BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20433_g1_i3 len=2177 path=[2155:0-1007 3163:1008-1099
3255:1100-1360 3516:1361-1534 3690:1535-1624 3780:1625-1626
3782:1627-2176]

Length=2177
                                                                      Score     E

gb|AAG24863.1|  CONSTANS-like protein                                   459   2e-151   Ipomoea nil [qian niu]
ref|XP_009630583.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     213   7e-58    
gb|AFY06686.1|  constans                                                213   7e-58    
gb|AEJ84000.1|  CONSTANS protein                                        211   3e-57    
emb|CDP02370.1|  unnamed protein product                                207   6e-56    
gb|AGC92992.1|  constans-like protein                                   203   1e-54    
gb|AGC92989.1|  constans-like protein                                   203   1e-54    
ref|XP_006338307.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    201   1e-54    
ref|XP_009765376.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     203   2e-54    
ref|NP_001233839.1|  CONSTANS 1                                         200   2e-53    
emb|CAP09655.1|  CONSTANS protein                                       198   1e-52    Solanum tuberosum subsp. andigenum
ref|NP_001274795.1|  CONSTANS                                           194   2e-51    
ref|XP_010029446.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     182   2e-47    
gb|KHG24977.1|  Zinc finger CONSTANS-LIKE 2 -like protein               182   2e-47    
ref|XP_002282509.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     182   2e-47    Vitis vinifera
gb|AAS67378.1|  CONSTANS 2                                              181   2e-47    Solanum lycopersicum
emb|CAN74840.1|  hypothetical protein VITISV_035527                     182   1e-46    Vitis vinifera
ref|XP_008230340.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     179   3e-46    
gb|ACJ06578.1|  CONSTANS                                                177   7e-46    Fragaria x ananassa
ref|XP_007215513.1|  hypothetical protein PRUPE_ppa007007mg             178   8e-46    
gb|AAS00054.1|  CONSTANS-like protein CO1                               179   8e-46    Populus deltoides
ref|XP_002532886.1|  zinc finger protein, putative                      177   1e-45    Ricinus communis
gb|AFK08986.1|  CO-like protein                                         175   3e-45    
gb|AIE41592.1|  zinc finger protein CONSTANS-LIKE 1                     175   8e-45    
gb|AEA50854.1|  col2a                                                   166   8e-45    
gb|AEK05655.1|  constans-1                                              172   1e-44    
gb|AEK05645.1|  constans-1                                              172   1e-44    
gb|AEK05663.1|  constans-1                                              172   1e-44    
gb|ABF56054.1|  CONSTANS                                                164   2e-44    Solanum demissum
ref|XP_004304173.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    172   2e-44    
gb|ABK95723.1|  unknown                                                 169   2e-44    Populus trichocarpa [western balsam poplar]
gb|ADL36677.1|  COL domain class transcription factor                   174   2e-44    
ref|XP_006373513.1|  hypothetical protein POPTR_0017s14410g             173   3e-44    
ref|XP_006373512.1|  CONSTANS-like protein CO2                          173   3e-44    
gb|AEA50853.1|  col2a                                                   168   4e-44    
gb|AEK05660.1|  constans-1                                              171   6e-44    
gb|AEK05644.1|  constans-1                                              171   6e-44    
ref|XP_009378312.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    172   8e-44    
ref|XP_011099077.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     170   1e-43    
ref|XP_010257847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     171   2e-43    
ref|XP_010525138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    171   2e-43    
ref|XP_008341828.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    171   2e-43    
ref|XP_006482341.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    170   2e-43    
gb|KDO58878.1|  hypothetical protein CISIN_1g017819mg                   170   3e-43    
ref|XP_006430882.1|  hypothetical protein CICLE_v10012022mg             170   4e-43    
gb|ADZ72833.1|  CONSTANS-like protein                                   170   5e-43    
ref|XP_011021143.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    171   6e-43    
ref|XP_009373735.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     170   6e-43    
gb|AFK08985.1|  CONSTANTS-like protein                                  169   7e-43    
ref|XP_008348263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    159   2e-42    
ref|XP_009378311.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    168   4e-42    
ref|XP_007139358.1|  hypothetical protein PHAVU_008G022800g             165   1e-41    
gb|ABO43724.1|  CONSTANS                                                162   2e-41    Solanum tuberosum [potatoes]
gb|KHN14463.1|  Zinc finger protein CONSTANS-LIKE 2                     157   2e-41    
ref|XP_002305307.1|  CONSTANS-like protein CO2                          164   3e-41    Populus trichocarpa [western balsam poplar]
ref|XP_006388756.1|  hypothetical protein POPTR_0105s00200g             155   5e-41    
gb|ACZ67162.1|  GATA-4/5/6 transcription factor                         155   7e-41    Populus nigra [black poplar]
gb|ACZ67160.1|  GATA-4/5/6 transcription factor                         155   1e-40    Populus balsamifera [balsam poplar]
gb|KDP24338.1|  hypothetical protein JCGZ_25634                         162   2e-40    
ref|XP_008379481.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     162   2e-40    
ref|XP_007032965.1|  Zinc finger protein CONSTANS-LIKE 2                162   4e-40    
ref|XP_010100899.1|  Zinc finger protein CONSTANS-LIKE 2                160   8e-40    
ref|NP_001235828.1|  CONSTANS-like 2a                                   159   1e-39    
ref|NP_001236860.1|  CONSTANS-like 2b                                   159   1e-39    
gb|AAS67379.1|  CONSTANS 3                                              160   1e-39    Solanum lycopersicum
ref|NP_001235843.1|  zinc finger protein CONSTANS-LIKE 2                159   2e-39    
gb|AEA50856.1|  col2b                                                   151   2e-39    
gb|ADO60999.1|  CONSTANS-like 2                                         158   5e-39    
gb|ADO60998.1|  CONSTANS-like 2                                         158   6e-39    
gb|AGM20690.1|  COL1-1                                                  157   1e-38    
ref|XP_004232119.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    157   3e-38    
gb|ACH47948.3|  constans-like protein                                   153   3e-37    Olea europaea
emb|CBI16899.3|  unnamed protein product                                154   4e-37    
gb|ACZ67161.1|  GATA-4/5/6 transcription factor                         145   6e-37    Populus deltoides
gb|ACB36912.1|  CONSTANS-like protein 2                                 151   7e-37    Oxybasis rubra [pigweed]
dbj|BAM67031.1|  constans-like 1                                        152   7e-37    
ref|XP_010261698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   8e-37    
ref|XP_006338763.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   1e-36    
gb|KEH21799.1|  zinc finger constans-like protein                       152   1e-36    
gb|AGF86398.1|  CONSTANS-like protein                                   152   1e-36    
gb|AAX47172.1|  CONSTANS-LIKE a                                         152   2e-36    Pisum sativum [garden pea]
gb|AAS00055.1|  CONSTANS-like protein CO2                               151   2e-36    Populus deltoides
gb|AHB64449.1|  CONSTANS-like protein                                   151   2e-36    
gb|AGM20665.1|  COL1-2                                                  149   5e-36    
ref|XP_010479901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   5e-36    
ref|XP_004137263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   5e-36    
ref|XP_010485482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     149   5e-36    
ref|XP_008455579.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     149   5e-36    
ref|XP_004491763.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   1e-35    
gb|ACV88633.1|  CONSTANS                                                148   1e-35    Magnolia virginiana [sweetbay]
gb|ABF17844.1|  CONSTANS                                                142   1e-35    Solanum tuberosum [potatoes]
ref|XP_010463643.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   2e-35    
ref|XP_010694604.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     148   2e-35    
ref|XP_011032791.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 2     148   2e-35    
gb|ACB36911.2|  CONSTANS-like protein 1                                 148   2e-35    Oxybasis rubra [pigweed]
ref|XP_010420262.1|  PREDICTED: zinc finger protein CONSTANS-like       147   5e-35    
ref|XP_004173366.1|  PREDICTED: zinc finger protein CONSTANS-like       140   5e-35    
ref|XP_010485483.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    146   6e-35    
ref|XP_010942234.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    145   7e-35    
gb|AFK29460.1|  putative flowering-time constans protein                144   4e-34    
ref|XP_003541197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   8e-34    
ref|XP_006400111.1|  hypothetical protein EUTSA_v10013895mg             143   9e-34    
gb|AEE42605.1|  CONSTANS-like 2                                         143   9e-34    
ref|XP_006400110.1|  hypothetical protein EUTSA_v10015486mg             143   1e-33    
ref|XP_011085568.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   1e-33    
gb|KFK25823.1|  hypothetical protein AALP_AA8G166000                    142   2e-33    
gb|AIE41593.1|  zinc finger protein CONSTANS-LIKE 2                     142   2e-33    
ref|XP_010929079.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   2e-33    
gb|AEN71141.1|  constans-like protein                                   142   3e-33    
gb|ABC69350.1|  constans-like                                           139   3e-33    Brassica napus [oilseed rape]
gb|AAP42647.1|  constans-like protein                                   140   6e-33    Brassica napus [oilseed rape]
emb|CDY26470.1|  BnaC09g41980D                                          139   9e-33    
ref|XP_002884316.1|  hypothetical protein ARALYDRAFT_477472             140   1e-32    
emb|CDX69493.1|  BnaA10g18420D                                          139   1e-32    
emb|CAL29796.1|  CONSTANS-like1 protein                                 139   1e-32    Brassica oleracea var. alboglabra
ref|NP_001031887.1|  zinc finger protein CONSTANS                       137   2e-32    Arabidopsis thaliana [mouse-ear cress]
ref|NP_186887.1|  zinc finger protein CONSTANS-LIKE 2                   139   2e-32    Arabidopsis thaliana [mouse-ear cress]
gb|AAN09822.1|  COL1 protein                                            139   3e-32    Brassica nigra
gb|ACF35243.1|  COL1                                                    138   3e-32    Brassica nigra
gb|ACF35247.1|  COL1                                                    138   3e-32    Brassica nigra
gb|ACF35236.1|  COL1                                                    138   3e-32    Brassica nigra
gb|ACF35231.1|  COL1                                                    138   3e-32    Brassica nigra
gb|AAN09820.1|  COL1 protein                                            138   3e-32    Brassica nigra
gb|AAN09846.1|  COL1 protein                                            138   3e-32    Brassica nigra
gb|AAN09841.1|  COL1 protein                                            138   3e-32    Brassica nigra
gb|ACF35240.1|  COL1                                                    138   3e-32    Brassica nigra
gb|ACF35226.1|  COL1                                                    138   3e-32    Brassica nigra
gb|ACF35232.1|  COL1                                                    138   3e-32    Brassica nigra
gb|AAN09819.1|  COL1 protein                                            138   3e-32    Brassica nigra
gb|AAN09848.1|  COL1 protein                                            138   3e-32    Brassica nigra
ref|XP_010492435.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   3e-32    
gb|ADO61520.1|  CONSTANS-like 2                                         134   3e-32    
gb|ACF35216.1|  COL1                                                    138   4e-32    Brassica nigra
gb|ADO61402.1|  CONSTANS-like 2                                         134   4e-32    
gb|ACF35206.1|  COL1                                                    138   4e-32    Brassica nigra
gb|ACF35220.1|  COL1                                                    138   4e-32    Brassica nigra
gb|AFK29462.1|  putative flowering-time constans protein                138   4e-32    
gb|ADO61412.1|  CONSTANS-like 2                                         134   4e-32    
gb|AEB35011.1|  CONSTANS-like 2                                         134   4e-32    
gb|ADO61529.1|  CONSTANS-like 2                                         134   4e-32    
gb|ADO61498.1|  CONSTANS-like 2                                         134   4e-32    
gb|AEB35009.1|  CONSTANS-like 2                                         134   4e-32    
gb|AAN09810.1|  COL1 protein                                            138   4e-32    Brassica nigra
gb|ADO61492.1|  CONSTANS-like 2                                         134   4e-32    
gb|AEB35034.1|  CONSTANS-like 2                                         134   4e-32    
gb|ADO61436.1|  CONSTANS-like 2                                         134   5e-32    
gb|ADO61511.1|  CONSTANS-like 2                                         134   5e-32    
gb|AEB34999.1|  CONSTANS-like 2                                         134   5e-32    
gb|AAN09838.1|  COL1 protein                                            138   5e-32    Brassica nigra
gb|ADO61521.1|  CONSTANS-like 2                                         134   5e-32    
gb|ACF35207.1|  COL1                                                    137   5e-32    Brassica nigra
gb|AAN09817.1|  COL1 protein                                            138   5e-32    Brassica nigra
gb|AAN09830.1|  COL1 protein                                            137   5e-32    Brassica nigra
gb|ACF35228.1|  COL1                                                    137   5e-32    Brassica nigra
gb|AAN09826.1|  COL1 protein                                            138   5e-32    Brassica nigra
gb|AAN09815.1|  COL1 protein                                            137   5e-32    Brassica nigra
gb|ADO61510.1|  CONSTANS-like 2                                         134   5e-32    
gb|ACF35229.1|  COL1                                                    137   5e-32    Brassica nigra
gb|ADO61447.1|  CONSTANS-like 2                                         134   5e-32    
gb|ACF35233.1|  COL1                                                    137   5e-32    Brassica nigra
gb|AAN09808.1|  COL1 protein                                            138   5e-32    Brassica nigra
gb|AAN09809.1|  COL1 protein                                            138   5e-32    Brassica nigra
gb|ACF35241.1|  COL1                                                    137   5e-32    Brassica nigra
gb|ACF35219.1|  COL1                                                    137   5e-32    Brassica nigra
gb|AAG27547.1|  constans-like protein                                   137   5e-32    Brassica nigra
gb|AAN09831.1|  COL1 protein                                            137   6e-32    Brassica nigra
ref|NP_197089.1|  zinc finger protein CONSTANS-LIKE 1                   138   6e-32    Arabidopsis thaliana [mouse-ear cress]
gb|AAN09828.1|  COL1 protein                                            137   6e-32    Brassica nigra
gb|AEB35017.1|  CONSTANS-like 2                                         134   6e-32    
gb|ADO61415.1|  CONSTANS-like 2                                         134   6e-32    
gb|ADO61463.1|  CONSTANS-like 2                                         134   6e-32    
gb|ABF82229.1|  constans-like 1 protein                                 137   7e-32    Brassica juncea [brown mustard]
gb|AEB35018.1|  CONSTANS-like 2                                         134   7e-32    
gb|AEB35039.1|  CONSTANS-like 2                                         133   7e-32    
ref|NP_197088.1|  zinc finger protein CONSTANS                          138   7e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121539.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   8e-32    
ref|XP_006299343.1|  hypothetical protein CARUB_v10015501mg             137   9e-32    
gb|AAN09813.1|  COL1 protein                                            136   1e-31    Brassica nigra
gb|AFK29459.1|  putative flowering-time constans protein                136   1e-31    
ref|XP_008783055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   2e-31    
ref|NP_001278944.1|  zinc finger protein CONSTANS-LIKE 2-like           136   2e-31    
gb|ADO61508.1|  CONSTANS-like 2                                         132   2e-31    
gb|ADO61401.1|  CONSTANS-like 2                                         132   2e-31    
gb|ADO61489.1|  CONSTANS-like 2                                         132   3e-31    
ref|XP_002873745.1|  hypothetical protein ARALYDRAFT_488432             135   3e-31    
gb|AEB35113.1|  CONSTANS-like 2                                         132   3e-31    
gb|AEB35007.1|  CONSTANS-like 2                                         132   3e-31    
gb|ADO61488.1|  CONSTANS-like 2                                         132   3e-31    
gb|AEB35013.1|  CONSTANS-like 2                                         132   3e-31    
gb|ADO61468.1|  CONSTANS-like 2                                         132   3e-31    
gb|AEB35008.1|  CONSTANS-like 2                                         132   3e-31    
ref|XP_006288045.1|  hypothetical protein CARUB_v10001279mg             135   3e-31    
gb|AGI62035.1|  CONSTANS-like 11                                        133   4e-31    
gb|ADO61495.1|  CONSTANS-like 2                                         132   4e-31    
ref|XP_010453736.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   4e-31    
gb|AEB35114.1|  CONSTANS-like 2                                         131   4e-31    
gb|AEB35014.1|  CONSTANS-like 2                                         131   4e-31    
gb|ADO61469.1|  CONSTANS-like 2                                         131   4e-31    
ref|XP_010420264.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    135   5e-31    
gb|ADO61400.1|  CONSTANS-like 2                                         131   5e-31    
gb|AEB35033.1|  CONSTANS-like 2                                         130   7e-31    
ref|XP_009126071.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   1e-30    
ref|XP_009394556.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   1e-30    
gb|AFK29461.1|  putative flowering-time constans protein                134   1e-30    
emb|CDX85529.1|  BnaA02g02840D                                          133   1e-30    
gb|AEB35030.1|  CONSTANS-like 2                                         129   2e-30    
gb|AEB34985.1|  CONSTANS-like 2                                         129   4e-30    
ref|XP_010453734.1|  PREDICTED: zinc finger protein CONSTANS-like       132   5e-30    
gb|AEB35029.1|  CONSTANS-like 2                                         128   5e-30    
gb|AEB35026.1|  CONSTANS-like 2                                         128   6e-30    
gb|AEA50855.1|  col2b                                                   129   7e-30    
gb|KFK37702.1|  hypothetical protein AALP_AA3G017800                    131   8e-30    
dbj|BAL41845.1|  CO                                                     126   1e-29    
gb|ADO61477.1|  CONSTANS-like 2                                         127   1e-29    
dbj|BAL41851.1|  CO                                                     125   2e-29    
ref|XP_010492434.1|  PREDICTED: zinc finger protein CONSTANS-like       130   2e-29    
gb|KFK25822.1|  coa                                                     131   2e-29    
gb|AEB35022.1|  CONSTANS-like 2                                         126   2e-29    
gb|AEB34994.1|  CONSTANS-like 2                                         126   2e-29    
ref|XP_008797568.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   2e-29    
gb|AEB34993.1|  CONSTANS-like 2                                         126   2e-29    
gb|AEB35025.1|  CONSTANS-like 2                                         126   3e-29    
dbj|BAI77474.1|  Zinc-finger type transcription factor                  130   3e-29    Phyllostachys edulis [kikko-chiku]
ref|XP_002873744.1|  hypothetical protein ARALYDRAFT_488429             130   3e-29    
gb|AEB34987.1|  CONSTANS-like 2                                         125   3e-29    
dbj|BAL41844.1|  CO                                                     125   3e-29    
gb|AEB34988.1|  CONSTANS-like 2                                         125   3e-29    
gb|ACJ66258.1|  constans-like protein                                   130   3e-29    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AEB35027.1|  CONSTANS-like 2                                         126   4e-29    
gb|AEB35036.1|  CONSTANS-like 2                                         125   4e-29    
gb|AEB35035.1|  CONSTANS-like 2                                         125   4e-29    
gb|AEB35043.1|  CONSTANS-like 2                                         125   4e-29    
gb|AEB35021.1|  CONSTANS-like 2                                         125   4e-29    
gb|ADO61503.1|  CONSTANS-like 2                                         125   5e-29    
gb|ADO61502.1|  CONSTANS-like 2                                         125   5e-29    
gb|AEB35023.1|  CONSTANS-like 2                                         125   5e-29    
dbj|BAL41841.1|  CO                                                     124   5e-29    
dbj|BAL41832.1|  CO                                                     124   5e-29    
dbj|BAL41833.1|  CO                                                     124   6e-29    
dbj|BAL41839.1|  CO                                                     124   6e-29    
gb|AAN09825.1|  COL1 protein                                            129   7e-29    Brassica nigra
dbj|BAL41865.1|  CO                                                     124   8e-29    
gb|AEP02829.1|  heading day 1                                           129   1e-28    
gb|AEB35038.1|  CONSTANS-like 2                                         124   2e-28    
ref|XP_006287957.1|  hypothetical protein CARUB_v10001192mg             128   2e-28    
gb|AEB35041.1|  CONSTANS-like 2                                         124   2e-28    
dbj|BAL41869.1|  CO                                                     122   2e-28    
dbj|BAL41877.1|  CO                                                     122   3e-28    
gb|AEB35042.1|  CONSTANS-like 2                                         123   3e-28    
gb|AEB35028.1|  CONSTANS-like 2                                         123   3e-28    
gb|AEB35037.1|  CONSTANS-like 2                                         123   3e-28    
gb|AGL61503.1|  constans-like protein                                   127   3e-28    
ref|XP_004965220.1|  PREDICTED: zinc finger protein HD1-like            127   4e-28    
dbj|BAL41876.1|  CO                                                     121   5e-28    
gb|AEP02828.1|  heading day 1                                           127   6e-28    
gb|AEP02811.1|  heading day 1                                           127   6e-28    
gb|ACF35197.1|  COb                                                     125   6e-28    Brassica nigra
gb|ACF35201.1|  COb                                                     125   6e-28    Brassica nigra
emb|CDX74261.1|  BnaA03g27860D                                          122   9e-28    
gb|KHN02659.1|  Zinc finger protein CONSTANS-LIKE 1                     122   1e-27    
gb|AFK31610.1|  Hd1                                                     126   1e-27    
gb|ADD60671.1|  putative heading date 1 protein                         125   2e-27    Oryza granulata
emb|CDX90969.1|  BnaC02g06280D                                          124   2e-27    
gb|AEB35032.1|  CONSTANS-like 2                                         120   2e-27    
gb|AEB35031.1|  CONSTANS-like 2                                         120   3e-27    
ref|XP_009134666.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   3e-27    
ref|XP_009418532.1|  PREDICTED: zinc finger protein HD1-like            123   3e-27    
gb|ACF35204.1|  COb                                                     124   3e-27    Brassica nigra
gb|ADI55328.1|  CONSTANS-like protein                                   124   4e-27    
gb|ACF35205.1|  COb                                                     123   4e-27    Brassica nigra
gb|ADD60697.1|  putative heading date 1 protein                         124   4e-27    Oryza officinalis
gb|ACF35199.1|  COb                                                     123   4e-27    Brassica nigra
gb|AEB35040.1|  CONSTANS-like 2                                         120   4e-27    
gb|AIP90463.1|  HD1                                                     124   6e-27    
gb|ADE32719.1|  putative constans-like protein                          123   7e-27    
dbj|BAI59738.1|  Heading date1                                          124   7e-27    Oryza longistaminata [long-staminate rice]
ref|XP_006844170.1|  hypothetical protein AMTR_s00006p00262710          123   7e-27    
gb|ADO61000.1|  CONSTANS-like 1                                         123   7e-27    
gb|ADE32725.1|  putative constans-like protein                          123   7e-27    
gb|ABK24894.1|  unknown                                                 121   8e-27    
gb|ADE32733.1|  putative constans-like protein                          123   8e-27    
gb|ADE32723.1|  putative constans-like protein                          123   8e-27    
gb|ADO61001.1|  CONSTANS-like 1                                         123   9e-27    
gb|AEB34990.1|  CONSTANS-like 2                                         119   9e-27    
gb|ACF35195.1|  COa                                                     122   9e-27    
gb|AEB34972.1|  CONSTANS-like 2                                         119   9e-27    
gb|AEB34890.1|  CONSTANS-like 2                                         119   9e-27    
gb|AEB34970.1|  CONSTANS-like 2                                         119   9e-27    
gb|ACF35158.1|  COa                                                     122   9e-27    
dbj|BAI59731.1|  Heading date1                                          121   1e-26    
gb|ACF35187.1|  COa                                                     122   1e-26    
gb|ACF35180.1|  COa                                                     122   1e-26    
gb|ACF35181.1|  COa                                                     122   1e-26    
gb|AFK31544.1|  Hd1                                                     123   1e-26    
gb|AEB34989.1|  CONSTANS-like 2                                         119   1e-26    
gb|ACF35176.1|  COa                                                     122   1e-26    
gb|ACF35196.1|  COa                                                     122   1e-26    
gb|AAG27546.1|  constans-like protein                                   122   1e-26    
gb|ACF35189.1|  COa                                                     122   1e-26    
gb|ACF35193.1|  COa                                                     122   1e-26    
gb|AFK31561.1|  Hd1                                                     123   1e-26    
gb|ACF35203.1|  COb                                                     122   1e-26    
gb|AIP90444.1|  HD1                                                     122   2e-26    
gb|AFK31535.1|  Hd1                                                     122   2e-26    
gb|ADD60684.1|  putative heading date 1 protein                         122   2e-26    
gb|AFK31568.1|  Hd1                                                     122   2e-26    
gb|ABR57243.1|  CONSTANS-like protein                                   122   2e-26    
gb|ADE32717.1|  putative constans-like protein                          122   2e-26    
gb|ABK24585.1|  unknown                                                 122   2e-26    
gb|ADE32721.1|  putative constans-like protein                          122   2e-26    
gb|AEK05666.1|  constans-2                                              120   2e-26    
gb|ADE32724.1|  putative constans-like protein                          122   2e-26    
ref|XP_009380766.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   2e-26    
gb|AEB34973.1|  CONSTANS-like 2                                         117   2e-26    
gb|AEK05679.1|  constans-2                                              120   3e-26    
gb|ACF35155.1|  COa                                                     120   3e-26    
gb|AEK05677.1|  constans-2                                              120   3e-26    
dbj|BAN00005.1|  heading date 1                                         121   3e-26    
gb|AEK05667.1|  constans-2                                              120   3e-26    
gb|AEK05686.1|  constans-2                                              120   3e-26    
gb|AEK05685.1|  constans-2                                              120   3e-26    
gb|ACF35148.1|  COa                                                     120   3e-26    
gb|AEP02821.1|  heading day 1                                           122   3e-26    
gb|AEK05684.1|  constans-2                                              120   4e-26    
gb|AEK05688.1|  constans-2                                              120   4e-26    
gb|AEK05669.1|  constans-2                                              120   4e-26    
gb|ACF35147.1|  COa                                                     120   4e-26    
dbj|BAN00006.1|  heading date 1                                         121   4e-26    
gb|AEK05673.1|  constans-2                                              120   4e-26    
gb|ADE32720.1|  putative constans-like protein                          121   4e-26    
gb|AFK31540.1|  Hd1                                                     121   4e-26    
gb|ADE32722.1|  putative constans-like protein                          121   4e-26    
gb|ACF35183.1|  COa                                                     120   5e-26    
gb|AFK31578.1|  Hd1                                                     121   5e-26    
gb|ACF35186.1|  COa                                                     120   5e-26    
gb|ACF35182.1|  COa                                                     120   5e-26    
gb|ADE32718.1|  putative constans-like protein                          121   5e-26    
dbj|BAJ53893.1|  Hd1 protein                                            121   5e-26    
gb|AFK31608.1|  Hd1                                                     121   5e-26    
gb|AEP02795.1|  heading day 1                                           121   5e-26    
gb|AFK31550.1|  Hd1                                                     121   5e-26    
gb|AIP90424.1|  HD1                                                     121   6e-26    
gb|AFK31554.1|  Hd1                                                     121   6e-26    
gb|AIP90426.1|  HD1                                                     121   6e-26    
gb|ADE32730.1|  putative constans-like protein                          120   6e-26    
gb|AIP90432.1|  HD1                                                     121   6e-26    
gb|AIP90449.1|  HD1                                                     120   6e-26    
gb|AFK31604.1|  Hd1                                                     121   6e-26    
gb|AEP02841.1|  heading day 1                                           120   6e-26    
gb|AFK31552.1|  Hd1                                                     121   6e-26    
gb|AFK31607.1|  Hd1                                                     120   6e-26    
gb|AFK31546.1|  Hd1                                                     120   6e-26    
dbj|BAI59737.1|  Heading date1                                          120   6e-26    
gb|AFK31579.1|  Hd1                                                     120   6e-26    
gb|AFK31606.1|  Hd1                                                     120   6e-26    
ref|XP_010548562.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 3     119   8e-26    
gb|AEK05668.1|  constans-2                                              119   8e-26    
gb|AEP02800.1|  heading day 1                                           121   8e-26    
gb|AFK31611.1|  Hd1                                                     120   8e-26    
gb|AEP02801.1|  heading day 1                                           120   8e-26    
gb|ACF35177.1|  COa                                                     119   9e-26    
gb|AEP02834.1|  heading day 1                                           120   9e-26    
gb|AIP90462.1|  HD1                                                     120   1e-25    
gb|AFK31555.1|  Hd1                                                     120   1e-25    
gb|AFK31551.1|  Hd1                                                     120   1e-25    
gb|AEP02797.1|  heading day 1                                           120   1e-25    
dbj|BAJ08369.1|  Hd1                                                    120   1e-25    
gb|AEP02789.1|  heading day 1                                           120   1e-25    
gb|AHA44836.1|  CONSTANS-like protein                                   120   1e-25    
ref|XP_003563958.1|  PREDICTED: zinc finger protein HD1                 120   1e-25    
dbj|BAJ08368.1|  Hd1                                                    120   1e-25    
gb|AIP90428.1|  HD1                                                     120   1e-25    
gb|AEP02848.1|  heading day 1                                           120   1e-25    
gb|AEP02853.1|  heading day 1                                           120   1e-25    
gb|AIP90443.1|  HD1                                                     120   1e-25    
gb|AFK31601.1|  Hd1                                                     120   1e-25    
gb|AEP02840.1|  heading day 1                                           120   1e-25    
gb|AIP90442.1|  HD1                                                     120   1e-25    
gb|AIP90425.1|  HD1                                                     120   1e-25    
gb|AEP02790.1|  heading day 1                                           120   1e-25    
gb|AIP90423.1|  HD1                                                     120   1e-25    
gb|AFK31625.1|  Hd1                                                     120   1e-25    
gb|AEP02816.1|  heading day 1                                           120   1e-25    
gb|AEP02807.1|  heading day 1                                           120   1e-25    
gb|AFK31624.1|  Hd1                                                     120   1e-25    
gb|AIP90438.1|  HD1                                                     120   1e-25    
gb|AIP90420.1|  HD1                                                     120   1e-25    
dbj|BAI59734.1|  Heading date1                                          120   1e-25    
gb|AFK31538.1|  Hd1                                                     120   1e-25    
gb|AEP02823.1|  heading day 1                                           120   1e-25    
gb|AFK31576.1|  Hd1                                                     120   1e-25    
ref|NP_001057378.1|  Os06g0275000                                       119   1e-25    
gb|AFK31566.1|  Hd1                                                     119   1e-25    
gb|AFK31549.1|  Hd1                                                     120   1e-25    
dbj|BAI59736.1|  Heading date1                                          120   1e-25    
gb|AFK31569.1|  Hd1                                                     120   1e-25    
gb|AIP90439.1|  HD1                                                     120   1e-25    
gb|AIP90429.1|  HD1                                                     120   1e-25    
gb|AEP02822.1|  heading day 1                                           120   1e-25    
gb|AIP90436.1|  HD1                                                     120   1e-25    
gb|AIP90435.1|  HD1                                                     120   1e-25    
gb|AEP02836.1|  heading day 1                                           120   1e-25    
gb|AEP02827.1|  heading day 1                                           120   1e-25    
gb|AEP02824.1|  heading day 1                                           120   1e-25    
gb|AEP02804.1|  heading day 1                                           120   1e-25    
gb|AEP02831.1|  heading day 1                                           120   1e-25    
gb|AFK31548.1|  Hd1                                                     119   1e-25    
gb|AEP02818.1|  heading day 1                                           120   1e-25    
gb|ABB17664.1|  Hd1                                                     119   1e-25    
gb|AFK31542.1|  Hd1                                                     119   1e-25    
dbj|BAI59726.1|  Heading date1                                          120   1e-25    
gb|AEP02803.1|  heading day 1                                           120   1e-25    
gb|ADO61358.1|  CONSTANS-like 1                                         114   1e-25    
gb|EEE65515.1|  hypothetical protein OsJ_20956                          119   1e-25    
dbj|BAI59727.1|  Heading date1                                          119   2e-25    
gb|AFK31575.1|  Hd1                                                     119   2e-25    
gb|AEP02825.1|  heading day 1                                           119   2e-25    
gb|AFK31600.1|  Hd1                                                     119   2e-25    
gb|AFK31536.1|  Hd1                                                     119   2e-25    
gb|AEP02791.1|  heading day 1                                           119   2e-25    
gb|ADO61376.1|  CONSTANS-like 1                                         114   2e-25    
gb|AFK31577.1|  Hd1                                                     119   2e-25    
gb|ADO61359.1|  CONSTANS-like 1                                         114   2e-25    
gb|AIP90415.1|  HD1                                                     119   2e-25    
gb|AFK31602.1|  Hd1                                                     119   2e-25    
gb|ADO61362.1|  CONSTANS-like 1                                         114   2e-25    
gb|AEP02839.1|  heading day 1                                           119   2e-25    
gb|ADO61323.1|  CONSTANS-like 1                                         114   2e-25    
gb|AFK31570.1|  Hd1                                                     119   2e-25    
gb|ADO61280.1|  CONSTANS-like 1                                         114   2e-25    
gb|AFK31541.1|  Hd1                                                     119   2e-25    
dbj|BAB17630.1|  unnamed protein product                                119   2e-25    
gb|AEP02820.1|  heading day 1                                           119   2e-25    
gb|ADO61364.1|  CONSTANS-like 1                                         113   2e-25    
gb|ADO61292.1|  CONSTANS-like 1                                         114   2e-25    
gb|AFK31573.1|  Hd1                                                     119   2e-25    
gb|AIP90403.1|  HD1                                                     119   2e-25    
gb|AEP02796.1|  heading day 1                                           120   2e-25    
gb|AFK31605.1|  Hd1                                                     119   2e-25    
dbj|BAJ08370.1|  Hd1                                                    120   2e-25    
gb|AFK31585.1|  Hd1                                                     119   2e-25    
gb|ADO61298.1|  CONSTANS-like 1                                         113   2e-25    
gb|AFK31553.1|  Hd1                                                     119   2e-25    
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   2e-25    
gb|AFK31609.1|  Hd1                                                     119   2e-25    
gb|AAC27696.1|  CONSTANS homolog                                        119   2e-25    
gb|AFK31537.1|  Hd1                                                     119   2e-25    
gb|ADO61394.1|  CONSTANS-like 1                                         113   2e-25    
ref|NP_001288811.1|  zinc finger protein CONSTANS-LIKE 2                117   3e-25    
gb|ACM69281.1|  constans                                                118   3e-25    
gb|AEP02793.1|  heading day 1                                           119   3e-25    
gb|ADO61340.1|  CONSTANS-like 1                                         113   3e-25    
gb|AFK31563.1|  Hd1                                                     119   3e-25    
ref|NP_973530.1|  zinc finger protein CONSTANS-LIKE 3                   115   3e-25    
gb|AEP02851.1|  heading day 1                                           119   3e-25    
gb|ADO61300.1|  CONSTANS-like 1                                         112   3e-25    
ref|XP_010047014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     118   3e-25    
gb|ADO61370.1|  CONSTANS-like 1                                         113   3e-25    
dbj|BAJ53890.1|  Hd1 protein                                            116   3e-25    
gb|ADO61336.1|  CONSTANS-like 1                                         112   3e-25    
gb|EEC80387.1|  hypothetical protein OsI_22512                          119   4e-25    
ref|XP_002436860.1|  hypothetical protein SORBIDRAFT_10g010050          118   4e-25    
gb|AFK31547.1|  Hd1                                                     118   4e-25    
gb|AEK05674.1|  constans-2                                              117   4e-25    
gb|AAC27695.1|  CONSTANS homolog                                        117   4e-25    
gb|AEK05675.1|  constans-2                                              116   5e-25    
ref|XP_009121540.1|  PREDICTED: zinc finger protein CONSTANS            117   5e-25    
dbj|BAB17631.1|  unnamed protein product                                115   6e-25    
gb|AFK31565.1|  Hd1                                                     117   6e-25    
gb|AFK31580.1|  Hd1                                                     117   7e-25    
ref|XP_011082019.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   7e-25    
ref|XP_002277953.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 5     117   7e-25    
gb|AFK31572.1|  Hd1                                                     117   7e-25    
gb|AFK31545.1|  Hd1                                                     117   7e-25    
dbj|BAO24101.1|  CONSTANS-like protein                                  116   9e-25    
dbj|BAI59735.1|  Heading date1                                          117   1e-24    
ref|XP_010913626.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     116   1e-24    
gb|AFK31626.1|  Hd1                                                     117   1e-24    
gb|AAT42130.1|  CONSTANS-like protein                                   117   1e-24    
ref|XP_003570457.1|  PREDICTED: zinc finger protein HD1-like            116   1e-24    
gb|AFK31574.1|  Hd1                                                     117   1e-24    
gb|ACC95130.1|  COL2                                                    116   1e-24    
gb|AIP90460.1|  HD1                                                     116   1e-24    
dbj|BAJ53891.1|  Hd1 protein                                            116   1e-24    
ref|XP_006845571.1|  hypothetical protein AMTR_s00019p00192190          116   1e-24    
dbj|BAJ53164.1|  JHL10I11.10                                            116   2e-24    
emb|CAL29797.1|  CONSTANS protein                                       116   2e-24    
ref|NP_180052.1|  zinc finger protein CONSTANS-LIKE 3                   115   2e-24    
emb|CAH55693.1|  putative Hd1-like protein                              116   2e-24    
emb|CDX91989.1|  BnaC03g32910D                                          113   2e-24    
dbj|BAB17629.1|  unnamed protein product                                115   2e-24    
gb|AAC35496.1|  CONSTANS-like 1 protein                                 115   2e-24    
gb|AAM62947.1|  zinc finger protein constans-like 8                     114   2e-24    
gb|AAT36322.1|  CONSTANS-like protein                                   115   2e-24    
gb|ACF35198.1|  COb                                                     115   2e-24    
gb|ACF81408.1|  unknown                                                 110   2e-24    
ref|XP_010928631.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   2e-24    
gb|ADA67904.1|  CONSTANS                                                115   2e-24    
ref|XP_006405043.1|  hypothetical protein EUTSA_v10000258mg             114   2e-24    
ref|XP_010692981.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 4     115   2e-24    



>gb|AAG24863.1| CONSTANS-like protein [Ipomoea nil]
Length=417

 Score =   459 bits (1181),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 297/297 (100%), Positives = 297/297 (100%), Gaps = 0/297 (0%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR
Sbjct  1     MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  60

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VHGANTVAGRHERVLVCEACESAPATVICKADAASLCAACDSDIHSANPLARRHHRVPIL
Sbjct  61    VHGANTVAGRHERVLVCEACESAPATVICKADAASLCAACDSDIHSANPLARRHHRVPIL  120

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLTQDAEETTMDEDEDEAASWLLLNP
Sbjct  121   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLTQDAEETTMDEDEDEAASWLLLNP  180

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
             NPNPNPNPVKSNNSTNMCKGGNNNNNEMSCAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ
Sbjct  181   NPNPNPNPVKSNNSTNMCKGGNNNNNEMSCAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  240

Query  1168  QQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAIFNCKEWNMRILTRDMV  1338
             QQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAIFNCKEWNMRILTRDMV
Sbjct  241   QQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAIFNCKEWNMRILTRDMV  297


 Score =   225 bits (573),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +2

Query  1601  WYIVILGYQ-VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQM  1777
             W + IL    VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQM
Sbjct  287   WNMRILTRDMVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQM  346

Query  1778  DREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLM  1957
             DREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLM
Sbjct  347   DREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLM  406

Query  1958  AESGYGIVPSF  1990
             AESGYGIVPSF
Sbjct  407   AESGYGIVPSF  417



>ref|XP_009630583.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nicotiana tomentosiformis]
Length=403

 Score =   213 bits (541),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 175/271 (65%), Gaps = 21/271 (8%)
 Frame = +1

Query  514   RSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
             +  +  NWA+VCD CRS AC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE 
Sbjct  4     KENSSNNWAKVCDTCRSTACTVYCRADSAYLCAGCDARIHAANLVASRHERVWVCEACER  63

Query  694   APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
             APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP  +     ++M+
Sbjct  64    APAAFLCKADAASLCASCDADIHSANPLARRHHRVPIMPIPGTLYGPPAVDTLSGGTLMI  123

Query  874   GLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstnmck  1044
             G     A ED+GFL+   +        ED+DEAASW            PVK+NN      
Sbjct  124   GGPEGDATEDDGFLSLTQDADDTTIDEEDKDEAASW-------LLLNLPVKNNNKNINNN  176

Query  1045  ggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSIN-QQQNYSVPQRNMSYRGDSI  1221
               N NN  M    E VD YLDLAE+    ++ F D+YS+N QQQNYSVPQ+N  Y GDS+
Sbjct  177   NNNQNNYGMLFGGEVVDEYLDLAEYGG--DSQFNDQYSVNQQQQNYSVPQKN--YGGDSV  232

Query  1222  VP---NHGKNQFHY---TQGLQQHNHHAIFN  1296
             VP     GK+   Y    Q  QQHNHH  F 
Sbjct  233   VPVQDRQGKSMILYQQQQQQQQQHNHHLSFQ  263


 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES LS+TS SH R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYREKKK RKFEKT
Sbjct  296   PESALSETSNSHPRLPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREKKKNRKFEKT  353

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+A+S YGIVPSF
Sbjct  354   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLIADSSYGIVPSF  403



>gb|AFY06686.1| constans [Nicotiana tabacum]
Length=403

 Score =   213 bits (541),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 175/271 (65%), Gaps = 21/271 (8%)
 Frame = +1

Query  514   RSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
             +  +  NWA+VCD CRS AC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE 
Sbjct  4     KENSSNNWAKVCDTCRSTACTVYCRADSAYLCAGCDARIHAANLVASRHERVWVCEACER  63

Query  694   APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
             APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP  +     ++M+
Sbjct  64    APAAFLCKADAASLCASCDADIHSANPLARRHHRVPIMPIPGTLYGPPAVDTLSGGTLMI  123

Query  874   GLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstnmck  1044
             G     A ED+GFL+   +        ED+DEAASW            PVK+NN      
Sbjct  124   GGPEGDATEDDGFLSLTQDADDTTIDEEDKDEAASW-------LLLNLPVKNNNKNINNN  176

Query  1045  ggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSIN-QQQNYSVPQRNMSYRGDSI  1221
               N NN  M    E VD YLDLAE+    ++ F D+YS+N QQQNYSVPQ+N  Y GDS+
Sbjct  177   NNNQNNYGMLFGGEVVDEYLDLAEYGG--DSQFNDQYSVNQQQQNYSVPQKN--YGGDSV  232

Query  1222  VP---NHGKNQFHY---TQGLQQHNHHAIFN  1296
             VP     GK+   Y    Q  QQHNHH  F 
Sbjct  233   VPVQDRQGKSMILYQQQQQQQQQHNHHLSFQ  263


 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES LS+TS SH R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYREKK+ RKFEKT
Sbjct  296   PESALSETSNSHPRLPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREKKRNRKFEKT  353

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+A+S YGIVPSF
Sbjct  354   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLIADSSYGIVPSF  403



>gb|AEJ84000.1| CONSTANS protein [Nicotiana tabacum]
Length=403

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 175/271 (65%), Gaps = 21/271 (8%)
 Frame = +1

Query  514   RSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
             +  +  NWA+VCD CRS AC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE 
Sbjct  4     KENSSNNWAKVCDTCRSTACTVYCRADSAYLCAGCDARIHAANLVASRHERVWVCEACER  63

Query  694   APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
             APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP  +     ++M+
Sbjct  64    APAAFLCKADAASLCASCDADIHSANPLARRHHRVPIMPIPGTLYGPPAVDTLSGGTLMI  123

Query  874   GLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstnmck  1044
             G     A ED+GFL+   +        ED+DEAASW            PVK+NN      
Sbjct  124   GGPEGDATEDDGFLSLTQDADDTTIDEEDKDEAASW-------LLLNLPVKNNNKNINNN  176

Query  1045  ggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSIN-QQQNYSVPQRNMSYRGDSI  1221
               N NN  M    E VD YLDLAE+    ++ F D+YS+N QQQNYSVPQ+N  Y GDS+
Sbjct  177   NNNQNNYGMLFGGEVVDEYLDLAEYGG--DSQFNDQYSVNQQQQNYSVPQKN--YGGDSV  232

Query  1222  VP---NHGKNQFHY---TQGLQQHNHHAIFN  1296
             VP     GK+   Y    Q  QQ+NHH  F 
Sbjct  233   VPVQDRQGKSMILYQQQQQQQQQYNHHLSFQ  263


 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES LS+TS SH R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYRE+K+ RKFEKT
Sbjct  296   PESALSETSNSHPRLPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREEKRNRKFEKT  353

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+A+S YGIVPSF
Sbjct  354   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLIADSSYGIVPSF  403



>emb|CDP02370.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   207 bits (526),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 169/238 (71%), Gaps = 18/238 (8%)
 Frame = +1

Query  520   GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
             G    WARVCD CRSAAC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE AP
Sbjct  10    GGANTWARVCDTCRSAACTVYCRADSAYLCTGCDARIHAANKVASRHERVWVCEACERAP  69

Query  700   ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGL  879
             A  +CKADAASLCAACDSDIHSANPLARRHHRVPILPI GTLYGPP ++P      M+G 
Sbjct  70    AAFLCKADAASLCAACDSDIHSANPLARRHHRVPILPIPGTLYGPPATDP---GGSMIGQ  126

Query  880   TGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnn  1059
               D  + D+GFLTQD +ET  + DEDEAASW           NPVK+N+  +     NN+
Sbjct  127   --DTEDADDGFLTQDVDETIDENDEDEAASW--------LLLNPVKNNSHHHHHHQNNNS  176

Query  1060  nnemscAVEAVDAYLDLAEFSSCHNNLFED--KYSINQQQNYSVPQRNMSYRGDSIVP  1227
             NN M    E VD YLDL E+SSC  N +    +YS NQQQ+Y+VPQ+  SY GDS+VP
Sbjct  177   NNNMLFGGEVVDEYLDLVEYSSCQENQYTSHHQYS-NQQQHYAVPQK--SYGGDSVVP  231


 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D GVVPEST+SD SISH R  KGTIDLF+ PPIQMP   QL+ MDREA+VLRYREKKKTR
Sbjct  281   DCGVVPESTMSDVSISHHRPPKGTIDLFASPPIQMP--QQLTPMDREAKVLRYREKKKTR  338

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+    LM ESGYGIVPSF
Sbjct  339   KFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMLSTALMVESGYGIVPSF  393



>gb|AGC92992.1| constans-like protein [Coffea arabica]
Length=392

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 169/238 (71%), Gaps = 19/238 (8%)
 Frame = +1

Query  520   GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
             G    WARVCD CRSAAC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE AP
Sbjct  10    GGANTWARVCDTCRSAACTVYCRADSAYLCTGCDARIHAANKVASRHERVWVCEACERAP  69

Query  700   ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGL  879
             A  +CKADAASLCAACDSDIHSANPLARRHHRVPILPI GTLYGPP ++P      M+G 
Sbjct  70    AAFLCKADAASLCAACDSDIHSANPLARRHHRVPILPIPGTLYGPPATDP---RGSMIG-  125

Query  880   TGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnn  1059
               D  + D+GFLTQD +ET  + DEDEAASW           NPVK+N+  +     N+N
Sbjct  126   -QDTEDADDGFLTQDVDETIDENDEDEAASW--------LLLNPVKNNSHHHHHHQNNSN  176

Query  1060  nnemscAVEAVDAYLDLAEFSSCHNNLFED--KYSINQQQNYSVPQRNMSYRGDSIVP  1227
             NN +    E VD YLDL E+SSC  N +    +YS NQQQ+Y+VPQ+  SY GDS+VP
Sbjct  177   NNMLFGG-EVVDEYLDLVEYSSCQENQYTSHHQYS-NQQQHYAVPQK--SYGGDSVVP  230


 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D GVVPEST+SD SISH R  KGTIDLF+ PPIQMP   QL+ MDREA+VLRYREKKKTR
Sbjct  280   DCGVVPESTMSDVSISHHRPPKGTIDLFASPPIQMP--QQLTPMDREAKVLRYREKKKTR  337

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+    LM ESGYGIVPSF
Sbjct  338   KFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMLSTALMVESGYGIVPSF  392



>gb|AGC92989.1| constans-like protein [Coffea arabica]
Length=392

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 169/238 (71%), Gaps = 19/238 (8%)
 Frame = +1

Query  520   GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
             G    WARVCD CRSAAC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE AP
Sbjct  10    GGANTWARVCDTCRSAACTVYCRADSAYLCTGCDARIHAANKVASRHERVWVCEACERAP  69

Query  700   ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGL  879
             A  +CKADAASLCAACDSDIHSANPLARRHHRVPILPI GTLYGPP ++P      M+G 
Sbjct  70    AAFLCKADAASLCAACDSDIHSANPLARRHHRVPILPIPGTLYGPPATDP---RGSMIG-  125

Query  880   TGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnn  1059
               D  + D+GFLTQD +ET  + DEDEAASW           NPVK+N+  +     N+N
Sbjct  126   -QDTEDADDGFLTQDVDETIDENDEDEAASW--------LLLNPVKNNSHHHHHHQNNSN  176

Query  1060  nnemscAVEAVDAYLDLAEFSSCHNNLFED--KYSINQQQNYSVPQRNMSYRGDSIVP  1227
             NN +    E VD YLDL E+SSC  N +    +YS NQQQ+Y+VPQ+  SY GDS+VP
Sbjct  177   NNMLFGG-EVVDEYLDLVEYSSCQENQYTSHHQYS-NQQQHYAVPQK--SYGGDSVVP  230


 Score =   161 bits (407),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D GVVPEST+SD SISH R  KGTIDLF+ PPIQMP   QL+ MDREA+VLRYREKKKTR
Sbjct  280   DCGVVPESTMSDVSISHHRPPKGTIDLFASPPIQMP--QQLTPMDREAKVLRYREKKKTR  337

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+    LM ESGYGIVPSF
Sbjct  338   KFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMLSTALMVESGYGIVPSF  392



>ref|XP_006338307.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
tuberosum]
Length=409

 Score =   201 bits (512),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 149/272 (55%), Positives = 172/272 (63%), Gaps = 19/272 (7%)
 Frame = +1

Query  505   SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
             SG   G+  NW+RVCD CRS AC+VYCR D  +LC GCDAR+H AN +A RHERV VCEA
Sbjct  7     SGGFDGSSNNWSRVCDSCRSTACTVYCREDSTFLCAGCDARMHAANLLASRHERVWVCEA  66

Query  685   CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
             C  APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP        S
Sbjct  67    CGRAPAAFLCKADAASLCASCDTDIHSANPLARRHHRVPIMPILGTLYGPPAVETVGSGS  126

Query  865   MMVGLTGDAAEEDNGFLtqdaeettmde-----dedeaaSWlllnpnpnpnpnpVKSnns  1029
             MM+G     + ED GFL+       M       DEDEAASWLLLNP         K+N +
Sbjct  127   MMIGGPTGESTEDYGFLSFTQNADDMTVDEEDEDEDEAASWLLLNPPVK------KNNKT  180

Query  1030  tnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSY  1206
              +      NNN  M    E VD YLDLAE+       F D+YS+NQQQ  YSVPQ+  SY
Sbjct  181   FDNDHNNQNNNYGMLFGREVVDDYLDLAEYGGVSQ--FNDQYSVNQQQQHYSVPQK--SY  236

Query  1207  RGDSIVP---NHGKNQFHYTQGLQQHNHHAIF  1293
             RGDS+VP     GK+   Y Q  QQ +HH  F
Sbjct  237   RGDSVVPVQEGQGKSLILYHQQQQQQSHHLNF  268


 Score = 41.6 bits (96),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NFQL GMEY+N+NT YGY A++SH+VS 
Sbjct  267   NFQL-GMEYDNYNTRYGYTATMSHSVSI  293


 Score =   140 bits (353),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDR  1783
             Y   + + VSISSMDV VVPES LS+TS SH R  KG IDLFSGPPIQ+PP  QL+ MDR
Sbjct  283   YTATMSHSVSISSMDVSVVPESALSETSNSHPRPPKGNIDLFSGPPIQIPPPPQLTPMDR  342

Query  1784  EARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAE  1963
             EARVLRYREKKK RKFEKTIRYASRK YAETRPRIKGRFAKRTDV  E DQ+    LMA+
Sbjct  343   EARVLRYREKKKNRKFEKTIRYASRKVYAETRPRIKGRFAKRTDV-AEADQMLSTQLMAD  401

Query  1964  SGYGIVPS  1987
               YGIVPS
Sbjct  402   RIYGIVPS  409



>ref|XP_009765376.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nicotiana sylvestris]
Length=406

 Score =   203 bits (517),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 168/254 (66%), Gaps = 18/254 (7%)
 Frame = +1

Query  514   RSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
             +  +  NWARVCD CRSAAC+VYCRAD AYLC GCDAR+H AN VA RHERV VCEACE 
Sbjct  4     KENSSNNWARVCDTCRSAACTVYCRADSAYLCAGCDARIHAANLVASRHERVWVCEACER  63

Query  694   APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
             APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP  +     ++M+
Sbjct  64    APAAFLCKADAASLCASCDADIHSANPLARRHHRVPIIPIPGTLYGPPAVDTLGGGTLMI  123

Query  874   GLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstnmck  1044
             G     A ED+ FL+            EDEDEAASWLLLNP    N   + +NN+     
Sbjct  124   GGPEGDATEDDRFLSLTQGADDTTIDEEDEDEAASWLLLNPPVKNNNKNINNNNNNQSNY  183

Query  1045  ggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSI  1221
             G            E VD YLDLAE+    ++ F D+YS+NQQQ  YSVPQ+N  Y GDS+
Sbjct  184   GMLFGG-------EVVDEYLDLAEYGG--DSQFNDQYSVNQQQQHYSVPQKN--YGGDSV  232

Query  1222  VP---NHGKNQFHY  1254
             VP    HGK+   Y
Sbjct  233   VPVQGGHGKSMILY  246


 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES LS+TS SH R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYREKKK RKFEKT
Sbjct  299   PESALSETSNSHPRPPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREKKKNRKFEKT  356

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+A+S YGIVPSF
Sbjct  357   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLIADSSYGIVPSF  406



>ref|NP_001233839.1| CONSTANS 1 [Solanum lycopersicum]
 gb|AAS67376.1| CONSTANS 1 [Solanum lycopersicum]
 gb|AAS67377.1| CONSTANS 1 [Solanum lycopersicum]
Length=391

 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 168/268 (63%), Gaps = 26/268 (10%)
 Frame = +1

Query  514   RSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
             +  N  NWARVCD C SA C+VYCRAD AYLC GCDAR+H A+ +A RHERV VCEACE 
Sbjct  3     KKENSNNWARVCDSCHSATCTVYCRADSAYLCAGCDARIHTASLMASRHERVWVCEACER  62

Query  694   APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
             APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GT+YGPP  +     SMM+
Sbjct  63    APAAFLCKADAASLCASCDADIHSANPLARRHHRVPIMPIPGTIYGPPAVHTITGGSMMI  122

Query  874   GLTGDAAEEDNGFLt---qdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmck  1044
             G T     ED+GFL+      + T  +EDEDEAASWLLLNP    N              
Sbjct  123   GGTTGEGTEDDGFLSLNQDADDTTIDEEDEDEAASWLLLNPPVKNNNKNNN---------  173

Query  1045  ggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSI  1221
                     M    E VD YLDLAE+    ++ F D+YS+NQQQ  YSVPQ+  SY  DS+
Sbjct  174   ------YGMLFGGEVVDDYLDLAEYGG--DSQFNDQYSVNQQQQHYSVPQK--SYVEDSV  223

Query  1222  VP---NHGKNQFHYTQGLQQHNHHAIFN  1296
             VP      K+   Y    QQ +HH  F 
Sbjct  224   VPVQNGQRKSLILYQTPQQQQSHHLNFQ  251


 Score =   160 bits (406),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDV VVPES  S+TS SH R  KGTIDLFSGPPIQ+PPQL  + MDREARVLRYREKKK 
Sbjct  278   MDVSVVPESAQSETSNSHPRPPKGTIDLFSGPPIQIPPQL--TPMDREARVLRYREKKKN  335

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM +S YGIVPSF
Sbjct  336   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLMTDSNYGIVPSF  391



>emb|CAP09655.1| CONSTANS protein [Solanum tuberosum subsp. andigenum]
Length=410

 Score =   198 bits (504),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 176/273 (64%), Gaps = 18/273 (7%)
 Frame = +1

Query  505   SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
             SG   G+  NWARVCD C SA C+VYCRAD AYLC GCD+R+H A+ +A RHERV VCEA
Sbjct  7     SGGFDGSSNNWARVCDSCHSATCTVYCRADSAYLCAGCDSRIHAASLMASRHERVWVCEA  66

Query  685   CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
             CE APA  +CKADAASLCA+CD+DIHSANPLARRHHRVPI+PI GTLYGPP  +     S
Sbjct  67    CERAPAAFLCKADAASLCASCDADIHSANPLARRHHRVPIMPIPGTLYGPPAVHTVSGGS  126

Query  865   MMVGLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstn  1035
             MM+G T     ED+GFL+   +        EDE+EAASWLLLNP    N     +NN+ N
Sbjct  127   MMIGGTTGEGTEDDGFLSLTQDADDTTIDEEDENEAASWLLLNPPVKNNNKNNINNNNNN  186

Query  1036  mckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRG  1212
                             E VD YLDLAE+    ++ F D+YS+NQQQ  YSVPQ+  SY  
Sbjct  187   QNNNYGMLFGG-----EVVDDYLDLAEYGG--DSQFNDQYSVNQQQQRYSVPQK--SYVE  237

Query  1213  DSIVP-NHGKNQ----FHYTQGLQQHNHHAIFN  1296
             DS+VP  +G+ +    +H  Q  QQ +HH  F 
Sbjct  238   DSVVPVQNGQRKSLILYHQPQQQQQQSHHLNFQ  270


 Score =   162 bits (410),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDV VVPES LS+TS SH R  KGTIDLFSGPPIQ+PPQL  + MDREARVLRYREKKK 
Sbjct  297   MDVSVVPESALSETSNSHPRPPKGTIDLFSGPPIQIPPQL--TPMDREARVLRYREKKKN  354

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM +S YGIVPSF
Sbjct  355   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLMTDSSYGIVPSF  410



>ref|NP_001274795.1| CONSTANS [Solanum tuberosum]
 gb|ABF56053.2| CONSTANS [Solanum tuberosum]
Length=413

 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 161/245 (66%), Gaps = 13/245 (5%)
 Frame = +1

Query  505   SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
             SG    +  NWARVCD C SA C+VYCRAD AYLC GCD+R+H A+ +A RHERV VCEA
Sbjct  7     SGGFDRSSNNWARVCDSCHSATCTVYCRADSAYLCAGCDSRIHAASLMASRHERVWVCEA  66

Query  685   CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
             CE APA  +CKADAASLCA+CD+ IHSANPLARRHHRVPI+PI GTLYGPP  +     S
Sbjct  67    CERAPAAFLCKADAASLCASCDAVIHSANPLARRHHRVPIMPIPGTLYGPPAVHTVSGGS  126

Query  865   MMVGLTGDAAEEDNGFLtqdaeettmd---ededeaaSWlllnpnpnpnpnpVKSnnstn  1035
             MM+G T     ED+GFL+   +        EDE+EAASWLLLNP    N     +NN+ N
Sbjct  127   MMIGGTTGEGTEDDGFLSLTQDADDTTIDEEDENEAASWLLLNPPVKNNNKNNINNNNNN  186

Query  1036  mckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRG  1212
                             E VD YLDLAE+    ++ F D+YS+NQQQ  YSVPQ+  SY  
Sbjct  187   QNNNYGMLFGG-----EVVDEYLDLAEYGG--DSQFNDQYSVNQQQQHYSVPQK--SYVE  237

Query  1213  DSIVP  1227
             DS+VP
Sbjct  238   DSVVP  242


 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDV VVPES LS+TS SH R  KGTIDLFSGPPIQ+PPQL  + MDREARVLRYREKKK 
Sbjct  300   MDVSVVPESALSETSNSHPRPPKGTIDLFSGPPIQIPPQL--TPMDREARVLRYREKKKN  357

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV  EVDQ+F   LM +S YGIVPSF
Sbjct  358   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVKAEVDQMFSTQLMTDSSYGIVPSF  413



>ref|XP_010029446.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Eucalyptus grandis]
 gb|KCW56361.1| hypothetical protein EUGRSUZ_I02094 [Eucalyptus grandis]
Length=387

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 123/159 (77%), Gaps = 6/159 (4%)
 Frame = +2

Query  1514  PVSPSGIKVCNFP*RLIMMLKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSIS  1693
             P+  S  +  NF     + L  + ++A N Y   L + VSISSMDVG+VPEST +D SIS
Sbjct  235   PIQHSDCQRHNFQ----LNLDYEPSKAANSYTRSLSHTVSISSMDVGIVPESTPTDISIS  290

Query  1694  HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAE  1873
             H R  KGTIDLFSGPPIQMP QL  S MDREARVLRYREKKKTRKFEKTIRYASRKAYAE
Sbjct  291   HPRPPKGTIDLFSGPPIQMPSQL--SPMDREARVLRYREKKKTRKFEKTIRYASRKAYAE  348

Query  1874  TRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             TRPRIKGRFAKRTDVD EVDQ+F A LM E+ YGIVPSF
Sbjct  349   TRPRIKGRFAKRTDVDIEVDQMFSATLMTENAYGIVPSF  387


 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 157/254 (62%), Gaps = 40/254 (16%)
 Frame = +1

Query  535   WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
             WARVCD CRSAAC+VYCRADLAYLC  CDAR+H AN VA RHERV VCEACE APA  +C
Sbjct  22    WARVCDTCRSAACTVYCRADLAYLCSSCDARIHAANRVASRHERVWVCEACERAPAAFLC  81

Query  715   KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVG--LTGD  888
             KADAASLC ACD+DIHSANPLARRHHRVPILPISG L+GP   N        VG  + G 
Sbjct  82    KADAASLCTACDADIHSANPLARRHHRVPILPISGCLHGPLAGN--------VGGPVMGH  133

Query  889   AAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnne  1068
             AA+ + GFL  + EE   +ED+DEAASW           NPVKSNNS             
Sbjct  134   AADTEEGFLAPEDEEAIDEEDDDEAASW--------LLINPVKSNNSHTNGFIFGGE---  182

Query  1069  mscAVEAVDAYLDLAEFSSCHNNLFEDKYS---------INQQQNYSVPQRNMSYRGDSI  1221
                    V+ YLDL E++S   N + D+Y+           QQQ+Y V ++N  Y GDS+
Sbjct  183   -------VEDYLDLVEYNSGAENQYVDQYNQHQQQQQQQQQQQQHYGVSRKN--YGGDSV  233

Query  1222  VP-NHGKNQFHYTQ  1260
             VP  H   Q H  Q
Sbjct  234   VPIQHSDCQRHNFQ  247



>gb|KHG24977.1| Zinc finger CONSTANS-LIKE 2 -like protein [Gossypium arboreum]
Length=374

 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 154/250 (62%), Gaps = 33/250 (13%)
 Frame = +1

Query  511   SRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACE  690
             S +G   +WARVCD CRSAAC+VYCRAD AYLC GCDARVH AN VA RHERV VCE CE
Sbjct  7     SDAGGGNDWARVCDTCRSAACTVYCRADSAYLCAGCDARVHAANRVASRHERVWVCEVCE  66

Query  691   SAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP-PTSNPCRESSM  867
              APA ++CKADAASLC  CD++IHSANPLARRH RVPILPISG LYGP PT + CR+   
Sbjct  67    RAPAALLCKADAASLCTTCDAEIHSANPLARRHQRVPILPISGCLYGPLPTDHGCRK---  123

Query  868   MVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckg  1047
                    A E ++GF+     + T+ EDEDEAASW                         
Sbjct  124   ----MASATETEDGFM-CTNGDETIAEDEDEAASW------------------LLLNPGK  160

Query  1048  gnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP  1227
              + N N        VD YLDL E++S   N F D++   QQQ+Y VP +  SY GDS+VP
Sbjct  161   NSTNQNNGFMLAGEVDDYLDLVEYNSSVENQFTDQH---QQQHYGVPHK--SYGGDSVVP  215

Query  1228  -NHGKNQFHY  1254
                G+ + H+
Sbjct  216   VQSGEAKDHF  225


 Score =   159 bits (401),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 4/121 (3%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SS+DVG+VPEST+SD SISH+R  KGTIDLFSGPP QMP   QL+ M+REARVLRYR
Sbjct  258   VSLSSVDVGIVPESTMSDISISHTRPPKGTIDLFSGPPTQMP--TQLAPMEREARVLRYR  315

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKKTRKFEKTIRYASRKAYAE RPRIKGRFAKRTD + EVDQ+F   ++  +GYGIVPS
Sbjct  316   EKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDAEVEVDQMFSTTVI--TGYGIVPS  373

Query  1988  F  1990
             F
Sbjct  374   F  374



>ref|XP_002282509.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Vitis vinifera]
Length=391

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 158/232 (68%), Gaps = 27/232 (12%)
 Frame = +1

Query  541   RVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKa  720
             RVCD CRSAAC++YCRAD AYLC GCDAR+H AN VA +HERV VCE+CE APA  +CKA
Sbjct  21    RVCDTCRSAACTIYCRADSAYLCAGCDARIHAANRVASQHERVWVCESCERAPAAFVCKA  80

Query  721   daaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEE  900
             DAASLCA CD+DIHSANPLARRHHRVP+LPI+G LYGPP ++P         +   AAE 
Sbjct  81    DAASLCATCDADIHSANPLARRHHRVPVLPIAGCLYGPPATDPGGT------VVRSAAEA  134

Query  901   DNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnemscA  1080
             DNGFL Q+AEET  +EDEDEAASWLLLNP  N N +    NN                  
Sbjct  135   DNGFLGQEAEETIDEEDEDEAASWLLLNPVKNNNGSSNNQNNGLLFGGE-----------  183

Query  1081  VEAVDAYLDLAEFSSCHNNLFEDKYSINQQQ---NYSVPQRNMSYRGDSIVP  1227
                VD YLDL E++SC  N F D+Y  NQQQ   +YSVP +N  Y GD +VP
Sbjct  184   ---VDEYLDLVEYNSCPENQFSDQY--NQQQPPPHYSVPHKN--YGGDRVVP  228


 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 96/110 (87%), Gaps = 4/110 (4%)
 Frame = +2

Query  1667  STLSDTSIS--HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             +T+SD SIS  H R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYREKKKTRKFEKT
Sbjct  284   TTMSDISISISHPRPPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREKKKTRKFEKT  341

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LMAESGYGIVPSF
Sbjct  342   IRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTLMAESGYGIVPSF  391



>gb|AAS67378.1| CONSTANS 2 [Solanum lycopersicum]
Length=341

 Score =   181 bits (459),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 167/270 (62%), Gaps = 16/270 (6%)
 Frame = +1

Query  505   SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
             SG   G++ NW+RVCD CRS AC+VYCRAD ++LC GCD R+H AN +A RH+RV +CEA
Sbjct  7     SGVFYGSRNNWSRVCDSCRSTACAVYCRADSSFLCAGCDTRMHAANLLASRHKRVWICEA  66

Query  685   CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
             CE +PA  +CKADAASLC +CD+DIHSA+PLA RHHRVPI+ I G+LYGPP        S
Sbjct  67    CERSPAAFLCKADAASLCTSCDADIHSASPLACRHHRVPIMTILGSLYGPPAVETIGSGS  126

Query  865   MMVGLTGDAAEEDNGFLtqdaeettmdeded---eaaSWlllnpnpnpnpnpVKSnnstn  1035
             +M+G       ED GFL+       M  +E+   EAASWLLLNP    N      N++ +
Sbjct  127   IMIGGPTGEKPEDYGFLSFTQNADDMTVNEEDEDEAASWLLLNPPVKKNNKNNFDNDNND  186

Query  1036  mckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQ-NYSVPQRNMSYRG  1212
                             E VD YLDLAE+    ++ F D+Y +NQQQ +YSVPQ+  SY G
Sbjct  187   QNNNYGTLFGG-----EVVDDYLDLAEYGG--DSQFNDQYGVNQQQHHYSVPQK--SYHG  237

Query  1213  DSIVP---NHGKNQFHYTQGLQQHNHHAIF  1293
             DS+VP     GK+   Y Q  QQ  HH  F
Sbjct  238   DSVVPVQEGQGKSLILYNQQQQQQIHHLNF  267


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQL  1762
             LG +V ISSMDV V+PES LS+TS SH R  KG +DLF GPPIQ+PP L
Sbjct  269   LGMEVPISSMDVSVIPESALSETSNSHLRPPKGNMDLFLGPPIQIPPSL  317



>emb|CAN74840.1| hypothetical protein VITISV_035527 [Vitis vinifera]
Length=449

 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 157/232 (68%), Gaps = 27/232 (12%)
 Frame = +1

Query  541   RVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKa  720
             RVCD CRSAAC++YCRAD AYLC GCDAR+H AN VA +HERV VCE+CE APA  +CKA
Sbjct  21    RVCDTCRSAACTIYCRADSAYLCAGCDARIHAANRVASQHERVWVCESCERAPAAFVCKA  80

Query  721   daaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEE  900
             DAASLCA CD+DIHSANPLARRHHRVP LPI+G LYGPP ++P         +   AAE 
Sbjct  81    DAASLCATCDADIHSANPLARRHHRVPXLPIAGCLYGPPATDPGGT------VVRSAAEA  134

Query  901   DNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnemscA  1080
             DNGFL Q+AEET  +EDEDEAASWLLLNP  N N +    NN                  
Sbjct  135   DNGFLGQEAEETIDEEDEDEAASWLLLNPVKNNNGSSNNQNNGLLFGGE-----------  183

Query  1081  VEAVDAYLDLAEFSSCHNNLFEDKYSINQQQ---NYSVPQRNMSYRGDSIVP  1227
                VD YLDL E++SC  N F D+Y  NQQQ   +YSVP +N  Y GD +VP
Sbjct  184   ---VDEYLDLVEYNSCPENQFSDQY--NQQQPPPHYSVPHKN--YGGDXVVP  228


 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 109/125 (87%), Gaps = 5/125 (4%)
 Frame = +2

Query  1625  QVSISSMDVGVVPE-STLSDTSIS--HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
              VS+SSMDVGVVPE +T+SD SIS  H R  KGTIDLFSGPPIQMP   QL+ MDREARV
Sbjct  327   HVSVSSMDVGVVPEATTMSDISISISHPRPPKGTIDLFSGPPIQMP--TQLTPMDREARV  384

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LMAESGYG
Sbjct  385   LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTLMAESGYG  444

Query  1976  IVPSF  1990
             IVPSF
Sbjct  445   IVPSF  449



>ref|XP_008230340.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Prunus mume]
Length=386

 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 154/290 (53%), Positives = 185/290 (64%), Gaps = 38/290 (13%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEES             +G+ + N  NWARVCD CRSAAC+VYCRAD AYLC GCDA 
Sbjct  1     MLKEES-------------NGAATTN--NWARVCDTCRSAACTVYCRADSAYLCSGCDAT  45

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             +H AN VA RHERV VCEACE APA  +CKADAASLC ACD+DIHSANPLARRH RVPIL
Sbjct  46    IHAANRVASRHERVWVCEACEQAPAAFLCKADAASLCTACDADIHSANPLARRHQRVPIL  105

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG LYGP  ++P     + VG    AAE ++GFL+Q+ +ET  +EDEDEAASWLLLNP
Sbjct  106   PISGCLYGPQATDP---GGIEVG--SAAAETEDGFLSQEGDETIDEEDEDEAASWLLLNP  160

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEF-SSCHN-NLFED----  1149
               N N N   +          NN +N     VE VD YLDL E+ SSC + N F D    
Sbjct  161   MKNNNNNCNNN----------NNQSNGFFFGVE-VDEYLDLVEYNSSCGDQNQFTDHHQH  209

Query  1150  -KYSINQQQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAIFN  1296
              +    QQQ+Y VP  + +Y GDS+VP   + Q  +  GL+  +  A ++
Sbjct  210   NQQQEQQQQHYGVPVPHKNYGGDSVVPVQMQKQSFHQLGLEYESSKAAYS  259


 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +2

Query  1565  MMLKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPI  1744
             + L+ + ++A   Y   L   VS+SSMDVGVVP+ST+SD SISH R  KGTIDLFSGPPI
Sbjct  247   LGLEYESSKAAYSYNGSLSNTVSVSSMDVGVVPDSTMSDISISHPRTPKGTIDLFSGPPI  306

Query  1745  QMPPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDT  1924
             QMP QL  S +DREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+++ 
Sbjct  307   QMPSQL--SPLDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTEMEV  364

Query  1925  EVDQIFYAPLMAESGYGIVPSF  1990
             EVDQ+F   LMAE+GYGIVPSF
Sbjct  365   EVDQMFSTTLMAENGYGIVPSF  386



>gb|ACJ06578.1| CONSTANS [Fragaria x ananassa]
Length=384

 Score =   177 bits (449),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 168/282 (60%), Gaps = 38/282 (13%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEES             +G+ + N  +WARVCD CRSA C+VYCRAD AYLC GCDA 
Sbjct  1     MLKEES-------------NGAAAAN--SWARVCDTCRSAPCTVYCRADSAYLCSGCDAT  45

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             +H AN VA RHERV VCEACE APA  +CKADAASLC ACD+DIHSANPLARRH RVPIL
Sbjct  46    IHAANRVASRHERVSVCEACERAPAAFLCKADAASLCTACDADIHSANPLARRHQRVPIL  105

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG          C+   +MVG T     ED     +  EE   +EDEDEAASW     
Sbjct  106   PISG----------CQ---IMVGSTPADTTEDGFLSQEGDEEVMDEEDEDEAASW-----  147

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
                   NPVK++N+ N      NNNN        VD YLDL E++S   N F    + N 
Sbjct  148   ---LLLNPVKNSNNHNSNNNNPNNNNNGFLFGVEVDEYLDLVEYNSSDQNQFSGTTATND  204

Query  1168  QQNYSVPQRNMSYRGDSIVP-NHGKNQFHYTQGLQQHNHHAI  1290
             Q NY VP + +SY GDS+VP  +G+ +    Q  Q+HN H +
Sbjct  205   QHNYGVPHK-ISYGGDSVVPVQYGEGKVTQMQMQQKHNFHQL  245


 Score = 37.0 bits (84),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NF   GMEYE+    YGY  SISHTVS 
Sbjct  241   NFHQLGMEYESSKAAYGYDGSISHTVSV  268


 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  1571  LKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQM  1750
             ++ + ++A   Y   + + VS+SSMDVGVVP+ST+S+ S+ H R  KGTIDLF+GP IQM
Sbjct  247   MEYESSKAAYGYDGSISHTVSVSSMDVGVVPDSTMSEMSVCHPRTPKGTIDLFNGPTIQM  306

Query  1751  PPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEV  1930
             P   QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTD++ EV
Sbjct  307   P--TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVEV  364

Query  1931  DQIFYAPLMAESGYGIVPSF  1990
             DQ+F   LM E+GYGIVPS+
Sbjct  365   DQMFSTSLMGETGYGIVPSY  384



>ref|XP_007215513.1| hypothetical protein PRUPE_ppa007007mg [Prunus persica]
 gb|EMJ16712.1| hypothetical protein PRUPE_ppa007007mg [Prunus persica]
Length=386

 Score =   178 bits (451),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 175/263 (67%), Gaps = 23/263 (9%)
 Frame = +1

Query  529   QNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATV  708
             +NWARVCD CRSAAC+VYCRAD AYLC GCDA +H AN VA RHERV VCEACE APA  
Sbjct  13    KNWARVCDTCRSAACTVYCRADSAYLCSGCDATIHAANRVASRHERVWVCEACEQAPAAF  72

Query  709   ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
             +CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYGP  ++P     ++VG    
Sbjct  73    LCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLYGPQATDP---GEIVVGAA--  127

Query  889   AAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnne  1068
             AAE ++G L+Q+ +ET  +EDEDEAASWLLLNP  N N N   +          NN +N 
Sbjct  128   AAETEDGLLSQEGDETIDEEDEDEAASWLLLNPMKNNNNNCNNN----------NNQSNG  177

Query  1069  mscAVEAVDAYLDLAEF-SSCHN-NLFED-----KYSINQQQNYSVPQRNMSYRGDSIVP  1227
                 VE VD YLDL E+ SSC + N F D     +    QQQ+Y VP  + +Y GDS+VP
Sbjct  178   FFFGVE-VDEYLDLVEYNSSCGDQNQFTDHHQSNQQQEQQQQHYGVPVPHKNYGGDSVVP  236

Query  1228  NHGKNQFHYTQGLQQHNHHAIFN  1296
                + Q  +  GL+  +  A ++
Sbjct  237   VQMQKQSFHQLGLEYESSKAAYS  259


 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  1571  LKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQM  1750
             L+ + ++A   Y   L   VS+SSMDVGVVP+ST+SD SISH R  KGTIDLFSGPPIQM
Sbjct  249   LEYESSKAAYSYNGSLSNTVSVSSMDVGVVPDSTMSDISISHPRTPKGTIDLFSGPPIQM  308

Query  1751  PPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEV  1930
             P QL  S +DREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+++ EV
Sbjct  309   PSQL--SPLDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTEMEVEV  366

Query  1931  DQIFYAPLMAESGYGIVPSF  1990
             DQ+F   LMAE+GYGIVPSF
Sbjct  367   DQMFSTTLMAENGYGIVPSF  386



>gb|AAS00054.1| CONSTANS-like protein CO1 [Populus deltoides]
Length=422

 Score =   179 bits (453),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 162/257 (63%), Gaps = 36/257 (14%)
 Frame = +1

Query  484   DVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHE  663
             +V +   SG   G   NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHE
Sbjct  49    EVMLKEESGGSGGVVNNWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHE  108

Query  664   RVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTS  843
             RV VCEACE APA ++CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG    
Sbjct  109   RVRVCEACERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG----  164

Query  844   NPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSn  1023
                      VG    A E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N       
Sbjct  165   -------TQVGPA--AGETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGF  215

Query  1024  nstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMS  1203
                                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++  
Sbjct  216   LFGGE-----------------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG  255

Query  1204  YRGDSIVP-NHGKNQFH  1251
               GDS+VP  +G+ + H
Sbjct  256   --GDSVVPIQYGEGKDH  270


 Score =   173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  AS+GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  304   VSMSSMDVGVVPESAMSEISISHQSASRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  361

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVPS
Sbjct  362   EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVPS  421

Query  1988  F  1990
             F
Sbjct  422   F  422



>ref|XP_002532886.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF29491.1| zinc finger protein, putative [Ricinus communis]
Length=378

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = +2

Query  1565  MMLKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPI  1744
             + L+ + ++A   Y   + + VSIS MDVGVVP+ST+S+ SISH R  KGTIDLFSGPPI
Sbjct  239   LGLEFESSKAAYSYNGSISHSVSISPMDVGVVPDSTMSEASISHPRPPKGTIDLFSGPPI  298

Query  1745  QMPPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDT  1924
             QMP QL  S  DREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ 
Sbjct  299   QMPSQL--SPRDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEV  356

Query  1925  EVDQIFYAPLMAESGYGIVPSF  1990
             EVDQIF   LMAE+GYGIVPSF
Sbjct  357   EVDQIFSTALMAETGYGIVPSF  378


 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 130/264 (49%), Positives = 161/264 (61%), Gaps = 37/264 (14%)
 Frame = +1

Query  535   WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
             WARVCD CR+AAC+VYC+AD AYLC  CDAR+H AN VA RH RV VCEACE APA  +C
Sbjct  15    WARVCDTCRAAACTVYCKADSAYLCATCDARIHAANRVASRHGRVWVCEACERAPAAFLC  74

Query  715   KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
             KADAASLCA CD+DIHSANPLARRH RVPI PISG L+GP         +  VG  G+  
Sbjct  75    KADAASLCATCDADIHSANPLARRHQRVPIHPISGCLHGP--------QAGPVGGGGETT  126

Query  895   EEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnems  1074
              ED  F+T+D E+   +E+EDEAASW           NPVK+ NS N    G     E  
Sbjct  127   TEDM-FMTEDGEDGVGEEEEDEAASW--------LLLNPVKNGNSQNNGTNGFLFGGE--  175

Query  1075  cAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP---------  1227
                  V+ YLDL E++S  N+  E++Y+ N  Q+YS      S+ GDS+VP         
Sbjct  176   -----VEEYLDLFEYNS--NSCGENQYADN-HQHYSGTVHQKSHEGDSVVPVRCGDGAGK  227

Query  1228  NHGKNQFHYTQ-GLQQHNHHAIFN  1296
             +H   Q+H  Q GL+  +  A ++
Sbjct  228   DHVHQQYHNFQLGLEFESSKAAYS  251



>gb|AFK08986.1| CO-like protein [Fragaria x ananassa]
Length=382

 Score =   175 bits (443),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 169/282 (60%), Gaps = 40/282 (14%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEES             +G+ + N  +WARVCD CRSA C+VYCRAD AYLC GCDA 
Sbjct  1     MLKEES-------------NGAAAAN--SWARVCDTCRSAPCTVYCRADSAYLCSGCDAT  45

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RHERV VCEACESAPA+ +CKADAASLC ACD+DIHSANPLARRH RVPIL
Sbjct  46    VHAANRVASRHERVSVCEACESAPASFLCKADAASLCTACDADIHSANPLARRHQRVPIL  105

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG               +MVG T     ED     +  EE   +EDEDEAASWLLLNP
Sbjct  106   PISG-------------GQIMVGSTPADTTEDGFLSQEGDEEAVDEEDEDEAASWLLLNP  152

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
               N N +   S          + NNN     VE VD YLD  E++S   N F    + N 
Sbjct  153   VKNSNNHNSNS---------NDPNNNGFFFGVE-VDEYLDFVEYNSSDQNQFSGTTATND  202

Query  1168  QQNYSVPQRNMSYRGDSIVP-NHGKNQFHYTQGLQQHNHHAI  1290
             + NY VP + +SY GDS+VP  +G+ +    Q  Q+HN H +
Sbjct  203   RHNYGVPHK-ISYGGDSVVPVQYGEGKVTQMQMQQKHNFHQL  243


 Score = 37.0 bits (84),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NF   GMEYE+    YGY  SISHTVS 
Sbjct  239   NFHQLGMEYESSKAAYGYDGSISHTVSV  266


 Score =   167 bits (423),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 113/140 (81%), Gaps = 2/140 (1%)
 Frame = +2

Query  1571  LKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQM  1750
             ++ + ++A   Y   + + VS+SSMDVGVVP ST+S+ S+ H R  KGTIDLF+GP IQM
Sbjct  245   MEYESSKAAYGYDGSISHTVSVSSMDVGVVPNSTMSEMSVCHPRTPKGTIDLFNGPTIQM  304

Query  1751  PPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEV  1930
             P   QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTD++ E+
Sbjct  305   P--TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVEM  362

Query  1931  DQIFYAPLMAESGYGIVPSF  1990
             DQIF   LM E+GY IVPS+
Sbjct  363   DQIFSTSLMGETGYSIVPSY  382



>gb|AIE41592.1| zinc finger protein CONSTANS-LIKE 1 [Lagerstroemia indica]
Length=388

 Score =   175 bits (444),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L ++VS+SSMDVG+VPES LSD SISHSR  KGTIDLFSGPP QMP   QLS MDREARV
Sbjct  266   LCHRVSVSSMDVGIVPESALSDISISHSRPPKGTIDLFSGPPAQMP--TQLSPMDREARV  323

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAE RPRIKGRFAKRTDV+ EVDQ+F   +M E+GYG
Sbjct  324   LRYREKKKTRKFEKTIRYASRKAYAEMRPRIKGRFAKRTDVEIEVDQMFSPTIMTENGYG  383

Query  1976  IVPSF  1990
             IVPSF
Sbjct  384   IVPSF  388


 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
            SGS SG+   WARVCD CRSAAC+VYCRAD AYLC GCDA++H AN VA RHERV VC+ 
Sbjct  6    SGSSSGD-STWARVCDTCRSAACTVYCRADSAYLCSGCDAQIHAANQVASRHERVWVCQG  64

Query  685  CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPI-SGTLYGP  834
            CE +PA   CKADAASLCA CDSDIHSANPLA RH R+PILPI SG  Y P
Sbjct  65   CERSPAAFFCKADAASLCAECDSDIHSANPLAHRHQRIPILPIPSGAHYDP  115



>gb|AEA50854.1| col2a [Populus tremula]
Length=117

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 104/119 (87%), Gaps = 2/119 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  1     VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  58

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVP  1984
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVP
Sbjct  59    EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVP  117



>gb|AEK05655.1| constans-1 [Populus balsamifera]
Length=326

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 155/241 (64%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA  +
Sbjct  4     NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAAFL  63

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  64    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGSA--A  110

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  111   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  159

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  160   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  208

Query  1249  H  1251
             H
Sbjct  209   H  209


 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP   QLS M+REARVLRYR
Sbjct  243   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMP--XQLSPMEREARVLRYR  300

Query  1808  ekkktrkfektIRYASRKAYAETRPR  1885
             EKKK RKFEKTIRYASRKAYAETRPR
Sbjct  301   EKKKARKFEKTIRYASRKAYAETRPR  326



>gb|AEK05645.1| constans-1 [Populus balsamifera]
 gb|AEK05646.1| constans-1 [Populus balsamifera]
 gb|AEK05647.1| constans-1 [Populus balsamifera]
 gb|AEK05648.1| constans-1 [Populus balsamifera]
 gb|AEK05649.1| constans-1 [Populus balsamifera]
 gb|AEK05650.1| constans-1 [Populus balsamifera]
 gb|AEK05651.1| constans-1 [Populus balsamifera]
 gb|AEK05652.1| constans-1 [Populus balsamifera]
 gb|AEK05653.1| constans-1 [Populus balsamifera]
 gb|AEK05654.1| constans-1 [Populus balsamifera]
 gb|AEK05656.1| constans-1 [Populus balsamifera]
 gb|AEK05657.1| constans-1 [Populus balsamifera]
 gb|AEK05658.1| constans-1 [Populus balsamifera]
 gb|AEK05659.1| constans-1 [Populus balsamifera]
 gb|AEK05661.1| constans-1 [Populus balsamifera]
 gb|AEK05662.1| constans-1 [Populus balsamifera]
Length=326

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 155/241 (64%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA  +
Sbjct  4     NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAAFL  63

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  64    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGSA--A  110

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  111   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  159

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  160   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  208

Query  1249  H  1251
             H
Sbjct  209   H  209


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP   QLS M+REARVLRYR
Sbjct  243   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPS--QLSPMEREARVLRYR  300

Query  1808  ekkktrkfektIRYASRKAYAETRPR  1885
             EKKK RKFEKTIRYASRKAYAETRPR
Sbjct  301   EKKKARKFEKTIRYASRKAYAETRPR  326



>gb|AEK05663.1| constans-1 [Populus balsamifera]
 gb|AEK05664.1| constans-1 [Populus balsamifera]
 gb|AEK05665.1| constans-1 [Populus balsamifera]
Length=326

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 155/241 (64%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA  +
Sbjct  4     NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAAXL  63

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  64    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGSA--A  110

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  111   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  159

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  160   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  208

Query  1249  H  1251
             H
Sbjct  209   H  209


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP   QLS M+REARVLRYR
Sbjct  243   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPS--QLSPMEREARVLRYR  300

Query  1808  ekkktrkfektIRYASRKAYAETRPR  1885
             EKKK RKFEKTIRYASRKAYAETRPR
Sbjct  301   EKKKARKFEKTIRYASRKAYAETRPR  326



>gb|ABF56054.1| CONSTANS, partial [Solanum demissum]
Length=333

 Score =   164 bits (416),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 144/221 (65%), Gaps = 14/221 (6%)
 Frame = +1

Query  577   VYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsd  756
             VYC AD  +LC GCDAR+H AN +A RHERV VCEAC  APA  +CKADAASLCA+CD+D
Sbjct  1     VYCWADSTFLCAGCDARMHSANLLASRHERVWVCEACGRAPAAFLCKADAASLCASCDAD  60

Query  757   IHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeet  936
             IHSANPLARRHHRVPI+P+ GTLYGPP        SMM+G     + ED GFL+      
Sbjct  61    IHSANPLARRHHRVPIMPVLGTLYGPPAVETVGSGSMMIGGPTGESTEDYGFLSFTQNAD  120

Query  937   tmdeded---eaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLD  1107
              M  DE+   EAASWLLLNP         K+N + +      NNN  M    E VD YLD
Sbjct  121   DMTVDEEDEDEAASWLLLNPPVK------KNNKNFDNDHNNQNNNYGMLFGREVVDDYLD  174

Query  1108  LAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSIVP  1227
             LAE+       F D+YS+NQQQ  YSVPQ+  SYRGDS+VP
Sbjct  175   LAEYGGVSQ--FNDQYSVNQQQQHYSVPQK--SYRGDSVVP  211


 Score = 45.1 bits (105),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 1/28 (4%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NFQL GMEY+N+NT YGYPA++SH+VS 
Sbjct  236   NFQL-GMEYDNYNTRYGYPATMSHSVSI  262


 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDR  1783
             Y   + + VSISSMDV VVPES LS+TS SH R  KG I LFSGPPIQ+PP  QL+ M+R
Sbjct  252   YPATMSHSVSISSMDVSVVPESALSETSNSHPRPPKGNIGLFSGPPIQIPP--QLTPMNR  309

Query  1784  EARVLRYrekkktrkfektIRYAS  1855
             EARVLRYREKKK RKFEKTIRYAS
Sbjct  310   EARVLRYREKKKNRKFEKTIRYAS  333



>ref|XP_004304173.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Fragaria 
vesca subsp. vesca]
Length=385

 Score =   172 bits (436),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 138/282 (49%), Positives = 169/282 (60%), Gaps = 37/282 (13%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEES             +G+ + N  +WARVCD CRSA C+VYCRAD AYLC GCDA 
Sbjct  1     MLKEES-------------NGAAAAN--SWARVCDTCRSAPCTVYCRADSAYLCSGCDAT  45

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             +H AN VA RHERV VCEACE APA ++CKADAASLC ACD+DIHSANPLARRH RVPIL
Sbjct  46    IHAANRVASRHERVWVCEACERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPIL  105

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG               ++VG T     ED     +  EE   +EDEDEAASW     
Sbjct  106   PISG-------------GQIVVGSTPADTTEDGFLSQEGDEEAMDEEDEDEAASW-----  147

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
                 NP    +++++N     N+NNN     VE VD YLDL E++S   N F    + N 
Sbjct  148   -LLLNPVKNSNSHNSNNNNNPNSNNNGFFFGVE-VDEYLDLVEYNSSDQNQFSGTTATND  205

Query  1168  QQNYSVPQRNMSYRGDSIVP-NHGKNQFHYTQGLQQHNHHAI  1290
             Q +Y VP + +SY GDS+VP  +G+ +    Q  Q+HN H +
Sbjct  206   QHSYGVPHK-ISYGGDSVVPVQYGEGKVTQMQMQQKHNFHQL  246


 Score = 37.0 bits (84),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NF   GMEYE+    YGY  SISHTVS 
Sbjct  242   NFHQLGMEYESSKAAYGYDGSISHTVSV  269


 Score =   170 bits (430),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +2

Query  1565  MMLKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPI  1744
             + ++ + ++A   Y   + + VS+SSMDVGVVP+ST+S+ S+ H R  KGTIDLF+GP I
Sbjct  246   LGMEYESSKAAYGYDGSISHTVSVSSMDVGVVPDSTMSEMSVCHPRTPKGTIDLFNGPTI  305

Query  1745  QMPPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDT  1924
             Q+P   QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTD+D 
Sbjct  306   QIP--TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIDV  363

Query  1925  EVDQIFYAPLMAESGYGIVPSF  1990
             EVDQ+F   LM E+GYGIVPS+
Sbjct  364   EVDQMFSTSLMGETGYGIVPSY  385



>gb|ABK95723.1| unknown [Populus trichocarpa]
Length=244

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  126   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  183

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVPS
Sbjct  184   EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVPS  243

Query  1988  F  1990
             F
Sbjct  244   F  244



>gb|ADL36677.1| COL domain class transcription factor [Malus domestica]
Length=393

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 170/268 (63%), Gaps = 25/268 (9%)
 Frame = +1

Query  502   SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
             S+G+ + N  NWARVCD CR+AAC+VYCRAD AYLC GCDA +H AN VA RHERV VCE
Sbjct  7     SNGTATAN--NWARVCDTCRAAACTVYCRADSAYLCSGCDATIHAANRVASRHERVWVCE  64

Query  682   ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRES  861
             ACE APA  +CKADAASLC ACD+DIHSANPLARRH RVPILPISG LY   +S    + 
Sbjct  65    ACERAPAAFLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLY---SSQATEQG  121

Query  862   SMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmc  1041
              M V ++  A  ED GFL+Q+ ++T  +EDEDEAASWLLLNP  N N N   +  +    
Sbjct  122   EMGVAVSAGAETED-GFLSQEGDDTIYEEDEDEAASWLLLNPVKNNNNNNNTNTQNNGFF  180

Query  1042  kggnnnnnemscAVEAVDAYLDLAEFSSC--HNNLF---EDKYSINQQQNYSVPQRNMSY  1206
              G              VD YLDL E+++C   NN F     ++   QQQ Y VP +N  Y
Sbjct  181   FGAE------------VDEYLDLVEYNTCADQNNQFTDHHQQHDQQQQQQYGVPYKN--Y  226

Query  1207  RGDSIVPNHGKNQFHYTQGLQQHNHHAI  1290
              GDS+VP H   +      LQ+ + H +
Sbjct  227   GGDSVVPIHQHGEVGKAHQLQKQSFHQL  254


 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P+ST+SD SISH R  KGTIDLFSGP IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  286   PDSTMSDISISHPRTPKGTIDLFSGPTIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  343

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  344   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFATSLMAENGYGIVPSF  393



>ref|XP_006373513.1| hypothetical protein POPTR_0017s14410g [Populus trichocarpa]
 gb|ERP51310.1| hypothetical protein POPTR_0017s14410g [Populus trichocarpa]
Length=374

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 151/232 (65%), Gaps = 35/232 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA ++
Sbjct  17    NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAALL  76

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  77    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGPA--A  123

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  124   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  172

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP  1227
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP
Sbjct  173   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVP  213


 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  256   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  313

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVPS
Sbjct  314   EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVPS  373

Query  1988  F  1990
             F
Sbjct  374   F  374



>ref|XP_006373512.1| CONSTANS-like protein CO2 [Populus trichocarpa]
 gb|ERP51309.1| CONSTANS-like protein CO2 [Populus trichocarpa]
Length=370

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 151/232 (65%), Gaps = 35/232 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA ++
Sbjct  17    NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAALL  76

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  77    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGPA--A  123

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  124   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  172

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP  1227
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP
Sbjct  173   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVP  213


 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  252   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  309

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVPS
Sbjct  310   EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVPS  369

Query  1988  F  1990
             F
Sbjct  370   F  370



>gb|AEA50853.1| col2a [Populus tremula]
Length=234

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 155/240 (65%), Gaps = 36/240 (15%)
 Frame = +1

Query  535   WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
             WARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA ++C
Sbjct  17    WARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAALLC  76

Query  715   KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
             KADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A 
Sbjct  77    KADAASLCTACDADIHSANPLARRHQRVPILPISGCLYG-----------TRVGPA--AG  123

Query  895   EEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnems  1074
             E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                        
Sbjct  124   ETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQSNNGFLFGGE------------  171

Query  1075  cAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQFH  1251
                  VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + H
Sbjct  172   -----VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKDH  221



>gb|AEK05660.1| constans-1 [Populus balsamifera]
Length=326

 Score =   171 bits (432),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 154/241 (64%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN  A RHERV VCEACE APA  +
Sbjct  4     NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRXASRHERVRVCEACERAPAAFL  63

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  64    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGSA--A  110

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  111   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  159

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  160   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  208

Query  1249  H  1251
             H
Sbjct  209   H  209


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP   QLS M+REARVLRYR
Sbjct  243   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPS--QLSPMEREARVLRYR  300

Query  1808  ekkktrkfektIRYASRKAYAETRPR  1885
             EKKK RKFEKTIRYASRKAYAETRPR
Sbjct  301   EKKKARKFEKTIRYASRKAYAETRPR  326



>gb|AEK05644.1| constans-1 [Populus balsamifera]
Length=326

 Score =   171 bits (432),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 154/241 (64%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA  +
Sbjct  4     NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERAPAAFL  63

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG LYG             VG    A
Sbjct  64    CKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYG-----------TQVGSA--A  110

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N                       
Sbjct  111   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFLFGGE-----------  159

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                    D YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  160   ------XDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  208

Query  1249  H  1251
             H
Sbjct  209   H  209


 Score =   112 bits (281),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 2/86 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP   QLS M+REARVLRYR
Sbjct  243   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPS--QLSPMEREARVLRYR  300

Query  1808  ekkktrkfektIRYASRKAYAETRPR  1885
             EKKK RKFEKTIRYASRKAYAETRPR
Sbjct  301   EKKKARKFEKTIRYASRKAYAETRPR  326



>ref|XP_009378312.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X2 
[Pyrus x bretschneideri]
Length=397

 Score =   172 bits (437),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 174/270 (64%), Gaps = 25/270 (9%)
 Frame = +1

Query  502   SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
             S+G+ + N  NWARVCD CR+AAC+V+CRAD AYLC GCDA +H AN VA RHERV VCE
Sbjct  7     SNGTAANN--NWARVCDTCRAAACTVFCRADSAYLCSGCDATIHAANCVASRHERVWVCE  64

Query  682   ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRES  861
             ACE APA  +CKAD+ASLC ACD+DIHSANPLARRH RVPILPISG  YGP       E 
Sbjct  65    ACERAPAAFLCKADSASLCTACDADIHSANPLARRHQRVPILPISGCPYGPRAI----EH  120

Query  862   SMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmc  1041
               M  +    AE ++GF++Q+ +ET  +EDEDEAASWLLLNP  N N N   +       
Sbjct  121   GRMKLVRSATAEMEDGFMSQEGDETIDEEDEDEAASWLLLNPVKNNNNNNNTT-------  173

Query  1042  kggnnnnnemscAVEAVDAYLDLAEFSSC--HNNLFED--KYSINQQQNYSVPQRNMSYR  1209
                   NN +   VE VD YLDL E++SC   NN F D  +    Q+Q++ VP +N  Y 
Sbjct  174   --TTTKNNGLFFGVE-VDEYLDLVEYNSCADQNNQFTDHHQQEQQQEQHFGVPHKN--YG  228

Query  1210  GDSIVPNHGKNQF---HYTQGLQQHNHHAI  1290
             GDS+VP H   +    H  Q LQ+ + H +
Sbjct  229   GDSVVPVHQYGEVGKAHQMQQLQKRSFHQL  258


 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P ST+ D SISH R  KGTIDLFSG  IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  290   PNSTMIDISISHPRTPKGTIDLFSGSSIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  347

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  348   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFSTTLMAENGYGIVPSF  397



>ref|XP_011099077.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Sesamum indicum]
Length=332

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDR  1783
             Y   + + VS+S MDVGVVPEST+++ SISH R  KGTIDLFSGPPIQ+P   QL+ MDR
Sbjct  206   YPNSMSHNVSLSPMDVGVVPESTMTEISISHQRPPKGTIDLFSGPPIQVP--TQLTPMDR  263

Query  1784  EARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAE  1963
             EARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKR DV  EV+Q+F APLM E
Sbjct  264   EARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVGVEVEQMFAAPLMGE  323

Query  1964  SGYGIVPSF  1990
             S YGIVPSF
Sbjct  324   SEYGIVPSF  332


 Score = 84.0 bits (206),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 118/199 (59%), Gaps = 34/199 (17%)
 Frame = +1

Query  640   NTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
             N ++ R +   +CEACE APA  +CKADAASLCAACDSDIHSANPLARRHHRVPI  +  
Sbjct  18    NWLSSRRQPFWLCEACERAPAAFLCKADAASLCAACDSDIHSANPLARRHHRVPIPQVPN  77

Query  820   TLYGPPTSNPCRESSMMVG-LTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpn  996
             TLYGP  S P     ++ G   GDA EE   FLTQ+A+ET   EDEDEAASW        
Sbjct  78    TLYGP--SAP----GLITGPAAGDAEEE---FLTQEADETVDGEDEDEAASW--------  120

Query  997   pnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN  1176
                NPVK+ ++ +   G              +D YLDL +++SC N+ F + ++ NQQQ+
Sbjct  121   LLLNPVKNGDNQSHDNGPTAALFGG-----TMDEYLDLDDYNSCQNSQFNEHFT-NQQQH  174

Query  1177  YSVPQRNMSYRGDSIVPNH  1233
             YS          DS+VP  
Sbjct  175   YS----------DSVVPTQ  183


 Score = 34.7 bits (78),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 19/27 (70%), Gaps = 1/27 (4%)
 Frame = +3

Query  1290  FQLQGMEYENFNTGYGYPASISHTVSF  1370
             FQL G+EYE  NT Y YP S+SH VS 
Sbjct  191   FQL-GLEYEVSNTAYSYPNSMSHNVSL  216



>ref|XP_010257847.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Nelumbo nucifera]
Length=365

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 146/231 (63%), Gaps = 32/231 (14%)
 Frame = +1

Query  535   WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
             WAR+CD CRSAAC+V+CRAD AYLC GCDAR+H  N VA RHERV VCEACE APA   C
Sbjct  16    WARMCDSCRSAACAVFCRADSAYLCAGCDARIHAVNQVASRHERVWVCEACERAPAAFTC  75

Query  715   KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
             KADAA+LC  CD+DIHSANPLARRHHRVPILPI+G LYGP  +NP R     + +     
Sbjct  76    KADAAALCTTCDADIHSANPLARRHHRVPILPIAGCLYGPSPTNPGRRVRPDINI-----  130

Query  895   EEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnems  1074
               ++GF+TQ+ +E   +EDEDE ASWLLLNP  N N                        
Sbjct  131   --EDGFMTQEGDEDIDEEDEDETASWLLLNPGKNDNNQNNNGFLLGGE------------  176

Query  1075  cAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP  1227
                  VD YLDL ++SSC +N +      NQQQ+YSV  +N     DS+VP
Sbjct  177   -----VDEYLDLVDYSSCTDNQY------NQQQHYSVQHKNDG--SDSVVP  214


 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MD  VVP++ ++D S SHSR  KGTIDLFS P + MPPQ   + MDREA+VLRYREK+KT
Sbjct  253   MDASVVPDAMMNDISNSHSRPPKGTIDLFSSP-LAMPPQF--TPMDREAKVLRYREKRKT  309

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EV+Q+F   ++AESGYG+VPSF
Sbjct  310   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVEQMFSTTVLAESGYGVVPSF  365



>ref|XP_010525138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Tarenaya 
hassleriana]
 gb|ABD96940.1| hypothetical protein [Cleome spinosa]
Length=381

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 133/274 (49%), Positives = 165/274 (60%), Gaps = 42/274 (15%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEE             +SG  +G + NWAR+CD CRSAAC+VYCRAD AYLC  CDAR
Sbjct  1     MLKEER------------TSGGETG-ENNWARICDTCRSAACTVYCRADSAYLCTSCDAR  47

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RHERV VCE+CE APA  +CKADAASLCAACD++IHSANPLARRHHRVPIL
Sbjct  48    VHAANHVASRHERVWVCESCERAPAAFLCKADAASLCAACDAEIHSANPLARRHHRVPIL  107

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG++ GP  ++   E++M         + +N  +    E    DED++EAASWLLLNP
Sbjct  108   PISGSMSGPMANHHPSETAM--------TDTENDMVVGREEAEDEDEDDEEAASWLLLNP  159

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
               N   N  ++N      +                D YLDL E++S   N F D+YS   
Sbjct  160   GKNSGNNNNQNNGFFFDGE---------------ADEYLDLVEYNSSMENQFSDQYS-QY  203

Query  1168  QQNYSVPQRNMSYRGDSIVP---NHGKNQFHYTQ  1260
              Q+  VPQ+  S+ GD +VP      + Q H+ Q
Sbjct  204   HQDCGVPQK--SFGGDGVVPLQVEESRGQLHHEQ  235


 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSI-SHSRASKGTIDLFSGPPIQMPPQLQLSQMDREAR  1792
             + + VS+SSMD+ VVPEST SD ++ S  RA KGT DL  GPPIQM PQL  S MDREAR
Sbjct  258   MNHSVSMSSMDIVVVPESTASDMAVVSQLRAPKGTTDLLIGPPIQMMPQL--SPMDREAR  315

Query  1793  VLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGY  1972
             VLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTD++ EVDQ F   LM ESGY
Sbjct  316   VLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEAEVDQAFSTTLMQESGY  375

Query  1973  GIVPSF  1990
             GIVPSF
Sbjct  376   GIVPSF  381



>ref|XP_008341828.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
 ref|XP_008368480.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
Length=393

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 169/268 (63%), Gaps = 25/268 (9%)
 Frame = +1

Query  502   SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
             S+G+ + N  NWARVCD C +AAC+VYCRAD AYLC GCDA +H AN VA RHERV VCE
Sbjct  7     SNGTATAN--NWARVCDTCXAAACTVYCRADSAYLCSGCDATIHAANRVASRHERVWVCE  64

Query  682   ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRES  861
             ACE APA  +CKADAASLC ACD+DIHSANPLARRH RVPILPISG LY   +S    + 
Sbjct  65    ACERAPAAFLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLY---SSQATEQG  121

Query  862   SMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmc  1041
              M V ++  A  ED GFL+Q+ ++T  +EDEDEAASWLLLNP  N N N   +  +    
Sbjct  122   EMGVAVSAGAETED-GFLSQEGDDTIYEEDEDEAASWLLLNPVKNNNNNNNTNTQNNGFF  180

Query  1042  kggnnnnnemscAVEAVDAYLDLAEFSSC--HNNLF---EDKYSINQQQNYSVPQRNMSY  1206
              G              VD YLDL E+++C   NN F     ++   QQQ Y VP +N  Y
Sbjct  181   FGAE------------VDEYLDLVEYNTCADQNNQFTDHHQQHDQQQQQQYGVPYKN--Y  226

Query  1207  RGDSIVPNHGKNQFHYTQGLQQHNHHAI  1290
              GDS+VP H   +      LQ+ + H +
Sbjct  227   GGDSVVPIHQHGEVGKAHQLQKQSFHQL  254


 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P+ST+SD SISH R  KGTIDLFSGP IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  286   PDSTMSDISISHPRTPKGTIDLFSGPTIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  343

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  344   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFATSLMAENGYGIVPSF  393



>ref|XP_006482341.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Citrus sinensis]
Length=365

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D+GVVPEST+SD SISHSR  KGTIDLFSGPPIQMPPQL  + MDREARVLRYREKKKTR
Sbjct  253   DLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQL--TPMDREARVLRYREKKKTR  310

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTD + EVDQ+F A LM + GYGIVPSF
Sbjct  311   KFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMFSATLMTDPGYGIVPSF  365


 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 14/128 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            M+KEES            + GS  GN  +WARVCD CR+AAC+VYC+AD+AYLC  CD+R
Sbjct  1    MMKEES------------NDGSGGGN--SWARVCDTCRAAACTVYCKADMAYLCSACDSR  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VCE+CE APA  +CKADAASLCAACD++IHSANPLARRH RVPIL
Sbjct  47   VHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPIL  106

Query  808  PISGTLYG  831
            PISG++YG
Sbjct  107  PISGSVYG  114



>gb|KDO58878.1| hypothetical protein CISIN_1g017819mg [Citrus sinensis]
Length=365

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D+GVVPEST+SD SISHSR  KGTIDLFSGPPIQMPPQL  + MDREARVLRYREKKKTR
Sbjct  253   DLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQL--TPMDREARVLRYREKKKTR  310

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTD + EVDQ+F A LM + GYGIVPSF
Sbjct  311   KFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMFSATLMTDPGYGIVPSF  365


 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 14/128 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            M+KEES            + GS  GN  +WARVCD CR+AAC+VYC+AD+AYLC  CD+R
Sbjct  1    MMKEES------------NDGSGGGN--SWARVCDTCRAAACTVYCKADMAYLCSACDSR  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VCE+CE APA  +CKADAASLCAACD++IHSANPLARRH RVPIL
Sbjct  47   VHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPIL  106

Query  808  PISGTLYG  831
            PISG++YG
Sbjct  107  PISGSVYG  114



>ref|XP_006430882.1| hypothetical protein CICLE_v10012022mg [Citrus clementina]
 gb|ESR44122.1| hypothetical protein CICLE_v10012022mg [Citrus clementina]
Length=365

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +2

Query  1646  DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktr  1825
             D+GVVPEST+SD SISHSR  KGTIDLFSGPPIQMPPQL  + MDREARVLRYREKKKTR
Sbjct  253   DLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQL--TPMDREARVLRYREKKKTR  310

Query  1826  kfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KFEKTIRYASRKAYAETRPRIKGRFAKRTD + EVDQ+F A LM + GYGIVPSF
Sbjct  311   KFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMFSATLMTDPGYGIVPSF  365


 Score =   150 bits (380),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 14/128 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            M+KEES            + GS  GN  +WARVCD CR+AAC+VYC+AD+AYLC  CD+R
Sbjct  1    MMKEES------------NDGSGGGN--SWARVCDTCRAAACTVYCKADMAYLCSACDSR  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VCE+CE APA  +CKADAASLCAACD++IHSANPLARRH RVPIL
Sbjct  47   VHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPIL  106

Query  808  PISGTLYG  831
            PISG++YG
Sbjct  107  PISGSVYG  114



>gb|ADZ72833.1| CONSTANS-like protein [Aquilegia formosa]
Length=381

 Score =   170 bits (430),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDR  1783
             +   L + VS+SSMD  +VP+ST+S+TS  HSR  KGTIDLFS PP+QMP   Q S MDR
Sbjct  255   FTASLTHSVSMSSMDASIVPDSTMSETSNMHSRTPKGTIDLFSSPPLQMP--AQFSPMDR  312

Query  1784  EARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAE  1963
             EARVLRYREK+KTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   +MAE
Sbjct  313   EARVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFATSVMAE  372

Query  1964  SGYGIVPSF  1990
             SGYGIVPSF
Sbjct  373   SGYGIVPSF  381


 Score =   160 bits (405),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            W+RVCD CR+AAC+V+CRAD AYLC GCDAR+HGAN +  RHERV VCEACESAPA   C
Sbjct  15   WSRVCDSCRAAACAVFCRADSAYLCTGCDARMHGANQLVSRHERVWVCEACESAPAAFTC  74

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
            KADAASLC  CD+DIHSANPLARRHHRVPILPISG LYGP  + P R         G  A
Sbjct  75   KADAASLCTTCDADIHSANPLARRHHRVPILPISGCLYGPSANYPSRP-------LGSVA  127

Query  895  EEDNGFL  915
            + ++GFL
Sbjct  128  DMEDGFL  134



>ref|XP_011021143.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Populus 
euphratica]
 ref|XP_011039781.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Populus 
euphratica]
Length=425

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 106/121 (88%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPES +S+ SISH  A +GTIDLFS PPIQMP QL  S M+REARVLRYR
Sbjct  307   VSMSSMDVGVVPESAMSEISISHQSAPRGTIDLFSSPPIQMPSQL--SPMEREARVLRYR  364

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F + LMAE+ YGIVPS
Sbjct  365   EKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDVEVDQMFSSTLMAETAYGIVPS  424

Query  1988  F  1990
             F
Sbjct  425   F  425


 Score =   170 bits (431),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 156/241 (65%), Gaps = 36/241 (15%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWARVCD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE +PA ++
Sbjct  68    NWARVCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRVCEACERSPAALL  127

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG  YG             VG    A
Sbjct  128   CKADAASLCTACDADIHSANPLARRHQRVPILPISGCPYG-----------TQVGPA--A  174

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              E ++ F+TQ+ EET  +EDEDEAASWLLLNP  N N         +             
Sbjct  175   GETEDQFMTQEGEETIGEEDEDEAASWLLLNPAKNSNNQNNNGFVFSGE-----------  223

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQF  1248
                   VD YLD+ E++SC  N + D+Y+   QQ+YSVP ++    GDS+VP  +G+ + 
Sbjct  224   ------VDEYLDIVEYNSCAENQYSDQYN---QQHYSVPPKSCG--GDSVVPIQYGEGKD  272

Query  1249  H  1251
             H
Sbjct  273   H  273



>ref|XP_009373735.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Pyrus x bretschneideri]
Length=397

 Score =   170 bits (430),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 175/271 (65%), Gaps = 27/271 (10%)
 Frame = +1

Query  502   SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
             S+G+ + N  NWARVCD CR+AAC+VYCRAD AYLC GCDA +H AN +A RHERV VCE
Sbjct  7     SNGTATAN--NWARVCDTCRAAACTVYCRADSAYLCSGCDATIHAANRLASRHERVWVCE  64

Query  682   ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRES  861
             ACE APA  +CKADAASLC ACD+DIHSANPLARRH RVPILPISG LY    S+   E 
Sbjct  65    ACERAPAAFLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLY----SSQATEQ  120

Query  862   SMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmc  1041
               M  +    AE ++GFL+Q+ ++T  +EDEDEAASWLLLNP  N + N   +       
Sbjct  121   GGMGVVVSAGAETEDGFLSQEGDDTIDEEDEDEAASWLLLNPVKNSSNNNNNT-------  173

Query  1042  kggnnnnnemscAVEAVDAYLDLAEFSSC--HNNLF---EDKYSINQQQNYSVPQRNMSY  1206
                N  NN     VE VD YLDL E++SC   NN F     ++   +QQ Y V  +N  Y
Sbjct  174   ---NAQNNGFFFGVE-VDEYLDLVEYNSCADQNNQFTDHHQQHDQQEQQQYGVQYKN--Y  227

Query  1207  RGDSIVP--NHGK-NQFHYTQGLQQHNHHAI  1290
              GDS+VP   HG+  + H  Q LQ+ + H +
Sbjct  228   GGDSVVPVHQHGEGGKAHQMQQLQKQSFHQL  258


 Score =   155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 97/110 (88%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P+ST+SD SISH R  KGTIDLFSGP IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  290   PDSTMSDISISHPRTPKGTIDLFSGPTIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  347

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  348   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFATSLMAENGYGIVPSF  397



>gb|AFK08985.1| CONSTANTS-like protein [Fragaria x ananassa]
Length=381

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  1571  LKSQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQM  1750
             ++ + ++A   Y   + + VS+SSMDVGVVP+ST+S+ S+ H R  KGTIDLF+GP IQM
Sbjct  244   MEYESSKAAYGYDGSISHTVSVSSMDVGVVPDSTMSEMSVCHPRTPKGTIDLFNGPTIQM  303

Query  1751  PPQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEV  1930
             P   QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTD++ EV
Sbjct  304   P--TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDIEVEV  361

Query  1931  DQIFYAPLMAESGYGIVPSF  1990
             DQ+F   LM E+GYGIVPS+
Sbjct  362   DQMFSTSLMRETGYGIVPSY  381


 Score =   165 bits (417),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 155/255 (61%), Gaps = 29/255 (11%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             +WARVCD C SA C+VYCRAD AYLC GCD  +H AN VA RHERV VCEACE APA  +
Sbjct  15    SWARVCDTCCSAPCTVYCRADSAYLCSGCDTTIHAANRVASRHERVWVCEACERAPAAFL  74

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD+DIHSANPLARRH RVPILPISG             S +MVG +  A
Sbjct  75    CKADAASLCTACDADIHSANPLARRHQRVPILPISG-------------SQIMVG-SAPA  120

Query  892   AEEDNGFLtq-daeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnne  1068
                ++GFL+Q   EE   +EDEDEAASW             +    ++N     NNNNN 
Sbjct  121   DTTEDGFLSQEGDEEAMDEEDEDEAASW-----------LLLNPVKNSNNHNNPNNNNNG  169

Query  1069  mscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQ  1245
                 VE VD YLD  E++S   N      + N Q NY VP + +SY GDS+VP  +G+ +
Sbjct  170   FFFGVE-VDEYLDFVEYNSSDQNQLGGTTATNDQHNYGVPHK-ISYGGDSVVPVQYGEGK  227

Query  1246  FHYTQGLQQHNHHAI  1290
                 Q  Q+HN H +
Sbjct  228   VTQMQMQQKHNFHQL  242


 Score = 37.0 bits (84),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 18/28 (64%), Gaps = 0/28 (0%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NF   GMEYE+    YGY  SISHTVS 
Sbjct  238   NFHQLGMEYESSKAAYGYDGSISHTVSV  265



>ref|XP_008348263.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Malus domestica]
Length=114

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDVGVVP ST+SD SISH R   GT+DLFSG  IQMP   QLS MDREARVLRYREKKKT
Sbjct  1     MDVGVVPNSTMSDISISHPRTPTGTVDLFSGSSIQMP--TQLSPMDREARVLRYREKKKT  58

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  59    RKFEKTIRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFSTTLMAENGYGIVPSF  114



>ref|XP_009378311.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like isoform X1 
[Pyrus x bretschneideri]
Length=411

 Score =   168 bits (425),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 165/248 (67%), Gaps = 22/248 (9%)
 Frame = +1

Query  502   SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
             S+G+ + N  NWARVCD CR+AAC+V+CRAD AYLC GCDA +H AN VA RHERV VCE
Sbjct  7     SNGTAANN--NWARVCDTCRAAACTVFCRADSAYLCSGCDATIHAANCVASRHERVWVCE  64

Query  682   ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRES  861
             ACE APA  +CKAD+ASLC ACD+DIHSANPLARRH RVPILPISG  YGP       E 
Sbjct  65    ACERAPAAFLCKADSASLCTACDADIHSANPLARRHQRVPILPISGCPYGPRAI----EH  120

Query  862   SMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmc  1041
               M  +    AE ++GF++Q+ +ET  +EDEDEAASWLLLNP  N N N   +       
Sbjct  121   GRMKLVRSATAEMEDGFMSQEGDETIDEEDEDEAASWLLLNPVKNNNNNNNTT-------  173

Query  1042  kggnnnnnemscAVEAVDAYLDLAEFSSC--HNNLFED--KYSINQQQNYSVPQRNMSYR  1209
                   NN +   VE VD YLDL E++SC   NN F D  +    Q+Q++ VP +N  Y 
Sbjct  174   --TTTKNNGLFFGVE-VDEYLDLVEYNSCADQNNQFTDHHQQEQQQEQHFGVPHKN--YG  228

Query  1210  GDSIVPNH  1233
             GDS+VP H
Sbjct  229   GDSVVPVH  236


 Score =   149 bits (376),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P ST+ D SISH R  KGTIDLFSG  IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  304   PNSTMIDISISHPRTPKGTIDLFSGSSIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  361

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  362   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFSTTLMAENGYGIVPSF  411



>ref|XP_007139358.1| hypothetical protein PHAVU_008G022800g [Phaseolus vulgaris]
 gb|ESW11352.1| hypothetical protein PHAVU_008G022800g [Phaseolus vulgaris]
Length=359

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             +S+S++D+GVVPES + D SISH+R  KGTIDLFSGPPIQM P    S MDREARVLRYR
Sbjct  240   ISVSTLDIGVVPESPMRDVSISHTRPPKGTIDLFSGPPIQMMPS-HFSPMDREARVLRYR  298

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYG+VPS
Sbjct  299   EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGLVPS  358

Query  1988  F  1990
             F
Sbjct  359   F  359


 Score =   114 bits (284),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             WAR CD CRSA  +V+CRA  AYLC  CD RVH  ++ +  HERV VCEACE APA  +
Sbjct  9    TWARTCDTCRSAPSTVFCRAHNAYLCSSCDGRVHHTSS-SSWHERVWVCEACERAPAAFL  67

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
            CKADAASLC++CD+DIHSANPLA RHHRVPILPI+ 
Sbjct  68   CKADAASLCSSCDADIHSANPLASRHHRVPILPIAA  103



>gb|ABO43724.1| CONSTANS [Solanum tuberosum]
Length=337

 Score =   162 bits (411),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 146/221 (66%), Gaps = 14/221 (6%)
 Frame = +1

Query  577   VYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsd  756
             VYCRAD AYLC  CDAR+H A+ +A RHERV VCEACE APA  +CKADAASLCA+CD+D
Sbjct  1     VYCRADSAYLCADCDARIHAASLMASRHERVWVCEACERAPAAFLCKADAASLCASCDAD  60

Query  757   IHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeet  936
             IHSANPLARRHHRVPI+PI GTLYGPP  +     SMM+G T +   ED+GFL+   +  
Sbjct  61    IHSANPLARRHHRVPIMPIPGTLYGPPAVHTVSGGSMMIGGTREGT-EDDGFLSLTQDAD  119

Query  937   tmdeded---eaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLD  1107
                 DE+   EAASWLLLNP    N     +NN+ N                E VD YLD
Sbjct  120   DTTIDEEDENEAASWLLLNPPVKNNNKNNINNNNNNQNNNYGMLFGG-----EVVDEYLD  174

Query  1108  LAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSIVP  1227
             LAE+    ++ F D+YS+NQQQ  YSVPQ+  SY  DS+VP
Sbjct  175   LAEYGG--DSQFNDQYSVNQQQQHYSVPQK--SYVEDSVVP  211


 Score = 37.0 bits (84),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 18/20 (90%), Gaps = 1/20 (5%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPA  1346
             NFQL GMEY+N NTGYGYPA
Sbjct  240   NFQL-GMEYDNSNTGYGYPA  258


 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 2/71 (3%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDV VVPES LS+TS SH R  KGTIDLFSGPPIQ+PP  QL+ MDREARVLRYREKKK 
Sbjct  269   MDVSVVPESALSETSNSHPRPPKGTIDLFSGPPIQIPP--QLTPMDREARVLRYREKKKN  326

Query  1823  rkfektIRYAS  1855
             RKFEKTIRYAS
Sbjct  327   RKFEKTIRYAS  337



>gb|KHN14463.1| Zinc finger protein CONSTANS-LIKE 2 [Glycine soja]
Length=114

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MD+GVVPES + D SI H+R  KGTIDLFSGPPIQ+P     S MDREARVLRYREKKKT
Sbjct  1     MDIGVVPESPMRDVSIGHTRTPKGTIDLFSGPPIQVPSHF--SPMDREARVLRYREKKKT  58

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  59    RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGIVPSF  114



>ref|XP_002305307.1| CONSTANS-like protein CO2 [Populus trichocarpa]
 gb|EEE85818.1| CONSTANS-like protein CO2 [Populus trichocarpa]
Length=369

 Score =   164 bits (416),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 140/278 (50%), Positives = 164/278 (59%), Gaps = 52/278 (19%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLK+ES               S  G   N ARVCD CR+A C+VYCRAD AYLC GCDAR
Sbjct  1     MLKQES---------------SGGGGGDNRARVCDTCRAAPCTVYCRADSAYLCAGCDAR  45

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RHERV VCEACE APA ++CKADAASLC ACD+DIHSANPLARRH RVPIL
Sbjct  46    VHAANRVASRHERVSVCEACERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPIL  105

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG L+G P           VG    A E ++ F TQ+ EET  +E+EDEAASW     
Sbjct  106   PISGCLHGSP-----------VGPA--AGETEDRFTTQEGEETISEEEEDEAASW-----  147

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
                   NPVK++ + N                  VD YLDL E++SC  N   D+Y+   
Sbjct  148   ---LLLNPVKNSKNQNNNGFLFGGE---------VDEYLDLVEYNSCTENQCSDQYN---  192

Query  1168  QQNYSVPQRNMSYRGDSIVP-NHGKNQFHYTQGLQQHN  1278
             QQ+Y VP +  SY GD  VP  +G+ + H  Q  Q HN
Sbjct  193   QQHYCVPPK--SYGGDRAVPIQYGEGKDHQQQ-RQYHN  227


 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDVGVVPEST+S+ SIS  R  KGT++LFS   IQMP QL  S MDREARVLRYREKKKT
Sbjct  256   MDVGVVPESTMSEISISQHRPPKGTMELFSSTAIQMPSQL--SPMDREARVLRYREKKKT  313

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKR DV+ E DQ+F + LMAE+GYGIVPSF
Sbjct  314   RKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVEDDQMFSSTLMAETGYGIVPSF  369



>ref|XP_006388756.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 ref|XP_006388757.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 gb|ERP47670.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
 gb|ERP47671.1| hypothetical protein POPTR_0105s00200g [Populus trichocarpa]
Length=117

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +2

Query  1634  ISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrek  1813
             +SSMDVGVVPEST+S+ SIS  R  KGT++LFS   IQMP QL  S MDREARVLRYREK
Sbjct  1     MSSMDVGVVPESTMSEISISQHRPPKGTMELFSSTAIQMPSQL--SPMDREARVLRYREK  58

Query  1814  kktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KKTRKFEKTIRYASRKAYAETRPRIKGRFAKR DV+ E DQ+F + LMAE+GYGIVPSF
Sbjct  59    KKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVEDDQMFSSTLMAETGYGIVPSF  117



>gb|ACZ67162.1| GATA-4/5/6 transcription factor, partial [Populus nigra]
Length=117

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPEST+S+ SIS  R  KGTI+LFS   IQMP QL  S MDREARVLRYR
Sbjct  1     VSMSSMDVGVVPESTMSEISISQHRPPKGTIELFSSTAIQMPSQL--SPMDREARVLRYR  58

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVP  1984
             EK+KTRKFEKTIRYASRKAYAETRPRIKGRFAKR DV+ E DQ+F + LMAE+GYGIVP
Sbjct  59    EKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVEDDQMFSSTLMAETGYGIVP  117



>gb|ACZ67160.1| GATA-4/5/6 transcription factor, partial [Populus balsamifera]
Length=117

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 2/119 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPEST+S+ SIS  R  KGT++LFS   IQMP QL  S MDREARVLRYR
Sbjct  1     VSMSSMDVGVVPESTMSEISISQHRPPKGTMELFSSTAIQMPSQL--SPMDREARVLRYR  58

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVP  1984
             EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKR DV+ E DQ+F + LMAE+GYGIVP
Sbjct  59    EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVEVEDDQMFSSTLMAETGYGIVP  117



>gb|KDP24338.1| hypothetical protein JCGZ_25634 [Jatropha curcas]
Length=383

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDVGVV +ST+S+ SISHSR  KGTIDLFSGPP+QMP QL  S  DREARVLRYREKKKT
Sbjct  270   MDVGVVQDSTMSEISISHSRTPKGTIDLFSGPPMQMPSQL--SPRDREARVLRYREKKKT  327

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVD EVDQ+F   LM E+GY IVPSF
Sbjct  328   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVDFEVDQMFSTTLMTETGYSIVPSF  383


 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WARVCD CR+AAC+VYC+AD AYLC GCDARVH AN VA RHERV VCEACE APA  IC
Sbjct  18   WARVCDTCRAAACTVYCKADAAYLCAGCDARVHAANRVASRHERVWVCEACERAPAAFIC  77

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP  834
            KADAASLC ACD+DIHSANPLARRH RVPILPISG L+ P
Sbjct  78   KADAASLCTACDADIHSANPLARRHQRVPILPISGGLHSP  117



>ref|XP_008379481.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Malus domestica]
Length=392

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 162/260 (62%), Gaps = 28/260 (11%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             N ARVCD CR+AAC+V+CRAD AYLC GCDA +H  N VA  HERV VCEACE APA  +
Sbjct  15    NCARVCDTCRAAACTVFCRADSAYLCSGCDATIHAVNCVASHHERVRVCEACERAPAAFL  74

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKAD+ASLC ACD+DIHSANPLARRH RVPILPISG LYGP      R   M +G +  A
Sbjct  75    CKADSASLCTACDADIHSANPLARRHQRVPILPISGCLYGPQAIEHGR---MKLGRSATA  131

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
               ED GF+ Q+ +ET  +EDEDEAASWLLLNP  N N N  K+N                
Sbjct  132   EMED-GFMNQEGDETIDEEDEDEAASWLLLNPVKNNNNNNTKNNGLFFGVD---------  181

Query  1072  scAVEAVDAYLDLAEFSSC--HNNLFED--KYSINQQQNYSVPQRNMSYRGDSIVPNHGK  1239
                   VD YLDL E++SC   NN F D  +    Q+Q+Y V  +N  Y GDS+VP H  
Sbjct  182   ------VDEYLDLVEYNSCADQNNQFTDHHQQEQQQEQHYGVAHKN--YGGDSVVPVHQY  233

Query  1240  NQF---HYTQGLQQHNHHAI  1290
              +    H  Q LQ+ + H +
Sbjct  234   GEVAKAHQMQQLQKQSFHQL  253


 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             P ST+SD SISH R   GT DLFSG  IQMP   QLS MDREARVLRYREKKKTRKFEKT
Sbjct  285   PNSTMSDISISHPRTPTGTXDLFSGSSIQMP--TQLSPMDREARVLRYREKKKTRKFEKT  342

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRT+++ EVDQ+F   LMAE+GYGIVPSF
Sbjct  343   IRYASRKAYAETRPRIKGRFAKRTEMEVEVDQMFSTTLMAENGYGIVPSF  392



>ref|XP_007032965.1| Zinc finger protein CONSTANS-LIKE 2 [Theobroma cacao]
 gb|EOY03891.1| Zinc finger protein CONSTANS-LIKE 2 [Theobroma cacao]
Length=382

 Score =   162 bits (409),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 99/113 (88%), Gaps = 2/113 (2%)
 Frame = +2

Query  1652  GVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkf  1831
             G+VPEST+SD SISH R  KGTIDLFSGP IQMP   QL+ MDREARVLRYREKKKTRKF
Sbjct  272   GIVPESTMSDISISHRRPPKGTIDLFSGPSIQMP--TQLTPMDREARVLRYREKKKTRKF  329

Query  1832  ektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             EKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM E+GYGIVPSF
Sbjct  330   EKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTLMTETGYGIVPSF  382


 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 109/156 (70%), Gaps = 17/156 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEE+           S +    G+  NWARVCD CRSAAC+VYC+AD AYLC GCDAR
Sbjct  1    MLKEET-----------SDASGGGGSGNNWARVCDTCRSAACTVYCQADSAYLCAGCDAR  49

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VCEACE APA  +CKADAASLC  CD++IHSANPLARRH RVPIL
Sbjct  50   VHAANRVASRHERVWVCEACERAPAAFLCKADAASLCTTCDAEIHSANPLARRHQRVPIL  109

Query  808  PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFL  915
            PISG LYG P++   R   M       AAE ++GF+
Sbjct  110  PISGCLYG-PSATELRGRKM-----ASAAETEDGFM  139



>ref|XP_010100899.1| Zinc finger protein CONSTANS-LIKE 2 [Morus notabilis]
 gb|EXB85823.1| Zinc finger protein CONSTANS-LIKE 2 [Morus notabilis]
Length=387

 Score =   160 bits (406),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDV VVP+ST+SD SISH R  KGTIDLFSGP +QMP   QL+ MDREARVLRYREKKKT
Sbjct  274   MDVSVVPDSTMSDISISHPRPPKGTIDLFSGPAVQMP--AQLTPMDREARVLRYREKKKT  331

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM ++GYGIVPSF
Sbjct  332   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTLMVDTGYGIVPSF  387


 Score =   160 bits (405),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = +1

Query  529  QNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATV  708
            +NWARVCD CRSAAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA  
Sbjct  13   KNWARVCDTCRSAACAVYCRADSAYLCAGCDARVHAANRVASRHERVFVCEACERAPAAF  72

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP  834
            ICKADAASLCA+CD+DIHSANPLARRHHRVP+LPISG +YGP
Sbjct  73   ICKADAASLCASCDADIHSANPLARRHHRVPVLPISGCVYGP  114



>ref|NP_001235828.1| CONSTANS-like 2a [Glycine max]
 gb|ABD17253.1| CONSTANS-like 2a [Glycine max]
 gb|ACJ65311.1| CONSTANS protein [Glycine max]
Length=348

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MD+GVVPES + D SI H+R  KGTIDLFSGPPIQ+P     S MDREARVLRYREKKKT
Sbjct  235   MDIGVVPESPMRDVSIGHTRTPKGTIDLFSGPPIQVPSHF--SPMDREARVLRYREKKKT  292

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  293   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGIVPSF  348


 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 14/116 (12%)
 Frame = +1

Query  472  VLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVA  651
            +LD + T+G+           WAR+CD CRSA  SV+CRA  A+LC  CDAR+H + T  
Sbjct  1    MLDGEATMGT-----------WARMCDTCRSAPSSVFCRAHTAFLCATCDARLHASLTW-  48

Query  652  GRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
              HERV VCEACE APA  +CKADAASLCA+CD+DIH+ANPLA RHHRVPILPI+ 
Sbjct  49   --HERVWVCEACERAPAAFLCKADAASLCASCDADIHAANPLASRHHRVPILPIAA  102



>ref|NP_001236860.1| CONSTANS-like 2b [Glycine max]
 gb|ABD17254.1| CONSTANS-like 2b [Glycine max]
Length=328

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MD+GVVPES + D SI+H+R  KGTIDLFSGPPIQ+P     S MDREARVLRYREKKK 
Sbjct  215   MDIGVVPESPMRDVSIAHTRPPKGTIDLFSGPPIQVPSHF--SPMDREARVLRYREKKKM  272

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  273   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGIVPSF  328


 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             W R+CD CRS   +V+CR+  A+LC  CD R+H + T    HERV VCEACE APA  +
Sbjct  10   TWPRMCDTCRSVPSTVFCRSHTAFLCATCDTRLHVSLTW---HERVWVCEACERAPAAFL  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPI  813
            CKADAASLCA+CD+DIH+ANPLA RHHRVPILPI
Sbjct  67   CKADAASLCASCDADIHAANPLASRHHRVPILPI  100



>gb|AAS67379.1| CONSTANS 3 [Solanum lycopersicum]
Length=409

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 166/274 (61%), Gaps = 20/274 (7%)
 Frame = +1

Query  505   SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
             SG   G+   WARVCD CRS  C++YC+AD AYLC  CDAR+H A+ V  RH+RV VCEA
Sbjct  7     SGGLDGSSNYWARVCDSCRSVTCTIYCQADSAYLCADCDARIHAASLVTSRHKRVWVCEA  66

Query  685   CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
             CE APA  +CKADAASLCA+CD+DIHSANPLA RHHR+PI+ I GTLYGPP        S
Sbjct  67    CERAPAAFLCKADAASLCASCDADIHSANPLAHRHHRIPIITIPGTLYGPPAVETVGGDS  126

Query  865   MMVGLTGDAAEEDNGFLtqdaee-----ttmdededeaaSWlllnpnpnpnpnpVKSnns  1029
             MM+  +     ED+GFL+   +         DEDEDEAASWLLLN     N     +NN+
Sbjct  127   MMISGSTGEGTEDDGFLSLTQDADDTIIDEEDEDEDEAASWLLLNHPVKNNNKNNVNNNN  186

Query  1030  tnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYS-VPQRNMSY  1206
                               E VD YLDLAE+    ++ F D+Y++NQQQ    VPQ  MSY
Sbjct  187   NQTNNYDMLFGG------EVVDDYLDLAEYGG--DSQFNDQYNVNQQQQQYFVPQ--MSY  236

Query  1207  RGDSIVP-NHGKNQ---FHYTQGLQQHNHHAIFN  1296
              GDS+VP   G+ +   F+  Q  QQ +HH  F 
Sbjct  237   GGDSVVPVQDGQGKPLIFYQQQQQQQQSHHQNFQ  270


 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES L +TS S  R  KGTI+LFSG PIQ+P    L+ MDREARVLRYREKKK RKFEKT
Sbjct  303   PESALCETSNSQPRPQKGTIELFSGHPIQIP---LLTPMDREARVLRYREKKKNRKFEKT  359

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM +S Y IVPSF
Sbjct  360   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLMTDSSYRIVPSF  409



>ref|NP_001235843.1| zinc finger protein CONSTANS-LIKE 2 [Glycine max]
 gb|ABD28283.1| zinc finger protein CONSTANS-LIKE 2 [Glycine max]
Length=352

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MD+GVVPES + D SI+H+R  KGTIDLFSGPPIQ+P     S MDREARVLRYREKKK 
Sbjct  239   MDIGVVPESPMRDVSIAHTRPPKGTIDLFSGPPIQVPSHF--SPMDREARVLRYREKKKM  296

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  297   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGIVPSF  352


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             W R+CD CRS   +V+CR+  A+LC  CD R+H + T    HERV VCEACE APA  +
Sbjct  10   TWPRMCDTCRSVPSTVFCRSHTAFLCATCDTRLHVSLTW---HERVWVCEACERAPAAFL  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPI  813
            CKADAASLCA+CD+DIH+ANPLA RHHRVPILPI
Sbjct  67   CKADAASLCASCDADIHAANPLASRHHRVPILPI  100



>gb|AEA50856.1| col2b [Populus tremula]
Length=114

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPEST+S+ SIS  R  KGT++LFS   IQMPPQL  S MDREARVLRYR
Sbjct  1     VSMSSMDVGVVPESTVSEISISQHRTPKGTLELFSSTAIQMPPQL--SPMDREARVLRYR  58

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKR D + E DQ+F + LMAE+GYG
Sbjct  59    EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDAEVEDDQMFSSTLMAETGYG  114



>gb|ADO60999.1| CONSTANS-like 2 [Helianthus annuus]
Length=385

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + VS+SSM+VGVVP+ST+++ S+SHSR SKGTIDLFS PP+Q+    QL+ MDREARV
Sbjct  263   LTHSVSMSSMEVGVVPDSTITEASLSHSRPSKGTIDLFSNPPVQV--ATQLTPMDREARV  320

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTI YASRKAYAETRPRIKGRFAKRT+ D +VDQ+F    M E GYG
Sbjct  321   LRYREKKKTRKFEKTIXYASRKAYAETRPRIKGRFAKRTNXDVDVDQMFPTNHMLEGGYG  380

Query  1976  IVPSF  1990
             IVPSF
Sbjct  381   IVPSF  385


 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATV  708
             WARVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  
Sbjct  15   TWARVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAF  74

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
            ICKADAASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D
Sbjct  75   ICKADAASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVD  134

Query  889  AAEEDNGFL  915
            +    +GFL
Sbjct  135  S---QSGFL  140



>gb|ADO60998.1| CONSTANS-like 2 [Helianthus annuus]
Length=385

 Score =   158 bits (400),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + VS+SSM+VGVVP+ST+++ S SH R SKGTIDLFS PP+Q+    QL+ MDREARV
Sbjct  263   LTHSVSMSSMEVGVVPDSTITEASFSHPRPSKGTIDLFSNPPVQV--ATQLTPMDREARV  320

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ D +VDQ+F    M E GYG
Sbjct  321   LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTNADVDVDQMFPTNHMLEGGYG  380

Query  1976  IVPSF  1990
             IVPSF
Sbjct  381   IVPSF  385


 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATV  708
             WARVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  
Sbjct  15   TWARVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAF  74

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
            ICKADAASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D
Sbjct  75   ICKADAASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVD  134

Query  889  AAEEDNGFL  915
            +    +GFL
Sbjct  135  S---QSGFL  140



>gb|AGM20690.1| COL1-1 [Populus tomentosa]
Length=373

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPEST+S+ SIS  R  KGTI+LFS   IQMP QL  S MDREARVLRYR
Sbjct  255   VSMSSMDVGVVPESTVSEISISQHRTPKGTIELFSSTAIQMPSQL--SPMDREARVLRYR  312

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKR DV+ E DQ+F + LM E+GYGIVP 
Sbjct  313   EKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKDVELEDDQMFSSTLMTETGYGIVPL  372

Query  1988  F  1990
             F
Sbjct  373   F  373


 Score =   150 bits (379),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = +1

Query  502  SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
            S GSR G+  N ARVCD CR+AAC+VYCRAD A+LC GCDARVH AN VA RHERV VCE
Sbjct  6    SRGSRGGD--NRARVCDTCRAAACTVYCRADSAFLCAGCDARVHAANCVASRHERVWVCE  63

Query  682  ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ACE APA ++CKADAASLC ACD+DIHSANPLARRH RVPILPISG L+G
Sbjct  64   ACERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLHG  113



>ref|XP_004232119.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
lycopersicum]
Length=409

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
            SG   G+   WARVCD CRS  C++YC+AD AYLC  CDAR+H A+ V  RH+RV VCEA
Sbjct  7    SGGLDGSSNYWARVCDSCRSVTCTIYCQADSAYLCADCDARIHAASLVTSRHKRVWVCEA  66

Query  685  CESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESS  864
            CE APA  +CKADAASLCA+CD+DIHSANPLA RHHR+PI+ I GTLYGPP        S
Sbjct  67   CERAPAAFLCKADAASLCASCDADIHSANPLAHRHHRIPIITIPGTLYGPPAVETVGGDS  126

Query  865  MMVGLTGDAAEEDNGFL  915
            MM+  +     ED+GFL
Sbjct  127  MMISGSTGEGTEDDGFL  143


 Score =   134 bits (337),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 3/110 (3%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES L +TS S  R  KGTI+LFSG PIQ+P    L+ MDREARVLRYREKKK RKFEKT
Sbjct  303   PESALCETSNSQPRPQKGTIELFSGHPIQIP---LLTPMDREARVLRYREKKKNRKFEKT  359

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LM +S Y IVPSF
Sbjct  360   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTQLMTDSSYRIVPSF  409



>gb|ACH47948.3| constans-like protein [Olea europaea]
Length=380

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 101/125 (81%), Gaps = 4/125 (3%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             + + VS SS+DVGVVPEST S+ S+ H R  KGTIDLFS PPI MP   QLS MDREARV
Sbjct  260   ISHTVSFSSLDVGVVPESTTSEVSVPHPRPPKGTIDLFSSPPIPMP--TQLSPMDREARV  317

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKK RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV    +Q+F + L+ E GYG
Sbjct  318   LRYREKKKARKFEKTIRYASRKAYAETRPRIKGRFAKRTDV--RANQMFSSTLIEEGGYG  375

Query  1976  IVPSF  1990
             IVPSF
Sbjct  376   IVPSF  380


 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +1

Query  502  SSGSRSGNKQN-WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVC  678
            S G   GN  + WAR+CD C+SA C++YCRAD AYLC GCD+R+H  +  A RH+R+ VC
Sbjct  6    SRGVHGGNTSSHWARICDTCQSAVCTMYCRADSAYLCTGCDSRIHRTSPEASRHQRMWVC  65

Query  679  EACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRE  858
            EACE APA  +CKADAASLC  CDSDIHSA PLARRH RVPILPI G L G P++     
Sbjct  66   EACERAPAAFLCKADAASLCITCDSDIHSAQPLARRHQRVPILPIPGMLCGTPSAP--YP  123

Query  859  SSMMVGLTGDAAE  897
            S +++G TG AA+
Sbjct  124  SGLVMGPTGVAAK  136



>emb|CBI16899.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 106/142 (75%), Gaps = 11/142 (8%)
 Frame = +1

Query  424  ARKHSKKPMLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAY  603
            A  HS   MLK+E C           ++ + +G    WARVCD CRSAAC++YCRAD AY
Sbjct  63   AHSHSLTHMLKDEGC-----------NADAAAGGGGGWARVCDTCRSAACTIYCRADSAY  111

Query  604  LCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLAR  783
            LC GCDAR+H AN VA +HERV VCE+CE APA  +CKADAASLCA CD+DIHSANPLAR
Sbjct  112  LCAGCDARIHAANRVASQHERVWVCESCERAPAAFVCKADAASLCATCDADIHSANPLAR  171

Query  784  RHHRVPILPISGTLYGPPTSNP  849
            RHHRVP+LPI+G LYGPP ++P
Sbjct  172  RHHRVPVLPIAGCLYGPPATDP  193


 Score =   152 bits (383),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 96/110 (87%), Gaps = 4/110 (4%)
 Frame = +2

Query  1667  STLSDTSIS--HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             +T+SD SIS  H R  KGTIDLFSGPPIQMP   QL+ MDREARVLRYREKKKTRKFEKT
Sbjct  331   TTMSDISISISHPRPPKGTIDLFSGPPIQMP--TQLTPMDREARVLRYREKKKTRKFEKT  388

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   LMAESGYGIVPSF
Sbjct  389   IRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTLMAESGYGIVPSF  438



>gb|ACZ67161.1| GATA-4/5/6 transcription factor, partial [Populus deltoides]
Length=117

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 98/119 (82%), Gaps = 2/119 (2%)
 Frame = +2

Query  1628  VSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYr  1807
             VS+SSMDVGVVPEST+S+ SIS  R  K TI+LFS   IQMP QL  S MDREARVLRYR
Sbjct  1     VSMSSMDVGVVPESTMSEISISQHRTPKRTIELFSSTAIQMPSQL--SPMDREARVLRYR  58

Query  1808  ekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVP  1984
             EKKKTRKFEKTIRYASRKAYAETRPR+KGRFAKR DV+ E D+ F + LMA +G GIVP
Sbjct  59    EKKKTRKFEKTIRYASRKAYAETRPRVKGRFAKRKDVEVEDDRTFSSTLMAGTGCGIVP  117



>gb|ACB36912.1| CONSTANS-like protein 2 [Oxybasis rubra]
Length=336

 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PEST+SD S+SHSR  KGTIDLFS PP+Q+P   QLS +DREARV+RYREKKK RKFEKT
Sbjct  229   PESTMSDMSVSHSRPPKGTIDLFSSPPMQVP--TQLSPLDREARVMRYREKKKNRKFEKT  286

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ E+DQ+F   LM++ GYGIVPSF
Sbjct  287   IRYASRKAYAETRPRIKGRFAKRTDVEAEMDQMFTNSLMSDGGYGIVPSF  336


 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +1

Query  520  GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
            G+  +WARVCD CRSA C+VYC+ D A+LC  CDAR+H  N VA RHERV VCEACE  P
Sbjct  9    GDNNSWARVCDTCRSAPCTVYCKEDSAFLCTSCDARIHAVNQVASRHERVWVCEACEREP  68

Query  700  ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP  834
            A  +CKADAASLCA CD+DIHSANPLARRHHRVPI+P+ G +YGP
Sbjct  69   AAFLCKADAASLCATCDADIHSANPLARRHHRVPIMPV-GCVYGP  112



>dbj|BAM67031.1| constans-like 1 [Chrysanthemum seticuspe f. boreale]
Length=387

 Score =   152 bits (385),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G  +  +   +L + VS+SSM+VGVVP+ST ++ S+S  R SKGTIDLFS P +Q+  
Sbjct  252   SNGGASGGYGYPVLTHSVSMSSMEVGVVPDSTRTEHSLSTPRPSKGTIDLFSNPQVQVA-  310

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
               QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ D +VDQ
Sbjct  311   -TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTNGDVDVDQ  369

Query  1937  IFYAPLMAESGYGIVPSF  1990
             +F    M E GYGIVPSF
Sbjct  370   MFPTNHMVEGGYGIVPSF  387


 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 8/129 (6%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATV  708
             +ARVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  
Sbjct  15   TFARVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAF  74

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
            ICKADAASLC  CD+DIH+ANPLARRHHRVP++PI G +YGP  ++P      ++GL GD
Sbjct  75   ICKADAASLCVTCDADIHAANPLARRHHRVPVMPIPGAMYGPRANDP----RSVIGLGGD  130

Query  889  AAEEDNGFL  915
            +    +GFL
Sbjct  131  S---QSGFL  136



>ref|XP_010261698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nelumbo 
nucifera]
 ref|XP_010261708.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Nelumbo 
nucifera]
Length=367

 Score =   152 bits (383),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             +D  VVP+  ++D S SHSR  KGTIDLFS PP+ MPPQ   + MDREA+VLRYREK+KT
Sbjct  254   IDASVVPDGIMNDISNSHSRPPKGTIDLFSSPPLPMPPQF--TPMDREAKVLRYREKRKT  311

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   ++AESGYGIVPSF
Sbjct  312   RKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVDQMFSTTVLAESGYGIVPSF  367


 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WAR+CD C SA C+VYCRAD AYLC GCDAR+H  + V  +HERV +CE CE APA   C
Sbjct  18   WARMCDSCCSAPCAVYCRADSAYLCAGCDARIH--DQVVSQHERVWICEVCERAPAAFTC  75

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCR  855
            KADAA+LC  CD+DIHSANPLARRHHRVPILPISG LYGP   NP R
Sbjct  76   KADAAALCTTCDADIHSANPLARRHHRVPILPISGCLYGPSGMNPGR  122



>ref|XP_006338763.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Solanum 
tuberosum]
Length=279

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES LS+TS SHSR  KGTIDLFSGPPIQ+PPQL  + MDREARVLRYREKKK RKFEKT
Sbjct  172   PESALSETSNSHSRPQKGTIDLFSGPPIQIPPQL--TPMDREARVLRYREKKKNRKFEKT  229

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EV Q+F   LMA+S Y IVPSF
Sbjct  230   IRYASRKAYAETRPRIKGRFAKRTDVEAEVYQMFSTQLMADSSYRIVPSF  279


 Score = 59.3 bits (142),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = +1

Query  1078  AVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSIVP---NHGKNQ  1245
             A E VD YLDLAE+    ++ F D+Y++NQQQ  YSVPQ+  SY GDS+VP     GK+ 
Sbjct  69    AGEVVDDYLDLAEYGG--DSQFNDQYNVNQQQQHYSVPQK--SYGGDSVVPVQDGQGKSL  124

Query  1246  FHYTQGLQQHNHHAIFNC  1299
             F Y    QQ +HH  F  
Sbjct  125   FFYHH--QQQSHHLNFQL  140


 Score = 25.8 bits (55),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 1/22 (5%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASI  1352
             NFQL GM+Y+N  T  GYPAS+
Sbjct  137   NFQL-GMDYDNSYTRLGYPASM  157



>gb|KEH21799.1| zinc finger constans-like protein [Medicago truncatula]
Length=396

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  472  VLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVA  651
            +L+ D    +S+ +   +   WAR CD CRSA C+V+CRAD AYLC  CDAR+H AN VA
Sbjct  1    MLEQDFLTTTSATATVRSAGTWARTCDTCRSAPCAVFCRADSAYLCAACDARIHAANRVA  60

Query  652  GRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
             RHERV VCEACE APA  +CKADAASLC+ CD+DIHSANPLA RH RVPILPISG LYG
Sbjct  61   SRHERVWVCEACERAPAAFLCKADAASLCSTCDADIHSANPLASRHQRVPILPISGYLYG  120

Query  832  PPTS  843
            PP +
Sbjct  121  PPAT  124


 Score =   133 bits (334),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 89/110 (81%), Gaps = 7/110 (6%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PEST++     +SR  KGTIDLFSGP IQM      S MDREARVLRYREKKKTRKFEKT
Sbjct  294   PESTMT-----YSRPPKGTIDLFSGPSIQMSSHF--SPMDREARVLRYREKKKTRKFEKT  346

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  347   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTSLITEVGYGIVPSF  396



>gb|AGF86398.1| CONSTANS-like protein [Chrysanthemum x morifolium]
Length=387

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G  +  +   +L + VS+SSM+VGVVP+ST ++ S+S  R +KGTIDLFS P +Q+  
Sbjct  252   SNGGASGGYGYHVLTHSVSMSSMEVGVVPDSTRTEHSLSTPRPAKGTIDLFSNPQVQVA-  310

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
               QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ D +VDQ
Sbjct  311   -TQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTNGDVDVDQ  369

Query  1937  IFYAPLMAESGYGIVPSF  1990
             +F    M E GYGIVPSF
Sbjct  370   MFPTNHMVEGGYGIVPSF  387


 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 8/129 (6%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATV  708
            ++ARVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  
Sbjct  15   SFARVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAF  74

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
            ICKADAASLC  CD+DIH+ANPLARRHHRVP++PI G +YGP  ++P      ++GL  D
Sbjct  75   ICKADAASLCVTCDADIHAANPLARRHHRVPVMPIPGAMYGPRANDP----RSVIGLGVD  130

Query  889  AAEEDNGFL  915
            +    +GFL
Sbjct  131  S---HSGFL  136



>gb|AAX47172.1| CONSTANS-LIKE a [Pisum sativum]
Length=405

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             W R CD CRSA C+V+CRAD AYLC GCDAR+H AN VA RHERV VCEACE APA  +
Sbjct  19   TWPRTCDTCRSAPCAVFCRADSAYLCAGCDARIHAANRVASRHERVWVCEACERAPAAFL  78

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTS  843
            CKADAASLC++CD+DIHSANPLA RH RVPILPISG LYGPPT+
Sbjct  79   CKADAASLCSSCDADIHSANPLASRHQRVPILPISGYLYGPPTT  122


 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 93/111 (84%), Gaps = 3/111 (3%)
 Frame = +2

Query  1661  PESTLSD-TSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfek  1837
             PEST+ D T++S+SR SKGTIDLFS PPIQM      S MDREARVLRY EKKKTRKFEK
Sbjct  296   PESTMRDATTMSYSRPSKGTIDLFSAPPIQMTSHF--SPMDREARVLRYLEKKKTRKFEK  353

Query  1838  tIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             TIRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L+ E GYGIVPSF
Sbjct  354   TIRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLITEVGYGIVPSF  404



>gb|AAS00055.1| CONSTANS-like protein CO2 [Populus deltoides]
Length=372

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 103/129 (80%), Gaps = 2/129 (2%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDR  1783
             Y  ++   VS+SSMDVGVVPEST+S+ SIS  R  K TI+LFS   IQMP QL  S MDR
Sbjct  246   YNGLISQSVSMSSMDVGVVPESTMSEISISQHRTPKRTIELFSSTAIQMPSQL--SPMDR  303

Query  1784  EARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAE  1963
             EARVLRYREKKKTRKFEKTIRYASRKAYAETRPR+KGRFAKR DV+ E D+ F + LMA 
Sbjct  304   EARVLRYREKKKTRKFEKTIRYASRKAYAETRPRVKGRFAKRKDVEVEDDRTFSSTLMAG  363

Query  1964  SGYGIVPSF  1990
             +G GIVPSF
Sbjct  364   TGCGIVPSF  372


 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = +1

Query  502  SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
            SSGS  G+  N AR+CD CR+AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCE
Sbjct  6    SSGSGGGD--NRARLCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVWVCE  63

Query  682  ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            +CE APA ++CKADAASLC ACD+DIHSANPLARRH RVPILPISG L+G
Sbjct  64   SCERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLHG  113


 Score = 45.8 bits (107),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 7/66 (11%)
 Frame = +1

Query  1090  VDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP-NHGKNQFHYTQGL  1266
             VD YLDL E++SC  N   D+Y+   QQ+Y VP +  SY GD +VP  +G+ + H  Q  
Sbjct  173   VDEYLDLVEYNSCTENQCSDQYN---QQHYCVPPK--SYGGDRVVPIQYGEGKDHQQQ-R  226

Query  1267  QQHNHH  1284
             Q HN  
Sbjct  227   QYHNFQ  232


 Score = 26.6 bits (57),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (4%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPASISHTVSF  1370
             NFQL G+EYE     Y Y   IS +VS 
Sbjct  230   NFQL-GLEYEPSKAAYSYNGLISQSVSM  256



>gb|AHB64449.1| CONSTANS-like protein [Chrysanthemum x morifolium]
Length=387

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G  +  +   +L + VS+SSM+VGVVP+ST ++ S+S  R +KGTIDLFS P +Q+  
Sbjct  252   SNGGASGGYGYPVLTHSVSMSSMEVGVVPDSTRTEHSLSTPRPAKGTIDLFSNPQVQV--  309

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
               QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ D +VDQ
Sbjct  310   ATQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTNGDVDVDQ  369

Query  1937  IFYAPLMAESGYGIVPSF  1990
             +F    M E GYGIVPSF
Sbjct  370   MFPTNHMVEGGYGIVPSF  387


 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 8/129 (6%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATV  708
             +ARVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  
Sbjct  15   TFARVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAF  74

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGD  888
            ICKADAASLC  CD+DIH+ANPLARRHHRVP++PI G +YGP  ++P      ++GL  D
Sbjct  75   ICKADAASLCVTCDADIHAANPLARRHHRVPVMPIPGAMYGPRANDP----RSVIGLGVD  130

Query  889  AAEEDNGFL  915
            +    +GFL
Sbjct  131  S---HSGFL  136



>gb|AGM20665.1| COL1-2 [Populus tomentosa]
Length=323

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = +1

Query  502  SSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCE  681
            S GSR G+  N ARVCD CR+AAC+VYCRAD A+LC GCDARVH AN VA RHERV VCE
Sbjct  6    SRGSRGGD--NRARVCDTCRAAACTVYCRADSAFLCAGCDARVHAANCVASRHERVWVCE  63

Query  682  ACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ACE APA ++CKADAASLC ACD+DIHSANPLARRH RVPILPISG L+G
Sbjct  64   ACERAPAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLHG  113



>ref|XP_010479901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L Y  S+SSMD+ VVPEST SD ++ H R +K TID  SGPP QM  QL  + M+REARV
Sbjct  224   LNYSASVSSMDISVVPESTASDITVQHPRTTKETIDQLSGPPTQMVQQL--TPMEREARV  281

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ + ++IF   LM+E+GYG
Sbjct  282   LRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEADAEEIFSTSLMSETGYG  341

Query  1976  IVPSF  1990
             IVPSF
Sbjct  342   IVPSF  346


 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 128/340 (38%), Positives = 160/340 (47%), Gaps = 81/340 (24%)
 Frame = +1

Query  532   NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             NWAR CD CRSAAC+VYC AD AYLC  CDARVH AN VA RHERV VCE+CESAPA  +
Sbjct  11    NWARACDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRVCESCESAPAAFL  70

Query  712   CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDA  891
             CKADAASLC ACD++IHSANPLARRH RVPILP+S         N C  SSM    T   
Sbjct  71    CKADAASLCTACDAEIHSANPLARRHQRVPILPLSA--------NSC--SSMAPSETDSD  120

Query  892   AEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnem  1071
              +ED+                                   V S    N  K     NN  
Sbjct  121   NDEDD---------------------------------IEVASWLLPNPGKNSGTQNNGF  147

Query  1072  scAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP--------  1227
                VE +D    L ++SS  +N F+D         YS  QR  S+ GD +VP        
Sbjct  148   LFGVEYLD----LVDYSSSMDNQFDD-------HQYSQYQR--SFGGDGVVPLQVEESTS  194

Query  1228  -------------NHG-KNQFHYTQGLQQHNHHAIFNCKEWNM--RILTRDMVIQHPSVT  1359
                          N+G  +  HY   L+  N+ A  +  + ++       D+ +QHP  T
Sbjct  195   HLQQSQHNFHLGINYGCSSGAHYNNSLKDLNYSASVSSMDISVVPESTASDITVQHPRTT  254

Query  1360  Q*VFFIISNCLTSG-KTILFFYFFMRNLRYQYSNKTQRQD  1476
             +     +S   T   + +       R LRY+   KT++ D
Sbjct  255   KETIDQLSGPPTQMVQQLTPMEREARVLRYREKKKTRKFD  294



>ref|XP_004137263.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Cucumis 
sativus]
 gb|KGN53769.1| hypothetical protein Csa_4G124910 [Cucumis sativus]
Length=344

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 107/138 (78%), Gaps = 9/138 (7%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPEST---LSDTSISHSRASKGTIDLFSGPPIQMP------P  1756
             Y   L + +S+SSM+VGVVPEST   +SD SIS+ R  KGTIDLFSG     P      P
Sbjct  207   YNGFLTHAISVSSMEVGVVPESTATIMSDISISNMRPPKGTIDLFSGMIAAEPAAASQMP  266

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
               QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ ++D+
Sbjct  267   AAQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVQLDR  326

Query  1937  IFYAPLMAESGYGIVPSF  1990
              +  PLM ++GYGIVPSF
Sbjct  327   KYSNPLMPDAGYGIVPSF  344


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  670  LVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPI  804
            ++CEACE  PA  ICKADAASLCAACD++IHSANPLARRH RVPI
Sbjct  19   VICEACERCPAEFICKADAASLCAACDAEIHSANPLARRHQRVPI  63



>ref|XP_010485482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Camelina sativa]
Length=346

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L Y  S+SSMD+ VVPEST SD ++ H R +K TID  SGPP QM  QL  + M+REARV
Sbjct  224   LNYSASVSSMDISVVPESTASDITVQHPRTTKETIDQLSGPPTQMVQQL--TPMEREARV  281

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ + ++IF   LM+E+GYG
Sbjct  282   LRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEADAEEIFSTSLMSETGYG  341

Query  1976  IVPSF  1990
             IVPSF
Sbjct  342   IVPSF  346


 Score =   141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 135/368 (37%), Positives = 168/368 (46%), Gaps = 99/368 (27%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLKEES E               SGN   WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1     MLKEESNE---------------SGN---WARACDTCRSAACTVYCEADSAYLCNTCDAR  42

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RHERV VC++CESAPA  +CKADAASLC  CD++IHSANPLARRH RVPIL
Sbjct  43    VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTTCDAEIHSANPLARRHQRVPIL  102

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             P+S         N C  SSM    T    +ED+                           
Sbjct  103   PLSA--------NSC--SSMAPSETDADNDEDD---------------------------  125

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
                     V S    N  K     NN     VE +D    L ++SS  +N F+D      
Sbjct  126   ------REVASWLLPNPGKNSGTQNNGFLFGVEYLD----LVDYSSSMDNQFDD------  169

Query  1168  QQNYSVPQRNMSYRGDSIVP---------------------NHG-KNQFHYTQGLQQHNH  1281
                YS  QR  S+ GD +VP                     N+G  +  HY   L+  N+
Sbjct  170   -HQYSQYQR--SFGGDGVVPLQVEESTSHLQQSQHNFHLGINYGCSSGAHYNNSLKDLNY  226

Query  1282  HAIFNCKEWNM--RILTRDMVIQHPSVTQ*VFFIISNCLTSG-KTILFFYFFMRNLRYQY  1452
              A  +  + ++       D+ +QHP  T+     +S   T   + +       R LRY+ 
Sbjct  227   SASVSSMDISVVPESTASDITVQHPRTTKETIDQLSGPPTQMVQQLTPMEREARVLRYRE  286

Query  1453  SNKTQRQD  1476
               KT++ D
Sbjct  287   KKKTRKFD  294



>ref|XP_008455579.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Cucumis melo]
Length=349

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 11/139 (8%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPEST---LSDTSISHSRASKGTIDLFSGPP-------IQMP  1753
             Y   L + +S+SSM+VGVVPEST   +SD SIS+ R  KGTIDLFSG         IQMP
Sbjct  212   YNGFLTHAISVSSMEVGVVPESTTTTMSDISISNVRPPKGTIDLFSGTTAAEVAVGIQMP  271

Query  1754  PQLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVD  1933
                QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ ++D
Sbjct  272   A-AQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVQLD  330

Query  1934  QIFYAPLMAESGYGIVPSF  1990
             + +  PL+ ++GYGIVPSF
Sbjct  331   RKYSNPLLPDAGYGIVPSF  349


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  673  VCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPI  804
            +CEACE  PA  ICKADAASLCAACD++IHSANPLARRH RVPI
Sbjct  20   ICEACERCPAEFICKADAASLCAACDAEIHSANPLARRHQRVPI  63



>ref|XP_004491763.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Cicer arietinum]
Length=377

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
             W R CD CRSAAC+V+CRADLAYLC  CDARVH AN VA RHERV VCEACE APA  +
Sbjct  25   TWPRTCDTCRSAACAVFCRADLAYLCAACDARVHAANRVASRHERVWVCEACERAPAAFL  84

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTS  843
            CKADAASLC+ CD+DIHSANPLA RH RVPIL ISG LYGPP +
Sbjct  85   CKADAASLCSTCDADIHSANPLASRHQRVPILTISGYLYGPPAT  128


 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 91/110 (83%), Gaps = 7/110 (6%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PEST++     +SR  KGTIDLFSGPPIQM      S MDREARVLRYREKKKTRKFEKT
Sbjct  275   PESTMT-----YSRPPKGTIDLFSGPPIQMTSHF--SPMDREARVLRYREKKKTRKFEKT  327

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F + L+ E GYGIVPSF
Sbjct  328   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSSTLITEIGYGIVPSF  377



>gb|ACV88633.1| CONSTANS [Magnolia virginiana]
Length=365

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  529  QNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATV  708
            + WARVCD CRSAAC+ YCRAD AYLC GCD+R H AN VA RHERV VCE+CE APA V
Sbjct  8    RRWARVCDSCRSAACTAYCRADAAYLCAGCDSRTHAANRVASRHERVWVCESCERAPAAV  67

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPP  837
             CKADAA+LC ACD DIHSANPLARRHHR PILPISG LY  P
Sbjct  68   SCKADAAALCTACDVDIHSANPLARRHHRTPILPISGQLYSSP  110


 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +2

Query  1643  MDVGVVPEST-LSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkk  1819
             MD  VVP++T ++D S SH R  KGTIDLF+GPP+QM P  Q S MDREARVLRYREKKK
Sbjct  250   MDASVVPDATAMTDISNSHVRPPKGTIDLFAGPPLQMMP-AQFSPMDREARVLRYREKKK  308

Query  1820  trkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             TRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ EV Q+F   +MAES Y IVPSF
Sbjct  309   TRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVEVHQMFSTTVMAESRYSIVPSF  365



>gb|ABF17844.1| CONSTANS [Solanum tuberosum]
Length=323

 Score =   142 bits (359),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 135/215 (63%), Gaps = 14/215 (7%)
 Frame = +1

Query  598   AYLCGGCDARVH-GANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANP  774
             AYLC  CDAR+   A+ +A RHERV VCEACE APA  +CKADAASLCA+CD DIHSANP
Sbjct  1     AYLCAVCDARITIAASLMASRHERVWVCEACERAPAAFLCKADAASLCASCDVDIHSANP  60

Query  775   LARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdede  954
             LARRHHRVPI+PI GTLYGPP  +     SMM+G T     ED+GFL+   +       E
Sbjct  61    LARRHHRVPIMPIPGTLYGPPAVHTVSGGSMMIGGTTGEGTEDDGFLSLTQDADDTTIAE  120

Query  955   d---eaaSWlllnpnpnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSS  1125
             +   EAASWLLLNP    N     +NN+ N                E VD YLDLAE+  
Sbjct  121   EDENEAASWLLLNPPVKNNNKNNINNNNNNQNNNYGMLFGG-----EVVDEYLDLAEYGG  175

Query  1126  CHNNLFEDKYSINQQQN-YSVPQRNMSYRGDSIVP  1227
               ++ F D+YS+ QQQ  YSVPQ+  SY  DS+VP
Sbjct  176   --DSQFNDQYSVKQQQQHYSVPQK--SYVEDSVVP  206


 Score = 37.0 bits (84),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 18/20 (90%), Gaps = 1/20 (5%)
 Frame = +3

Query  1287  NFQLQGMEYENFNTGYGYPA  1346
             NFQL GMEY+N NTGYGYPA
Sbjct  235   NFQL-GMEYDNSNTGYGYPA  253


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLR  1801
             MDV VVPES LS+ S SH R  KGTIDLFSGPPIQ+PP  QL+ MDREA VL 
Sbjct  264   MDVSVVPESALSEASNSHPRPPKGTIDLFSGPPIQIPP--QLTPMDREAGVLE  314



>ref|XP_010463643.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L Y  S+SSMD+ VVP+ST SD ++ H R +K TID  SGPP QM  QL  + M+REARV
Sbjct  224   LNYSASVSSMDISVVPDSTASDITVQHPRTTKETIDQLSGPPTQMVQQL--TPMEREARV  281

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ + ++IF   LM+E+GYG
Sbjct  282   LRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEADAEEIFSTSLMSETGYG  341

Query  1976  IVPSF  1990
             IVPSF
Sbjct  342   IVPSF  346


 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            NWAR CD CRSAAC+VYC AD AYLC  CDARVH AN VA RHERV VC++CESAPA  +
Sbjct  11   NWARSCDTCRSAACTVYCEADSAYLCNTCDARVHAANRVASRHERVRVCQSCESAPAAFL  70

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
            CKADAASLC ACD++IHSANPLARRH RVPILP+S 
Sbjct  71   CKADAASLCTACDAEIHSANPLARRHQRVPILPLSA  106



>ref|XP_010694604.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Beta vulgaris 
subsp. vulgaris]
 gb|ACC95129.1| COL1 [Beta vulgaris subsp. vulgaris]
Length=367

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PES +SD S+SH R  KGTIDLFS PP+Q+P   QLS +DREARV+RYREKKK RKFEKT
Sbjct  260   PESAMSDISMSHPRPPKGTIDLFSSPPMQVP--TQLSPLDREARVMRYREKKKNRKFEKT  317

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ E+DQ+F   LMA+SGYGIVPS+
Sbjct  318   IRYASRKAYAETRPRIKGRFAKRTDVEAEMDQMFTNSLMADSGYGIVPSY  367


 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  517  SGNKQN-WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACES  693
            SG+  N WARVCD CR+A C+VYCRAD A+LC  CDAR+H AN VA RHERV VCEACE 
Sbjct  7    SGSDTNSWARVCDTCRAAPCTVYCRADSAFLCTSCDARIHAANQVASRHERVWVCEACER  66

Query  694  APATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP  834
            APA  +CKADAASLCA CD++IHSANPLARRH RVPI+P++G +YGP
Sbjct  67   APAAFLCKADAASLCATCDAEIHSANPLARRHQRVPIMPVAGCVYGP  113



>ref|XP_011032791.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2 [Populus euphratica]
Length=369

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             MDVGVVPEST+S+ SIS     KGTI+L SG  IQMP QL  S MDREARVLRYREKKKT
Sbjct  256   MDVGVVPESTMSEISISQHIPPKGTIELVSGTAIQMPSQL--SPMDREARVLRYREKKKT  313

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKR DV  E DQ+F + LMAE+GYGIVPSF
Sbjct  314   RKFEKTIRYASRKAYAETRPRIKGRFAKRKDVVVEDDQMFSSTLMAETGYGIVPSF  369


 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 94/128 (73%), Gaps = 15/128 (12%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLK+ES               S SG   N ARVCD CR+AAC+VYCRAD AYLC GCDAR
Sbjct  1    MLKQES---------------SGSGGGDNRARVCDTCRAAACTVYCRADSAYLCAGCDAR  45

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             H AN VA RHERV VCEACE APA ++CKADAASLC ACD+DIHSANPLA RH RVPIL
Sbjct  46   EHAANCVASRHERVRVCEACERAPAALLCKADAASLCTACDADIHSANPLASRHQRVPIL  105

Query  808  PISGTLYG  831
            PISG ++G
Sbjct  106  PISGCVHG  113



>gb|ACB36911.2| CONSTANS-like protein 1 [Oxybasis rubra]
Length=365

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PEST+SD S+SHSR  KGTIDLFS  P+Q+P   QLS +DREARV+RYREKKK RKFEKT
Sbjct  258   PESTMSDMSVSHSRPPKGTIDLFSSTPMQVP--TQLSPLDREARVMRYREKKKNRKFEKT  315

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ E+DQ+F   LM++ GYGIVPSF
Sbjct  316   IRYASRKAYAETRPRIKGRFAKRTDVEAEMDQMFTNSLMSDGGYGIVPSF  365


 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +1

Query  520  GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
            G+  +WARVCD CRSA C+VYC+ D A+LC  CDAR+H  N +A RHERV VCEACE  P
Sbjct  8    GDNNSWARVCDTCRSAPCTVYCKEDSAFLCTSCDARIHAVNQMASRHERVWVCEACEREP  67

Query  700  ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGP  834
            A  +CKADAASLCA CD+DIHSANPLARRHHRVPI+P+ G +YGP
Sbjct  68   AAFLCKADAASLCATCDADIHSANPLARRHHRVPIMPV-GCVYGP  111



>ref|XP_010420262.1| PREDICTED: zinc finger protein CONSTANS-like [Camelina sativa]
Length=376

 Score =   147 bits (371),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 147/260 (57%), Gaps = 41/260 (16%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLK+ES           +++GS   N+   AR CDICRS AC+VYC AD AYLC  CDA+
Sbjct  1     MLKQES-----------NNTGSGENNR---ARACDICRSNACTVYCHADSAYLCTSCDAQ  46

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RH+RV VCE+CE APA  +C AD ASLC ACDS++HSANPLARRHHRVPIL
Sbjct  47    VHSANRVASRHKRVRVCESCERAPAAFLCVADDASLCTACDSEVHSANPLARRHHRVPIL  106

Query  808   PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnp  987
             PISG  Y   +++   E++M         E++ G            ED  +  SWL  N 
Sbjct  107   PISGNSYSSMSTHHQSETTMTDQDKLPIVEQERGV--------EGGEDAKKVPSWLFTNS  158

Query  988   npnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQ  1167
             N N   +   S N+  +                  DAYLDLA+++S  +  F  +Y+  Q
Sbjct  159   NKNKGNHNDNSQNNGFLFS----------------DAYLDLADYNSSMDYQFTSQYN-QQ  201

Query  1168  QQNYSVPQRNMSYRGDSIVP  1227
             QQ+  VPQ   SY GD +VP
Sbjct  202   QQDCGVPQ--TSYGGDRVVP  219


 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L +   ISSM+ GVVPEST    + SH R  K T+D    PP QM    QLS MDREARV
Sbjct  255   LNHNAYISSMETGVVPESTPRVKTASHPRTPKATVDQLPDPPSQMI--TQLSPMDREARV  312

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREK+KTRKFEKTIRYASRKAYAE R  + GRFAKR +++ E D  F   LM ++GYG
Sbjct  313   LRYREKRKTRKFEKTIRYASRKAYAERRLWVNGRFAKRREIEDE-DHEFNIMLMYDTGYG  371

Query  1976  IVPSF  1990
             +VPSF
Sbjct  372   VVPSF  376



>ref|XP_004173366.1| PREDICTED: zinc finger protein CONSTANS-like [Cucumis sativus]
Length=125

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 9/125 (7%)
 Frame = +2

Query  1643  MDVGVVPEST---LSDTSISHSRASKGTIDLFSGPPIQMP------PQLQLSQMDREARV  1795
             M+VGVVPEST   +SD SIS+ R  KGTIDLFSG     P      P  QLS MDREARV
Sbjct  1     MEVGVVPESTATIMSDISISNMRPPKGTIDLFSGMIAAEPAAASQMPAAQLSPMDREARV  60

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDV+ ++D+ +  PLM ++GYG
Sbjct  61    LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDVEVQLDRKYSNPLMPDAGYG  120

Query  1976  IVPSF  1990
             IVPSF
Sbjct  121   IVPSF  125



>ref|XP_010485483.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Camelina 
sativa]
Length=346

 Score =   146 bits (368),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L Y  S+SSMD+ VVPES  SD ++ H R +K TID  SGPP QM  QL  + M+REARV
Sbjct  224   LNYSASVSSMDISVVPESPASDITVQHPRTTKETIDQLSGPPTQMVQQL--TPMEREARV  281

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ + ++IF   LM+E+GYG
Sbjct  282   LRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEADAEEIFSTSLMSETGYG  341

Query  1976  IVPSF  1990
             IVPSF
Sbjct  342   IVPSF  346


 Score =   140 bits (354),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 89/124 (72%), Gaps = 18/124 (15%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES E               SGN   WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKEESNE---------------SGN---WARACDTCRSAACTVYCEADSAYLCNTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VC++CESAPA  +CKADAASLC  CD++IHSANPLARRH RVPIL
Sbjct  43   VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTTCDAEIHSANPLARRHQRVPIL  102

Query  808  PISG  819
            P+S 
Sbjct  103  PLSA  106



>ref|XP_010942234.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Elaeis guineensis]
Length=327

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+  +V ++T++D S SH + SKGTIDLFSGPP+QMPPQ   + M+REA+VLRYREK+KT
Sbjct  214   MEASMVSDTTMADISNSHLQPSKGTIDLFSGPPLQMPPQF--TPMEREAKVLRYREKRKT  271

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKR+DV+ EVDQ+F   +M +S YGIVPSF
Sbjct  272   RKFEKTIRYASRKAYAETRPRIKGRFAKRSDVELEVDQLFSTTMMTDSSYGIVPSF  327


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +1

Query  508  GSRSGNKQNWAR-VCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
            G   GN   WA   C+ CRSA C+VYCRAD A LC  CDA +H AN +A RH RV V  A
Sbjct  9    GDSVGN--GWAPPACESCRSAPCAVYCRADAAALCTACDADIHSANLLARRHHRVPVLPA  66


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  673  VCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPIS  816
             CE+C SAP  V C+ADAA+LC ACD+DIHSAN LARRHHRVP+LP S
Sbjct  20   ACESCRSAPCAVYCRADAAALCTACDADIHSANLLARRHHRVPVLPAS  67



>gb|AFK29460.1| putative flowering-time constans protein [Arabidopsis lyrata 
subsp. lyrata]
Length=347

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N ++  L +  S+SSMD+ VVPEST SD ++ H R +K T D  +GPP Q+  
Sbjct  212   SSGANYNNXFLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETTDQLAGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR  ++   ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIQIEAGAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347


 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 91/124 (73%), Gaps = 10/124 (8%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WAR CD CRSAAC+VYC AD AYLC  CDARVH AN VA RHERV VC++CESAPA  +C
Sbjct  12   WARACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCESAPAAFLC  71

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
            KADAASLC ACD++IHSANPLARRH RVPILP+S        +N C  SSM    T    
Sbjct  72   KADAASLCTACDAEIHSANPLARRHQRVPILPLS--------ANSC--SSMAASETDADN  121

Query  895  EEDN  906
            +ED+
Sbjct  122  DEDD  125


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERV----L  672
            + +R  ++    RVC  C SA  +  C+AD A LC  CDA +H AN +A RH+RV    L
Sbjct  45   AANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPILPL  104

Query  673  VCEACESAPAT  705
               +C S  A+
Sbjct  105  SANSCSSMAAS  115



>ref|XP_003541197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Glycine 
max]
Length=361

 Score =   143 bits (361),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = +1

Query  520  GNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAP  699
            G+   W+ VCD CRSA C +YC AD AYLC  CDARVH AN VA RHERV VCEACE AP
Sbjct  11   GSTGTWSHVCDTCRSAPCVLYCHADSAYLCSSCDARVHAANRVASRHERVWVCEACERAP  70

Query  700  ATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPP  837
            A  +CKADAASLC++CD+DIHSANPLA RHHRVPILPISG+L+G P
Sbjct  71   AAFLCKADAASLCSSCDADIHSANPLASRHHRVPILPISGSLFGEP  116


 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 86/109 (79%), Gaps = 4/109 (4%)
 Frame = +2

Query  1664  ESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfektI  1843
             EST+SD S+SHS++  GT DLF  PP+ MP  L  + MDREARVLRYREKKKTRKFEK I
Sbjct  257   ESTISDISMSHSKSPIGTTDLF--PPLPMPSHL--TPMDREARVLRYREKKKTRKFEKKI  312

Query  1844  RYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L  E G  I P+F
Sbjct  313   RYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTTLFTEVGGSIFPTF  361



>ref|XP_006400111.1| hypothetical protein EUTSA_v10013895mg [Eutrema salsugineum]
 gb|ESQ41564.1| hypothetical protein EUTSA_v10013895mg [Eutrema salsugineum]
Length=365

 Score =   143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA+VH AN VA RHERV VCE+CE APA
Sbjct  4    EESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQVHAANRVASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILP+SG  Y    +N   E+++  
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPVSGDSYSSMATNHSSETTLTT  120


 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             +G VPES  SDT++SH R+ K   +    PP QM     LS MDREARV+RYREKKK RK
Sbjct  257   IGAVPESATSDTTVSHPRSPKAVAEQLPDPPTQM-----LSPMDREARVMRYREKKKMRK  311

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEKTIRYASRKAYAETRPRIKGRFAKR +VD E D+ F   +M ++GYGIVPSF
Sbjct  312   FEKTIRYASRKAYAETRPRIKGRFAKRKEVDAEADKAFSTMIMFDTGYGIVPSF  365



>gb|AEE42605.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEE42606.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEE42607.1| CONSTANS-like 2 [Helianthus annuus]
Length=352

 Score =   143 bits (360),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + VS+SSM+VGVVP+ST+++ S+SHSR SKGTIDLFS PP+Q+    QL+ MDREARV
Sbjct  246   LTHSVSMSSMEVGVVPDSTITEASLSHSRPSKGTIDLFSNPPVQV--ATQLTPMDREARV  303

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIF  1942
             LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT+ D +VDQ+F
Sbjct  304   LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTNADVDVDQMF  352


 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = +1

Query  541  RVCDICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICK  717
            RVCD CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICK
Sbjct  1    RVCDTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICK  60

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAE  897
            ADAASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+  
Sbjct  61   ADAASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS--  118

Query  898  EDNGFL  915
              +GFL
Sbjct  119  -QSGFL  123



>ref|XP_006400110.1| hypothetical protein EUTSA_v10015486mg [Eutrema salsugineum]
 gb|ESQ41563.1| hypothetical protein EUTSA_v10015486mg [Eutrema salsugineum]
Length=354

 Score =   143 bits (360),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 17/158 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES      D+ IG         + N AR CD CRS  C+VYCRAD AYLC  CDA+
Sbjct  1    MLKEES-----KDIGIG---------EYNMARACDTCRSTPCTVYCRADSAYLCTSCDAQ  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RH+RV VCE+CE APA  +C+AD ASLC ACDS++HSANPLARRHHRVPIL
Sbjct  47   VHSANRVASRHKRVQVCESCERAPAAFLCEADDASLCIACDSEVHSANPLARRHHRVPIL  106

Query  808  PISGTLYGPPTSNPCRESSMMVGLTG--DAAEEDNGFL  915
            PISG  Y    ++P  ++ M+V   G  + A+ED  +L
Sbjct  107  PISGISYTSMATDP-EKTVMVVDPKGGEEDAKEDASWL  143


 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 80/120 (67%), Gaps = 12/120 (10%)
 Frame = +2

Query  1637  SSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekk  1816
             +  +   VPES  SD     +R  K T+D     P+  PP  QLS MDREARVLRYREKK
Sbjct  245   ACTETDFVPESIASD-----ARTPKVTMDQ----PLPDPP-TQLSPMDREARVLRYREKK  294

Query  1817  ktrkfektIRYASRKAYAETRPRIKGRFAK--RTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             KTR+FEK IRYASRKAYAE RPRI GRF K    +++ E DQ F   LM ++GYGIVPSF
Sbjct  295   KTRRFEKIIRYASRKAYAERRPRINGRFVKSREIEIEAEEDQCFNTMLMYDTGYGIVPSF  354



>ref|XP_011085568.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Sesamum 
indicum]
Length=354

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  526  KQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPAT  705
            +  W R CD CRSAA +VYCR  LAYLC  CD R+H  N ++ RHERV VCEACES+PA 
Sbjct  16   RSTWPRGCDTCRSAASAVYCRTHLAYLCTSCDTRIHADNHLSPRHERVWVCEACESSPAA  75

Query  706  VICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
            +ICKAD+ASLC+ACD+DIHSANPLARRHHRVPILPI GTLYGP  +N
Sbjct  76   LICKADSASLCSACDADIHSANPLARRHHRVPILPIPGTLYGPSAAN  122


 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 4/131 (3%)
 Frame = +2

Query  1604  YIVILGYQVSISSMD-VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMD  1780
             Y   +   V++  MD VG VPE   S+ S+S +R  KGTI+LFSGPP+Q+P   QLS  D
Sbjct  226   YPASISQTVALPLMDHVGGVPEPATSEVSVSQTRPPKGTIELFSGPPVQIP--TQLSPTD  283

Query  1781  REARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRT-DVDTEVDQIFYAPLM  1957
             REARVLRYREKKK RKFEKTIRYASRKAYAETRPRIKGRFAKR+ D + EVDQ+F   L+
Sbjct  284   REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSGDAEAEVDQLFSTSLV  343

Query  1958  AESGYGIVPSF  1990
             +ES + +VPSF
Sbjct  344   SESAFSVVPSF  354



>gb|KFK25823.1| hypothetical protein AALP_AA8G166000 [Arabis alpina]
Length=353

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA+VH AN VA RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQVHAANRVASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS+IHSANPLARRH RVPILPISG  Y    +N   E+++  
Sbjct  64   AFFCKADAASLCTACDSEIHSANPLARRHQRVPILPISGNSYSSMPNNHSSETTVTT  120


 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 92/125 (74%), Gaps = 6/125 (5%)
 Frame = +2

Query  1619  GYQVSISSM-DVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
              +Q SI S+  +GVVPES  SD + SH R+ K   D    PP Q+     LS MDREARV
Sbjct  234   AHQSSIGSLSHIGVVPESPTSDITASHPRSPKAVADQLLEPPTQV-----LSPMDREARV  288

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKR +VD E DQ F   +M ++GYG
Sbjct  289   LRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRKEVDAEADQPFSTMIMFDTGYG  348

Query  1976  IVPSF  1990
             IVPSF
Sbjct  349   IVPSF  353



>gb|AIE41593.1| zinc finger protein CONSTANS-LIKE 2 [Lagerstroemia indica]
Length=345

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 9/131 (7%)
 Frame = +2

Query  1619  GYQVSIS---SMDVGVVPESTLSDTSISHSRASKGTIDLFSGPP-IQMPPQLQLSQMDRE  1786
             GY  S+S   SM+VGVVPEST   + ISH+R  KGTIDLFS PP IQ+PPQL  S MDRE
Sbjct  217   GYPGSMSHSVSMEVGVVPESTSEVSMISHTRTPKGTIDLFSSPPLIQLPPQL--SAMDRE  274

Query  1787  ARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDT--EVDQIFYAP-LM  1957
             ARVLRYREKKK RKFEKTIRYASRKAYAETRPRIKGRFAKR DV    +VD +F  P LM
Sbjct  275   ARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRRDVQVQLQVDHLFSDPSLM  334

Query  1958  AESGYGIVPSF  1990
              ++ YG+VPSF
Sbjct  335   PDTSYGVVPSF  345


 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 6/119 (5%)
 Frame = +1

Query  472  VLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVA  651
            +L ++ T  ++ G   G   +WAR CD C +AA +VYCRADLAYLC  CDAR H A   A
Sbjct  1    MLKVETTTTANDG---GGATSWARTCDTCCTAASAVYCRADLAYLCTSCDARTHAA---A  54

Query  652  GRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLY  828
              H+RV +CE+CE APA  +CKAD+ASLCAACD+++HSANPLARRHHRVPI PI GTLY
Sbjct  55   NHHDRVWLCESCERAPAEFLCKADSASLCAACDAEVHSANPLARRHHRVPIQPIPGTLY  113



>ref|XP_010929079.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Elaeis guineensis]
Length=290

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+  +VP+ TL+D S SH R SKGTID FSG P+QMPPQ   + MDREA+VLRYREKKK 
Sbjct  177   MEASIVPDITLADISNSHLRPSKGTIDFFSGLPLQMPPQC--TPMDREAKVLRYREKKKA  234

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKR+DV+  VDQ+F   +  +S YGI+PSF
Sbjct  235   RKFEKTIRYASRKAYAETRPRIKGRFAKRSDVELAVDQLFSTTVTTDSSYGIIPSF  290



>gb|AEN71141.1| constans-like protein [Chrysanthemum x morifolium]
Length=382

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            +WAR+CD CRSA C+VYCRAD AYLC GCDA VH AN VA RH+RV VCEACE APA  +
Sbjct  15   SWARLCDTCRSAPCTVYCRADSAYLCAGCDAHVHAANRVASRHKRVRVCEACERAPAAFL  74

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLY  828
            CKADAASLC ACD+DIHSANPLARRH RVP++PISG+ Y
Sbjct  75   CKADAASLCTACDADIHSANPLARRHQRVPVIPISGSTY  113


 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 7/124 (6%)
 Frame = +2

Query  1619  GYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVL  1798
             G+ VS+SS+DVGVVPES++S +      +SKGT DLFSG  IQMP   QL+ +DREARVL
Sbjct  266   GHSVSMSSLDVGVVPESSISSSR-----SSKGTTDLFSGTSIQMP--TQLTPLDREARVL  318

Query  1799  RYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGI  1978
              YREKKKTRKFEKTIRYASRKAYAETRPRIKGRF+KRT+VD EVDQ+F   LM E GY I
Sbjct  319   SYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFSKRTNVDVEVDQMFSTTLMTEGGYCI  378

Query  1979  VPSF  1990
             VPSF
Sbjct  379   VPSF  382



>gb|ABC69350.1| constans-like [Brassica napus]
Length=246

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VC++CE APA   
Sbjct  7    NWAQTCDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCQSCERAPAAFF  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
            CKADAASL  ACDS IHSANPLARRH RVPILPISG++
Sbjct  67   CKADAASLYTACDSQIHSANPLARRHQRVPILPISGSM  104



>gb|AAP42647.1| constans-like protein [Brassica napus]
Length=337

 Score =   140 bits (353),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VC++CE APA   
Sbjct  7    NWAQTCDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCQSCERAPAAFF  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
            CKADAASL  ACDS IHSANPLARRH RVPILPISG++
Sbjct  67   CKADAASLYTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPESTLS+T++S+ R+ K   +     P+QM     LS M+R+ARV+RYREKKKTRK
Sbjct  228   VSLVPESTLSETTVSNPRSPKAATEELPEAPVQM-----LSPMERKARVMRYREKKKTRK  282

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEKTIRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGIVPSF
Sbjct  283   FEKTIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIVPSF  337



>emb|CDY26470.1| BnaC09g41980D [Brassica napus]
Length=333

 Score =   139 bits (351),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VC++CE APA
Sbjct  4    QESNWAQTCDTCRSAACTVYCRADSAYLCTNCDAQVHAANRLASRHERVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
               CKADAASLC ACDS IHSANPLARRH RVPILPISG++
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPESTLS+T++SH R+ K   +     P+QM     LS ++R+ARV+RYREKKKTRK
Sbjct  224   VSLVPESTLSETTVSHPRSPKVATEELHDAPVQM-----LSPVERKARVMRYREKKKTRK  278

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGIVPSF
Sbjct  279   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIVPSF  333



>ref|XP_002884316.1| hypothetical protein ARALYDRAFT_477472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60575.1| hypothetical protein ARALYDRAFT_477472 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 100/153 (65%), Gaps = 28/153 (18%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES E           SG+       WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKEESNE-----------SGT-------WARACDTCRSAACTVYCEADSAYLCTTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VC++CESAPA  +CKADAASLC ACD++IHSANPLARRH RVPIL
Sbjct  43   VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPIL  102

Query  808  PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            P+S         N C  SSM    T    +ED+
Sbjct  103  PLSA--------NSC--SSMAASETDADNDEDD  125


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N ++  L +  S+SSMD+ VVPEST SD ++ H R +K T D  +GPP Q+  
Sbjct  212   SSGANYNNNFLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETTDQLAGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ E ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEAEAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347



>emb|CDX69493.1| BnaA10g18420D [Brassica napus]
Length=337

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VC++CE APA   
Sbjct  7    NWAQTCDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCQSCERAPAAFF  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
            CKADAASLC ACDS IHSANPLARRH RVPILPISG++
Sbjct  67   CKADAASLCTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPESTLS+T++SH R+ K  ++     P+QM     LS M+R+ARV+RYREKKKTRK
Sbjct  228   VSLVPESTLSETTVSHPRSPKAAMEELPEAPVQM-----LSPMERKARVMRYREKKKTRK  282

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEKTIRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGIVPSF
Sbjct  283   FEKTIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIVPSF  337



>emb|CAL29796.1| CONSTANS-like1 protein [Brassica oleracea var. alboglabra]
 emb|CAL29798.1| CONSTANS-like1 protein [Brassica oleracea var. alboglabra]
 emb|CAL29800.1| CONSTANS-like1 protein [Brassica oleracea var. alboglabra]
 emb|CAL29802.1| CONSTANS-like1 protein [Brassica oleracea var. italica]
Length=335

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VC++CE APA
Sbjct  4    QESNWAQTCDTCRSAACTVYCRADSAYLCTNCDAQVHAANRLASRHERVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
               CKADAASLC ACDS IHSANPLARRH RVPILPISG++
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   101 bits (251),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPESTLS+T++SH R+ K   +     P+QM     LS ++R+ARV+RYREKKK RK
Sbjct  226   VSLVPESTLSETTVSHPRSPKVATEELHDAPVQM-----LSPVERKARVMRYREKKKKRK  280

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGIVPSF
Sbjct  281   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIVPSF  335



>ref|NP_001031887.1| zinc finger protein CONSTANS [Arabidopsis thaliana]
 gb|AED92214.1| zinc finger protein CONSTANS [Arabidopsis thaliana]
Length=274

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 150/290 (52%), Gaps = 58/290 (20%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLK+ES +       IGS   +R       AR CD CRS AC+VYC AD AYLC  CDA+
Sbjct  1     MLKQESND-------IGSGENNR-------ARPCDTCRSNACTVYCHADSAYLCMSCDAQ  46

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RH+RV VCE+CE APA  +C+AD ASLC ACDS++HSANPLARRH RVPIL
Sbjct  47    VHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPIL  106

Query  808   PISGTLYGPPTSNPCRESSMMVG----LTGDAAEEDNGFLtqdaeettmdededeaaSWl  975
             PISG  +   T+   +    M      L  D  E + G           D+D  E ASWL
Sbjct  107   PISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEEG-----------DKDAKEVASWL  155

Query  976   llnpnpnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKY  1155
               N + N N                          +   D YL+L +++S  +  F  +Y
Sbjct  156   FPNSDKNNNNQNN---------------------GLLFSDEYLNLVDYNSSMDYKFTGEY  194

Query  1156  SINQQQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAI-FNCK  1302
             S   QQN SVPQ   SY GD +VP     +   ++G Q HN     FN K
Sbjct  195   S-QHQQNCSVPQ--TSYGGDRVVP----LKLEESRGHQCHNQQNFQFNIK  237



>ref|NP_186887.1| zinc finger protein CONSTANS-LIKE 2 [Arabidopsis thaliana]
 sp|Q96502.1|COL2_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 2 [Arabidopsis 
thaliana]
 gb|AAG12597.1|AC068900_3 putative flowering-time gene CONSTANS (COL2); 19155-17969 [Arabidopsis 
thaliana]
 gb|AAK43964.1|AF370149_1 putative flowering-time gene CONSTANS protein COL2 [Arabidopsis 
thaliana]
 gb|AAB67879.1| COL2 [Arabidopsis thaliana]
 gb|AAB67880.1| COL2 [Arabidopsis thaliana]
 gb|AAF32446.1| COL2 [Arabidopsis thaliana]
 gb|AAL15198.1| putative flowering-time gene CONSTANS protein COL2 [Arabidopsis 
thaliana]
 gb|AAM67092.1| zinc finger protein CONSTANS-like 2 [Arabidopsis thaliana]
 gb|AEE73800.1| zinc finger protein CONSTANS-LIKE 2 [Arabidopsis thaliana]
Length=347

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 90/124 (73%), Gaps = 18/124 (15%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES E           SG+       WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKEESNE-----------SGT-------WARACDTCRSAACTVYCEADSAYLCTTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VC++CESAPA  +CKADAASLC ACD++IHSANPLARRH RVPIL
Sbjct  43   VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPIL  102

Query  808  PISG  819
            P+S 
Sbjct  103  PLSA  106


 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N  +  L +  S+SSMD+ VVPEST SD ++ H R +K TID  SGPP Q+  
Sbjct  212   SSGAHYNNNSLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETIDQLSGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR + + E ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIETEAEAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347



>gb|AAN09822.1| COL1 protein [Brassica nigra]
Length=345

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   105 bits (261),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ     ++ ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQALSTMVVFDTGYGIVPSF  344



>gb|ACF35243.1| COL1 [Brassica nigra]
 gb|ACF35250.1| COL1 [Brassica nigra]
Length=338

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  237   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  291

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  292   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  338



>gb|ACF35247.1| COL1 [Brassica nigra]
Length=338

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 92.4 bits (228),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPE+  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  237   VSLVPETVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  291

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  292   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  338



>gb|ACF35236.1| COL1 [Brassica nigra]
 gb|ACF35237.1| COL1 [Brassica nigra]
 gb|ACF35242.1| COL1 [Brassica nigra]
 gb|ACF35244.1| COL1 [Brassica nigra]
 gb|ACF35245.1| COL1 [Brassica nigra]
 gb|ACF35246.1| COL1 [Brassica nigra]
 gb|ACF35248.1| COL1 [Brassica nigra]
 gb|ACF35249.1| COL1 [Brassica nigra]
 gb|ACF35251.1| COL1 [Brassica nigra]
 gb|ACF35252.1| COL1 [Brassica nigra]
 gb|ACF35253.1| COL1 [Brassica nigra]
 gb|ACF35254.1| COL1 [Brassica nigra]
 gb|ACF35255.1| COL1 [Brassica nigra]
Length=339

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  339



>gb|ACF35231.1| COL1 [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 120/294 (41%), Positives = 151/294 (51%), Gaps = 55/294 (19%)
 Frame = +1

Query  523   NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
              + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4     QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703   TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
                CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64    AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874   GLTGDAAEEDNGFLtqdaeettmdededeaaSWlllnpnpnpnpnpVKSnnstnmckggn  1053
             G   +   E   +L                             P+ VK+    N     N
Sbjct  122   GQEEEDEAEAASWL----------------------------LPSSVKNCGDNNNNNNNN  153

Query  1054  nnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKYSINQQQNYSVPQRNMSYRGDSIVP--  1227
             + NN  S   E +D    L ++SS  +  F  + S   QQ+Y+VPQR  SY  D +VP  
Sbjct  154   SENNRFSVGEEYLD----LVDYSSSIDKRFTGQ-SNQYQQDYNVPQR--SYVADGVVPLQ  206

Query  1228  --------NHGKNQFHYTQGLQQHNHHAIFNCKEWNMRIL-----TRDMVIQHP  1350
                     +H ++ F +         H I N    +M  L     T D  + HP
Sbjct  207   VGVANGHMHHEQHNFQFGFTNVSSEAHQISNGSPIHMVSLVPESVTSDATVSHP  260


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  244   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  298

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  299   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  345



>gb|AAN09820.1| COL1 protein [Brassica nigra]
 gb|AAN09821.1| COL1 protein [Brassica nigra]
 gb|AAN09842.1| COL1 protein [Brassica nigra]
 gb|AAN09843.1| COL1 protein [Brassica nigra]
 gb|AAN09844.1| COL1 protein [Brassica nigra]
 gb|AAN09845.1| COL1 protein [Brassica nigra]
 gb|AAN09847.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPSF  344



>gb|AAN09846.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYGIVPSF  344



>gb|AAN09841.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 7/113 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPS  1987
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPS
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPS  343



>gb|ACF35240.1| COL1 [Brassica nigra]
Length=339

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P++M     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVRM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  339



>gb|ACF35226.1| COL1 [Brassica nigra]
 gb|ACF35227.1| COL1 [Brassica nigra]
Length=335

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSETAEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  234   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  288

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  289   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  335



>gb|ACF35232.1| COL1 [Brassica nigra]
Length=335

 Score =   138 bits (347),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSETAEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  234   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  288

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  289   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  335



>gb|AAN09819.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSETTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPSF  344



>gb|AAN09848.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 92/121 (76%), Gaps = 5/121 (4%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG---TLYGPPTSNPCRESSMMV  873
               CKADAASLC ACDS IHSANPLARRH RVPILPISG   T +   T+ P  E+ ++V
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEP--ENIVVV  121

Query  874  G  876
            G
Sbjct  122  G  122


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPSF  344



>ref|XP_010492435.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Camelina 
sativa]
Length=357

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+VCD CRSAAC+VYC AD AYLC  CDA+VH  N +A RHERV VC++CE APA
Sbjct  4    EESNWAQVCDSCRSAACTVYCHADSAYLCTSCDAQVHAVNRLASRHERVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
               CKADAASLC ACDS+IHSANPLARRH RVPILPISG  YG   +N
Sbjct  64   AFFCKADAASLCTACDSEIHSANPLARRHQRVPILPISGNSYGSMETN  111


 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  1613  ILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREAR  1792
              + + V +SS+D+GVVPEST SD ++SH R+ K   +    PP QM     LS M+R+AR
Sbjct  237   FISHMVHVSSIDLGVVPESTTSDATVSHPRSPKAVTERIPEPPAQM-----LSPMERQAR  291

Query  1793  VLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGY  1972
             V+RYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAKR +VD E DQ F   +  ++GY
Sbjct  292   VMRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRKEVDAEADQAFSTTITFDTGY  351

Query  1973  GIVPSF  1990
             GIVPS 
Sbjct  352   GIVPSL  357



>gb|ADO61520.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35165.1| CONSTANS-like 2 [Helianthus annuus]
Length=205

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ACF35216.1| COL1 [Brassica nigra]
 gb|ACF35217.1| COL1 [Brassica nigra]
Length=340

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 75/107 (70%), Gaps = 7/107 (7%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESG  1969
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++G
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTG  340



>gb|ADO61402.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61403.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61404.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61405.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61406.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61407.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61410.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61411.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35047.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35048.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35049.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35050.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35051.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35052.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35055.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35056.1| CONSTANS-like 2 [Helianthus argophyllus]
Length=204

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ACF35206.1| COL1 [Brassica nigra]
 gb|ACF35210.1| COL1 [Brassica nigra]
 gb|ACF35213.1| COL1 [Brassica nigra]
Length=343

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  242   VSLVPESVTSDATVSHQRSPKSGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  296

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++GYG
Sbjct  297   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTGYG  343



>gb|ACF35220.1| COL1 [Brassica nigra]
 gb|ACF35221.1| COL1 [Brassica nigra]
 gb|ACF35222.1| COL1 [Brassica nigra]
 gb|ACF35223.1| COL1 [Brassica nigra]
Length=342

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 77/109 (71%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++GYG
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTGYG  342



>gb|AFK29462.1| putative flowering-time constans protein [Arabidopsis halleri 
subsp. halleri]
Length=347

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 90/124 (73%), Gaps = 18/124 (15%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLK+ES E           SGS       WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKQESNE-----------SGS-------WARACDTCRSAACTVYCEADSAYLCTTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VC++CESAPA  +CKADAASLC ACD++IHSANPLARRH RVPIL
Sbjct  43   VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPIL  102

Query  808  PISG  819
            P+S 
Sbjct  103  PLSA  106


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N  +  L +  S+SSMD+ VVPEST SD ++ H R +K T D  +GPP Q+  
Sbjct  212   SSGPHYNNXSLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETTDQLAGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ E ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEAEAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347



>gb|ADO61412.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61413.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61414.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61416.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61417.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61418.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61419.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61420.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61421.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61422.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61423.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61424.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61425.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61426.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61427.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61428.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61429.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61430.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61431.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61432.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61433.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61434.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61435.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61438.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61439.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61440.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61441.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61442.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61443.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61444.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61445.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61446.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61448.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61449.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61450.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61453.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61456.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61457.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61458.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61459.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61460.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61461.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61462.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61464.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61465.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61466.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61467.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61470.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61471.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61472.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61473.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61476.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61478.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61479.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61481.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61482.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61483.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61484.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61485.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61486.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61487.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61490.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61491.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61496.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61497.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61500.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61501.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61504.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61505.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61506.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61507.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61512.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61513.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61514.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61515.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61516.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61517.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61518.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61522.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61523.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61526.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61527.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61528.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61530.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61531.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35044.1| CONSTANS-like 2 [Helianthus tuberosus]
 gb|AEB35057.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35058.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35059.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35061.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35062.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35063.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35064.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35065.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35066.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35067.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35068.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35069.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35070.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35071.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35072.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35073.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35074.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35075.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35076.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35077.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35078.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35079.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35080.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35083.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35084.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35085.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35086.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35087.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35088.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35089.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35090.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35091.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35093.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35094.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35095.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35098.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35101.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35102.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35103.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35104.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35105.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35106.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35107.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35109.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35110.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35111.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35112.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35115.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35116.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35117.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35118.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35121.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35123.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35124.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35126.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35127.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35128.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35129.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35130.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35131.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35132.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35135.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35136.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35141.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35142.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35145.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35146.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35149.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35150.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35151.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35152.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35157.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35158.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35159.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35160.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35161.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35162.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35163.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35167.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35168.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35171.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35172.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35173.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35175.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35176.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AEB35011.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35012.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35019.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35020.1| CONSTANS-like 2 [Helianthus exilis]
Length=203

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61529.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35174.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC+ CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCSTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61498.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35143.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AEB35009.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35010.1| CONSTANS-like 2 [Helianthus exilis]
Length=203

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AAN09810.1| COL1 protein [Brassica nigra]
Length=348

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++ YGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTRYGIVPSF  347



>gb|ADO61492.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35137.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD++IHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDANIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AEB35034.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=204

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61436.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61437.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61524.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61525.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35081.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35082.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35169.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35170.1| CONSTANS-like 2 [Helianthus annuus]
Length=203

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61511.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35156.1| CONSTANS-like 2 [Helianthus annuus]
Length=203

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AEB34999.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35000.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35001.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35002.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35003.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35004.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35005.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB35006.1| CONSTANS-like 2 [Helianthus paradoxus]
Length=205

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AAN09838.1| COL1 protein [Brassica nigra]
Length=342

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   +      +M+++GYGIVPSF
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ANHALSTMVMSDTGYGIVPSF  341



>gb|ADO61521.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35166.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ACF35207.1| COL1 [Brassica nigra]
 gb|ACF35208.1| COL1 [Brassica nigra]
 gb|ACF35209.1| COL1 [Brassica nigra]
 gb|ACF35211.1| COL1 [Brassica nigra]
 gb|ACF35212.1| COL1 [Brassica nigra]
 gb|ACF35214.1| COL1 [Brassica nigra]
 gb|ACF35215.1| COL1 [Brassica nigra]
 gb|ACF35218.1| COL1 [Brassica nigra]
 gb|ACF35224.1| COL1 [Brassica nigra]
 gb|ACF35225.1| COL1 [Brassica nigra]
Length=336

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYG
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYG  336



>gb|AAN09817.1| COL1 protein [Brassica nigra]
Length=342

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYGIVPSF  341



>gb|AAN09830.1| COL1 protein [Brassica nigra]
Length=342

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYGIVPSF  341



>gb|ACF35228.1| COL1 [Brassica nigra]
Length=338

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  237   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  291

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  292   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  338



>gb|AAN09826.1| COL1 protein [Brassica nigra]
Length=345

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPSF
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPSF  344



>gb|AAN09815.1| COL1 protein [Brassica nigra]
 gb|AAN09816.1| COL1 protein [Brassica nigra]
 gb|AAN09818.1| COL1 protein [Brassica nigra]
 gb|AAN09823.1| COL1 protein [Brassica nigra]
 gb|AAN09824.1| COL1 protein [Brassica nigra]
 gb|AAN09829.1| COL1 protein [Brassica nigra]
 gb|AAN09832.1| COL1 protein [Brassica nigra]
 gb|AAN09833.1| COL1 protein [Brassica nigra]
 gb|AAN09834.1| COL1 protein [Brassica nigra]
 gb|AAN09835.1| COL1 protein [Brassica nigra]
 gb|AAN09836.1| COL1 protein [Brassica nigra]
 gb|AAN09837.1| COL1 protein [Brassica nigra]
 gb|AAN09839.1| COL1 protein [Brassica nigra]
 gb|AAN09840.1| COL1 protein [Brassica nigra]
Length=342

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYGIVPSF  341



>gb|ADO61510.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35155.1| CONSTANS-like 2 [Helianthus annuus]
Length=202

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ACF35229.1| COL1 [Brassica nigra]
 gb|ACF35230.1| COL1 [Brassica nigra]
 gb|ACF35234.1| COL1 [Brassica nigra]
 gb|ACF35239.1| COL1 [Brassica nigra]
Length=339

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  238   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  292

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  293   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  339



>gb|ADO61447.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61451.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61452.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61454.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61455.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61480.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61493.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61499.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61519.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35092.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35096.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35097.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35099.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35100.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35125.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35138.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35144.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35164.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ACF35233.1| COL1 [Brassica nigra]
 gb|ACF35235.1| COL1 [Brassica nigra]
 gb|ACF35238.1| COL1 [Brassica nigra]
Length=338

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  237   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  291

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  292   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  338



>gb|AAN09808.1| COL1 protein [Brassica nigra]
 gb|AAN09811.1| COL1 protein [Brassica nigra]
 gb|AAN09812.1| COL1 protein [Brassica nigra]
 gb|AAN09814.1| COL1 protein [Brassica nigra]
Length=348

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++GYGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTGYGIVPSF  347



>gb|AAN09809.1| COL1 protein [Brassica nigra]
Length=348

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFA R +VD   DQ F   +M ++GYGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAXRNEVD--ADQAFPTVVMFDTGYGIVPSF  347



>gb|ACF35241.1| COL1 [Brassica nigra]
Length=336

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYG
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYG  336



>gb|ACF35219.1| COL1 [Brassica nigra]
Length=342

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYG
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYG  342



>gb|AAG27547.1| constans-like protein [Brassica nigra]
 gb|AAN09827.1| COL1 protein [Brassica nigra]
Length=348

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMFDTGYGIVPSF  347



>gb|AAN09831.1| COL1 protein [Brassica nigra]
Length=344

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  237   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  291

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      ++ ++GYGIVPSF
Sbjct  292   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVVFDTGYGIVPSF  343



>ref|NP_197089.1| zinc finger protein CONSTANS-LIKE 1 [Arabidopsis thaliana]
 sp|O50055.1|COL1_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 1 [Arabidopsis 
thaliana]
 emb|CAA71587.1| CONSTANS [Arabidopsis thaliana]
 emb|CAA71588.1| constans-like protein 1 [Arabidopsis thaliana]
 emb|CAC01784.1| CONSTANS-like 1 [Arabidopsis thaliana]
 gb|AAL67065.1| putative CONSTANS 1 protein [Arabidopsis thaliana]
 gb|AAN86196.1| putative CONSTANS 1 protein [Arabidopsis thaliana]
 gb|AED92215.1| zinc finger protein CONSTANS-LIKE 1 [Arabidopsis thaliana]
Length=355

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +1

Query  526  KQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPAT  705
            + NWA+ CD CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VC++CE APA 
Sbjct  5    ESNWAQACDTCRSAACTVYCRADSAYLCSSCDAQVHAANRLASRHERVRVCQSCERAPAA  64

Query  706  VICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
              CKADAASLC  CDS+IHSANPLARRH RVPILPIS   Y    +N
Sbjct  65   FFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISEYSYSSTATN  111


 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 93/125 (74%), Gaps = 5/125 (4%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + V++SSMD+GVVPEST SD ++S+ R+ K   D    PP QM     LS  DREARV
Sbjct  236   LSHMVNVSSMDLGVVPESTTSDATVSNPRSPKAVTDQPPYPPAQM-----LSPRDREARV  290

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAK+ DVD E +Q F   +  ++GYG
Sbjct  291   LRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKKKDVDEEANQAFSTMITFDTGYG  350

Query  1976  IVPSF  1990
             IVPSF
Sbjct  351   IVPSF  355


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
            + +R  ++    RVC  C  A  + +C+AD A LC  CD+ +H AN +A RH+RV +   
Sbjct  41   AANRLASRHERVRVCQSCERAPAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPI  100

Query  685  CE  690
             E
Sbjct  101  SE  102



>gb|AAN09828.1| COL1 protein [Brassica nigra]
Length=348

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   D      +M ++GYGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADHALSTMVMVDTGYGIVPSF  347



>gb|AEB35017.1| CONSTANS-like 2 [Helianthus exilis]
Length=205

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61415.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35060.1| CONSTANS-like 2 [Helianthus annuus]
Length=206

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ADO61463.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61474.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61475.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35108.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35119.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35120.1| CONSTANS-like 2 [Helianthus annuus]
Length=206

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|ABF82229.1| constans-like 1 protein [Brassica juncea]
Length=337

 Score =   137 bits (345),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCR D AYLC  CDA++H AN +A RHERV VC++CE APA
Sbjct  4    QESNWAQTCDTCRSAACTVYCRPDSAYLCTSCDAQIHEANRLASRHERVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
               CKADAASLC ACDS IHSANPLARRH RVPILPISG++
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   108 bits (271),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES+LS+T++S+ R+ K   +     P+QM     LS M+R+ARV+RYREKKKTRK
Sbjct  228   VSLVPESSLSETTVSNPRSPKAATEELPEAPVQM-----LSPMERKARVMRYREKKKTRK  282

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEKTIRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGI PSF
Sbjct  283   FEKTIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIEPSF  337



>gb|AEB35018.1| CONSTANS-like 2 [Helianthus exilis]
Length=205

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>gb|AEB35039.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=203

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P     M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRDVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>ref|NP_197088.1| zinc finger protein CONSTANS [Arabidopsis thaliana]
 sp|Q39057.1|CONS_ARATH RecName: Full=Zinc finger protein CONSTANS [Arabidopsis thaliana]
 emb|CAA64407.1| CONSTANS protein [Arabidopsis thaliana]
 emb|CAC01783.1| CONSTANS [Arabidopsis thaliana]
 gb|AAM63636.1| CONSTANS [Arabidopsis thaliana]
 gb|AAN71925.1| putative CONSTANS protein [Arabidopsis thaliana]
 gb|AED92213.1| zinc finger protein CONSTANS [Arabidopsis thaliana]
Length=373

 Score =   138 bits (347),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 150/290 (52%), Gaps = 58/290 (20%)
 Frame = +1

Query  448   MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
             MLK+ES +       IGS   +R       AR CD CRS AC+VYC AD AYLC  CDA+
Sbjct  1     MLKQESND-------IGSGENNR-------ARPCDTCRSNACTVYCHADSAYLCMSCDAQ  46

Query  628   VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
             VH AN VA RH+RV VCE+CE APA  +C+AD ASLC ACDS++HSANPLARRH RVPIL
Sbjct  47    VHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPIL  106

Query  808   PISGTLYGPPTSNPCRESSMMVG----LTGDAAEEDNGFLtqdaeettmdededeaaSWl  975
             PISG  +   T+   +    M      L  D  E + G           D+D  E ASWL
Sbjct  107   PISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEEG-----------DKDAKEVASWL  155

Query  976   llnpnpnpnpnpVKSnnstnmckggnnnnnemscAVEAVDAYLDLAEFSSCHNNLFEDKY  1155
               N + N N                          +   D YL+L +++S  +  F  +Y
Sbjct  156   FPNSDKNNNNQNN---------------------GLLFSDEYLNLVDYNSSMDYKFTGEY  194

Query  1156  SINQQQNYSVPQRNMSYRGDSIVPNHGKNQFHYTQGLQQHNHHAI-FNCK  1302
             S   QQN SVPQ   SY GD +VP     +   ++G Q HN     FN K
Sbjct  195   S-QHQQNCSVPQ--TSYGGDRVVP----LKLEESRGHQCHNQQNFQFNIK  237


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             + +   ISSM+ GVVPEST   T+ SH R  KGT++    P  QM    QLS MDREARV
Sbjct  251   INHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQLSPMDREARV  310

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREK+KTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E +Q F   LM  +GYG
Sbjct  311   LRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKR-EIEAE-EQGFNTMLMYNTGYG  368

Query  1976  IVPSF  1990
             IVPSF
Sbjct  369   IVPSF  373



>ref|XP_009121539.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Brassica 
rapa]
Length=337

 Score =   137 bits (344),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            NWA+ CD CRSAAC+VYCR D AYLC  CDA++H AN +A RHERV VC++CE APA   
Sbjct  7    NWAQTCDTCRSAACTVYCRPDSAYLCTSCDAQIHEANRLASRHERVRVCQSCERAPAAFF  66

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTL  825
            CKADAASLC ACDS IHSANPLARRH RVPILPISG++
Sbjct  67   CKADAASLCTACDSQIHSANPLARRHQRVPILPISGSM  104


 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPESTLS+T++S+ R+ K   +     P+QM     LS M+R+ARV+RYREKKKTRK
Sbjct  228   VSLVPESTLSETTVSNPRSPKAATEELPEAPVQM-----LSPMERKARVMRYREKKKTRK  282

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDT-EVDQIFYAPLMAESGYGIVPSF  1990
             FEKTIRYASRK YAE RPRIKGRFAKR +VD  E D+ F + +M ++GYGIVPSF
Sbjct  283   FEKTIRYASRKEYAEKRPRIKGRFAKRNEVDAEEADKAFSSMVMFDTGYGIVPSF  337



>ref|XP_006299343.1| hypothetical protein CARUB_v10015501mg [Capsella rubella]
 gb|EOA32241.1| hypothetical protein CARUB_v10015501mg [Capsella rubella]
Length=344

 Score =   137 bits (344),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  1598  NWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQM  1777
             N  I  L Y  S+SSMD+ VVPEST SD ++ H R ++ TID  SGPP   P   QL+ M
Sbjct  216   NSSIKDLNYSASVSSMDISVVPESTASDITVHHPRTTRETIDQLSGPPT--PMVQQLTPM  273

Query  1778  DREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLM  1957
             +REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ E ++IF A LM
Sbjct  274   EREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEAEAEEIFSASLM  333

Query  1958  AESGYGIVPSF  1990
             +E+GYGIVPSF
Sbjct  334   SETGYGIVPSF  344


 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 89/124 (72%), Gaps = 18/124 (15%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES E           SG+       WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKEESNE-----------SGT-------WARACDTCRSAACTVYCEADSAYLCNTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN +A RHERV VC++CESAPA   CKADAASLC ACD++IHSANPLARRH RVPIL
Sbjct  43   VHVANRLASRHERVRVCQSCESAPAAFFCKADAASLCTACDAEIHSANPLARRHQRVPIL  102

Query  808  PISG  819
            P+S 
Sbjct  103  PLSA  106



>gb|AAN09813.1| COL1 protein [Brassica nigra]
Length=348

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD CRSAAC+VYCRAD AYLC  CDA++H AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               C+ADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   VFFCQADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  241   VSLVPESVTSDATVSHQRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  295

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFAKR +VD   DQ F   +M ++GYGIVPSF
Sbjct  296   FEKRIRYASRKEYAEKRPRIKGRFAKRNEVD--ADQAFPTVVMFDTGYGIVPSF  347



>gb|AFK29459.1| putative flowering-time constans protein [Arabidopsis kamchatica]
Length=347

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N ++  L +  S+SSMD+ VVPEST SD ++ H R +K T D  +GPP Q+  
Sbjct  212   SSGANYNNNFLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETTDQLAGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ E ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEAEAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347


 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 89/124 (72%), Gaps = 10/124 (8%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WAR CD CRSAAC+VYC AD AYLC  CDARVH AN VA RHERV VC++CESAPA  +C
Sbjct  12   WARACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCESAPAAFLC  71

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
            KADAASLC ACD++IHSANPLARRH RV ILP+S         N C  SSM    T    
Sbjct  72   KADAASLCTACDAEIHSANPLARRHQRVSILPLSA--------NSC--SSMAASETDADN  121

Query  895  EEDN  906
            +ED+
Sbjct  122  DEDD  125


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (55%), Gaps = 4/71 (6%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERV----L  672
            + +R  ++    RVC  C SA  +  C+AD A LC  CDA +H AN +A RH+RV    L
Sbjct  45   AANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVSILPL  104

Query  673  VCEACESAPAT  705
               +C S  A+
Sbjct  105  SANSCSSMAAS  115



>ref|XP_008783055.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Phoenix 
dactylifera]
Length=292

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+   V ++T++D S SH   SKGTID FSG P+QMPPQ   + MDREARVLRYREKKKT
Sbjct  181   MEASSVADTTMADISNSHLLPSKGTIDFFSGLPLQMPPQF--TPMDREARVLRYREKKKT  238

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRFAKR+DV  EVDQ F   +M +S YGIVPSF
Sbjct  239   RKFEKTIRYASRKAYAETRPRIKGRFAKRSDV--EVDQFFSTTVMTDSSYGIVPSF  292



>ref|NP_001278944.1| zinc finger protein CONSTANS-LIKE 2-like [Glycine max]
 gb|AEF12201.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN30769.1| Zinc finger protein CONSTANS-LIKE 2 [Glycine soja]
Length=366

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +1

Query  508  GSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEAC  687
            GS +G    W+RVCD C SA C +YC AD AYLC  CDARVH AN VA RH+RV VCEAC
Sbjct  11   GSNTGT--TWSRVCDTCLSAPCVLYCHADSAYLCSSCDARVHAANRVASRHKRVWVCEAC  68

Query  688  ESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
            E APA  +CKADAASLC++CD+DIHSANPLA RH+RVPILPISG+L+  P  N
Sbjct  69   ERAPAAFLCKADAASLCSSCDADIHSANPLASRHNRVPILPISGSLFREPEHN  121


 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 86/110 (78%), Gaps = 4/110 (4%)
 Frame = +2

Query  1661  PESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrkfekt  1840
             PEST+S  S+SHS++  GT DLF  PP+ MP  L  + MDREARVLRYREKKKTRKFEK 
Sbjct  261   PESTVSGISMSHSKSPIGTNDLF--PPLLMPSHL--TPMDREARVLRYREKKKTRKFEKK  316

Query  1841  IRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             IRYASRKAYAETRPRIKGRFAKRTDV+ EVDQ+F   L  E G  I P+F
Sbjct  317   IRYASRKAYAETRPRIKGRFAKRTDVEAEVDQMFSTKLFNEVGGSIFPTF  366



>gb|ADO61508.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35153.1| CONSTANS-like 2 [Helianthus annuus]
Length=200

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|ADO61401.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61409.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35046.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35054.1| CONSTANS-like 2 [Helianthus argophyllus]
Length=201

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|ADO61489.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61494.1| CONSTANS-like 2 [Helianthus annuus]
 gb|ADO61509.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35134.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35139.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35154.1| CONSTANS-like 2 [Helianthus annuus]
Length=201

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>ref|XP_002873745.1| hypothetical protein ARALYDRAFT_488432 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50004.1| hypothetical protein ARALYDRAFT_488432 [Arabidopsis lyrata subsp. 
lyrata]
Length=348

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +1

Query  526  KQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPAT  705
            + NW + CD CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VC++CE APA 
Sbjct  5    ESNWGQACDTCRSAACTVYCRADSAYLCTSCDAQVHAANRLASRHERVRVCQSCERAPAA  64

Query  706  VICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
              CKADAASLC  CDS+IHSANPLARRH RVPILPIS   Y    +N
Sbjct  65   FFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISENSYSSTATN  111


 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 87/125 (70%), Gaps = 12/125 (10%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + V +SS+D+GVVPEST       + R+ K   D    PP QM     LS  DREARV
Sbjct  236   LSHMVHVSSIDLGVVPEST-------NPRSPKAVTDQLPDPPAQM-----LSPRDREARV  283

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAKR +VD E ++ F   +  ++GYG
Sbjct  284   LRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRNEVDAEANEAFSTIITFDTGYG  343

Query  1976  IVPSF  1990
             IVPSF
Sbjct  344   IVPSF  348


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEA  684
            + +R  ++    RVC  C  A  + +C+AD A LC  CD+ +H AN +A RH+RV +   
Sbjct  41   AANRLASRHERVRVCQSCERAPAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPI  100

Query  685  CESA  696
             E++
Sbjct  101  SENS  104



>gb|AEB35113.1| CONSTANS-like 2 [Helianthus annuus]
Length=202

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|AEB35007.1| CONSTANS-like 2 [Helianthus paradoxus]
Length=202

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|ADO61488.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35133.1| CONSTANS-like 2 [Helianthus annuus]
Length=200

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|AEB35013.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35015.1| CONSTANS-like 2 [Helianthus exilis]
Length=200

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|ADO61468.1| CONSTANS-like 2 [Helianthus annuus]
Length=202

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSALCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|AEB35008.1| CONSTANS-like 2 [Helianthus paradoxus]
Length=204

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>ref|XP_006288045.1| hypothetical protein CARUB_v10001279mg [Capsella rubella]
 gb|EOA20943.1| hypothetical protein CARUB_v10001279mg [Capsella rubella]
Length=355

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  526  KQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPAT  705
            + NWA+ CD CRSAAC+VYC AD AYLC  CDA++H  N +A RHERV VC++CE APA 
Sbjct  5    ESNWAQACDSCRSAACTVYCHADSAYLCTSCDAQIHAVNCLASRHERVRVCQSCERAPAA  64

Query  706  VICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
              CKADAASLC ACDS+IHSANPLARRH RVPILPISG  YG   +N
Sbjct  65   FFCKADAASLCIACDSEIHSANPLARRHQRVPILPISGNSYGSMETN  111


 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             + + V +SSMD+ VVPEST SD ++S  R+ K   D  + PP QM     LS ++REARV
Sbjct  236   ISHMVHVSSMDLIVVPESTTSDATVSQPRSPKAVTDQLTEPPPQM-----LSPVEREARV  290

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAKR + D E DQ F   +  ++GYG
Sbjct  291   LRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRNEADAEADQTFSTTITFDTGYG  350

Query  1976  IVPSF  1990
             IVPS 
Sbjct  351   IVPSL  355



>gb|AGI62035.1| CONSTANS-like 11 [Erycina pusilla]
Length=248

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 97/121 (80%), Gaps = 3/121 (2%)
 Frame = +2

Query  1631  SISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYre  1810
             S+SS++  +VP+++++  S S   +SKGT D+F GPP+QM      + MDREARVLRYRE
Sbjct  130   SLSSIEATLVPQNSINCVSNSQITSSKGTSDIFHGPPLQMSQHF--TPMDREARVLRYRE  187

Query  1811  kkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEV-DQIFYAPLMAESGYGIVPS  1987
             K+KTRKF+K IRYASRKAYAETRPRIKGRFAKRTDV+ EV DQ+F AP+M ESGYG V S
Sbjct  188   KRKTRKFQKIIRYASRKAYAETRPRIKGRFAKRTDVEHEVIDQMFVAPVMVESGYGFVHS  247

Query  1988  F  1990
             +
Sbjct  248   Y  248



>gb|ADO61495.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35140.1| CONSTANS-like 2 [Helianthus annuus]
Length=205

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>ref|XP_010453736.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Camelina 
sativa]
Length=355

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+VCD CRSAAC+VYC AD AYLC  CDA+VH  N +A RH RV VC++CE APA
Sbjct  4    EESNWAQVCDSCRSAACTVYCHADSAYLCTSCDAQVHAVNRLASRHGRVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
               CKADAASLC ACDS+IHSANPLARRH RVPILPISG  YG   +N
Sbjct  64   AFFCKADAASLCTACDSEIHSANPLARRHQRVPILPISGNSYGSMETN  111


 Score =   128 bits (322),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +2

Query  1613  ILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREAR  1792
             ++ + V +SS+D+GVVPEST SD+++SH  + K   D    PP QM     LS ++R+AR
Sbjct  235   LISHMVHVSSIDLGVVPESTTSDSTVSHPISPKAVTDQIPEPPAQM-----LSPIERQAR  289

Query  1793  VLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGY  1972
             V+RYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAKR +VD E DQ F   L  ++GY
Sbjct  290   VMRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRKEVDAEADQAFSTTLTFDTGY  349

Query  1973  GIVPSF  1990
             GIVPS 
Sbjct  350   GIVPSL  355



>gb|AEB35114.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|AEB35014.1| CONSTANS-like 2 [Helianthus exilis]
 gb|AEB35016.1| CONSTANS-like 2 [Helianthus exilis]
Length=202

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|ADO61469.1| CONSTANS-like 2 [Helianthus annuus]
Length=204

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSALCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>ref|XP_010420264.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Camelina 
sativa]
Length=359

 Score =   135 bits (340),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+VCD CRSAAC+VYC AD AYLC  CDA+VH  N +A RH RV VC++CE APA
Sbjct  4    EESNWAQVCDSCRSAACTVYCHADSAYLCTSCDAQVHAVNRLASRHGRVRVCQSCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSN  846
               CKADAASLC ACDS+IHSANPLARRH RVPILPISG  YG   +N
Sbjct  64   AFFCKADAASLCTACDSEIHSANPLARRHQRVPILPISGNSYGSMETN  111


 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = +2

Query  1613  ILGYQVSISSMDVGVVPESTL----SDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMD  1780
              + + V +SS+D+GVVPEST     SD ++SH  + K   D    PP QM     LS ++
Sbjct  235   FISHMVHVSSIDLGVVPESTTKSTTSDATVSHPISPKAVTDQIPEPPAQM-----LSPIE  289

Query  1781  REARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMA  1960
             R+ARV+RYREKKK RKFEKTIRYASRKAYAE RPRIKGRFAKR +VD E DQ F   L  
Sbjct  290   RQARVMRYREKKKMRKFEKTIRYASRKAYAEKRPRIKGRFAKRKEVDAEADQAFSTTLTF  349

Query  1961  ESGYGIVPSF  1990
             ++GYGIVPS 
Sbjct  350   DTGYGIVPSL  359



>gb|ADO61400.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|ADO61408.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35045.1| CONSTANS-like 2 [Helianthus argophyllus]
 gb|AEB35053.1| CONSTANS-like 2 [Helianthus argophyllus]
Length=199

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 89/121 (74%), Gaps = 6/121 (5%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP  + P   + M +G+     +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQGAGPDPRAVMGLGV-----DSQSGF  115

Query  913  L  915
            L
Sbjct  116  L  116



>gb|AEB35033.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=203

 Score =   130 bits (328),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DI SANPLARRHHRVP++PI G LYGP  + P     M +G+  D+    +
Sbjct  61   ASLCTTCDADIRSANPLARRHHRVPVMPIPGALYGPQGAGPDPRDVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>ref|XP_009126071.1| PREDICTED: zinc finger protein CONSTANS-LIKE 1-like [Brassica 
rapa]
Length=315

 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +1

Query  529  QNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATV  708
            +NW +VC+ CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VCEACE APA  
Sbjct  6    RNWTQVCNTCRSAACTVYCRADSAYLCATCDAQVHAANLLASRHERVRVCEACERAPAAF  65

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVG  876
             CKADAASLC ACDS IH  NPLARRH RVPILPIS        +N   E++ M G
Sbjct  66   FCKADAASLCIACDSQIHLVNPLARRHQRVPILPISSM-----ATNHSSETTAMTG  116


 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 82/123 (67%), Gaps = 6/123 (5%)
 Frame = +2

Query  1625  QVSISSMDVGVVPESTLSDTSIS-HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLR  1801
              VS     V +VPEST SDT++  HS + K   D    P  Q+     LS  +REARV+R
Sbjct  198   NVSSGCHMVSLVPESTTSDTTVLLHSPSPKAATDQLPDPSTQI-----LSPGEREARVMR  252

Query  1802  YrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIV  1981
             YREKKKTRKFEK +RYASRKAYAETRPRIKGRF KR +VD E DQ F    M  +GYG+V
Sbjct  253   YREKKKTRKFEKRVRYASRKAYAETRPRIKGRFVKREEVDAEADQGFSTMTMFNTGYGVV  312

Query  1982  PSF  1990
             PS 
Sbjct  313   PSL  315



>ref|XP_009394556.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Musa acuminata 
subsp. malaccensis]
Length=302

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 103/131 (79%), Gaps = 12/131 (9%)
 Frame = +2

Query  1604  YIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGP-PIQMPPQLQLSQMD  1780
             Y   L ++VS+SSMD  VVP     DTSI    A KGT+DLFSG  P+Q+ PQL L  MD
Sbjct  182   YSSSLSHRVSLSSMDASVVP-----DTSIG---APKGTMDLFSGHHPLQVQPQLNL--MD  231

Query  1781  REARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIF-YAPLM  1957
             REARVLRYREK+KTR+FEKTIRYASRKAYAETRPRIKGRFAK++DV+ EVDQ+F  A ++
Sbjct  232   REARVLRYREKRKTRRFEKTIRYASRKAYAETRPRIKGRFAKKSDVELEVDQMFSTAAVL  291

Query  1958  AESGYGIVPSF  1990
             A S +G+VPSF
Sbjct  292   ANSRFGVVPSF  302


 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +1

Query  673  VCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILP-ISGTLYGPPTSNP  849
             CE+C SAP TV C+ADAA+LCAACD+ IHSAN LARRHHRVP+LP ++G   G     P
Sbjct  15   TCESCRSAPCTVYCRADAAALCAACDASIHSANLLARRHHRVPLLPDLAG---GGLVVRP  71

Query  850  CRESSMMVGLTGDAAEED  903
               ++  VG+   A ++D
Sbjct  72   GLSAAYHVGVPSGAGDKD  89



>gb|AFK29461.1| putative flowering-time constans protein [Arabidopsis halleri 
subsp. gemmifera]
Length=347

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 103/138 (75%), Gaps = 2/138 (1%)
 Frame = +2

Query  1577  SQGNEAPNWYIVILGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPP  1756
             S G    N  +  L +  S+SSMD+ VVPEST SD ++ H R +K T D  +GPP Q+  
Sbjct  212   SSGPHYNNXSLKDLNHSASVSSMDISVVPESTASDITVQHPRTTKETTDQLAGPPTQVVQ  271

Query  1757  QLQLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQ  1936
             QL  + M+REARVLRYREKKKTRKF+KTIRYASRKAYAE RPRIKGRFAKR +++ E ++
Sbjct  272   QL--TPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEIEAEAEE  329

Query  1937  IFYAPLMAESGYGIVPSF  1990
             IF   LM+E+GYGIVPSF
Sbjct  330   IFSTSLMSETGYGIVPSF  347


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 89/124 (72%), Gaps = 18/124 (15%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLK+ES E           SGS       WAR CD CRSAAC+V C AD AYLC  CDAR
Sbjct  1    MLKQESNE-----------SGS-------WARACDTCRSAACTVCCEADSAYLCTTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RHERV VC++CESAPA  +CKADAASLC ACD++IHSANPLARRH RVPIL
Sbjct  43   VHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPIL  102

Query  808  PISG  819
            P+S 
Sbjct  103  PLSA  106



>emb|CDX85529.1| BnaA02g02840D [Brassica napus]
Length=317

 Score =   133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 85/116 (73%), Gaps = 5/116 (4%)
 Frame = +1

Query  529  QNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATV  708
            +NW +VC+ CRSAAC+VYCRAD AYLC  CDA+VH AN +A RHERV VCEACE APA  
Sbjct  6    RNWTQVCNTCRSAACTVYCRADSAYLCSTCDAQVHAANLLASRHERVRVCEACERAPAAF  65

Query  709  ICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVG  876
             CKADAASLC ACDS IH  NPLARRH RVPILPIS        +N   E++ M G
Sbjct  66   FCKADAASLCIACDSQIHLVNPLARRHQRVPILPISSM-----ATNHSSETTAMTG  116


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 82/125 (66%), Gaps = 8/125 (6%)
 Frame = +2

Query  1625  QVSISSMDVGVVPESTLSDTSIS-HSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLR  1801
              VS     V +VPEST SDT++  HS + K   D    P  Q+     LS  +REARV+R
Sbjct  198   NVSSGCHMVSLVPESTTSDTTVVLHSPSPKAATDQLPDPSTQI-----LSPGEREARVMR  252

Query  1802  YrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVD--TEVDQIFYAPLMAESGYG  1975
             YREKKKTRKFEK +RYASRKAYAETRPRIKGRF KR +VD   E DQ F    M  +GYG
Sbjct  253   YREKKKTRKFEKRVRYASRKAYAETRPRIKGRFVKREEVDAEAEADQGFSTMTMFNTGYG  312

Query  1976  IVPSF  1990
             +VPS 
Sbjct  313   VVPSL  317



>gb|AEB35030.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=200

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P   + M +G+ G   +  +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDP--RAVMGLGM-GVGVDSQS  116

Query  907  GFL  915
            GFL
Sbjct  117  GFL  119



>gb|AEB34985.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34986.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34991.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34992.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34995.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34996.1| CONSTANS-like 2 [Helianthus petiolaris]
 gb|AEB34997.1| CONSTANS-like 2 [Helianthus paradoxus]
 gb|AEB34998.1| CONSTANS-like 2 [Helianthus paradoxus]
Length=202

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQS  114

Query  907  GFL  915
            GFL
Sbjct  115  GFL  117



>ref|XP_010453734.1| PREDICTED: zinc finger protein CONSTANS-like [Camelina sativa]
Length=376

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  526  KQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPAT  705
            + N AR CDICRS AC+VYC AD AYLC  CDA+VH AN VA RH+RV VCE+CE APA 
Sbjct  13   ENNRARACDICRSNACTVYCHADSAYLCTSCDAQVHSANRVASRHKRVRVCESCERAPAA  72

Query  706  VICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSM  867
             +C AD ASLC ACDS++HSANPLAR HHRVPILPISG  Y   +++   E++M
Sbjct  73   FLCVADDASLCTACDSEVHSANPLARHHHRVPILPISGNSYSSMSTHHQSETTM  126


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQM-PPQLQLSQMDREAR  1792
             L +   ISSM+ GVVPEST   T+ SHSR  K T+D    PP QM  P   LS MDREAR
Sbjct  255   LNHNAYISSMETGVVPESTPRVTTASHSRTPKATVDQLPDPPSQMIAP---LSPMDREAR  311

Query  1793  VLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGY  1972
             VLRYREK+KTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E D  F   LM + GY
Sbjct  312   VLRYREKRKTRKFEKTIRYASRKAYAERRPRVNGRFAKRREIEDE-DHEFNIMLMYDIGY  370

Query  1973  GIVPSF  1990
             G+VPSF
Sbjct  371   GVVPSF  376



>gb|AEB35029.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=198

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQS  114

Query  907  GFL  915
            GFL
Sbjct  115  GFL  117



>gb|AEB35026.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=199

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 4/121 (3%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYG   + P     M +G+  D+    +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGSQGAGPDPRDVMGLGVGVDS---QSGF  117

Query  913  L  915
            L
Sbjct  118  L  118



>gb|AEA50855.1| col2b [Populus tremula]
Length=227

 Score =   129 bits (323),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  565  AACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICKadaaslcaa  744
            AAC+VYCRAD AYLC GCDARVH AN VA RHERV VCEACE APA ++CKADAASLC A
Sbjct  1    AACTVYCRADSAYLCAGCDARVHAANRVASRHERVWVCEACERAPAALLCKADAASLCTA  60

Query  745  cdsdIHSANPLARRHHRVPILPISGTLYG  831
            CD+DIHSANPLARRH RVPILPISG L+G
Sbjct  61   CDADIHSANPLARRHQRVPILPISGCLHG  89



>gb|KFK37702.1| hypothetical protein AALP_AA3G017800 [Arabis alpina]
Length=324

 Score =   131 bits (329),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 96/156 (62%), Gaps = 18/156 (12%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLKEES E           SG+       WAR CD CRSAAC+VYC AD AYLC  CDAR
Sbjct  1    MLKEESNE-----------SGT-------WARTCDTCRSAACTVYCEADSAYLCTTCDAR  42

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            +H AN VA RHERV VC+ CESAPA  +CKADAASLC ACD++IHSANPLARRH RVPI 
Sbjct  43   IHAANRVASRHERVRVCQQCESAPAAFLCKADAASLCIACDTEIHSANPLARRHQRVPIT  102

Query  808  PISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGFL  915
              S        ++   +      L      ++NGFL
Sbjct  103  HQSNPSETDADNDEDDQEVASWLLLNPGKNQNNGFL  138


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 92/126 (73%), Gaps = 14/126 (11%)
 Frame = +2

Query  1616  LGYQVSISSMD-VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREAR  1792
             L + VSISSMD + VVPEST   T   +SR +K TID  SGP +Q     QLS MDREAR
Sbjct  212   LNHSVSISSMDNISVVPEST---TVQENSRITKETIDQVSGPLVQ-----QLSPMDREAR  263

Query  1793  VLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGY  1972
             V+RYREKKKTRKFEKTIRYASRKAYAE RPRIKGRFAKRT  +TEVD    A  +   GY
Sbjct  264   VMRYREKKKTRKFEKTIRYASRKAYAEIRPRIKGRFAKRT--ETEVDD---AEQLFSRGY  318

Query  1973  GIVPSF  1990
             GIVPS 
Sbjct  319   GIVPSL  324



>dbj|BAL41845.1| CO, partial [Cardamine nipponica]
Length=161

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CESAPA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCESAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C SA  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCESAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>gb|ADO61477.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35122.1| CONSTANS-like 2 [Helianthus annuus]
Length=205

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDA +H AN + + +HERV VCEACE APA  ICKA+A
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDAGIHAANKLQSSQHERVWVCEACEQAPAAFICKAEA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDN  906
            ASLC  CD+DIHSANPLARRHHRV ++PI G LYGP  + P   + M +G+  D+    +
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVRVMPIPGALYGPQGAGPDPRAVMGLGVGVDS---QS  117

Query  907  GFL  915
            GFL
Sbjct  118  GFL  120



>dbj|BAL41851.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41868.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGKFFS  114


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>ref|XP_010492434.1| PREDICTED: zinc finger protein CONSTANS-like [Camelina sativa]
Length=376

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  517  SGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESA  696
            S    N AR CD CRS  C+VYC AD AYLC  CDA+VH AN VA RH+RV VCE+CE A
Sbjct  10   SSGGDNRARACDTCRSNVCTVYCHADSAYLCMSCDAQVHSANRVASRHKRVPVCESCERA  69

Query  697  PATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSM  867
            PA  +C+AD ASLC ACDS++HSANPLARRHHRVPILPISG  Y    S+   E+ M
Sbjct  70   PAAFLCEADDASLCTACDSEVHSANPLARRHHRVPILPISGNSYSSMASHHQSETIM  126


 Score =   120 bits (301),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +2

Query  1619  GYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVL  1798
              +   IS+M+ GVVPEST    + SH R  K TID    PP QM    QLS MDREARVL
Sbjct  256   NHNAYISAMETGVVPESTPRVITASHPRKPKATIDHIPDPPSQMI--TQLSPMDREARVL  313

Query  1799  RYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGI  1978
             RYREK+KTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E D  F   LM ++GYG+
Sbjct  314   RYREKRKTRKFEKTIRYASRKAYAERRPRVNGRFAKRREIEDE-DHRFNTMLMYDTGYGV  372

Query  1979  VPSF  1990
             VPSF
Sbjct  373   VPSF  376



>gb|KFK25822.1| coa [Arabis alpina]
Length=389

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 6/129 (5%)
 Frame = +1

Query  532  NWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVI  711
            N AR CD C+S AC+VYC AD AYLC  CDA+VH AN VA RH+RV VCE+CE APA  +
Sbjct  15   NRARACDTCQSTACTVYCHADSAYLCTSCDAQVHSANRVASRHKRVRVCESCERAPAAFL  74

Query  712  CKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSM------MV  873
            C+AD ASLC ACDS++HSANPLARRH RVPILPISG  Y    +    E++M      +V
Sbjct  75   CEADDASLCIACDSEVHSANPLARRHQRVPILPISGNSYSSKATQHKSETTMTNPENRLV  134

Query  874  GLTGDAAEE  900
             + G+  E+
Sbjct  135  AVQGEGDED  143


 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 96/144 (67%), Gaps = 19/144 (13%)
 Frame = +2

Query  1613  ILGYQVSISSMDVGVVPESTLSDT--SISHSRASKGTIDLFSGPPIQMPPQL--------  1762
              + +   ISS + GVVPE+T  DT  S SH R  K TID    PPIQ+  QL        
Sbjct  247   FINHNAYISSTETGVVPEATARDTTASASHPRMPKETIDQQPDPPIQIITQLSPMDREQP  306

Query  1763  --------QLSQMDREARVLRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDV  1918
                     QLS MDREARVLRYREKKKTRKFEKTIRYASRKAYAE RPRI GRFAKR ++
Sbjct  307   DPPIQIITQLSPMDREARVLRYREKKKTRKFEKTIRYASRKAYAERRPRINGRFAKRREI  366

Query  1919  DTEVDQIFYAPLMAESGYGIVPSF  1990
             + E DQ+F   LM ++GYGIVPSF
Sbjct  367   EAE-DQVFNTMLMNDTGYGIVPSF  389


 Score = 52.4 bits (124),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCIACDSEVHSANPLARRHQRVPI  105



>gb|AEB35022.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=197

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = +1

Query  553  ICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaa  729
             CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAA
Sbjct  1    TCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAA  60

Query  730  slcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNG  909
            SLC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +G
Sbjct  61   SLCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQSG  114

Query  910  FL  915
            FL
Sbjct  115  FL  116



>gb|AEB34994.1| CONSTANS-like 2 [Helianthus petiolaris]
Length=200

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP       +   ++GL G   +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQG-----DPRAVMGL-GVGVDSQSGF  114

Query  913  L  915
            L
Sbjct  115  L  115



>ref|XP_008797568.1| PREDICTED: zinc finger protein CONSTANS-LIKE 2-like [Phoenix 
dactylifera]
Length=331

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+  +VP++T++D S SH R +KGTIDLFSGP  Q  P      MDREA+VLRYREK+KT
Sbjct  222   MEASIVPDTTVADISNSHLRPAKGTIDLFSGPAPQFTP------MDREAKVLRYREKRKT  275

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYASRKAYAETRPRIKGRF KR+DV+ EVDQ+F   +M +S   IVPSF
Sbjct  276   RKFEKTIRYASRKAYAETRPRIKGRFVKRSDVELEVDQLFSTTMMTDSSNSIVPSF  331



>gb|AEB34993.1| CONSTANS-like 2 [Helianthus petiolaris]
Length=199

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQSGF  114

Query  913  L  915
            L
Sbjct  115  L  115



>gb|AEB35025.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=196

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQSGF  114

Query  913  L  915
            L
Sbjct  115  L  115



>dbj|BAI77474.1| Zinc-finger type transcription factor [Phyllostachys edulis]
Length=382

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+VG+VP++T+ D   S      G I+LFSGP +QMP  L LS MDREARVLRY+EKKKT
Sbjct  269   MEVGIVPDNTVIDMPNSSILTPAGAINLFSGPSLQMP--LHLSTMDREARVLRYKEKKKT  326

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRYA+RKAYAE RPRIKGRFAKR+DVD EVDQ+F +  +++  YG VP F
Sbjct  327   RKFEKTIRYATRKAYAEARPRIKGRFAKRSDVDIEVDQMFSSAALSDCSYGTVPWF  382


 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WAR CD C +A   VYCRAD AYLC  CD+RVH AN VA RHERV VCEACE APA + C
Sbjct  23   WARPCDGCNAAPSVVYCRADAAYLCASCDSRVHAANRVATRHERVRVCEACERAPAVLAC  82

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPIL  807
            +ADAA LC +CD+ +HSANPLARRH RVP++
Sbjct  83   RADAAVLCVSCDAQVHSANPLARRHQRVPVV  113


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            + +R   +    RVC+ C  A   + CRAD A LC  CDA+VH AN +A RH+RV V
Sbjct  56   AANRVATRHERVRVCEACERAPAVLACRADAAVLCVSCDAQVHSANPLARRHQRVPV  112



>ref|XP_002873744.1| hypothetical protein ARALYDRAFT_488429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50003.1| hypothetical protein ARALYDRAFT_488429 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 94/140 (67%), Gaps = 14/140 (10%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLK+ES E+                 + N AR CD CRS AC+VYC AD AYLC  CDA+
Sbjct  1    MLKQESNEI--------------DSEENNRARACDTCRSNACTVYCHADSAYLCMSCDAQ  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RH+RV VCE+CE APA  +C+AD ASLC ACDS++HSANPL+RRH RVPIL
Sbjct  47   VHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCIACDSEVHSANPLSRRHQRVPIL  106

Query  808  PISGTLYGPPTSNPCRESSM  867
            PISG  +    ++   E++M
Sbjct  107  PISGNSFSSMATHHQSETTM  126


 Score =   126 bits (317),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             L + V I SM+ GVVPEST  D + S  R  K T D    PPIQM    QLS MDREARV
Sbjct  250   LNHNVYILSMETGVVPESTARDKTASPPRTPKKTTDQLPDPPIQMI--TQLSPMDREARV  307

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREKKKTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E DQ+F   LM ++GYG
Sbjct  308   LRYREKKKTRKFEKTIRYASRKAYAEIRPRVNGRFAKRREIEAE-DQVFNTMLMYDTGYG  366

Query  1976  IVPS  1987
             IVPS
Sbjct  367   IVPS  370



>gb|AEB34987.1| CONSTANS-like 2 [Helianthus petiolaris]
Length=185

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYG P  +P     + VG+     +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYG-PQGDPRAVMGLGVGV-----DSQSGF  114

Query  913  L  915
            L
Sbjct  115  L  115



>dbj|BAL41844.1| CO, partial [Cardamine nipponica]
Length=161

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA+ +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPASFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  S  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPASFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>gb|AEB34988.1| CONSTANS-like 2 [Helianthus petiolaris]
Length=186

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAAEEDNGF  912
            LC  CD+DIHSANPLARRHHRVP++PI G LYGP       +   ++GL G   +  +GF
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYGPQG-----DPRAVMGL-GVGVDSQSGF  114

Query  913  L  915
            L
Sbjct  115  L  115



>gb|ACJ66258.1| constans-like protein [Chrysanthemum x morifolium]
Length=373

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 92/132 (70%), Gaps = 14/132 (11%)
 Frame = +1

Query  448  MLKEESCEVLDLDVTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDAR  627
            MLK+ES +       IGS   +R       AR CD CRS AC+VYC AD AYLC  CDA+
Sbjct  1    MLKQESND-------IGSGENNR-------ARPCDTCRSNACTVYCHADSAYLCTSCDAQ  46

Query  628  VHGANTVAGRHERVLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPIL  807
            VH AN VA RH+RV VCE+CE APA  +C+AD ASLC ACDS++HSANPLARRH RVPIL
Sbjct  47   VHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPIL  106

Query  808  PISGTLYGPPTS  843
            PISG  +   T+
Sbjct  107  PISGNSFSSMTT  118


 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = +2

Query  1616  LGYQVSISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARV  1795
             + +   ISSM+ GVVPEST   T+ SH R  KGT++    P  QM    QLS MDREARV
Sbjct  251   INHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQLSPMDREARV  310

Query  1796  LRYrekkktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYG  1975
             LRYREK+KTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E +Q F   LM  +GYG
Sbjct  311   LRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKR-EIEAE-EQGFNTMLMYNTGYG  368

Query  1976  IVPSF  1990
             IVPSF
Sbjct  369   IVPSF  373



>gb|AEB35027.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=202

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|AEB35036.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=203

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|AEB35035.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=199

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|AEB35043.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=203

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|AEB35021.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=202

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|ADO61503.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35148.1| CONSTANS-like 2 [Helianthus annuus]
Length=203

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|ADO61502.1| CONSTANS-like 2 [Helianthus annuus]
 gb|AEB35147.1| CONSTANS-like 2 [Helianthus annuus]
Length=199

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>gb|AEB35023.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=203

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 77/95 (81%), Gaps = 1/95 (1%)
 Frame = +1

Query  550  DICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKada  726
            D CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADA
Sbjct  1    DTCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADA  60

Query  727  aslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            ASLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   ASLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  95



>dbj|BAL41841.1| CO, partial [Cardamine nipponica]
 dbj|BAL41842.1| CO, partial [Cardamine nipponica]
Length=161

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +1

Query  487  VTIGSSSGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHER  666
            +T  S+  SR  N +  AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+R
Sbjct  2    MTQESNDISRGENVR--ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKR  59

Query  667  VLVCEACESAPATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            V VCE+CE APA  +C+AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  60   VRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114



>dbj|BAL41832.1| CO, partial [Cardamine nipponica]
 dbj|BAL41834.1| CO, partial [Cardamine nipponica]
 dbj|BAL41835.1| CO, partial [Cardamine nipponica]
 dbj|BAL41836.1| CO, partial [Cardamine nipponica]
 dbj|BAL41837.1| CO, partial [Cardamine nipponica]
 dbj|BAL41850.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41852.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41853.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41854.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41855.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41856.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41857.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41858.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41859.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41860.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41861.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41862.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41863.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41864.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41867.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>dbj|BAL41833.1| CO, partial [Cardamine nipponica]
 dbj|BAL41838.1| CO, partial [Cardamine nipponica]
 dbj|BAL41843.1| CO, partial [Cardamine nipponica]
 dbj|BAL41847.1| CO, partial [Cardamine nipponica]
 dbj|BAL41866.1| CO, partial [Cardamine bellidifolia]
 dbj|BAL41870.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41871.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41872.1| CO, partial [Cardamine bellidifolia subsp. alpina]
Length=161

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>dbj|BAL41839.1| CO, partial [Cardamine nipponica]
 dbj|BAL41840.1| CO, partial [Cardamine nipponica]
 dbj|BAL41846.1| CO, partial [Cardamine nipponica]
 dbj|BAL41848.1| CO, partial [Cardamine nipponica]
 dbj|BAL41849.1| CO, partial [Cardamine nipponica]
Length=161

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPI  105



>gb|AAN09825.1| COL1 protein [Brassica nigra]
Length=342

 Score =   129 bits (323),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  523  NKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPA  702
             + NWA+ CD  RSAAC+VYCRAD AY C  CDA++  AN +A RHERV VCE+CE APA
Sbjct  4    QESNWAQACDTXRSAACTVYCRADSAYXCTSCDAQIXAANRLASRHERVRVCESCERAPA  63

Query  703  TVICKadaaslcaacdsdIHSANPLARRHHRVPILPISG  819
               CKADAASLC ACDS IHSANPLARRH RVPILPISG
Sbjct  64   AFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISG  102


 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  1649  VGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkktrk  1828
             V +VPES  SD ++SH R+ K   +     P+QM     LS M+R+ARVLRYREKKKTRK
Sbjct  235   VSLVPESVTSDATVSHPRSPKAGTEELPEAPVQM-----LSPMERKARVLRYREKKKTRK  289

Query  1829  fektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             FEK IRYASRK YAE RPRIKGRFA R +VD   D      +M ++GYGIVPSF
Sbjct  290   FEKRIRYASRKEYAEKRPRIKGRFAXRNEVD--ADHALSTMVMFDTGYGIVPSF  341


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            + +R  ++    RVC+ C  A  + +C+AD A LC  CD+++H AN +A RH+RV +
Sbjct  41   AANRLASRHERVRVCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRVPI  97



>dbj|BAL41865.1| CO, partial [Cardamine bellidifolia]
Length=161

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANHVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVPILP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPILPVSGNSFS  114



>gb|AEP02829.1| heading day 1 [Oryza rufipogon]
Length=406

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = +1

Query  535  WARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVIC  714
            WAR CD CR+A   VYCRAD AYLC  CDARVH AN VA RHERV VCEACE APA ++C
Sbjct  30   WARPCDGCRAAPSVVYCRADAAYLCASCDARVHAANRVASRHERVRVCEACERAPAALVC  89

Query  715  KadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMMVGLTGDAA  894
            +ADAA+LC ACD  +HSANPLARRH RVP+ P+      P TS           + GD  
Sbjct  90   RADAAALCVACDVQVHSANPLARRHQRVPVAPLPAITI-PATSVLAEAVVATATVLGDKD  148

Query  895  EEDNGFL  915
            EE + +L
Sbjct  149  EEVDSWL  155


 Score =   121 bits (304),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = +2

Query  1643  MDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrekkkt  1822
             M+ G+VP+ST+ D   S +    G I+LFSGP +QM   L  S MDREARVLRYREKKK 
Sbjct  293   MEAGIVPDSTVIDMPNSSTLTPAGAINLFSGPSLQM--SLHFSSMDREARVLRYREKKKA  350

Query  1823  rkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             RKFEKTIRY +RKAYAE RPRIKGRFAKR+DV  EVDQ+F    +++  YG VP F
Sbjct  351   RKFEKTIRYETRKAYAEARPRIKGRFAKRSDVQIEVDQMFSTAALSDGSYGTVPWF  406



>gb|AEB35038.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=197

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            LC  C++DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   LCTTCEADIHSANPLARRHHRVPVMPIPGALYG  93



>ref|XP_006287957.1| hypothetical protein CARUB_v10001192mg [Capsella rubella]
 gb|EOA20855.1| hypothetical protein CARUB_v10001192mg [Capsella rubella]
Length=376

 Score =   128 bits (321),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  517  SGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESA  696
            S  + N AR CD CRS   +VYC AD AYLC  CDA+VH AN VA RH+RV VCE+CE A
Sbjct  10   SSGENNRARACDTCRSNVSTVYCHADSAYLCMSCDAQVHSANRVASRHKRVGVCESCERA  69

Query  697  PATVICKadaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            PA  +C+AD ASLC ACDS++HSANPLARRHHRVPILPISG  Y 
Sbjct  70   PAAFLCEADDASLCTACDSEVHSANPLARRHHRVPILPISGNSYS  114


 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 87/119 (73%), Gaps = 3/119 (3%)
 Frame = +2

Query  1634  ISSMDVGVVPESTLSDTSISHSRASKGTIDLFSGPPIQMPPQLQLSQMDREARVLRYrek  1813
             ISS++ GVVP ST   T+ SH R  K TID    PP QM    QLS  DREARVLRYREK
Sbjct  261   ISSIETGVVPVSTACFTTASHPRTPKATIDKLPDPPSQMV--TQLSPTDREARVLRYREK  318

Query  1814  kktrkfektIRYASRKAYAETRPRIKGRFAKRTDVDTEVDQIFYAPLMAESGYGIVPSF  1990
             +KTRKFEKTIRYASRKAYAE RPR+ GRFAKR +++ E D  F   LM E+GYG+VPSF
Sbjct  319   RKTRKFEKTIRYASRKAYAERRPRVNGRFAKRIEIEDE-DHGFNTMLMYETGYGVVPSF  376



>gb|AEB35041.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=199

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            LC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYG  93



>dbj|BAL41869.1| CO, partial [Cardamine bellidifolia subsp. alpina]
 dbj|BAL41873.1| CO, partial [Cardamine resedifolia]
 dbj|BAL41874.1| CO, partial [Cardamine resedifolia]
 dbj|BAL41875.1| CO, partial [Cardamine resedifolia]
Length=161

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  17   ARACDTCRSAPCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAFLCE  76

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            AD ASLC ACDS++HSANPLARRH RVP LP+SG  + 
Sbjct  77   ADDASLCTACDSEVHSANPLARRHQRVPTLPVSGNSFS  114


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERV  669
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV
Sbjct  49   SANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV  103



>dbj|BAL41877.1| CO, partial [Cardamine glauca]
Length=155

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +1

Query  538  ARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLVCEACESAPATVICK  717
            AR CD CRSA+C+VYC AD AYLC  CD +VH AN VA RH+RV VCE+CE APA  +C+
Sbjct  11   ARACDTCRSASCTVYCHADSAYLCTSCDTQVHSANRVASRHKRVRVCESCERAPAAYLCE  70

Query  718  adaaslcaacdsdIHSANPLARRHHRVPILPISGTLYGPPTSNPCRESSMM  870
            AD ASLC ACDS++HSANPLARRH RV ILPISG  +   +++   E++M 
Sbjct  71   ADDASLCTACDSEVHSANPLARRHQRVQILPISGNSFSFMSTHHQSETTMT  121


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  SGSRSGNKQNWARVCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV  675
            S +R  ++    RVC+ C  A  +  C AD A LC  CD+ VH AN +A RH+RV +
Sbjct  43   SANRVASRHKRVRVCESCERAPAAYLCEADDASLCTACDSEVHSANPLARRHQRVQI  99



>gb|AEB35042.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=200

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +1

Query  556  CRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaas  732
            CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAAS
Sbjct  1    CRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAAS  60

Query  733  lcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            LC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   LCTTCDADIHSANPLARRHHRVPVMPIPGALYG  93



>gb|AEB35028.1| CONSTANS-like 2 [Helianthus tuberosus]
Length=199

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +1

Query  553  ICRSAACSVYCRADLAYLCGGCDARVHGANTV-AGRHERVLVCEACESAPATVICKadaa  729
             CRSA C++YCR D AYLC  CDAR+H AN + + +HERV VCEACE APA  ICKADAA
Sbjct  1    TCRSAPCTIYCRPDAAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADAA  60

Query  730  slcaacdsdIHSANPLARRHHRVPILPISGTLYG  831
            SLC  CD+DIHSANPLARRHHRVP++PI G LYG
Sbjct  61   SLCTTCDADIHSANPLARRHHRVPVMPIPGALYG  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6621399016112