjct  113   P------PICISEDISRFPYTNKGGNPSAIRVARVVSETV----ALNHSNVRWFVFGDDD  162

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADG  859
             TIF  +NLV  L++YDH  +YY+G +SE    N +FSF+ AFGG G V+S+PLA  +A  
Sbjct  163   TIFFPENLVKTLSKYDHGLWYYIGSNSESFIQNKFFSFEMAFGGAGFVISYPLAKVLAKV  222

Query  860   IMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLH  1039
                C++RY HL  +D     C+ +LGV L+   GFHQ+D HG++ G L+ H   PL+SLH
Sbjct  223   FDSCIERYPHLYGSDGRIHACLTELGVTLTHEPGFHQMDFHGNVFGLLAAHSIRPLVSLH  282

Query  1040  HFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK  1219
             H ++++PIFP+M R ++  H   AA+    R+LQQ +C+ R  +W+ SV+WGY+  ++  
Sbjct  283   HMEIIDPIFPNMTRMKALEHLYQAASFYPQRILQQTVCYDRRFSWTVSVSWGYAVQVFAH  342

Query  1220  IMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIV  1399
              +     Q   E++  W  +     + ++ RK   +DPC     +FL++V   ++ DEI 
Sbjct  343   NVFLPDAQRVQESYFPWKKNAYGTLYEYNTRK-FESDPCKKQIVYFLDNVS--SSMDEIK  399

Query  1400  ATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDS  1567
               Y++  +     C    G  S  ++ +I V+S      T      R  CCDV + S   
Sbjct  400   TIYKK--KTTSENC--TFGKNSPRKLEEIRVFSHKLDLDTNQLLAPRRHCCDV-LPSTSG  454

Query  1568  ESAVIKTRRCMADDII  1615
             +   I  R C  D++I
Sbjct  455   KVMEIGIRECKEDELI  470



>ref|XP_010240968.1| PREDICTED: uncharacterized protein LOC104585699 [Nelumbo nucifera]
Length=475

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/434 (35%), Positives = 229/434 (53%), Gaps = 21/434 (5%)
 Frame = +2

Query  341   DSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDK-PPGAELLPWPPSS  517
             D + PT L H+VFG+  S ++W  R+ YV  WW+P    G + +++ P GA+       +
Sbjct  50    DLSPPTTLDHVVFGISSSAQSWPMRKEYVRLWWKPERMRGCVFVERMPTGADKYNRTDHT  109

Query  518   --PPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFL  691
               PP  +S + SR             R+   + ETV       TG +RW V GDDDT+F 
Sbjct  110   TLPPICISQDTSRFRYTHGSGLKSAIRVARSVSETV---ALNQTG-VRWFVFGDDDTLFF  165

Query  692   VDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDC  871
              +NLV  L++YDH  +YY+G +SE    N+ FSF+ A+ GGG  LS+PLA  +A  +  C
Sbjct  166   PENLVQTLSKYDHNLWYYIGTYSESAKQNSVFSFQMAYWGGGFALSYPLAKVLAKVLDSC  225

Query  872   LKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDM  1051
             L+RY HL   D     C+ +LGV L+   GFHQ+D+ GD  G L+ HP  PL+SLH  + 
Sbjct  226   LERYPHLYGDDARIFSCLTELGVGLTYEPGFHQVDLKGDAFGLLAAHPLKPLVSLHRLED  285

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             + P+FP M R ++  H + A   D  R+LQQ +C+ R   W+ SV+WGY+  ++E  +  
Sbjct  286   IEPVFPKMARKQALEHLLEAVKLDPGRILQQTICYDRWFQWTVSVSWGYAVQVFEAHILL  345

Query  1232  SYLQNPIETFQTWGP--SPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVAT  1405
               +     TF+ W    +  PP  +FD R+    DPC  P  FFLESV     R+ I +T
Sbjct  346   PDVLPVQRTFEPWNKRDTSLPPLHMFDTRE-LPEDPCRRPIIFFLESVSS-DHRERIKST  403

Query  1406  YRRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDSES  1573
             YR +       C   +   ++ ++ +I+V+S       +  +  R  CCD+   S  SE 
Sbjct  404   YRSTISE---KCL--ESKDTSKKLKQIIVFSKKLNLDIRQLRAPRRHCCDILTSSA-SEV  457

Query  1574  AVIKTRRCMADDII  1615
               I  R C  +++I
Sbjct  458   LEIGIRECREEEMI  471



>ref|XP_009779247.1| PREDICTED: uncharacterized protein LOC104228481 [Nicotiana sylvestris]
Length=472

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/436 (35%), Positives = 231/436 (53%), Gaps = 28/436 (6%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAE-----LL  499
             + D +SPT L H+VFG+  +EK+W  R+  V+ W++PN   G + L+K P +      LL
Sbjct  52    KYDLSSPTTLHHVVFGIASNEKSWSKRKELVKLWYKPNEMRGCVFLEKMPNSSTNDSLLL  111

Query  500   PWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDD  679
             P      P  +S+++SR        NP   R+   + ETV          +RW V GDDD
Sbjct  112   P------PIYISEDISRFPYTNRGGNPSAIRVARVVSETV----ALNHSNVRWFVFGDDD  161

Query  680   TIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADG  859
             TIF  +NLV  L++YDH  +YY+G +SE    N +FSF+ AFGG G  +S+PL   +A  
Sbjct  162   TIFFPENLVKTLSKYDHGLWYYIGSNSESFIQNKFFSFEMAFGGAGFAISYPLGNVLAKV  221

Query  860   IMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLH  1039
                C++RY HL  +D     C+ +LGV L+   GFHQ+D HG++ G L+ H   PL+SLH
Sbjct  222   FDSCIERYPHLYGSDGRIHACLTELGVTLTHEPGFHQMDFHGNVFGLLAAHSIRPLVSLH  281

Query  1040  HFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEK  1219
             H +++ PIFP+M R +S  H   AA+ D  R+LQQ +C+ R  +W+ SV+WGY+  ++  
Sbjct  282   HMEIIEPIFPNMTRMKSLEHLYQAASFDPQRLLQQAVCYDRRFSWTVSVSWGYAVQVFAH  341

Query  1220  IMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIV  1399
              +  +  Q   E++  W  +     + ++ RK   +D C     FFL  V   +  DEI 
Sbjct  342   NVFLTDAQRVQESYLPWKKNAYGTLYEYNTRK-FESDQCKKQIIFFLNKVS--SGMDEIK  398

Query  1400  ATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPV----TKPAKIGRSECCDVTIDSVDS  1567
               Y++  +      F+ +   S   I +I V+S      T      R  CCDV + S   
Sbjct  399   TIYKK--KTSDNCTFSKN---SPREIEEIRVFSHKLDLDTNQLLAPRRHCCDV-LPSTSG  452

Query  1568  ESAVIKTRRCMADDII  1615
             +   ++ R C  D++I
Sbjct  453   KVMEMEIRECKEDELI  468



>ref|XP_010495666.1| PREDICTED: uncharacterized protein LOC104772768 [Camelina sativa]
Length=503

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/435 (35%), Positives = 232/435 (53%), Gaps = 25/435 (6%)
 Frame = +2

Query  344   SNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPS---  514
             S  P N+SH++F + G+ + W  R  Y   WWR + T GF+ LDKP     LP   S   
Sbjct  83    SIGPLNVSHILFCIAGAAETWIDRSQYTSLWWRNSTTRGFVWLDKPVN---LPQNHSDVR  139

Query  515   -SPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIF  688
              S P RVSD   +R    ++    R+AR++        D+ +     +RW VMGDDDT+F
Sbjct  140   FSIPIRVSDPGWTRFKFSSSRAAVRIARIIW-------DSYRLNLPNVRWFVMGDDDTVF  192

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMD  868
               +NLV VL++YDH + +Y+GG+SE +  +   ++  AFGGGG  +S PLA  +A+ + D
Sbjct  193   FTENLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRPLAARLANAMDD  252

Query  869   CLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFD  1048
             CL+RY +   +D+    C++++GV  +  +GFHQ+D+ GD  G+L+ HP  PL+SLHH  
Sbjct  253   CLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIKGDPYGYLAAHPLTPLVSLHHLV  312

Query  1049  MVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMP  1228
              ++P+FP+ N  ES +  M   + DQ R+LQQ+ C    R WS S++WGYS  IY   + 
Sbjct  313   YLDPMFPNKNPIESLQTLMKPYSLDQNRILQQINCHEGKRQWSISISWGYSIQIYSYFLT  372

Query  1229  RSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATY  1408
                L  P++TF+TW  S   P ++F+ R     DPC  P  +F++  E+V  R     T 
Sbjct  373   AKELTTPLQTFKTWRSSSDGP-FVFNTRP-LPPDPCQRPVTYFMDGAEDV--RFYGTKTR  428

Query  1409  RRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDVT---IDSVDSE  1570
                  +    C          ++ +I+V S    P    K  R +CC+V           
Sbjct  429   YSVADKNFGRCENNTEHSELTKVKRILVTSMKMDPEYWNKAPRRQCCEVMGGGRGKRKEN  488

Query  1571  SAVIKTRRCMADDII  1615
               +I+ R+C + + I
Sbjct  489   EMLIRIRKCKSSERI  503



>ref|XP_002531833.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF30553.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=498

 Score =   265 bits (677),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 205/389 (53%), Gaps = 20/389 (5%)
 Frame = +2

Query  308   NESRSELESRNDSNSP-----------TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNAT  454
             ++ + E E   DS  P           T L H+VFG+  S   W  R+ YV+ WWRP  T
Sbjct  60    DDKKQEREEERDSLQPILLPQRSQSYNTELKHIVFGIAASANLWEKRKEYVKIWWRPRET  119

Query  455   VGFLQLDKPPGAELLPWPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQ  634
              G + +D+   +         P  RVS + SR        +    R+   + ET+R   +
Sbjct  120   RGIVWMDRRVRSRR---NDGLPEIRVSADTSRFKYSNRQGHRSAIRISRVVSETLRLGLK  176

Query  635   RATGTLRWVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGG  814
                  +RW VMGDDDT+F+V+N+V +L++YDH ++YY+G  SE    N YFS+  A+GGG
Sbjct  177   ----DVRWFVMGDDDTVFIVENVVRILSKYDHRQFYYVGSSSESHLQNIYFSYAMAYGGG  232

Query  815   GIVLSFPLAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDIS  994
             G  +S+PLA  +A     C++RY  L  +D     C+++LGV L+   GFHQ D++GD+ 
Sbjct  233   GFAISYPLAQQLAKMQDKCIQRYPGLYGSDDRIQACMSELGVPLTKEPGFHQYDVYGDLL  292

Query  995   GFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNW  1174
             G L  HP  PL SLHH D+V P+FP M R ++ +H   +   D   ++QQ +C+ + R W
Sbjct  293   GLLGAHPVTPLASLHHLDVVQPVFPRMTRVKALQHLFQSVRLDSGSIMQQSICYDKKRYW  352

Query  1175  SFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAF  1354
             S SV+WG+   I+  ++    L+ P  TF  W        + F+ R   T  PCL P  F
Sbjct  353   SISVSWGFVVQIWRGVISPRELETPTRTFLNWYRKADYTAYAFNTRP-VTKHPCLKPFIF  411

Query  1355  FLESVEEVTARDEIVATYRRSWRRGLPAC  1441
             ++ + +   A+  IV+ Y R   R  P C
Sbjct  412   YMSATKYDRAKKHIVSVYNRHKSRA-PYC  439



>ref|XP_010464844.1| PREDICTED: uncharacterized protein LOC104745342 [Camelina sativa]
Length=505

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/446 (34%), Positives = 236/446 (53%), Gaps = 25/446 (6%)
 Frame = +2

Query  311   ESRSELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGA  490
             + +S   S   S  P N+SH++F + G+ + W  R  Y   WWR + T GF+ +DKP   
Sbjct  74    QKKSIALSPTGSIGPLNISHILFCIAGAAETWIDRSQYTSLWWRNSTTRGFVWVDKPVN-  132

Query  491   ELLPWPPS----SPPYRVSD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLR  655
                P   S    S P RVSD   +R    ++    R+AR++        D+ +     +R
Sbjct  133   --FPQNNSDVRFSIPIRVSDPGWTRFKFSSSRAAVRIARIIW-------DSYRLNLPNVR  183

Query  656   WVVMGDDDTIFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFP  835
             W VMGDDDT+F  +NLV VL++YDH + +Y+GG+SE +  +   ++  AFGGGG  +S P
Sbjct  184   WFVMGDDDTVFFTENLVKVLSKYDHEQMWYIGGNSESVEQDVMHAYDMAFGGGGFAISRP  243

Query  836   LAMAMADGIMDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHP  1015
             LA  +A+ + DCL+RY +   +D+    C++++GV  +  +GFHQ+D+ GD  G+L+ HP
Sbjct  244   LAARLANAMDDCLQRYFYFYGSDQRIAACVSEIGVPFTEERGFHQLDIKGDPYGYLAAHP  303

Query  1016  NAPLISLHHFDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWG  1195
               PL+SLHH   ++P+FP+ N  ES +  M   + DQ R+LQQ+ C    R WS S++WG
Sbjct  304   LTPLVSLHHLVYLDPMFPNKNPIESLQTLMKPYSLDQNRILQQINCHEGKRQWSISISWG  363

Query  1196  YSANIYEKIMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEE  1375
             YS  IY   +    L  P++TF+TW  S   P ++F+ R     DPC  P  +F++  E+
Sbjct  364   YSIQIYSYFLTAKELTTPLQTFKTWRSSSDGP-FVFNTRP-LPPDPCQRPVTYFMDGAED  421

Query  1376  VTARDEIVATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPA---KIGRSECCDV  1546
             V  R     T+     +    C          ++ +I+V S    P    K  R +CC+V
Sbjct  422   V--RFYGTKTWYSVADKNFGRCENNTEHSELTKVKRILVTSMKMDPEYWNKAPRRQCCEV  479

Query  1547  T---IDSVDSESAVIKTRRCMADDII  1615
                          +I+ R+C + + I
Sbjct  480   MEGGRGKRKENEMLIRIRKCKSSERI  505



>ref|XP_010456306.1| PREDICTED: uncharacterized protein LOC104737750 [Camelina sativa]
Length=517

 Score =   265 bits (678),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/434 (35%), Positives = 229/434 (53%), Gaps = 25/434 (6%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPPSSPPYRV  532
             T L H+VFG+  S   W HRR YV++WW+P+  + G + LD P   + +    + PP ++
Sbjct  92    TELKHVVFGIAASSDLWKHRREYVKTWWKPHGDMNGAVWLDTPVN-DSVSSSSALPPIKI  150

Query  533   SDNVSRVVEETNHVNPRVARMVHGIMETVRDAP-QRATGTLRWVVMGDDDTIFLVDNLVD  709
             S + S       + +    R+   + ETVR      A   +RWVVMGDDDT+F  +NLV 
Sbjct  151   SSDTSSFKYRYRNGHRSAIRITRIVSETVRMLNGTEAERNVRWVVMGDDDTVFFTENLVR  210

Query  710   VLAQYDHTKYYYLGGHSEFIHANNY--FSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRY  883
             VL +YDH ++YY+G  SE  H  N   FS+  A+GGGG  +S+PLA  +      C++RY
Sbjct  211   VLRKYDHKQFYYIGAPSE-SHLQNLHQFSYGMAYGGGGFAISYPLAKVLEKMQDRCIERY  269

Query  884   SHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPI  1063
             + L  +D     C+A+LGV L+   GFHQ+D++GD+ G LS HP  P++S+HH D+V PI
Sbjct  270   ADLYGSDDRIHACMAELGVPLTKEVGFHQMDVYGDLLGLLSVHPQVPIVSIHHLDVVEPI  329

Query  1064  FPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQ  1243
             FP  +R  + +  M  A  D   ++QQ +C+   R W+ S++WGY+  I    MP   ++
Sbjct  330   FPKTSRVNAVKKLMIPAKLDSASLVQQSVCYDTSRQWTMSISWGYTVQITRTYMPARMME  389

Query  1244  NPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDE--IVATYRR-  1414
              P  TF  W       N  F+ R  T TD C  P  F+L      ++ D+   +  Y R 
Sbjct  390   MPTRTFNDWHKRYDFTNVAFNTRPITYTD-CQRPRVFYLSRAFNNSSSDQTTTITEYMRH  448

Query  1415  -SWRRGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDSESA  1576
               W    P+C  G  D S   I++I VY    KP      K  R +CC + + +    + 
Sbjct  449   DEW---YPSCDWGIADPSD--INQIFVYK---KPNPDRWNKAPRRDCCRL-VPTRKKGTM  499

Query  1577  VIKTRRCMADDIIA  1618
             V+    C  D+I+A
Sbjct  500   VLNVAACANDEILA  513



>emb|CBI16231.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   263 bits (671),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/420 (35%), Positives = 219/420 (52%), Gaps = 34/420 (8%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+  S K W  R+ Y++ WWRP  T G + LDKP          +    R +
Sbjct  42    TELKHIVFGIAASSKLWEQRKQYIKQWWRPRVTRGVVWLDKPY--------TNRQGDRSA  93

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
               +SRVV ET  +  +                      +RW VMGDDDT+F+VDN+V +L
Sbjct  94    LRISRVVSETLRLGMK---------------------DVRWFVMGDDDTVFVVDNVVRIL  132

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH ++YY+G  SE    N +FS+  A+GGGG  +S+PLA+ +A     C++RY  L 
Sbjct  133   SKYDHRQFYYIGSSSESHTQNIFFSYAMAYGGGGFAISYPLAIELAKVQDRCIQRYPGLY  192

Query  896   SADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSM  1075
              +D     C+A+LGV L+   GFHQ D++GD+ G L+ HP  PL+S+HH D+V+PIFP M
Sbjct  193   GSDDRMQACMAELGVPLTREAGFHQYDVYGDLLGLLAAHPVTPLVSIHHLDVVDPIFPGM  252

Query  1076  NRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIE  1255
             ++ +S +    +   D   ++QQ +C+ + R+WS S++WGY   I   I+    L+ P  
Sbjct  253   SQVKSLQRLFESIKLDSSSIMQQSICYDKKRSWSISISWGYVVQILRGIVSPRELEMPTR  312

Query  1256  TFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLP  1435
             TF  W        + F+ R   T  PC  P  F++ +     AR + V  Y R  R   P
Sbjct  313   TFLNWYRKADYTAYAFNTRP-VTKHPCQKPFIFYMSTTRLDRARRQTVGVYSRH-RGRHP  370

Query  1436  AC-FAGDGDQSADRISKIVVYSPVTKPAKIGRSECCDVTIDSVDSESAVIKTRRCMADDI  1612
             AC +  D  +  D I+ ++      +  +  R +CC V + S  S S  +    C   +I
Sbjct  371   ACRWKMDSPEKIDSIT-VLKRPDDLRWQRSPRRDCCRV-LPSRRSSSMYLWVGNCRESEI  428



>ref|XP_006344119.1| PREDICTED: uncharacterized protein LOC102598352 [Solanum tuberosum]
Length=350

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  920   CIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPSMNRAESARH  1099
             CIAD+GVNLSP QG HQID+ GDISGFLSYHP + L+SLHHFDMV+PIFPSM+R +S  H
Sbjct  3     CIADIGVNLSPLQGIHQIDLRGDISGFLSYHPKSLLMSLHHFDMVDPIFPSMDRVKSVFH  62

Query  1100  FMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPIETFQTWGPS  1279
                 A  DQ RMLQQ +C HR ++W+FSV+WGYSA+IYEKIMPRS++Q PIETF+TW PS
Sbjct  63    LQKVAKYDQSRMLQQTICHHRSKSWTFSVSWGYSAHIYEKIMPRSWIQRPIETFKTWQPS  122

Query  1280  PRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGLPACFAGDGD  1459
             P PP ++FDVR   + DPC  PH FF +SV++ T R EI+ TY R W RG+ AC +  G+
Sbjct  123   PNPPYYMFDVRS-PSWDPCEAPHVFFFKSVKK-TQRGEILTTYTRGWPRGIGACLSS-GN  179

Query  1460  QSADRISKIVVYSPVTKPAKIGRSE  1534
              SA+ +SKI VYS  TK  ++   E
Sbjct  180   FSAEYVSKIHVYSSTTKRIRLPFEE  204



>ref|XP_002980904.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ18089.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=576

 Score =   267 bits (682),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/371 (36%), Positives = 212/371 (57%), Gaps = 18/371 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L+++VFG+  S K W  R+ YV+ WWRP    GF+ LDK   +    W  + PP R+S
Sbjct  157   TGLANIVFGIAASAKLWEKRQEYVKLWWRPGEMRGFVWLDKAVSS----WSKALPPMRIS  212

Query  536   DNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDVL  715
             ++ ++     N+ N +  R    I   V +  ++    + W VMGDDDT+F+ +NLV +L
Sbjct  213   EDTAKF----NYTNKKGGRSGIRISRVVSETFRQNLTDVHWFVMGDDDTMFVPENLVRIL  268

Query  716   AQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHLN  895
             ++YDH K+YY+G HSE    N +FS+  A+GGGG  +S+PLA A+A     C+ +Y +L 
Sbjct  269   SKYDHRKFYYIGSHSESHTQNIHFSYNMAYGGGGFAISYPLAKALAKVQDRCIMKYPYLY  328

Query  896   SADKTTGYCIADLGVNLSPHQGFHQI--------DMHGDISGFLSYHPNAPLISLHHFDM  1051
              +D     C+++LGV L+   GFHQ+        D++GD  G L+ HP  PL+S+HH D+
Sbjct  329   GSDDRIQACLSELGVPLTKEPGFHQVLSLFSWQFDIYGDAFGLLAAHPVTPLVSIHHLDL  388

Query  1052  VNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPR  1231
             ++P+FP+  + E+ RHF ++   D   +LQQ +C+ + + WS SV+WGY+  +Y  I+P 
Sbjct  389   IDPVFPNTTQIEALRHFKSSMRVDPGGVLQQSICYDKYKRWSISVSWGYAVQVYRGILPP  448

Query  1232  SYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYR  1411
               L+ P+ TF +W        + F+ R    + PC  P  F+++ V       E +++Y 
Sbjct  449   RLLELPMRTFLSWYRRMDDIGFPFNTRPFLKS-PCEQPTIFYMKEVGYGDEAGETISSYS  507

Query  1412  RSWR-RGLPAC  1441
             R  R RG   C
Sbjct  508   RDRRQRGGGEC  518



>ref|XP_010046420.1| PREDICTED: uncharacterized protein LOC104435352 [Eucalyptus grandis]
Length=502

 Score =   265 bits (676),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/401 (36%), Positives = 218/401 (54%), Gaps = 17/401 (4%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSS-PPYRV  532
             T + H+VFG+  S   W  R+ Y++ WWRP  T G + LDK     +  W     P  R+
Sbjct  91    TEIKHIVFGIAASSNLWEKRKEYIKLWWRPKETRGVVWLDK----RVRTWRNEPLPEIRI  146

Query  533   SDNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             S + S+  + TN    R A R+   I ET+R   +     +RW VMGDDDT+F+VDN+V 
Sbjct  147   SGDTSKF-KYTNRQGQRAALRISRVISETLRLGMK----DVRWFVMGDDDTVFIVDNVVR  201

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             +L++YDH ++YY+G  SE    N YFS+  A+GGGG  +S+PLA+ +A     C++RY  
Sbjct  202   ILSKYDHRQFYYVGSSSESHVQNIYFSYAMAYGGGGFAISYPLAVELAKMQDKCIQRYPG  261

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
             L  +D     C+A+LGV L+   GFHQ D++GD+ G L  HP  PL+S+HH D+V P+FP
Sbjct  262   LYGSDDRMQACMAELGVPLTKEPGFHQYDVYGDLLGLLGAHPVTPLVSIHHLDVVEPVFP  321

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
              M R  + RH   +   D   ++QQ +C+ + R+WS SV+WGY   +   +     L+ P
Sbjct  322   RMTRVRALRHLFESVKHDSASIMQQSICYDKRRSWSISVSWGYVVQVIRGVTSPRELEMP  381

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
               TF  W        + F+ R      PC  P  +++ SV+   A+ + +  Y R  R  
Sbjct  382   TRTFLNWYRRADYTAYAFNTRP-VMKHPCQKPFIYYMNSVKYDRAKKQTLGIYSRQ-RSR  439

Query  1430  LPAC-FAGDGDQSADRISKIVVYSP-VTKPAKIGRSECCDV  1546
              P+C +  D  ++ + I  +V+  P   +  K  R +CC +
Sbjct  440   HPSCRWKMDSPENINSI--VVLKRPDSNRWQKSPRRDCCRI  478



>ref|XP_004169123.1| PREDICTED: uncharacterized LOC101218166 [Cucumis sativus]
Length=547

 Score =   266 bits (679),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 215/403 (53%), Gaps = 21/403 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+ GS   W  R+ Y++ WWRP  T G + LDK   A+        P  R+S
Sbjct  134   TELKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKR---NEGLPEIRIS  190

Query  536   DNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
              + SR  + TN    R A R+   + ET+R         +RW VMGDDDT+F+V+N+V V
Sbjct  191   GDTSRF-KYTNRQGQRSALRISRVVSETLR----LGMKDVRWFVMGDDDTVFMVENVVRV  245

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH+++YY+G  SE    N YFS+  A+GGGG  +S+PLA  +      C++RY  L
Sbjct  246   LSKYDHSQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDKCIQRYPGL  305

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+A+LGV L+   GFHQ D++GD+ G L  HP  PL+SLHH D+V PIFP 
Sbjct  306   YGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVVEPIFPK  365

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M R ++ +    ++N D   ++QQ +C+ + R WS SV+WGY   I   ++    L+ P 
Sbjct  366   MTRVKALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPRELEMPT  425

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF  W        + F+ R   T  PC  P  F++ +      + + V  Y R   R  
Sbjct  426   RTFLNWYRRADYTAYAFNTRP-VTKHPCQKPFIFYMGTTRYDRTKKQTVGIYIRDKSRH-  483

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDV  1546
             P C       S D+I  +++   + KP      K  R +CC V
Sbjct  484   PFCRWKMS--SPDKIDSVII---LKKPDPYRWQKSPRRDCCRV  521



>ref|XP_004148789.1| PREDICTED: uncharacterized protein LOC101218166 [Cucumis sativus]
Length=547

 Score =   266 bits (679),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 148/403 (37%), Positives = 215/403 (53%), Gaps = 21/403 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+ GS   W  R+ Y++ WWRP  T G + LDK   A+        P  R+S
Sbjct  134   TELKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKR---NEGLPEIRIS  190

Query  536   DNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
              + SR  + TN    R A R+   + ET+R         +RW VMGDDDT+F+V+N+V V
Sbjct  191   GDTSRF-KYTNRQGQRSALRISRVVSETLR----LGMKDVRWFVMGDDDTVFMVENVVRV  245

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH+++YY+G  SE    N YFS+  A+GGGG  +S+PLA  +      C++RY  L
Sbjct  246   LSKYDHSQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDKCIQRYPGL  305

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+A+LGV L+   GFHQ D++GD+ G L  HP  PL+SLHH D+V PIFP 
Sbjct  306   YGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVVEPIFPK  365

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M R ++ +    ++N D   ++QQ +C+ + R WS SV+WGY   I   ++    L+ P 
Sbjct  366   MTRVKALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPRELEMPT  425

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF  W        + F+ R   T  PC  P  F++ +      + + V  Y R   R  
Sbjct  426   RTFLNWYRRADYTAYAFNTRP-VTKHPCQKPFIFYMGTTRYDRTKKQTVGIYIRDKSRH-  483

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDV  1546
             P C       S D+I  +++   + KP      K  R +CC V
Sbjct  484   PFCRWKMS--SPDKIDSVII---LKKPDPYRWQKSPRRDCCRV  521



>ref|XP_007152167.1| hypothetical protein PHAVU_004G107300g [Phaseolus vulgaris]
 gb|ESW24161.1| hypothetical protein PHAVU_004G107300g [Phaseolus vulgaris]
Length=529

 Score =   265 bits (678),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 144/412 (35%), Positives = 218/412 (53%), Gaps = 21/412 (5%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             EL  R D    T + H+VFG+  S   W  R+ Y++ WW+PN T G + LD     +   
Sbjct  109   ELSQRQD----TKVEHIVFGIAASSNLWDQRKEYIKVWWKPNQTRGVVWLDSKVRVQA--  162

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
                  P  R+S + ++      + N +  R    I   V +  +     +RW +MGDDDT
Sbjct  163   -NEGLPEIRISGDTTKF----KYTNSQGQRSALRISRVVTETLKLGMKDVRWFMMGDDDT  217

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F+VDN+V +L++YDHT++YYLG  SE    N +FS+  A+GGGG  +S+PLA+ +A   
Sbjct  218   VFIVDNVVRILSKYDHTQFYYLGSSSESHVQNIHFSYAMAYGGGGFAISYPLAIELAKMQ  277

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++RY  L  +D     C+A+LGV ++   GFHQ D++GD+ G L  HP  PL++LHH
Sbjct  278   DRCIQRYPSLYGSDDRMQACMAELGVPITKEPGFHQYDVYGDLLGLLGAHPVTPLMTLHH  337

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYE-K  1219
              D+V PIFP M+R ES +  M +   D   ++QQ +C+ + R WS S++WG+   +    
Sbjct  338   LDVVQPIFPLMDRVESLKQLMKSVKQDSGSIMQQSICYDKKRFWSISISWGFVVQVLRGA  397

Query  1220  IMPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIV  1399
             I+PR  L+ P  TF  W        + F+ R   T +PC     F++ S         I 
Sbjct  398   ILPRE-LEMPTRTFLNWYKKADYTAYSFNTRP-VTKNPCQKAFLFYMNSSRYDPVTKTIF  455

Query  1400  ATYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKPAKIGRS---ECCDV  1546
              TY R ++   P C      +S ++I  I+V S    P +  RS   +CC V
Sbjct  456   GTYSR-FKTKTPLCTW--ELESPEKIDTIIV-SKTPDPLRWQRSTRRDCCRV  503



>gb|KHN33433.1| hypothetical protein glysoja_005475 [Glycine soja]
Length=544

 Score =   265 bits (678),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 146/435 (34%), Positives = 220/435 (51%), Gaps = 23/435 (5%)
 Frame = +2

Query  323   ELESRNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLP  502
             ++  R D    T L H+VFG+ GS   WH R+ Y++ WWRP  T G + LDK   ++   
Sbjct  125   QMSERQD----TELKHVVFGIAGSSNLWHIRKEYIKIWWRPKETRGVVWLDKKVRSQS--  178

Query  503   WPPSSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDT  682
                  P   +S + S+      + N +  R    I   V +  +     +RW VMGDDDT
Sbjct  179   -NEGLPDIYISGDTSKF----RYTNRQGQRSALRISRVVTETFKLGMKDVRWFVMGDDDT  233

Query  683   IFLVDNLVDVLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGI  862
             +F+VDN+V +L++YDH  +YY+G  SE    N +FS+  A+GGGG  +S+PLA  +A   
Sbjct  234   MFMVDNVVRILSKYDHRHFYYIGSSSESHVQNIHFSYAMAYGGGGFAISYPLAQELAKMQ  293

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++RY  L  +D     C+A+LGV L+   GFHQ D++GD+ G L  HP +PL+SLHH
Sbjct  294   DRCIQRYPALYGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVSPLVSLHH  353

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D+V PIFP M R  + RH M + N D   ++QQ +C+ +   WS SV+WGY   I   +
Sbjct  354   LDVVQPIFPRMTRVRALRHLMESVNQDSGSIMQQSICYDKQNFWSISVSWGYVVQILRGV  413

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             +    L+ P  TF  W        + F+ R      PC  P  +++ +    +   ++V 
Sbjct  414   LSPRELEMPSRTFLNWYKRADYTAYAFNTRP-VAKHPCQKPFVYYMTNTHYDSTTKQVVG  472

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDVTIDSVDS  1567
              Y R   +  P C       S D+I+ +VV     KP      K  R +CC +      +
Sbjct  473   VYSRDKSKS-PFCRWRMN--SPDKITSVVV---TKKPDPLRWKKSPRRDCCRILSSRKST  526

Query  1568  ESAVIKTRRCMADDI  1612
              +  I    C   ++
Sbjct  527   NTLYIWVGNCQESEV  541



>emb|CDY54929.1| BnaAnng13620D [Brassica napus]
Length=502

 Score =   264 bits (675),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 151/434 (35%), Positives = 228/434 (53%), Gaps = 14/434 (3%)
 Frame = +2

Query  335   RNDSNSPTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATV-GFLQLDKPPGAELLPWPP  511
             +N +   T L+H+VFG+    K W HRR YV++WW+PN  + G + LDKP   + L    
Sbjct  73    QNHTEDKTELNHIVFGIAAFSKLWKHRREYVKTWWKPNGEMKGAVWLDKPTVNDSLS--S  130

Query  512   SSPPYRVSDNVSRVVEETNHVNPRVARMVHGIMETVRDAP-QRATGTLRWVVMGDDDTIF  688
             + P  R+S + S         +    R+   + +TVR      +   +RW+VMGDDDT+F
Sbjct  131   ALPEIRISSDTSSFKYRYRRGHRSAIRITRIVSDTVRMLKGTESERNVRWIVMGDDDTVF  190

Query  689   LVDNLVDVLAQYDHTKYYYLGGHSEFIHANNY--FSFKQAFGGGGIVLSFPLAMAMADGI  862
               +NLV VL +YDH ++YY+G  SE  H  N   FS+  A+GGGG  +S+PLA  +    
Sbjct  191   FPENLVRVLRKYDHKQFYYIGAPSE-SHLQNLQQFSYGMAYGGGGFAISYPLAKTLEKMQ  249

Query  863   MDCLKRYSHLNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHH  1042
               C++ YS L  +D     C+A+LGV L+   GFHQ D++G++ G LS HP AP++S+HH
Sbjct  250   DRCIESYSDLYGSDDRIHACMAELGVPLTREVGFHQFDVYGNLLGLLSVHPQAPIVSIHH  309

Query  1043  FDMVNPIFPSMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKI  1222
              D+V PIFP ++R ++    M +A  D   ++QQ +C+ R   W+ S++WGY+  I    
Sbjct  310   LDVVEPIFPKVDRVKAVERLMISAKLDSASLVQQSICYDRTNQWTMSISWGYTVQITRTY  369

Query  1223  MPRSYLQNPIETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVA  1402
             MP   ++ P  TF  W       N  F+ R  T TD C  P  F++      ++    V 
Sbjct  370   MPARMMEVPTRTFSDWHKRHDFNNLAFNTRPITYTD-CQRPRVFYMSRTLGDSSSSTTVT  428

Query  1403  TYRRSWRRGLPACFAGDGDQSADRISKIVVYSPVT--KPAKIGRSECCDVTIDSVDSESA  1576
              Y R      P C  G  D S   I++I V+      +  K  R +CC + + +    + 
Sbjct  429   EYLRHNELN-PNCEWGIPDPSD--INRIFVHKESNPDRWNKAPRRDCCRL-LPATKKGTM  484

Query  1577  VIKTRRCMADDIIA  1618
             +IK   C  D+I A
Sbjct  485   MIKVAPCENDEIAA  498



>ref|XP_011002626.1| PREDICTED: uncharacterized protein LOC105109578 isoform X2 [Populus 
euphratica]
Length=496

 Score =   264 bits (674),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 151/420 (36%), Positives = 224/420 (53%), Gaps = 18/420 (4%)
 Frame = +2

Query  353   PTNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRV  532
             PTN+SH++F + GS   W  R  Y   WW PN T GF+ L++   +       + P  +V
Sbjct  79    PTNISHILFCIGGSTATWRDRSLYSSVWWVPNVTRGFVWLEQNIDSNQTN--KNVPAVKV  136

Query  533   SD-NVSRVVEETNHVNPRVARMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVD  709
             S    +R    ++    R+AR++        D+ +     +RW VMGDDDT++  DNLV 
Sbjct  137   SSPEWTRFKYSSSRSAVRIARIIS-------DSVKLRLPDVRWFVMGDDDTVYYTDNLVS  189

Query  710   VLAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSH  889
             VL++YDH + +Y+GG+SE +  +   S+  AFGGGG  LS+PLA ++   +  CL RY +
Sbjct  190   VLSRYDHNQMWYIGGNSESVEQDVIHSYDMAFGGGGFALSYPLAESLVSILDGCLDRYYY  249

Query  890   LNSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFP  1069
                +D+    CI+++GV LS  +GFHQ D+ G   G L+ HP APL+SLHH D + P+FP
Sbjct  250   FYGSDQRIWACISEIGVPLSRERGFHQFDIRGSAYGLLAAHPLAPLVSLHHLDNLEPLFP  309

Query  1070  SMNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNP  1249
             + NR +S +    A   D PR+ QQ  C    R WS S+AWGY+  +Y  ++P   LQ P
Sbjct  310   NHNRIDSLKSINQAYRVDPPRIFQQTFCHDSKRKWSISIAWGYTVQLYPLLLPAKDLQTP  369

Query  1250  IETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRG  1429
              +TF+TW      P + F+ R     DPC  P  F LE   E  A   + ++Y+R     
Sbjct  370   EQTFKTWRSWSDGP-FTFNTRP-MEPDPCKRPVVFMLEQANEGDANGSL-SSYKRIVHEP  426

Query  1430  LPACFAGDGDQSADRISKIVVYSPVTKP---AKIGRSECCDV-TIDSVDSESAVIKTRRC  1597
                C      Q A  + +I+V S   +P    K  R  CC++    S+ + S  ++ RRC
Sbjct  427   GKTCETTKYAQ-AMSVQRILVSSLKMEPDYWKKAPRRYCCELMNKGSIKNGSMQLRIRRC  485



>ref|XP_008465293.1| PREDICTED: uncharacterized protein LOC103502944 [Cucumis melo]
Length=545

 Score =   265 bits (677),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 149/403 (37%), Positives = 214/403 (53%), Gaps = 21/403 (5%)
 Frame = +2

Query  356   TNLSHLVFGLLGSEKAWHHRRAYVESWWRPNATVGFLQLDKPPGAELLPWPPSSPPYRVS  535
             T L H+VFG+ GS   W  R+ Y++ WWRP  T G + LDK   A+        P  R+S
Sbjct  132   TQLKHIVFGIAGSSNLWVKRKEYIKLWWRPKETRGVVWLDKKVYAKR---NEGLPEIRIS  188

Query  536   DNVSRVVEETNHVNPRVA-RMVHGIMETVRDAPQRATGTLRWVVMGDDDTIFLVDNLVDV  712
              + SR  + TN    R A R+   + ET+R   +     +RW VMGDDDT+F+V+N+V V
Sbjct  189   GDTSRF-KYTNRQGQRSALRISRVVSETLRLGMK----DVRWFVMGDDDTVFMVENVVRV  243

Query  713   LAQYDHTKYYYLGGHSEFIHANNYFSFKQAFGGGGIVLSFPLAMAMADGIMDCLKRYSHL  892
             L++YDH ++YY+G  SE    N YFS+  A+GGGG  +S+PLA  +      C++RY  L
Sbjct  244   LSKYDHRQFYYIGSSSESHVQNIYFSYAMAYGGGGFAISYPLAKELEKMQDRCIQRYPGL  303

Query  893   NSADKTTGYCIADLGVNLSPHQGFHQIDMHGDISGFLSYHPNAPLISLHHFDMVNPIFPS  1072
               +D     C+A+LGV L+   GFHQ D++GD+ G L  HP  PL+SLHH D+V PIFP 
Sbjct  304   YGSDDRIQACMAELGVPLTREPGFHQYDVYGDLLGLLGAHPVTPLLSLHHLDVVEPIFPR  363

Query  1073  MNRAESARHFMAAANSDQPRMLQQLLCFHRPRNWSFSVAWGYSANIYEKIMPRSYLQNPI  1252
             M R  + +    ++N D   ++QQ +C+ + R WS SV+WGY   I   ++    L+ P 
Sbjct  364   MTRVRALQRLFQSSNLDSSSIMQQSICYDKKRYWSISVSWGYVVQILRGVISPRELEMPT  423

Query  1253  ETFQTWGPSPRPPNWIFDVRKRTTTDPCLVPHAFFLESVEEVTARDEIVATYRRSWRRGL  1432
              TF  W        + F+ R   T  PC  P  F++ +      + + V  Y R   R  
Sbjct  424   RTFLNWYRRADYTAYAFNTRP-VTKHPCQKPFIFYMGTTRYDRTKKQTVGVYIRDKSRH-  481

Query  1433  PACFAGDGDQSADRISKIVVYSPVTKP-----AKIGRSECCDV  1546
             P C       S D+I  I++   + KP      K  R +CC V
Sbjct  482   PFCRWKMS--SPDKIDSIII---LKKPDPYRWQKSPRRDCCRV  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5193175752787