BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20428_g2_i1 len=954 path=[2223:0-366 2590:367-404 2627:405-953]

Length=954
                                                                      Score     E

ref|XP_009620411.1|  PREDICTED: transcription factor BEE 3-like         239   2e-73   
ref|XP_009777020.1|  PREDICTED: transcription factor BEE 3-like         232   9e-71   
emb|CDP21609.1|  unnamed protein product                                227   5e-70   
ref|XP_009617979.1|  PREDICTED: transcription factor BEE 1-like         229   1e-69   
ref|XP_009796282.1|  PREDICTED: transcription factor BEE 1-like         229   2e-69   
ref|XP_006353818.1|  PREDICTED: transcription factor BEE 1-like         221   4e-67   
ref|XP_004252234.1|  PREDICTED: transcription factor BEE 1-like         222   6e-67   
ref|XP_004235809.1|  PREDICTED: transcription factor BEE 3              222   6e-67   
ref|XP_006341598.1|  PREDICTED: transcription factor BEE 3-like         221   1e-66   
ref|XP_007036544.1|  BR enhanced expression 1                           221   2e-66   
ref|XP_011045849.1|  PREDICTED: transcription factor BEE 3 isofor...    219   1e-65   
ref|XP_011080441.1|  PREDICTED: transcription factor BEE 1-like         219   1e-65   
ref|XP_002317910.1|  basic helix-loop-helix family protein              218   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002532159.1|  DNA binding protein, putative                      213   2e-64   Ricinus communis
ref|XP_011045850.1|  PREDICTED: transcription factor BEE 1 isofor...    215   4e-64   
gb|KHF97488.1|  Transcription factor BEE 3 -like protein                213   1e-63   
ref|XP_011090153.1|  PREDICTED: transcription factor BEE 1-like         214   1e-63   
ref|XP_007154151.1|  hypothetical protein PHAVU_003G094700g             211   1e-62   
gb|EYU35927.1|  hypothetical protein MIMGU_mgv1a022747mg                209   1e-61   
ref|XP_003533364.1|  PREDICTED: transcription factor BEE 1-like         207   4e-61   
ref|XP_006440991.1|  hypothetical protein CICLE_v10024155mg             200   6e-60   
ref|XP_011007722.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    203   1e-59   
gb|KDP20132.1|  hypothetical protein JCGZ_05901                         203   2e-59   
ref|XP_003528950.1|  PREDICTED: transcription factor BEE 1-like         202   3e-59   
ref|XP_004512905.1|  PREDICTED: transcription factor BEE 3-like         202   5e-59   
ref|XP_006485801.1|  PREDICTED: transcription factor BEE 3-like         201   1e-58   
ref|XP_002276500.1|  PREDICTED: transcription factor BEE 3              201   1e-58   Vitis vinifera
ref|XP_010265101.1|  PREDICTED: transcription factor bHLH75-like        201   2e-58   
gb|EYU46217.1|  hypothetical protein MIMGU_mgv1a011969mg                200   2e-58   
ref|XP_008240256.1|  PREDICTED: transcription factor BEE 1              200   3e-58   
gb|KHF97638.1|  Transcription factor BEE 1 -like protein                199   4e-58   
gb|KHN21570.1|  Transcription factor BEE 1                              198   5e-58   
ref|XP_010537453.1|  PREDICTED: transcription factor BEE 3 isofor...    199   6e-58   
ref|XP_010537454.1|  PREDICTED: transcription factor BEE 3 isofor...    199   6e-58   
ref|XP_002887509.1|  hypothetical protein ARALYDRAFT_476520             199   6e-58   
ref|XP_007210857.1|  hypothetical protein PRUPE_ppa015301mg             199   7e-58   
ref|XP_003525253.1|  PREDICTED: transcription factor BEE 1-like         198   9e-58   
ref|XP_006416609.1|  hypothetical protein EUTSA_v10008517mg             198   9e-58   
ref|XP_004137542.1|  PREDICTED: transcription factor BEE 3-like         198   1e-57   
gb|KHN32051.1|  Transcription factor BEE 3                              197   1e-57   
ref|XP_008453408.1|  PREDICTED: transcription factor BEE 3-like         198   1e-57   
ref|XP_010477017.1|  PREDICTED: transcription factor BEE 1-like         198   1e-57   
gb|KFK43999.1|  hypothetical protein AALP_AA1G201600                    197   2e-57   
ref|NP_173276.2|  transcription factor BEE 1                            197   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ACN21646.1|  putative basic helix-loop-helix protein BHLH5           197   3e-57   Lotus japonicus
ref|XP_006305468.1|  hypothetical protein CARUB_v10009894mg             198   3e-57   
ref|XP_003532505.1|  PREDICTED: transcription factor BEE 3-like         196   4e-57   
ref|XP_010264190.1|  PREDICTED: transcription factor bHLH75-like        197   6e-57   
ref|XP_010498227.1|  PREDICTED: transcription factor BEE 1              196   7e-57   
ref|XP_010036900.1|  PREDICTED: transcription factor BEE 3              196   2e-56   
emb|CDY65027.1|  BnaC05g50040D                                          195   2e-56   
ref|XP_010428323.1|  PREDICTED: transcription factor BEE 3 isofor...    195   2e-56   
gb|AAW81732.1|  putative bZIPtranscription factor protein               195   2e-56   Brassica oleracea
ref|XP_004137476.1|  PREDICTED: transcription factor BEE 3-like         195   2e-56   
ref|XP_009149281.1|  PREDICTED: transcription factor BEE 1              194   3e-56   
ref|XP_007160380.1|  hypothetical protein PHAVU_002G316900g             194   4e-56   
ref|XP_008393318.1|  PREDICTED: transcription factor BEE 3              194   4e-56   
ref|XP_009106040.1|  PREDICTED: transcription factor BEE 3              194   5e-56   
emb|CDX73020.1|  BnaC06g34680D                                          194   5e-56   
emb|CDY67050.1|  BnaA07g38970D                                          193   7e-56   
gb|KGN63829.1|  hypothetical protein Csa_1G024150                       198   2e-55   
gb|AAG52074.1|AC012679_12  putative helix-loop-helix DNA-binding ...    191   3e-55   
ref|NP_177524.2|  transcription factor BEE 3                            192   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459453.1|  PREDICTED: transcription factor BEE 1-like         191   4e-55   
gb|KFK41823.1|  hypothetical protein AALP_AA2G175900                    191   8e-55   
ref|XP_006374179.1|  hypothetical protein POPTR_0015s03760g             186   9e-55   
ref|XP_010416202.1|  PREDICTED: transcription factor BEE 3-like         190   1e-54   
ref|XP_010471458.1|  PREDICTED: transcription factor BEE 3              190   1e-54   
ref|XP_004300517.1|  PREDICTED: transcription factor BEE 3-like         191   1e-54   
ref|XP_009360148.1|  PREDICTED: transcription factor BEE 3-like         190   2e-54   
emb|CAN76460.1|  hypothetical protein VITISV_010828                     188   3e-54   Vitis vinifera
ref|XP_002279412.1|  PREDICTED: transcription factor bHLH75             189   3e-54   Vitis vinifera
emb|CBI27002.3|  unnamed protein product                                189   3e-54   
ref|XP_006302692.1|  hypothetical protein CARUB_v10020802mg             189   3e-54   
emb|CDY47737.1|  BnaA02g16580D                                          188   5e-54   
gb|AFK47662.1|  unknown                                                 189   6e-54   
ref|XP_009128012.1|  PREDICTED: transcription factor BEE 3-like i...    188   8e-54   
emb|CDY45873.1|  BnaC02g22470D                                          185   2e-53   
ref|XP_009128013.1|  PREDICTED: transcription factor BEE 3-like i...    186   2e-53   
ref|NP_001185394.1|  transcription factor BEE 3                         186   3e-53   
ref|XP_010094743.1|  hypothetical protein L484_019953                   188   8e-53   
ref|XP_006390502.1|  hypothetical protein EUTSA_v10019010mg             184   2e-52   
ref|XP_008458311.1|  PREDICTED: transcription factor BEE 3-like         184   5e-52   
ref|XP_010428324.1|  PREDICTED: transcription factor BEE 3 isofor...    182   5e-52   
ref|XP_009347236.1|  PREDICTED: transcription factor BEE 3-like         182   1e-51   
gb|AAF25996.1|AC013354_15  F15H18.11                                    194   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010032051.1|  PREDICTED: transcription factor BEE 1-like         180   8e-51   
ref|XP_006469087.1|  PREDICTED: transcription factor bHLH75-like        179   8e-51   
gb|KDO76971.1|  hypothetical protein CISIN_1g042908mg                   179   1e-50   
ref|XP_006448452.1|  hypothetical protein CICLE_v10016461mg             178   2e-50   
ref|XP_006448451.1|  hypothetical protein CICLE_v10016461mg             178   2e-50   
gb|KDP29431.1|  hypothetical protein JCGZ_18352                         177   2e-50   
ref|XP_002890272.1|  F15H18.11                                          190   4e-50   
ref|XP_006842314.1|  hypothetical protein AMTR_s00079p00137860          178   8e-50   
ref|XP_003620453.1|  Transcription factor BEE                           177   2e-49   
ref|XP_010537455.1|  PREDICTED: transcription factor BEE 3 isofor...    176   2e-49   
ref|XP_010677996.1|  PREDICTED: transcription factor BEE 3              176   2e-49   
ref|XP_003545405.1|  PREDICTED: transcription factor BEE 1-like         175   3e-48   
gb|EYU40766.1|  hypothetical protein MIMGU_mgv1a025086mg                173   5e-48   
ref|XP_011078318.1|  PREDICTED: transcription factor bHLH75             172   7e-48   
ref|XP_003550247.1|  PREDICTED: transcription factor BEE 1-like         172   1e-47   
ref|XP_010926028.1|  PREDICTED: transcription factor bHLH75-like        172   2e-47   
ref|XP_009409985.1|  PREDICTED: transcription factor bHLH75-like        171   3e-47   
ref|XP_007033256.1|  Basic helix-loop-helix DNA-binding superfami...    171   3e-47   
gb|KHN15301.1|  Transcription factor BEE 1                              171   4e-47   
ref|XP_010681492.1|  PREDICTED: transcription factor bHLH75-like        170   4e-47   
ref|XP_004299055.1|  PREDICTED: transcription factor bHLH75-like        169   5e-47   
ref|XP_008807118.1|  PREDICTED: transcription factor bHLH75-like        170   6e-47   
ref|XP_010916401.1|  PREDICTED: transcription factor bHLH75-like ...    170   6e-47   
ref|XP_009602728.1|  PREDICTED: transcription factor BEE 1-like         170   7e-47   
ref|XP_009779032.1|  PREDICTED: transcription factor bHLH75-like        167   1e-45   
ref|XP_008797805.1|  PREDICTED: transcription factor bHLH75-like        166   2e-45   
emb|CDY36107.1|  BnaA08g19410D                                          165   2e-45   
ref|XP_009797954.1|  PREDICTED: transcription factor bHLH75-like ...    164   6e-45   
ref|XP_010660417.1|  PREDICTED: transcription factor bHLH75-like ...    166   8e-45   
ref|XP_006360470.1|  PREDICTED: transcription factor bHLH75-like        160   1e-44   
emb|CBI33645.3|  unnamed protein product                                166   1e-44   
emb|CDY24404.1|  BnaCnng04710D                                          162   2e-44   
ref|XP_009797953.1|  PREDICTED: transcription factor bHLH75-like ...    163   2e-44   
ref|XP_009797952.1|  PREDICTED: transcription factor bHLH75-like ...    164   2e-44   
ref|XP_010916400.1|  PREDICTED: transcription factor BEE 1-like i...    164   2e-44   
ref|XP_009415914.1|  PREDICTED: transcription factor BEE 1-like         162   5e-44   
ref|XP_009109880.1|  PREDICTED: transcription factor bHLH75             160   8e-44   
ref|XP_008243254.1|  PREDICTED: transcription factor bHLH75-like ...    160   9e-44   
ref|XP_008243253.1|  PREDICTED: transcription factor bHLH75-like ...    160   1e-43   
ref|XP_004236997.1|  PREDICTED: transcription factor bHLH75             162   1e-43   
ref|XP_007223899.1|  hypothetical protein PRUPE_ppa010885mg             159   5e-43   
ref|XP_006415858.1|  hypothetical protein EUTSA_v10008699mg             158   1e-42   
ref|XP_009380294.1|  PREDICTED: transcription factor BEE 3-like         159   1e-42   
ref|XP_007223898.1|  hypothetical protein PRUPE_ppa010885mg             157   2e-42   
gb|KDP32956.1|  hypothetical protein JCGZ_12987                         159   2e-42   
ref|XP_010499123.1|  PREDICTED: transcription factor bHLH75-like ...    157   2e-42   
ref|XP_010499122.1|  PREDICTED: transcription factor bHLH75-like ...    157   2e-42   
ref|XP_006303530.1|  hypothetical protein CARUB_v10010961mg             157   2e-42   
gb|AAG28811.2|AC079374_14  helix-loop-helix protein homolog, puta...    155   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339657.1|  PREDICTED: transcription factor bHLH75-like        157   2e-42   
ref|XP_010477946.1|  PREDICTED: transcription factor bHLH75-like        156   4e-42   
ref|XP_008389280.1|  PREDICTED: transcription factor bHLH75-like ...    157   4e-42   
ref|XP_009356252.1|  PREDICTED: transcription factor bHLH75-like        156   5e-42   
ref|XP_010099250.1|  hypothetical protein L484_015439                   155   5e-42   
ref|NP_564229.1|  transcription factor CESTA                            155   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28414.1|  unknown                                                 155   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462908.1|  PREDICTED: transcription factor bHLH75-like        155   7e-42   
ref|XP_008243252.1|  PREDICTED: transcription factor bHLH75-like ...    155   2e-41   
ref|XP_008243251.1|  PREDICTED: transcription factor bHLH75-like ...    155   2e-41   
emb|CDP00640.1|  unnamed protein product                                155   3e-41   
gb|EPS58961.1|  hypothetical protein M569_15851                         150   4e-41   
ref|XP_010660418.1|  PREDICTED: transcription factor BEE 1-like i...    154   1e-40   
ref|XP_008389281.1|  PREDICTED: transcription factor bHLH75-like ...    153   1e-40   
ref|XP_006383447.1|  hypothetical protein POPTR_0005s15590g             153   1e-40   
gb|KFK44530.1|  hypothetical protein AALP_AA1G268600                    150   6e-40   
gb|KFK44529.1|  hypothetical protein AALP_AA1G268600                    150   7e-40   
ref|XP_011021250.1|  PREDICTED: transcription factor bHLH75-like        151   8e-40   
ref|XP_002533944.1|  DNA binding protein, putative                      151   1e-39   Ricinus communis
ref|XP_009405138.1|  PREDICTED: transcription factor BEE 3              148   6e-39   
ref|XP_006430772.1|  hypothetical protein CICLE_v10012453mg             149   9e-39   
ref|XP_006482245.1|  PREDICTED: transcription factor BEE 3-like         149   9e-39   
emb|CAN71967.1|  hypothetical protein VITISV_017400                     148   2e-38   Vitis vinifera
ref|XP_002305819.2|  hypothetical protein POPTR_0004s09850g             146   9e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011035067.1|  PREDICTED: transcription factor BEE 1-like         142   2e-36   
gb|KDO57469.1|  hypothetical protein CISIN_1g024653mg                   140   2e-36   
ref|XP_009383609.1|  PREDICTED: transcription factor bHLH75-like        139   2e-35   
gb|KGN57761.1|  hypothetical protein Csa_3G282490                       139   2e-35   
gb|KDO59022.1|  hypothetical protein CISIN_1g017964mg                   139   2e-34   
emb|CDY45835.1|  BnaA02g14180D                                          140   4e-34   
ref|XP_009127689.1|  PREDICTED: transcription factor bHLH49-like        140   4e-34   
ref|XP_009401352.1|  PREDICTED: transcription factor BEE 1-like i...    135   4e-34   
ref|XP_002977203.1|  hypothetical protein SELMODRAFT_106386             133   5e-34   
gb|EPS62866.1|  hypothetical protein M569_11921                         131   6e-34   
emb|CDX81575.1|  BnaC02g18790D                                          139   8e-34   
ref|XP_002526990.1|  DNA binding protein, putative                      132   1e-33   Ricinus communis
ref|XP_010511918.1|  PREDICTED: transcription factor bHLH49-like        138   2e-33   
ref|XP_009380954.1|  PREDICTED: transcription factor BEE 1-like         133   2e-33   
ref|XP_006391072.1|  hypothetical protein EUTSA_v10018444mg             138   2e-33   
ref|XP_009372199.1|  PREDICTED: transcription factor bHLH62             138   3e-33   
ref|XP_008456996.1|  PREDICTED: transcription factor BEE 3-like i...    133   3e-33   
ref|XP_008809649.1|  PREDICTED: transcription factor bHLH78-like ...    138   3e-33   
ref|XP_008809650.1|  PREDICTED: transcription factor bHLH78-like ...    138   3e-33   
ref|XP_010907240.1|  PREDICTED: transcription factor bHLH62             138   3e-33   
emb|CAE00874.1|  TA1 protein                                            132   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382580.1|  PREDICTED: transcription factor bHLH62 isofo...    138   4e-33   
ref|XP_011024588.1|  PREDICTED: transcription factor bHLH62             137   4e-33   
gb|KDO70234.1|  hypothetical protein CISIN_1g0086311mg                  132   4e-33   
emb|CDY33568.1|  BnaC06g29840D                                          137   5e-33   
gb|KDO70235.1|  hypothetical protein CISIN_1g0086311mg                  132   5e-33   
ref|XP_008382579.1|  PREDICTED: transcription factor bHLH62 isofo...    137   6e-33   
gb|KDP45272.1|  hypothetical protein JCGZ_15137                         137   6e-33   
ref|XP_008456998.1|  PREDICTED: transcription factor BEE 3-like i...    132   6e-33   
gb|EPS74146.1|  hypothetical protein M569_00610                         128   6e-33   
ref|XP_002966517.1|  hypothetical protein SELMODRAFT_72702              128   6e-33   
ref|XP_008382578.1|  PREDICTED: transcription factor bHLH62 isofo...    137   7e-33   
ref|XP_009612948.1|  PREDICTED: transcription factor bHLH77-like        136   8e-33   
gb|KDO70232.1|  hypothetical protein CISIN_1g0086311mg                  132   9e-33   
ref|XP_009392658.1|  PREDICTED: transcription factor bHLH77             134   9e-33   
ref|XP_009105442.1|  PREDICTED: transcription factor bHLH49             136   9e-33   
ref|XP_006347483.1|  PREDICTED: transcription factor bHLH137-like       132   9e-33   
ref|NP_177058.1|  transcription factor bHLH49                           136   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73774.1|  hypothetical protein M569_00982                         130   1e-32   
ref|XP_006302168.1|  hypothetical protein CARUB_v10020178mg             136   1e-32   
ref|XP_002303073.2|  basic helix-loop-helix family protein              136   1e-32   Populus trichocarpa [western balsam poplar]
ref|NP_001031255.1|  transcription factor bHLH49                        136   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470832.1|  PREDICTED: transcription factor bHLH49-like        136   1e-32   
gb|KDO70233.1|  hypothetical protein CISIN_1g0086311mg                  132   1e-32   
ref|XP_009760399.1|  PREDICTED: transcription factor bHLH78-like        135   1e-32   
ref|XP_008813505.1|  PREDICTED: transcription factor bHLH62-like ...    136   1e-32   
ref|XP_008799570.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    136   1e-32   
ref|XP_010415500.1|  PREDICTED: transcription factor bHLH49-like        135   1e-32   
gb|AAM10942.1|AF488584_1  putative bHLH transcription factor            135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008813504.1|  PREDICTED: transcription factor bHLH62-like ...    136   2e-32   
ref|XP_001780050.1|  predicted protein                                  129   2e-32   
ref|XP_004253164.1|  PREDICTED: transcription factor bHLH62-like        134   2e-32   
ref|XP_010036765.1|  PREDICTED: transcription factor bHLH62-like        135   2e-32   
ref|XP_011084194.1|  PREDICTED: transcription factor bHLH78-like        135   2e-32   
ref|XP_002865830.1|  basic helix-loop-helix family protein              132   3e-32   
ref|XP_008372543.1|  PREDICTED: transcription factor bHLH62-like        135   3e-32   
ref|XP_002887213.1|  basic helix-loop-helix family protein              135   3e-32   
gb|KHG16496.1|  Transcription factor bHLH62 -like protein               134   3e-32   
gb|KEH22550.1|  BHLH transcription factor                               135   3e-32   
ref|XP_010318148.1|  PREDICTED: basic helix-loop-helix isoform X1       133   3e-32   
ref|NP_001266190.1|  basic helix-loop-helix                             133   3e-32   
gb|AFK37834.1|  unknown                                                 135   3e-32   
emb|CBI17295.3|  unnamed protein product                                134   3e-32   
gb|ABR16552.1|  unknown                                                 135   3e-32   Picea sitchensis
ref|XP_004248023.1|  PREDICTED: transcription factor bHLH62             134   3e-32   
ref|XP_010552022.1|  PREDICTED: transcription factor bHLH62-like        135   4e-32   
ref|XP_006358792.1|  PREDICTED: transcription factor bHLH62-like        134   4e-32   
ref|XP_003603935.1|  Transcription factor BEE                           134   4e-32   
ref|XP_006363974.1|  PREDICTED: transcription factor bHLH137-like       132   4e-32   
gb|AES74186.2|  BHLH transcription factor                               134   4e-32   
gb|AFK40379.1|  unknown                                                 134   4e-32   
gb|EMS64147.1|  Transcription factor bHLH49                             133   4e-32   
gb|KDP32569.1|  hypothetical protein JCGZ_13119                         134   4e-32   
ref|XP_010322508.1|  PREDICTED: transcription factor bHLH137-like       131   4e-32   
gb|KEH22551.1|  BHLH transcription factor                               134   4e-32   
ref|XP_010542232.1|  PREDICTED: transcription factor bHLH49-like        129   4e-32   
gb|KFK38192.1|  hypothetical protein AALP_AA3G081200                    134   4e-32   
ref|XP_009406341.1|  PREDICTED: transcription factor bHLH62-like        134   5e-32   
ref|XP_006407846.1|  hypothetical protein EUTSA_v10020729mg             134   5e-32   
ref|XP_010547134.1|  PREDICTED: transcription factor bHLH62-like        134   5e-32   
ref|XP_007201182.1|  hypothetical protein PRUPE_ppa003350mg             135   5e-32   
gb|KHG19333.1|  Transcription factor bHLH62 -like protein               134   5e-32   
ref|XP_001783811.1|  predicted protein                                  128   5e-32   
ref|XP_007140690.1|  hypothetical protein PHAVU_008G133600g             134   5e-32   
emb|CAN73299.1|  hypothetical protein VITISV_005183                     134   5e-32   Vitis vinifera
ref|XP_008244684.1|  PREDICTED: transcription factor bHLH62             134   5e-32   
ref|XP_006602464.1|  PREDICTED: transcription factor bHLH78-like ...    134   5e-32   
ref|XP_007034153.1|  Basic helix-loop-helix DNA-binding superfami...    134   5e-32   
emb|CDX95974.1|  BnaA07g27570D                                          134   5e-32   
ref|XP_002264969.2|  PREDICTED: transcription factor bHLH77-like        134   5e-32   Vitis vinifera
ref|XP_010243164.1|  PREDICTED: transcription factor bHLH62-like        135   6e-32   
ref|XP_004147655.1|  PREDICTED: transcription factor bHLH78-like        134   6e-32   
ref|XP_008792945.1|  PREDICTED: transcription factor bHLH62-like        134   6e-32   
ref|XP_004492265.1|  PREDICTED: transcription factor bHLH78-like        134   6e-32   
emb|CDX84885.1|  BnaA03g13450D                                          131   6e-32   
ref|XP_006602463.1|  PREDICTED: transcription factor bHLH78-like ...    134   6e-32   
ref|XP_008439060.1|  PREDICTED: transcription factor bHLH62-like        134   6e-32   
ref|XP_010913102.1|  PREDICTED: transcription factor bHLH78-like ...    134   6e-32   
emb|CDY45806.1|  BnaC03g16290D                                          131   6e-32   
ref|XP_003532257.1|  PREDICTED: transcription factor bHLH78-like        134   7e-32   
ref|NP_001183599.1|  putative HLH DNA-binding domain superfamily ...    134   7e-32   
ref|XP_007034154.1|  Basic helix-loop-helix DNA-binding superfami...    134   7e-32   
ref|XP_007045713.1|  Basic helix-loop-helix DNA-binding superfami...    134   7e-32   
ref|XP_011102313.1|  PREDICTED: transcription factor bHLH49-like        133   7e-32   
ref|XP_007045714.1|  Basic helix-loop-helix DNA-binding superfami...    134   7e-32   
gb|EPS69456.1|  hypothetical protein M569_05311                         128   8e-32   
ref|XP_010681176.1|  PREDICTED: transcription factor bHLH49 isofo...    134   8e-32   
ref|XP_010905158.1|  PREDICTED: transcription factor bHLH62-like        134   8e-32   
ref|XP_006661402.1|  PREDICTED: transcription factor bHLH77-like        131   8e-32   
ref|XP_010681179.1|  PREDICTED: transcription factor bHLH49 isofo...    133   8e-32   
dbj|BAJ94720.1|  predicted protein                                      130   8e-32   
ref|XP_009132684.1|  PREDICTED: transcription factor bHLH137            131   8e-32   
ref|XP_006297628.1|  hypothetical protein CARUB_v10013649mg             133   8e-32   
ref|XP_007209284.1|  hypothetical protein PRUPE_ppa008085mg             132   8e-32   
ref|XP_002534345.1|  transcription factor, putative                     134   8e-32   Ricinus communis
ref|XP_010681178.1|  PREDICTED: transcription factor bHLH49 isofo...    134   8e-32   
gb|AAM10951.1|AF488595_1  putative bHLH transcription factor            133   9e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001757672.1|  predicted protein                                  124   9e-32   
emb|CDM85636.1|  unnamed protein product                                133   9e-32   
ref|NP_187390.1|  transcription factor bHLH62                           133   9e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44326.1|  putative bHLH transcription factor (bHLH062)           133   9e-32   
ref|XP_007045712.1|  Basic helix-loop-helix DNA-binding superfami...    134   9e-32   
ref|XP_011089038.1|  PREDICTED: transcription factor bHLH62 isofo...    134   9e-32   
gb|KHN10339.1|  Transcription factor bHLH62                             134   9e-32   
ref|XP_008222784.1|  PREDICTED: transcription factor bHLH62             133   1e-31   
emb|CDP10270.1|  unnamed protein product                                133   1e-31   
ref|XP_009410618.1|  PREDICTED: transcription factor bHLH77-like ...    132   1e-31   
gb|EYU32918.1|  hypothetical protein MIMGU_mgv11b022778mg               127   1e-31   
ref|XP_008466092.1|  PREDICTED: transcription factor bHLH49-like        133   1e-31   
gb|ACN21632.1|  putative basic helix-loop-helix protein BHLH7           131   1e-31   
ref|XP_010486282.1|  PREDICTED: transcription factor bHLH62-like        133   1e-31   
ref|XP_011089037.1|  PREDICTED: transcription factor bHLH62 isofo...    133   1e-31   
ref|NP_568745.1|  transcription factor bHLH137                          130   1e-31   
emb|CCF72395.1|  bHLH trascription factor                               132   1e-31   
ref|XP_010513668.1|  PREDICTED: transcription factor bHLH49-like        127   1e-31   
ref|XP_007221818.1|  hypothetical protein PRUPE_ppa003543mg             133   1e-31   
ref|XP_010943354.1|  PREDICTED: transcription factor bHLH49 isofo...    133   1e-31   
ref|XP_010464354.1|  PREDICTED: transcription factor bHLH62-like        133   1e-31   
ref|XP_006402045.1|  hypothetical protein EUTSA_v10014242mg             130   1e-31   
gb|KHG05669.1|  Transcription factor protein                            131   1e-31   
gb|EYU22588.1|  hypothetical protein MIMGU_mgv1a025708mg                131   1e-31   
ref|XP_010442567.1|  PREDICTED: transcription factor bHLH137-like       130   1e-31   
gb|KHG20666.1|  Transcription factor bHLH62 -like protein               133   1e-31   
ref|XP_011077884.1|  PREDICTED: transcription factor bHLH49             133   1e-31   
ref|XP_010482407.1|  PREDICTED: transcription factor bHLH137-like...    130   1e-31   
ref|XP_011009204.1|  PREDICTED: transcription factor bHLH49             133   1e-31   
ref|XP_009587187.1|  PREDICTED: transcription factor bHLH137            131   1e-31   
gb|EPS74590.1|  hypothetical protein M569_00166                         125   1e-31   
ref|XP_006645221.1|  PREDICTED: transcription factor bHLH78-like        132   1e-31   
ref|XP_004292343.1|  PREDICTED: transcription factor bHLH62-like        133   1e-31   
ref|NP_001045188.1|  Os01g0915600                                       132   1e-31   
ref|XP_006349897.1|  PREDICTED: transcription factor bHLH62-like        132   1e-31   
ref|XP_002884644.1|  predicted protein                                  132   1e-31   
ref|XP_009786910.1|  PREDICTED: transcription factor bHLH137            131   2e-31   
ref|XP_002314910.2|  basic helix-loop-helix family protein              133   2e-31   
ref|XP_010926677.1|  PREDICTED: transcription factor bHLH77-like        133   2e-31   
ref|XP_011102214.1|  PREDICTED: transcription factor bHLH49-like        133   2e-31   
ref|XP_004296985.1|  PREDICTED: transcription factor bHLH78-like        133   2e-31   
ref|XP_002458978.1|  hypothetical protein SORBIDRAFT_03g043690          132   2e-31   
dbj|BAJ93142.1|  predicted protein                                      132   2e-31   
ref|XP_009757727.1|  PREDICTED: transcription factor bHLH62-like        132   2e-31   
dbj|BAJ85847.1|  predicted protein                                      132   2e-31   
ref|NP_001168271.1|  putative HLH DNA-binding domain superfamily ...    132   2e-31   
ref|XP_002970479.1|  hypothetical protein SELMODRAFT_93546              125   2e-31   
gb|ABW22630.1|  bHLH transcription factor Upa20                         130   2e-31   
ref|NP_001063582.1|  Os09g0501600                                       131   2e-31   
gb|EAZ09639.1|  hypothetical protein OsI_31923                          131   2e-31   
ref|XP_009373612.1|  PREDICTED: transcription factor bHLH62-like        132   2e-31   
ref|XP_009371096.1|  PREDICTED: transcription factor bHLH62 isofo...    132   2e-31   
ref|XP_009371097.1|  PREDICTED: transcription factor bHLH62 isofo...    132   2e-31   
ref|XP_001775637.1|  predicted protein                                  126   2e-31   
ref|XP_010532469.1|  PREDICTED: transcription factor bHLH49-like ...    132   2e-31   
ref|XP_010943352.1|  PREDICTED: transcription factor bHLH49 isofo...    132   2e-31   
gb|EYU24278.1|  hypothetical protein MIMGU_mgv1a006404mg                132   2e-31   
ref|XP_006492985.1|  PREDICTED: transcription factor bHLH62-like        132   2e-31   
ref|XP_007049642.1|  Basic helix-loop-helix DNA-binding superfami...    133   2e-31   
gb|KDO52837.1|  hypothetical protein CISIN_1g011621mg                   132   2e-31   
ref|XP_003564914.1|  PREDICTED: transcription factor bHLH77-like ...    132   2e-31   
gb|KDP31423.1|  hypothetical protein JCGZ_11799                         133   2e-31   
ref|XP_006421053.1|  hypothetical protein CICLE_v10004862mg             132   2e-31   
gb|AET01414.2|  BHLH transcription factor                               132   2e-31   
ref|XP_006484281.1|  PREDICTED: transcription factor bHLH49-like ...    132   2e-31   
ref|XP_003626938.1|  BHLH transcription factor                          132   2e-31   
ref|XP_006848450.1|  hypothetical protein AMTR_s00013p00245920          133   2e-31   
ref|XP_002514566.1|  conserved hypothetical protein                     133   2e-31   
ref|XP_010482405.1|  PREDICTED: transcription factor bHLH137-like...    130   2e-31   
ref|XP_004971039.1|  PREDICTED: transcription factor bHLH78-like ...    132   2e-31   
ref|XP_002320444.1|  hypothetical protein POPTR_0014s14650g             132   2e-31   
ref|XP_001772019.1|  predicted protein                                  125   2e-31   
ref|XP_007038103.1|  DNA binding protein, putative isoform 4            129   2e-31   
ref|XP_004150900.1|  PREDICTED: transcription factor bHLH62-like        131   2e-31   
ref|XP_011099632.1|  PREDICTED: transcription factor BEE 2              130   2e-31   
emb|CDP00498.1|  unnamed protein product                                132   2e-31   
ref|XP_011073134.1|  PREDICTED: transcription factor bHLH137 isof...    129   2e-31   
gb|KGN49799.1|  hypothetical protein Csa_5G135350                       132   2e-31   
ref|XP_009621297.1|  PREDICTED: transcription factor bHLH78-like ...    132   2e-31   
ref|XP_004149484.1|  PREDICTED: transcription factor bHLH49-like        132   2e-31   
ref|XP_009788675.1|  PREDICTED: transcription factor bHLH62-like        132   2e-31   
ref|XP_004166054.1|  PREDICTED: transcription factor bHLH49-like        132   2e-31   
ref|XP_009621298.1|  PREDICTED: transcription factor bHLH78-like ...    132   2e-31   
ref|XP_006484279.1|  PREDICTED: transcription factor bHLH49-like ...    132   3e-31   
ref|XP_006437828.1|  hypothetical protein CICLE_v10031122mg             132   3e-31   
emb|CDX86296.1|  BnaA06g30130D                                          129   3e-31   
gb|KHG22593.1|  Transcription factor bHLH49 -like protein               132   3e-31   
ref|XP_008339739.1|  PREDICTED: transcription factor bHLH49-like        132   3e-31   
ref|XP_010532461.1|  PREDICTED: transcription factor bHLH49-like ...    132   3e-31   
emb|CCF72394.1|  bHLH trascription factor                               128   3e-31   
gb|EEE55883.1|  hypothetical protein OsJ_04533                          132   3e-31   
ref|XP_009421185.1|  PREDICTED: transcription factor bHLH137-like       129   3e-31   
ref|XP_009410617.1|  PREDICTED: transcription factor bHLH77-like ...    131   3e-31   
ref|XP_010100794.1|  hypothetical protein L484_015823                   132   3e-31   
ref|XP_004498947.1|  PREDICTED: transcription factor bHLH74-like ...    131   3e-31   
ref|XP_009410615.1|  PREDICTED: transcription factor bHLH77-like ...    131   3e-31   
ref|XP_002516384.1|  transcription factor, putative                     132   3e-31   
ref|XP_009355681.1|  PREDICTED: transcription factor bHLH49-like        132   3e-31   
gb|KEH35698.1|  transcription factor bHLH137                            130   3e-31   
gb|ACF83761.1|  unknown                                                 130   3e-31   
tpg|DAA40452.1|  TPA: putative HLH DNA-binding domain superfamily...    129   3e-31   
ref|NP_001136513.1|  uncharacterized protein LOC100216628               129   3e-31   
ref|XP_011073133.1|  PREDICTED: transcription factor bHLH137 isof...    129   3e-31   
ref|XP_009368786.1|  PREDICTED: transcription factor bHLH137-like       130   3e-31   
ref|XP_008651560.1|  PREDICTED: BHLH transcription factor isoform X1    130   3e-31   
ref|NP_001151910.1|  BHLH transcription factor                          130   3e-31   
tpg|DAA62210.1|  TPA: putative HLH DNA-binding domain superfamily...    130   3e-31   
ref|XP_008243775.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    132   4e-31   
ref|XP_006437240.1|  hypothetical protein CICLE_v10031135mg             132   4e-31   
ref|XP_010654214.1|  PREDICTED: transcription factor bHLH49 isofo...    132   4e-31   
ref|XP_006484809.1|  PREDICTED: transcription factor bHLH78-like ...    131   4e-31   
ref|XP_006655999.1|  PREDICTED: transcription factor bHLH49-like        131   4e-31   
ref|XP_010525275.1|  PREDICTED: transcription factor bHLH62-like        132   4e-31   
ref|XP_010044347.1|  PREDICTED: transcription factor bHLH49             132   4e-31   
ref|XP_010913103.1|  PREDICTED: transcription factor bHLH78-like ...    132   4e-31   
gb|KGN44647.1|  hypothetical protein Csa_7G360030                       131   4e-31   
ref|XP_010232732.1|  PREDICTED: transcription factor bHLH62-like ...    132   4e-31   
ref|XP_004957264.1|  PREDICTED: transcription factor bHLH49-like        130   4e-31   
gb|KCW58019.1|  hypothetical protein EUGRSUZ_H00748                     132   4e-31   
ref|XP_007225728.1|  hypothetical protein PRUPE_ppa003619mg             132   4e-31   
ref|XP_010246667.1|  PREDICTED: transcription factor bHLH78             132   4e-31   
ref|XP_010654210.1|  PREDICTED: transcription factor bHLH49 isofo...    132   4e-31   
emb|CBI27416.3|  unnamed protein product                                131   4e-31   
gb|ABK94855.1|  unknown                                                 130   4e-31   
ref|XP_007038100.1|  Basic helix-loop-helix DNA-binding superfami...    130   4e-31   
ref|NP_001169219.1|  putative HLH DNA-binding domain superfamily ...    130   4e-31   
ref|XP_009627868.1|  PREDICTED: transcription factor bHLH62-like        131   4e-31   
ref|XP_010654187.1|  PREDICTED: transcription factor bHLH49 isofo...    132   4e-31   
ref|XP_011000012.1|  PREDICTED: transcription factor bHLH77             132   4e-31   
gb|ADD60710.1|  putative TA1 protein                                    131   4e-31   
ref|XP_011042744.1|  PREDICTED: transcription factor bHLH77-like        132   4e-31   
ref|XP_004170614.1|  PREDICTED: transcription factor bHLH62-like        131   5e-31   
ref|XP_010037626.1|  PREDICTED: transcription factor bHLH79-like ...    127   5e-31   
tpg|DAA40453.1|  TPA: putative HLH DNA-binding domain superfamily...    129   5e-31   
ref|XP_009387712.1|  PREDICTED: transcription factor BEE 3-like         127   5e-31   
ref|XP_009147085.1|  PREDICTED: transcription factor bHLH62             131   5e-31   
ref|XP_004510231.1|  PREDICTED: transcription factor bHLH78-like ...    131   5e-31   
ref|XP_009396799.1|  PREDICTED: transcription factor bHLH77-like        131   5e-31   
ref|XP_010451395.1|  PREDICTED: transcription factor bHLH62-like        131   5e-31   
emb|CDY28061.1|  BnaC05g44630D                                          131   5e-31   
gb|KDO69861.1|  hypothetical protein CISIN_1g023847mg                   125   5e-31   
ref|XP_010069612.1|  PREDICTED: transcription factor bHLH62-like        131   5e-31   
ref|XP_003628711.1|  BHLH transcription factor                          131   5e-31   
ref|NP_001136483.1|  uncharacterized protein LOC100216597               131   5e-31   
ref|XP_004510232.1|  PREDICTED: transcription factor bHLH78-like ...    131   5e-31   
ref|XP_010326270.1|  PREDICTED: transcription factor bHLH62-like ...    131   6e-31   
ref|XP_004247047.1|  PREDICTED: transcription factor bHLH62-like ...    131   6e-31   
ref|XP_009408340.1|  PREDICTED: transcription factor bHLH77-like        131   6e-31   
emb|CDY35923.1|  BnaA05g30270D                                          130   6e-31   
ref|XP_004298536.1|  PREDICTED: transcription factor bHLH137-like       128   6e-31   
ref|XP_010261463.1|  PREDICTED: transcription factor bHLH49             131   6e-31   
ref|XP_009369387.1|  PREDICTED: transcription factor bHLH79-like        128   6e-31   
ref|XP_010536589.1|  PREDICTED: transcription factor bHLH137 isof...    129   7e-31   
gb|EMT05490.1|  Transcription factor bHLH49                             129   7e-31   
ref|XP_007137888.1|  hypothetical protein PHAVU_009G164300g             129   7e-31   
ref|XP_009381314.1|  PREDICTED: transcription factor bHLH77-like        130   7e-31   
ref|XP_010532719.1|  PREDICTED: transcription factor bHLH77             130   7e-31   
ref|XP_006573184.1|  PREDICTED: transcription factor bHLH49-like ...    131   7e-31   
ref|XP_010685111.1|  PREDICTED: transcription factor bHLH78             131   7e-31   
ref|XP_006573185.1|  PREDICTED: transcription factor bHLH49-like ...    131   7e-31   
ref|XP_002863906.1|  hypothetical protein ARALYDRAFT_494918             130   7e-31   
ref|XP_010037625.1|  PREDICTED: transcription factor bHLH79-like ...    128   7e-31   
gb|EYU28613.1|  hypothetical protein MIMGU_mgv1a010637mg                128   7e-31   
gb|AAM10957.1|AF488610_1  putative bHLH transcription factor            130   7e-31   
ref|XP_007209455.1|  hypothetical protein PRUPE_ppa009757mg             128   7e-31   
ref|XP_004498946.1|  PREDICTED: transcription factor bHLH74-like ...    130   7e-31   
ref|NP_199667.1|  transcription factor bHLH78                           130   8e-31   
ref|XP_008239542.1|  PREDICTED: transcription factor bHLH137 isof...    129   8e-31   
emb|CDP02008.1|  unnamed protein product                                128   8e-31   
gb|KHN10946.1|  Transcription factor bHLH62                             131   8e-31   
gb|ADD60699.1|  putative TA1 protein                                    130   8e-31   
gb|AAD56411.1|AF185269_1  bHLH transcription factor GBOF-1              129   8e-31   
ref|XP_002965357.1|  hypothetical protein SELMODRAFT_439190             132   8e-31   
ref|XP_008337491.1|  PREDICTED: transcription factor bHLH77             130   8e-31   
ref|XP_008797587.1|  PREDICTED: transcription factor bHLH49-like ...    130   9e-31   
ref|XP_003520142.1|  PREDICTED: transcription factor bHLH49-like ...    131   9e-31   
ref|XP_002318764.2|  basic helix-loop-helix family protein              129   9e-31   
ref|XP_008797586.1|  PREDICTED: transcription factor bHLH49-like ...    130   9e-31   
ref|XP_009401353.1|  PREDICTED: transcription factor BEE 1-like i...    125   9e-31   
ref|XP_002301743.2|  hypothetical protein POPTR_0002s23650g             131   1e-30   
ref|NP_001057380.1|  Os06g0275600                                       130   1e-30   
ref|NP_001145523.1|  uncharacterized protein LOC100278938               130   1e-30   
ref|XP_006574976.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
gb|ADX60284.1|  bHLH transcription factor                               130   1e-30   
ref|XP_008239541.1|  PREDICTED: transcription factor bHLH137 isof...    129   1e-30   
ref|XP_009346736.1|  PREDICTED: transcription factor bHLH79-like        128   1e-30   
ref|XP_009151654.1|  PREDICTED: transcription factor bHLH78 isofo...    130   1e-30   
gb|KDO47528.1|  hypothetical protein CISIN_1g022116mg                   128   1e-30   
ref|XP_006437241.1|  hypothetical protein CICLE_v10031135mg             130   1e-30   
ref|XP_008795935.1|  PREDICTED: transcription factor bHLH63-like        129   1e-30   
ref|XP_006484808.1|  PREDICTED: transcription factor bHLH78-like ...    130   1e-30   
ref|XP_006436928.1|  hypothetical protein CICLE_v10031873mg             127   1e-30   
ref|XP_009767242.1|  PREDICTED: transcription factor bHLH49             130   1e-30   
ref|XP_009593502.1|  PREDICTED: transcription factor bHLH49-like        130   1e-30   
gb|AIA57941.1|  basic helix-loop-helix protein                          123   1e-30   
ref|XP_006576637.1|  PREDICTED: transcription factor bHLH62-like        131   1e-30   
ref|XP_008797585.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
ref|XP_008239676.1|  PREDICTED: transcription factor bHLH79             127   1e-30   
gb|KHN05778.1|  Transcription factor bHLH62                             131   1e-30   
gb|KDO60872.1|  hypothetical protein CISIN_1g044652mg                   130   1e-30   
ref|XP_003547776.2|  PREDICTED: transcription factor bHLH62-like        131   1e-30   
gb|ADD60686.1|  putative TA1 protein                                    130   1e-30   
ref|XP_008807018.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
ref|XP_001780480.1|  predicted protein                                  125   1e-30   
emb|CDX82053.1|  BnaC02g22370D                                          122   1e-30   
gb|ADD60674.1|  putative TA1 protein                                    130   1e-30   
ref|XP_011042945.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    129   1e-30   
ref|XP_006653293.1|  PREDICTED: transcription factor bHLH62-like        127   1e-30   
ref|XP_001752951.1|  predicted protein                                  122   1e-30   
ref|XP_006348629.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
ref|XP_008374503.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    127   1e-30   
ref|XP_006348631.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
ref|XP_009776786.1|  PREDICTED: transcription factor bHLH49-like        130   1e-30   
ref|XP_010929074.1|  PREDICTED: transcription factor bHLH49-like        130   1e-30   
ref|XP_007038102.1|  Basic helix-loop-helix DNA-binding superfami...    129   1e-30   
ref|XP_008346753.1|  PREDICTED: transcription factor bHLH79-like        127   1e-30   
gb|KDP22555.1|  hypothetical protein JCGZ_26386                         129   1e-30   
ref|NP_001052532.2|  Os04g0350700                                       127   1e-30   
ref|XP_008393087.1|  PREDICTED: transcription factor bHLH79-like        127   1e-30   
ref|XP_010929645.1|  PREDICTED: transcription factor bHLH137-like       128   1e-30   
ref|XP_008807015.1|  PREDICTED: transcription factor bHLH49-like ...    130   1e-30   
ref|XP_006363454.1|  PREDICTED: transcription factor bHLH78-like        130   1e-30   
ref|XP_002284464.1|  PREDICTED: transcription factor bHLH137            128   1e-30   
ref|XP_008377295.1|  PREDICTED: transcription factor bHLH63 isofo...    128   1e-30   



>ref|XP_009620411.1| PREDICTED: transcription factor BEE 3-like [Nicotiana tomentosiformis]
Length=282

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 191/273 (70%), Gaps = 13/273 (5%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELN--PNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
            F + N+D S+    QFPELN  P   ++S  NF + +GFS ++  L+Q P   EF     
Sbjct  17   FSVFNIDSSLNFNNQFPELNLNPTSLEMSNFNFQSFVGFSHEN-ILTQTP---EFPVCLT  72

Query  663  AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsvg  484
            A     ++    ++  I   ND  E+K +    T   S + +S + + S  GT+RK S G
Sbjct  73   ANFHGIFQEDDKNKVTIQARNDINESKKRKTIETPESSSAYSSPAVSWS--GTKRKTSKG  130

Query  483  kgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKT  304
            KGK+ KS E+E+  P +VVHVRA+RGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK+
Sbjct  131  KGKKVKSDEKEEDNPRQVVHVRAKRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKS  190

Query  303  MGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQK  124
            MGMAVMLDEIINYVQSLQNQVEFLSMKL+ AS+Y +FNSET I+ET+QRAKAYE   MQK
Sbjct  191  MGMAVMLDEIINYVQSLQNQVEFLSMKLSAASTYNNFNSETYILETLQRAKAYEAHIMQK  250

Query  123  QVKDGYEGLSTSN---PFDQQSFGCYPSLPHNT  34
              K+G EG+++SN   P D  SFGCYP LP+NT
Sbjct  251  LRKEGCEGVASSNQIGPLD-HSFGCYPQLPYNT  282



>ref|XP_009777020.1| PREDICTED: transcription factor BEE 3-like [Nicotiana sylvestris]
Length=277

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 195/286 (68%), Gaps = 20/286 (7%)
 Frame = -1

Query  858  MADHF-RQLFPLLNVDPSME-VAQFPEL-NPNFGDLSGPNFHTLMGFSQQDQFLSQVPSA  688
            MADHF    F L N+D SM+ + QFPE+ NP   +LS  N  + M FS ++ F +QV   
Sbjct  1    MADHFINSPFSLFNIDSSMDFMNQFPEIINPCSSELSSFNLQSSMEFSHENIF-TQV---  56

Query  687  AEF--SPQEYAVNSLHYEAKTGHRAV---ILPENDALETKMKPADYTTMEscsanssspa  523
            AEF  + QEY   ++  + K     V   ++P N++   K K  D  T ES SA SS   
Sbjct  57   AEFPGNLQEYFQENIQQDEKINASLVSSDMVPINES--KKRKTID--TPESSSAYSSPAV  112

Query  522  vSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERL  343
             +    RR         K S E+E+ KP EVVHVRA+RGQATDSHSLAERVRRGKINE+L
Sbjct  113  SATGTKRRSIKRRGNSVKSSDEKEEEKPKEVVHVRAKRGQATDSHSLAERVRRGKINEKL  172

Query  342  KCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            +CLQDIVPGCYKTMGMA MLDEIINYVQSLQNQVEFLSMKLT ASSYYDFNSE++I+ +M
Sbjct  173  RCLQDIVPGCYKTMGMAGMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSESDILVSM  232

Query  162  QRAKAYEDMKMQKQVKD-GYEGLST--SNPFDQQSFGCYPSLPHNT  34
            QRAKA+E +KMQK  K+ G EGLS+  + P+D  SFG +P LP NT
Sbjct  233  QRAKAFEALKMQKGKKELGCEGLSSNQAGPYD-HSFGTFPLLPFNT  277



>emb|CDP21609.1| unnamed protein product, partial [Coffea canephora]
Length=177

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 125/139 (90%), Gaps = 3/139 (2%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGC+KTMGMAVMLDEIINY
Sbjct  40   KPKEVVHVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCHKTMGMAVMLDEIINY  99

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS-  88
            VQSLQNQVEFLSMKLT AS++YDFN ET+ I+T+QRAKA+E MKMQK +K+ ++G+ ++ 
Sbjct  100  VQSLQNQVEFLSMKLTAASNFYDFNRETDTIDTLQRAKAFEAMKMQKLMKEEFDGVPSTQ  159

Query  87   -NPFDQQSFGCYPSLPHNT  34
              P D Q+FGCYPSLP NT
Sbjct  160  VGPLD-QTFGCYPSLPFNT  177



>ref|XP_009617979.1| PREDICTED: transcription factor BEE 1-like [Nicotiana tomentosiformis]
Length=276

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 159/284 (56%), Positives = 194/284 (68%), Gaps = 21/284 (7%)
 Frame = -1

Query  858  MADHF-RQLFPLLNVDPSME-VAQFPEL-NPNFGDLSGPNFHTLMGFSQQDQFLSQVPSA  688
            MADHF    F L N+D SM+ + QFPE+ NP   +LS  N  + M FS ++ F +QV   
Sbjct  1    MADHFINSPFSLFNIDSSMDFMNQFPEIINPCSSELSSFNLQSSMEFSHENVF-TQV---  56

Query  687  AEF--SPQEYAVNSLHYEAKTGHRAV---ILPENDALETKMKPADYTTMEscsanssspa  523
            AEF  + QEY   + H + K     V   ++P N++   K K  D  T ES SA SS   
Sbjct  57   AEFPGNLQEYFQENFHQDDKINASVVPCDMVPINES--KKRKTID--TPESSSAYSSPAV  112

Query  522  vSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERL  343
             +  GT+R       + K S E+E+ K  EVVHVRA+RGQATDSHSLAERVRRGKINE+L
Sbjct  113  SAN-GTKRSSKRRGNRVKSSDEKEEEKSKEVVHVRAKRGQATDSHSLAERVRRGKINEKL  171

Query  342  KCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            +CLQDIVPGCYKTMGMA MLDEI NYVQSLQNQVEFLSMKLT ASSYYDFNSE++I  +M
Sbjct  172  RCLQDIVPGCYKTMGMAGMLDEITNYVQSLQNQVEFLSMKLTAASSYYDFNSESDIRVSM  231

Query  162  QRAKAYEDMKMQKQVKD-GYEGLST--SNPFDQQSFGCYPSLPH  40
            QRAKA+E +KMQK  K+ G EGLS+  + P+D  +FG YP LP+
Sbjct  232  QRAKAFEALKMQKSKKELGCEGLSSNQAGPYD-HNFGSYPLLPY  274



>ref|XP_009796282.1| PREDICTED: transcription factor BEE 1-like [Nicotiana sylvestris]
Length=271

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 182/267 (68%), Gaps = 12/267 (4%)
 Frame = -1

Query  834  FPLLNVDPSMEVAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEYAVN  655
            F + N+D S+        NP   D+S  NF + +GFS ++  ++Q P       + +  N
Sbjct  17   FSVFNIDSSLNFN-----NPTSLDMSNLNFQSFVGFSNEN-IITQAPEFPVCLTENFNGN  70

Query  654  SLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsvgkgk  475
               ++    ++ +I   ND  E K +    T     S+  SSPAVS  GT+RK S GKGK
Sbjct  71   ---FQEDDKNKVIIQARNDINECKKRKIIETP--ESSSAYSSPAVSRSGTKRKTSKGKGK  125

Query  474  rkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGM  295
            + KS E+E+  P +VVHVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK+MGM
Sbjct  126  KVKSDEKEEDNPRQVVHVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKSMGM  185

Query  294  AVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVK  115
            AVMLDEIINYVQSLQNQVEFLSMKL+ AS+Y +FNSET+I+ET+QRAKAYE   MQK  K
Sbjct  186  AVMLDEIINYVQSLQNQVEFLSMKLSAASTYNNFNSETDILETLQRAKAYEAHTMQKLRK  245

Query  114  DGYEGLSTSNPFDQQSFGCYPSLPHNT  34
            +G    +   P D  +FGCYP LP+NT
Sbjct  246  EGVASSNQIGPLD-HTFGCYPQLPYNT  271



>ref|XP_006353818.1| PREDICTED: transcription factor BEE 1-like [Solanum tuberosum]
Length=228

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  +VVHVRA+RGQATDSHSLAERVRRGKINERL CLQDIVPGCYK+MGMAVMLDEIINY
Sbjct  90   KLRQVVHVRAKRGQATDSHSLAERVRRGKINERLGCLQDIVPGCYKSMGMAVMLDEIINY  149

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            VQSLQNQVEFLSMKL+ AS+YYDFNSET+I+ETMQRAKAYE   MQK  K+G EG+ ++ 
Sbjct  150  VQSLQNQVEFLSMKLSAASTYYDFNSETDILETMQRAKAYETHMMQKLKKEGCEGVGSNQ  209

Query  84   --PFDQQSFGCYPSLPHNT  34
              P    +FGCYP L +NT
Sbjct  210  VAPLIDHTFGCYPKLSYNT  228



>ref|XP_004252234.1| PREDICTED: transcription factor BEE 1-like [Solanum lycopersicum]
Length=272

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 2/139 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  +VVHVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK+MGMAVMLDEIINY
Sbjct  134  KLRQVVHVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKSMGMAVMLDEIINY  193

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS-  88
            VQSLQNQVEFLSMKL+ AS+YYDFNSET+I+ETMQRAKAYE   MQK  K+G EG+ ++ 
Sbjct  194  VQSLQNQVEFLSMKLSAASTYYDFNSETDILETMQRAKAYEANMMQKLKKEGCEGMGSNQ  253

Query  87   -NPFDQQSFGCYPSLPHNT  34
              P   ++FGCYP L +NT
Sbjct  254  VGPLIDRTFGCYPKLSYNT  272



>ref|XP_004235809.1| PREDICTED: transcription factor BEE 3 [Solanum lycopersicum]
Length=270

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 175/270 (65%), Gaps = 21/270 (8%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELN--PNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
            F LLN D S+++  QFP++   P   D+S  N  + M FS  D   +QV      S QE 
Sbjct  19   FSLLNFDSSVDLMNQFPDMMTIPCSSDMSSFNIQSSMEFSN-DNVFTQVNDQFPGSLQEI  77

Query  663  AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsvg  484
               ++  E+K          ND+ + K+     ++           + S  G +R+++ G
Sbjct  78   FQGNIQQESKNEEI------NDSKKRKISDTPESS-----------SASATGNKRRNTKG  120

Query  483  kgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKT  304
            +G R K  E+E+ KP EVVHVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKT
Sbjct  121  RGNRVKVDEKEEEKPREVVHVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKT  180

Query  303  MGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQK  124
            MGMA MLDEIINYVQSLQNQVEFLSMKLT ASSYYDFNSE++I+ ++QRAKAYE +KMQK
Sbjct  181  MGMAGMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSESDILVSLQRAKAYEALKMQK  240

Query  123  QVKDGYEGLSTSNPFDQQSFGCYPSLPHNT  34
             +K   E    S       FG YP LP+NT
Sbjct  241  MMKKEIECEVMSTNQVGLHFGSYPMLPYNT  270



>ref|XP_006341598.1| PREDICTED: transcription factor BEE 3-like [Solanum tuberosum]
Length=276

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 186/272 (68%), Gaps = 19/272 (7%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELN--PNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
            F LLN D S+++  QFP++   P   D+S  N  + M FS  D   +QV      S QE 
Sbjct  19   FSLLNFDSSIDLMNQFPDMMNIPCSSDMSSFNIQSSMEFSN-DNVFTQVADQFPGSLQEI  77

Query  663  AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsvg  484
               ++  E+KT         ND+ + K+     +     S+  SSPA S  G +R+++ G
Sbjct  78   FQGNIQQESKTEEI------NDSKKRKI-----SDTPESSSAYSSPAASATGNKRRNTKG  126

Query  483  kgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKT  304
            +G R KS E+E+ KP EVVHVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKT
Sbjct  127  RGNRVKSDEKEEEKPREVVHVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKT  186

Query  303  MGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQK  124
            MGMA MLDEIINYVQSLQNQV+FLSMKLT ASSYYDFNSE++I+ ++QRAKAYE +KMQK
Sbjct  187  MGMAGMLDEIINYVQSLQNQVDFLSMKLTAASSYYDFNSESDILVSLQRAKAYEALKMQK  246

Query  123  QVKD--GYEGLSTSNPFDQQSFGCYPSLPHNT  34
             +K   G E +S++      +FG YP LP+NT
Sbjct  247  MMKKEIGCEVMSSNQV--GPNFGSYPMLPYNT  276



>ref|XP_007036544.1| BR enhanced expression 1 [Theobroma cacao]
 gb|EOY21045.1| BR enhanced expression 1 [Theobroma cacao]
Length=278

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 181/255 (71%), Gaps = 7/255 (3%)
 Frame = -1

Query  846  FRQLFPLLNVDPSME-VAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ  670
            F+Q F  L++DP+ME + QF EL+P   D S  NF + + FS    F +Q P     +  
Sbjct  11   FKQSFSFLDIDPAMESLNQFAELSPGVIDNSALNFQSFLPFSNDSFFSNQAPEIPGNNWG  70

Query  669  EYAVNSLHYEAKTGHRAVILP----ENDALETKMKPADYTTMEscsanssspavSEIGTr  502
            E     +H+  ++   +V  P    + +  E+K + A     ES S NSSSP VSE G +
Sbjct  71   ENLPGFIHHSNQSSVVSVAQPTVTSKTEFHESKKRKA-LDVSESSSGNSSSPQVSESGIK  129

Query  501  rkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIV  322
            R+++ G+GKR +S+E+ + KP EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIV
Sbjct  130  RRNNPGRGKRARSNEKGEEKPKEVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIV  189

Query  321  PGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYE  142
            PGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS+YYDFNSE++ +E MQRAKA E
Sbjct  190  PGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTYYDFNSESDAMEKMQRAKAQE  249

Query  141  DMKMQKQVK-DGYEG  100
              ++ + ++ +GY G
Sbjct  250  AKELDRLMRSEGYVG  264



>ref|XP_011045849.1| PREDICTED: transcription factor BEE 3 isoform X1 [Populus euphratica]
Length=273

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 175/270 (65%), Gaps = 22/270 (8%)
 Frame = -1

Query  861  FMAD--HFRQLFPLLNVDPSM-EVAQFPELNPNFGD-LSGPNFHTLMGFSQQDQFLSQVP  694
            F AD   FR  FP L++DPSM  ++QF E++    D  S  N H+ M F+  + F  Q P
Sbjct  4    FTADLLSFRPPFPFLDIDPSMVALSQFTEVSQAILDNPSVNNIHSFMPFTSDNFFSHQAP  63

Query  693  SAAEFSPQEYAVNSLHYEAKTGHR----------AVILPENDALETKMKPADYTTMEscs  544
                    E+  N     A   H+           +  P N++   + K      + + S
Sbjct  64   --------EFPGNLAEGFAGIFHQNDQNVMPVSQPLTTPGNESEIQESKKRKAMDVSASS  115

Query  543  anssspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRR  364
            + +SSP VSE G++R++     + K     ED KP +VVHVRARRGQATDSHSLAERVRR
Sbjct  116  SMNSSPQVSESGSKRRNVNSSRRGKGVKSNEDGKPKDVVHVRARRGQATDSHSLAERVRR  175

Query  363  GKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSE  184
            GKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS++YDFN+E
Sbjct  176  GKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTFYDFNAE  235

Query  183  TEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            T+ IETMQRAKA E  ++Q+ +++G  GL+
Sbjct  236  TDAIETMQRAKAQEAKELQRAMREGSGGLA  265



>ref|XP_011080441.1| PREDICTED: transcription factor BEE 1-like [Sesamum indicum]
Length=278

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 188/284 (66%), Gaps = 19/284 (7%)
 Frame = -1

Query  858  MADHF-----RQLFPLLNVDPSME-VAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQV  697
            MAD +     +Q F L ++DP++E +  FP LNP   D S  NFH+LMGF        Q+
Sbjct  1    MADQYFLQNIKQSFSLADIDPNIEFMNHFPGLNPGHQDTSDLNFHSLMGFPHDSINFHQL  60

Query  696  PSAAEFSPQEYAVNSLHY-EAKTGHRAVILP----ENDALETKMKPADYTTMEscsanss  532
            P   EF       + L + +  T    V +P    +N+  + K K  D +T ES SANS 
Sbjct  61   P---EFPGNLENFHGLFFLDDNTVIPPVPVPTISNDNNHQDRKRKSTDISTPESSSANSF  117

Query  531  spavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKIN  352
            S    + G R+ ++ G+GK+ KS+EE+D  P EV+HVRA+RGQATDSHSLAERVRRGKIN
Sbjct  118  SS---DKGIRKTNAAGRGKKVKSNEEKDDMPREVIHVRAKRGQATDSHSLAERVRRGKIN  174

Query  351  ERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEII  172
            ERL+CLQDIVPGCYK+MGMAVMLD+IINYVQSLQNQVEFLSMKLT AS++YDFN++ + I
Sbjct  175  ERLRCLQDIVPGCYKSMGMAVMLDQIINYVQSLQNQVEFLSMKLTAASTFYDFNTDADGI  234

Query  171  ETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQSFGCYPSLPH  40
            +T+QRAKA E +++Q     G    S  +     +FG +P LPH
Sbjct  235  DTLQRAKASEALEVQNAASQGIP--SAQSAALGLNFGYFPQLPH  276



>ref|XP_002317910.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE96130.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=273

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 173/263 (66%), Gaps = 8/263 (3%)
 Frame = -1

Query  861  FMAD--HFRQLFPLLNVDPSM-EVAQFPELNPNFGD-LSGPNFHTLMGFSQQDQFLSQVP  694
            F AD   FR  FP L++DPSM  ++QF E++    D  S  N H+ M F+  + F  Q P
Sbjct  4    FTADLQSFRPPFPFLDIDPSMVALSQFTEVSQAILDNPSVNNIHSFMPFTSDNFFSHQAP  63

Query  693  SAAEFSPQEYAVNSLHYEAKTG---HRAVILPENDALETKMKPADYTTMEscsanssspa  523
                   + +A    H   +T     +    P N++   + K      +   S+ +SSP 
Sbjct  64   EFPGNLAEGFA-GIFHQNDQTVMPVSQPFTTPGNESEFQESKKRKAMDVSESSSMNSSPQ  122

Query  522  vSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERL  343
            VSE G++R++     + K     ED KP +VVHVRARRGQATDSHSLAERVRRGKINERL
Sbjct  123  VSESGSKRRNVNSSRRGKGVKSNEDGKPKDVVHVRARRGQATDSHSLAERVRRGKINERL  182

Query  342  KCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            +CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS++YDFN+ET+ IETM
Sbjct  183  RCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTFYDFNAETDAIETM  242

Query  162  QRAKAYEDMKMQKQVKDGYEGLS  94
            QRAKA E  ++Q+ +++G  G +
Sbjct  243  QRAKAQEAKELQRAMREGSGGFA  265



>ref|XP_002532159.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF30233.1| DNA binding protein, putative [Ricinus communis]
Length=190

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKTMGMAVMLDEII
Sbjct  64   DEKPKEVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEII  123

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQNQVEFLSMKLT AS++YDFNSET+ IETMQRAKA E  ++++ +K+GY GL+ 
Sbjct  124  NYVQSLQNQVEFLSMKLTAASTFYDFNSETDAIETMQRAKAQEAKEIERVMKEGYGGLTN  183

Query  90   SNP  82
             +P
Sbjct  184  FHP  186



>ref|XP_011045850.1| PREDICTED: transcription factor BEE 1 isoform X2 [Populus euphratica]
Length=271

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 180/270 (67%), Gaps = 24/270 (9%)
 Frame = -1

Query  861  FMAD--HFRQLFPLLNVDPSM-EVAQFPELNPNFGD-LSGPNFHTLMGFSQQDQFLSQVP  694
            F AD   FR  FP L++DPSM  ++QF E++    D  S  N H+ M F+  + F  Q P
Sbjct  4    FTADLLSFRPPFPFLDIDPSMVALSQFTEVSQAILDNPSVNNIHSFMPFTSDNFFSHQAP  63

Query  693  SAAEFSPQEYAVNSLHYEAKTGHR----------AVILPENDALETKMKPADYTTMEscs  544
                    E+  N     A   H+           +  P N++   + K      + + S
Sbjct  64   --------EFPGNLAEGFAGIFHQNDQNVMPVSQPLTTPGNESEIQESKKRKAMDVSASS  115

Query  543  anssspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRR  364
            + +SSP VSE G++R++S  +GK  KS+E  D KP +VVHVRARRGQATDSHSLAERVRR
Sbjct  116  SMNSSPQVSESGSKRRNSSRRGKGVKSNE--DGKPKDVVHVRARRGQATDSHSLAERVRR  173

Query  363  GKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSE  184
            GKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS++YDFN+E
Sbjct  174  GKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTFYDFNAE  233

Query  183  TEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            T+ IETMQRAKA E  ++Q+ +++G  GL+
Sbjct  234  TDAIETMQRAKAQEAKELQRAMREGSGGLA  263



>gb|KHF97488.1| Transcription factor BEE 3 -like protein [Gossypium arboreum]
Length=247

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 139/245 (57%), Positives = 165/245 (67%), Gaps = 18/245 (7%)
 Frame = -1

Query  861  FMADHFRQLFPLLNVDPSME-VAQFPELNPN--FGDLSGPNFHTLMGFSQQDQFLSQVPS  691
            F A  +RQ FP L++DP+ME + QF ELNP     D S  NF T    S  D   S   S
Sbjct  4    FSAQSYRQPFPFLDIDPTMESLTQFAELNPQSFILDNSAFNFQTFFPLSINDSLFSNQAS  63

Query  690  AAEF-------SPQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanss  532
              E        S Q        + AKT        E + +  K K  D +   S +++S+
Sbjct  64   EGETMSGFIHNSNQSSVSAQPIFSAKT--------EMEEISNKRKALDISESSSGNSSST  115

Query  531  spavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKIN  352
            SP VSE G +R+++ G+GKR KS+E+E  KP EVVHVRARRGQATDSHSLAERVRRGKIN
Sbjct  116  SPQVSETGIKRRNNSGRGKRAKSNEKEMEKPKEVVHVRARRGQATDSHSLAERVRRGKIN  175

Query  351  ERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEII  172
            ERL+CLQDIVPGCYKTMGMA+MLDEIINYVQSLQNQVEFLSMKLT AS+YYDFNSE++ +
Sbjct  176  ERLRCLQDIVPGCYKTMGMALMLDEIINYVQSLQNQVEFLSMKLTAASTYYDFNSESDAM  235

Query  171  ETMQR  157
            E MQR
Sbjct  236  ERMQR  240



>ref|XP_011090153.1| PREDICTED: transcription factor BEE 1-like [Sesamum indicum]
Length=273

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 167/268 (62%), Gaps = 13/268 (5%)
 Frame = -1

Query  852  DHFRQLFPLLNVDPSME-VAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFS  676
            D+ +  F     DP++E    F ++N +   LSG + H+LMGF   + F  Q P  ++  
Sbjct  10   DNLKHSFSSSEADPNIEFTTHFSDINLSHQHLSGSDIHSLMGFPLDNLFPHQFPGNSDRF  69

Query  675  PQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrk  496
            P  +       E       VI  +ND ++ K K      ME  S  +SS   S+ G  RK
Sbjct  70   PGLFI-----QEVPPLTEQVISNDNDRVDRKRK-----AMEISSPGNSSAQGSDNGIGRK  119

Query  495  hs-vgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVP  319
            +S     K K S + ++ KP EVVHVRA+RGQATDSHSLAERVRR KINERL+CLQDIVP
Sbjct  120  NSCRRGKKVKNSDQNKEEKPREVVHVRAKRGQATDSHSLAERVRREKINERLRCLQDIVP  179

Query  318  GCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYED  139
            GCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKL  AS++YDFNS+ + +ETMQRAKA+E 
Sbjct  180  GCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLAAASTFYDFNSDRDALETMQRAKAFEA  239

Query  138  MKMQKQVKDGYEGLSTSNPFDQQSFGCY  55
            +K Q     G        P D  +FGCY
Sbjct  240  LKTQNGGSPGIPSAHQFAPLD-LNFGCY  266



>ref|XP_007154151.1| hypothetical protein PHAVU_003G094700g [Phaseolus vulgaris]
 gb|ESW26145.1| hypothetical protein PHAVU_003G094700g [Phaseolus vulgaris]
Length=273

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 177/258 (69%), Gaps = 13/258 (5%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEYAV  658
            FP L++DPSME+  QF  +N +  D S    H LM FS  D FL   P   EF P     
Sbjct  18   FPFLDIDPSMELLNQFIGMNQHVIDNSNLTMHNLMPFSC-DTFLG--PQEPEF-PGNLEE  73

Query  657  NSLHYEAKTGHRA--VILP----ENDALETKMKPADYTTMEscsanssspavSEIGTrrk  496
            N         H A  V LP    EN   + K + +    +   S+ +S+PAVSE G++RK
Sbjct  74   NFPALVHHVNHNALPVSLPIFQAENKIHDGKKRKS--MDLPETSSANSTPAVSESGSKRK  131

Query  495  hsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPG  316
            HS G+GKR KS+  E+ K  EVVHVRARRGQATDSHSLAERVRRGKINE+L+CLQ+IVPG
Sbjct  132  HSSGRGKRAKSNVTEEEKAKEVVHVRARRGQATDSHSLAERVRRGKINEKLRCLQNIVPG  191

Query  315  CYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDM  136
            CYKTMGMAVMLDEIINYVQSLQ+QVEFLS+KLT AS++YDFNSET+ +ETMQRA+A E  
Sbjct  192  CYKTMGMAVMLDEIINYVQSLQHQVEFLSLKLTAASTFYDFNSETDALETMQRARASEAK  251

Query  135  KMQKQVKDGYEGLSTSNP  82
            ++ K  ++GY G+S   P
Sbjct  252  ELGKYKREGYGGVSCFQP  269



>gb|EYU35927.1| hypothetical protein MIMGU_mgv1a022747mg [Erythranthe guttata]
Length=297

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 110/135 (81%), Gaps = 5/135 (4%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K MEVVHVRA+RGQATDSHSLAERVRR KINERLKCLQDIVPGCYKTMGMAVMLDEIINY
Sbjct  166  KTMEVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  225

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            VQSLQNQVEFLSMKLT ASS+YDFNSE + +ETMQR KA E  K+Q    +GY       
Sbjct  226  VQSLQNQVEFLSMKLTTASSFYDFNSEADALETMQRQKALETFKIQ----NGYSSADQFA  281

Query  84   PFDQQSFGCYPSLPH  40
            P D  +FGC+P  PH
Sbjct  282  PLD-LTFGCFPQFPH  295



>ref|XP_003533364.1| PREDICTED: transcription factor BEE 1-like [Glycine max]
Length=273

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 178/259 (69%), Gaps = 17/259 (7%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELNPNFGDLSG-PNFHTLMGFSQQDQFLSQVPSAAEFSPQEYA  661
            FP L +DPSME+  QF  +N +  + S     H L+ FS  D FL   P   EF P    
Sbjct  20   FPFLEIDPSMELLNQFIGMNQHVLENSNLSTMHNLVPFSC-DTFLG--PQEPEF-PGNLE  75

Query  660  VNSLHYEAKTGHRA--VILP----ENDALETKMKPADYTTMEscsanssspavSEIGTrr  499
             N   + A   H A  V LP    EN+  E K + +    +   S+ +S+PAVSE G++ 
Sbjct  76   EN---FPALVNHNALPVSLPIFQAENEIHEGKKRKS--VDLPETSSANSTPAVSESGSKI  130

Query  498  khsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVP  319
            KHS G+GKR KS+  E+ K  EVVHVRARRGQATDSHSLAERVRRGKINE+L+CLQ+IVP
Sbjct  131  KHSSGRGKRVKSNVTEEEKAKEVVHVRARRGQATDSHSLAERVRRGKINEKLRCLQNIVP  190

Query  318  GCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYED  139
            GCYKTMGMAVMLDEIINYVQSLQ+QVEFLS+KLT AS++YDFNSET+ +ETMQRA+A E 
Sbjct  191  GCYKTMGMAVMLDEIINYVQSLQHQVEFLSLKLTAASTFYDFNSETDALETMQRARASEA  250

Query  138  MKMQKQVKDGYEGLSTSNP  82
             ++ K  K+GY G+S   P
Sbjct  251  KELGKYKKEGYGGVSFFQP  269



>ref|XP_006440991.1| hypothetical protein CICLE_v10024155mg, partial [Citrus clementina]
 gb|ESR54231.1| hypothetical protein CICLE_v10024155mg, partial [Citrus clementina]
Length=145

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKTMGM +MLDEIINYVQSL
Sbjct  21   VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKTMGMTMMLDEIINYVQSL  80

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPF  79
            QNQVEFLSMKLT AS++YDFNSE++ +ETMQ+AKAYE  +M++ +K+G    S+S+ F
Sbjct  81   QNQVEFLSMKLTAASTFYDFNSESDAVETMQKAKAYEAKEMERLMKEGNFACSSSSSF  138



>ref|XP_011007722.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor BEE 3-like 
[Populus euphratica]
Length=274

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 177/270 (66%), Gaps = 15/270 (6%)
 Frame = -1

Query  861  FMAD--HFRQLFPLLNVDPSME-VAQFPELNPNFGDLSGP---NFHTLMGFSQQDQFLSQ  700
            F AD   F+   P L++D SM  + QF E+N     L  P   NFH+   F+  + F  Q
Sbjct  4    FTADLQSFKPPXPFLDIDASMAAINQFTEVNQAI-QLDYPIMNNFHSFTPFTSDNFFSHQ  62

Query  699  VPS-----AAEFSPQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsans  535
             P      A  F P  +  N  +    +        E++  E+K +  D   M   S  +
Sbjct  63   SPEFPGNLAGIFLPGSFHQNDQNVMPVSQTFTTPAKESEFQESKRRAMD---MSESSCMN  119

Query  534  sspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKI  355
            SSP VSE G++++ S  +GKR KS+EEE+ K  EVVHVRARRGQATDSHSLAERVRRGKI
Sbjct  120  SSPQVSESGSKKRRSSRRGKRVKSNEEEEEKTREVVHVRARRGQATDSHSLAERVRRGKI  179

Query  354  NERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            NERL+CLQDIVPGCYKTMGMAV LDEIINYVQSLQNQVEFLSMKLT AS++YDFN+ET+ 
Sbjct  180  NERLRCLQDIVPGCYKTMGMAVRLDEIINYVQSLQNQVEFLSMKLTAASTFYDFNAETDA  239

Query  174  IETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            IET+QRAKA E  ++Q+  ++G  G + S+
Sbjct  240  IETVQRAKAQETKELQRATREGSGGHAQSH  269



>gb|KDP20132.1| hypothetical protein JCGZ_05901 [Jatropha curcas]
Length=289

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSL
Sbjct  168  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSL  227

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            QNQVEFLSMKLT AS++YDFN+ET+ IETMQRAKA E  +M++ +K+GY GL+
Sbjct  228  QNQVEFLSMKLTAASTFYDFNAETDDIETMQRAKAQEAKEMERVMKEGYGGLT  280



>ref|XP_003528950.1| PREDICTED: transcription factor BEE 1-like [Glycine max]
 gb|KHN20738.1| Transcription factor BEE 3 [Glycine soja]
Length=272

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 177/261 (68%), Gaps = 21/261 (8%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELNPNFGDLSGPNF---HTLMGFSQQDQFLSQVPSAAEFSPQE  667
            FP L +DPSME+  QF  +N +   L   N    H L+ FS  D FL   P   E  P  
Sbjct  19   FPFLEIDPSMELLNQFLGMNQHV--LENSNLIPMHNLVPFSC-DTFLG--PQEPE-CPGN  72

Query  666  YAVNSLHYEAKTGHRA--VILP----ENDALETKMKPADYTTMEscsanssspavSEIGT  505
               N   + A   H A  + LP    EN+  E K + +    +   S+ +S+PAVSE G+
Sbjct  73   LEEN---FPAHVNHNALPISLPIFQAENEIHEGKKRKS--MDLPETSSANSTPAVSESGS  127

Query  504  rrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDI  325
            + KHS G+GKR KS+  E+ K  EVVHVRARRGQATDSHSLAERVRRGKINE+L+CLQ+I
Sbjct  128  KIKHSSGRGKRVKSNVTEEEKAKEVVHVRARRGQATDSHSLAERVRRGKINEKLRCLQNI  187

Query  324  VPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAY  145
            VPGCYKTMGMAVMLDEIINYVQSLQ+QVEFLS+KLT AS++YDFNSET+ +ETMQRA+A 
Sbjct  188  VPGCYKTMGMAVMLDEIINYVQSLQHQVEFLSLKLTAASTFYDFNSETDALETMQRARAS  247

Query  144  EDMKMQKQVKDGYEGLSTSNP  82
            E  ++ K  K+GY G+S   P
Sbjct  248  EAKELGKYKKEGYGGVSFFQP  268



>ref|XP_004512905.1| PREDICTED: transcription factor BEE 3-like [Cicer arietinum]
Length=270

 Score =   202 bits (513),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 172/260 (66%), Gaps = 10/260 (4%)
 Frame = -1

Query  846  FRQLFPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ  670
             R  FP L+ D SME+  QF  +N +  D S  N   LM FS  D  L   PS  EF P 
Sbjct  12   IRPSFPFLDSDQSMELLNQFIGINQHVMDNSNMNMQNLMSFSS-DSIL--CPSQQEF-PG  67

Query  669  EYAVNSLHYEAKTGHRAV-ILPENDALETKMKPADYTTM---EscsanssspavSEIGTr  502
                   H+     H AV +   N  +  K+  A    +   +  S+ +S+ AVSE G++
Sbjct  68   NLE-EDFHHGLVHHHNAVQVSVPNFEVGNKVHDAKKRKIMDFQETSSANSTLAVSESGSK  126

Query  501  rkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIV  322
             K + G+GKR K+   E+ K  EVVHVRARRGQATDSHSLAERVRRGKI+E+L+CLQ++V
Sbjct  127  TKLNGGRGKRVKNYGTEEEKAKEVVHVRARRGQATDSHSLAERVRRGKISEKLRCLQNMV  186

Query  321  PGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYE  142
            PGCYKTMGMAVMLDEIINYVQSLQ+QVEFLS+KLT AS+YYDFNSET+ +ETMQ+A+A E
Sbjct  187  PGCYKTMGMAVMLDEIINYVQSLQHQVEFLSLKLTAASTYYDFNSETDDLETMQKARASE  246

Query  141  DMKMQKQVKDGYEGLSTSNP  82
              ++ +  ++GY G+S   P
Sbjct  247  AKELGRYKREGYGGISCFQP  266



>ref|XP_006485801.1| PREDICTED: transcription factor BEE 3-like [Citrus sinensis]
 gb|KDO57468.1| hypothetical protein CISIN_1g024653mg [Citrus sinensis]
Length=264

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 166/257 (65%), Gaps = 21/257 (8%)
 Frame = -1

Query  834  FPLLNVDPSMEVAQFPELNPNFGDLSGP---NFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
            FP L++DP++E     ++N N   L      N+ + M FS  D F     + AE  P  +
Sbjct  17   FPFLDIDPNIE-----QINNNLSVLDNTSLLNYQSFMPFSNPDNFFEFPGNLAENFPGNF  71

Query  663  AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspa-vSEIGTrrkhsv  487
              N++     T              TK +  +   +E   +++   + VSEI T ++   
Sbjct  72   IQNNMLPVCHT-----------VTSTKCESKNRKAVEISESSNEDSSPVSEIETNKRKKN  120

Query  486  gkgkrkks-seeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCY  310
               +++   +E+E+ K  EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCY
Sbjct  121  SGRRKRVKGNEKEEEKSKEVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCY  180

Query  309  KTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKM  130
            KTMGM +MLDEIINYVQSLQNQVEFLSMKLT AS++YDFNSE++ +ETMQ+AKAY+  +M
Sbjct  181  KTMGMTMMLDEIINYVQSLQNQVEFLSMKLTAASTFYDFNSESDAVETMQKAKAYKAKEM  240

Query  129  QKQVKDGYEGLSTSNPF  79
            ++ +K+G    S+S+ F
Sbjct  241  ERLMKEGNFACSSSSSF  257



>ref|XP_002276500.1| PREDICTED: transcription factor BEE 3 [Vitis vinifera]
 emb|CBI15462.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 109/139 (78%), Gaps = 11/139 (8%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKTMGMAVMLDEII
Sbjct  138  DEKPREVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEII  197

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQNQVEFLSMKLT AS YYDFNS+T+ +ET+QR K + +     Q          
Sbjct  198  NYVQSLQNQVEFLSMKLTAASQYYDFNSDTDTLETIQRGKVHGEQPPSTQ----------  247

Query  90   SNPFDQQSFGCYPSLPHNT  34
              P D  +FG Y SLP+NT
Sbjct  248  HGPID-LTFGSYSSLPYNT  265



>ref|XP_010265101.1| PREDICTED: transcription factor bHLH75-like [Nelumbo nucifera]
Length=278

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 175/274 (64%), Gaps = 24/274 (9%)
 Frame = -1

Query  846  FRQLFPLLNVDPSMEVA--QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVP----SAA  685
            FR  FP L +D +ME+   Q  ELNP+       N  + MGFS  + F+ Q P    S A
Sbjct  11   FRPSFPFLEIDSNMELMMNQLAELNPSGFLNPNLNIQSFMGFSNDNFFVQQQPDFSTSFA  70

Query  684  EFS----PQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavS  517
            + S    P  Y  N+L           +    DA++ + K     +  S   +S+  + +
Sbjct  71   DNSTAGVPHRYGPNALPVIQS------VASAGDAVDHESKKQMMVSESSSGNSSAPVSET  124

Query  516  EIG----TrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINE  349
              G    T+RK+S G+GKRK+++E E   P EV+HVRARRGQATDSHSLAERVRR KIN+
Sbjct  125  GSGGDDKTKRKNSFGRGKRKRNNENEGETPKEVIHVRARRGQATDSHSLAERVRREKIND  184

Query  348  RLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIE  169
            RL+CLQ +VPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKL+ ASS+YDFNSE E +E
Sbjct  185  RLRCLQGLVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLSAASSFYDFNSEMEALE  244

Query  168  TMQRAKAYEDMKMQKQVKD-GYEGLSTSN---PF  79
            T Q A AYE  ++++ V+D GY GL+  N   PF
Sbjct  245  TTQGANAYEAQEIERVVRDGGYGGLTCFNSTWPF  278



>gb|EYU46217.1| hypothetical protein MIMGU_mgv1a011969mg [Erythranthe guttata]
Length=265

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 165/284 (58%), Gaps = 34/284 (12%)
 Frame = -1

Query  861  FMADHFRQLFPLLNVDPSME-VAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQV---P  694
            F   +F+Q F L + DP  + V QF  LN           H+L+G    D    Q+   P
Sbjct  4    FFLQNFKQSFSLEDFDPGSDFVNQFSGLN-----------HSLIGSFPHDSIFPQLSPGP  52

Query  693  SAAEFSPQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSE  514
               +  P  +  +  +         VIL  N    TK K  D +T ES SANSS+ +  +
Sbjct  53   GNLDNFPGLFIHDDKNVAVTPFTEPVILNNNHQKNTKRKADDTSTPESSSANSSAYSSPQ  112

Query  513  IGTrrkhs----vgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINER  346
            +               K K  +E+ED KP EV+HVRA+RGQATDSHSLAERVRRGKINER
Sbjct  113  VSDNGIRKPNCGRRGKKAKGGNEKEDEKPREVIHVRAKRGQATDSHSLAERVRRGKINER  172

Query  345  LKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIET  166
            L+CLQDIVPGCYKTMGMAVM DEIINYVQSLQNQVEFLSMKLT AS+Y+DFNS+T  +ET
Sbjct  173  LRCLQDIVPGCYKTMGMAVMFDEIINYVQSLQNQVEFLSMKLTAASTYFDFNSDTYAMET  232

Query  165  MQRAKAYEDMKMQKQVKDGYEGLSTS--NPFDQQSFGCYPSLPH  40
            MQ+A A              +GLS+   +P     FGCY  LPH
Sbjct  233  MQKANA------------AIQGLSSGQISPL-SLDFGCYNQLPH  263



>ref|XP_008240256.1| PREDICTED: transcription factor BEE 1 [Prunus mume]
Length=282

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 166/262 (63%), Gaps = 15/262 (6%)
 Frame = -1

Query  834  FPLLNVDPS--ME-VAQFPE-LNPNFGDL-SGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ  670
             P L++ P+  ME + Q+ +  NPN  D  S  NF T M FS  + F SQ P       Q
Sbjct  15   LPFLDIAPNTNMEPIHQYTDQFNPNVLDFYSSLNFQTCMPFSNDNYFSSQGPEFQGNLVQ  74

Query  669  EYAVNSLHYEAKTG---------HRAVILPENDALETKMKPADYTTMEscsanssspavS  517
             +  N   ++ K+          H       N   E+K + A     ES S  S+ P   
Sbjct  75   NFP-NFFDHDNKSNQNDEAPAVQHLVGAGAGNGFQESKKRRAMDDVSESSSGISTPPVSE  133

Query  516  EIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKC  337
                R+  S    + KKS+E+ED KP +VVHVRARRGQATDSHSLAERVRRGKINERL+C
Sbjct  134  TGVRRKNSSGRGKRHKKSNEKEDEKPKDVVHVRARRGQATDSHSLAERVRRGKINERLRC  193

Query  336  LQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQR  157
            LQ+IVPGC KTMGMAVMLDEIINYVQSLQNQVEFLSMKLT ASS+YDFNSET+ +ETMQ 
Sbjct  194  LQNIVPGCSKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASSFYDFNSETDDMETMQS  253

Query  156  AKAYEDMKMQKQVKDGYEGLST  91
            AK YE +++++  ++GY G  +
Sbjct  254  AKVYEAVELERMKREGYGGYGS  275



>gb|KHF97638.1| Transcription factor BEE 1 -like protein [Gossypium arboreum]
Length=268

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 168/261 (64%), Gaps = 32/261 (12%)
 Frame = -1

Query  846  FRQLFPLLNVDPSMEVAQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQ---VP------  694
            F+Q F  L+++    +  F ELNP   D S  N+ + +  S  D F SQ   +P      
Sbjct  11   FKQSFSFLDMES---LNHFTELNPRLLDNSVMNYQSFLP-SSIDNFFSQAQAIPGHEGGN  66

Query  693  ---SAAEFSPQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspa  523
               SA+ F P   A   L +E+K                K K  D +   S   + SSP 
Sbjct  67   LQSSASVFQPLLTAKTELIHESK----------------KRKALDVSKSSSFGNSLSSPQ  110

Query  522  vSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERL  343
            VSE   +R++  G+GKR K +E+E+ KP +VVHVRARRGQATDSHSLAERVRRGKINERL
Sbjct  111  VSETEVKRRNDSGRGKRAKRNEKEEEKPKDVVHVRARRGQATDSHSLAERVRRGKINERL  170

Query  342  KCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            +CLQDIVPGC++TMGMAVMLDEIINYVQSLQNQ+EFLSMKLT AS+YYDFNSE + +E M
Sbjct  171  RCLQDIVPGCHRTMGMAVMLDEIINYVQSLQNQIEFLSMKLTAASTYYDFNSEPDALERM  230

Query  162  QRAKAYEDMKMQKQVKDGYEG  100
            QR KA E  ++++ +K+ Y G
Sbjct  231  QREKAQEAKELERLMKERYVG  251



>gb|KHN21570.1| Transcription factor BEE 1 [Glycine soja]
Length=226

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRA+RGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMA+MLDEII
Sbjct  98   DKKPNEVVHVRAKRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAIMLDEII  157

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLSMKL  AS+YYDFNSE++++ETMQRA+A E  ++ + V++  EG+S 
Sbjct  158  NYVQSLQHQVEFLSMKLNAASTYYDFNSESDVLETMQRARASEVKELDRYVREECEGVSC  217

Query  90   SNP  82
              P
Sbjct  218  FEP  220



>ref|XP_010537453.1| PREDICTED: transcription factor BEE 3 isoform X1 [Tarenaya hassleriana]
Length=264

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EVVHVRARRGQATDSHSLAERVRRGKIN+RL+CLQD+VPGCYKTMGMA MLDEIINY
Sbjct  143  KEREVVHVRARRGQATDSHSLAERVRRGKINDRLRCLQDMVPGCYKTMGMATMLDEIINY  202

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS  88
            VQSLQNQVEFLSMKLT AS++YDFNSET+ ++++QRAKA E ++M +QVKDG   L +S
Sbjct  203  VQSLQNQVEFLSMKLTAASTFYDFNSETDAMDSLQRAKAREAVEMGRQVKDGDAVLHSS  261



>ref|XP_010537454.1| PREDICTED: transcription factor BEE 3 isoform X2 [Tarenaya hassleriana]
Length=263

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EVVHVRARRGQATDSHSLAERVRRGKIN+RL+CLQD+VPGCYKTMGMA MLDEIINY
Sbjct  142  KEREVVHVRARRGQATDSHSLAERVRRGKINDRLRCLQDMVPGCYKTMGMATMLDEIINY  201

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS  88
            VQSLQNQVEFLSMKLT AS++YDFNSET+ ++++QRAKA E ++M +QVKDG   L +S
Sbjct  202  VQSLQNQVEFLSMKLTAASTFYDFNSETDAMDSLQRAKAREAVEMGRQVKDGDAVLHSS  260



>ref|XP_002887509.1| hypothetical protein ARALYDRAFT_476520 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63768.1| hypothetical protein ARALYDRAFT_476520 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EVVHVRARRGQATDSHS+AERVRRGKINERLKCLQDIVPGCYKTMGMA MLDEIINY
Sbjct  142  KDREVVHVRARRGQATDSHSIAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINY  201

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            VQSLQNQVEFLSMKLT ASSYYDFNSET+ +E+MQRAKA E ++M  Q +DG
Sbjct  202  VQSLQNQVEFLSMKLTAASSYYDFNSETDAVESMQRAKAREAVEM-GQGRDG  252



>ref|XP_007210857.1| hypothetical protein PRUPE_ppa015301mg [Prunus persica]
 gb|EMJ12056.1| hypothetical protein PRUPE_ppa015301mg [Prunus persica]
Length=284

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP +VVHVRARRGQATDSHSLAERVRRGKINERL+CLQ+IVPGC KTMGMAVMLDEII
Sbjct  156  DEKPKDVVHVRARRGQATDSHSLAERVRRGKINERLRCLQNIVPGCSKTMGMAVMLDEII  215

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQNQVEFLSMKLT ASS+YDFNSET+ +ETMQ AK YE  ++++  ++GY G  +
Sbjct  216  NYVQSLQNQVEFLSMKLTAASSFYDFNSETDDMETMQSAKVYEAAELERMKREGYGGYGS  275



>ref|XP_003525253.1| PREDICTED: transcription factor BEE 1-like [Glycine max]
Length=246

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRA+RGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMA+MLDEII
Sbjct  118  DKKPNEVVHVRAKRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAIMLDEII  177

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLSMKL  AS+YYDFNSE++++ETMQRA+A E  ++ + V++  EG+S 
Sbjct  178  NYVQSLQHQVEFLSMKLNAASTYYDFNSESDVLETMQRARASEVKELDRYVREECEGVSC  237

Query  90   SNP  82
              P
Sbjct  238  FEP  240



>ref|XP_006416609.1| hypothetical protein EUTSA_v10008517mg [Eutrema salsugineum]
 gb|ESQ34962.1| hypothetical protein EUTSA_v10008517mg [Eutrema salsugineum]
Length=261

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK+MGMA MLDEIINYVQSL
Sbjct  143  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKSMGMATMLDEIINYVQSL  202

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  203  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKAREAVEMGRQTRDG  250



>ref|XP_004137542.1| PREDICTED: transcription factor BEE 3-like [Cucumis sativus]
 ref|XP_004173026.1| PREDICTED: transcription factor BEE 3-like [Cucumis sativus]
Length=265

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRARRGQATDSHSLAERVRRGKINERL+CL+DIVPGCYKTMGMAVMLDEIINYVQS
Sbjct  144  EVVHVRARRGQATDSHSLAERVRRGKINERLRCLKDIVPGCYKTMGMAVMLDEIINYVQS  203

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            LQNQVEFLSMKL  ASS+YDFNSE + I  +QRAKA+E  ++++ +K+GY G++
Sbjct  204  LQNQVEFLSMKLAAASSFYDFNSEADAISKLQRAKAHEAKELERLMKEGYGGIA  257



>gb|KHN32051.1| Transcription factor BEE 3 [Glycine soja]
Length=245

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            + K  EVVHVRARRGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMAVMLDEII
Sbjct  119  EEKAKEVVHVRARRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAVMLDEII  178

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLS+KLT AS++YDFNSET+ +ETMQRA+A E  ++ K  K+GY G+S 
Sbjct  179  NYVQSLQHQVEFLSLKLTAASTFYDFNSETDALETMQRARASEAKELGKYKKEGYGGVSF  238

Query  90   SNP  82
              P
Sbjct  239  FQP  241



>ref|XP_008453408.1| PREDICTED: transcription factor BEE 3-like [Cucumis melo]
Length=268

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRARRGQATDSHSLAERVRRGKINERL+CL+DIVPGCYKTMGMAVMLDEIINYVQS
Sbjct  147  EVVHVRARRGQATDSHSLAERVRRGKINERLRCLKDIVPGCYKTMGMAVMLDEIINYVQS  206

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            LQNQVEFLSMKL  ASS+YDFNSE + I  +QRAKA+E  ++++ +K+GY G++
Sbjct  207  LQNQVEFLSMKLAAASSFYDFNSEADAISKLQRAKAHEAKELERLMKEGYGGIA  260



>ref|XP_010477017.1| PREDICTED: transcription factor BEE 1-like [Camelina sativa]
Length=263

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  145  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  205  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDG  252



>gb|KFK43999.1| hypothetical protein AALP_AA1G201600 [Arabis alpina]
Length=249

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK+MGMA MLDEIINYVQSL
Sbjct  131  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKSMGMATMLDEIINYVQSL  190

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  191  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDG  238



>ref|NP_173276.2| transcription factor BEE 1 [Arabidopsis thaliana]
 sp|Q8GZ13.1|BEE1_ARATH RecName: Full=Transcription factor BEE 1; AltName: Full=Basic 
helix-loop-helix protein 44; Short=AtbHLH44; Short=bHLH 44; 
AltName: Full=Protein Brassinosteroid enhanced expression 1; 
AltName: Full=Transcription factor EN 77; AltName: Full=bHLH 
transcription factor bHLH044 [Arabidopsis thaliana]
 dbj|BAC41942.1| putative bHLH transcription factor bHLH044 [Arabidopsis thaliana]
 gb|AAO63332.1| At1g18400 [Arabidopsis thaliana]
 gb|AAN18283.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AEE29711.1| transcription factor BEE 1 [Arabidopsis thaliana]
Length=260

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  142  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  201

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  202  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDG  249



>gb|ACN21646.1| putative basic helix-loop-helix protein BHLH5 [Lotus japonicus]
 gb|AFK35854.1| unknown [Lotus japonicus]
Length=268

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D K  +VVHVRARRGQATDSHSLAERVRRGKINE+LKCLQ+IVPGCYKTMGMA+MLDEII
Sbjct  143  DKKSTQVVHVRARRGQATDSHSLAERVRRGKINEKLKCLQNIVPGCYKTMGMAIMLDEII  202

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLSMKLT AS++YDFNSE   +E MQRA+  E  ++ K V +GYEG+S 
Sbjct  203  NYVQSLQHQVEFLSMKLTAASTFYDFNSEINSLEAMQRARVSEAKELAKYVTEGYEGVSC  262

Query  90   SNP  82
              P
Sbjct  263  FQP  265



>ref|XP_006305468.1| hypothetical protein CARUB_v10009894mg, partial [Capsella rubella]
 gb|EOA38366.1| hypothetical protein CARUB_v10009894mg, partial [Capsella rubella]
Length=294

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  176  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  235

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  236  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDG  283



>ref|XP_003532505.1| PREDICTED: transcription factor BEE 3-like [Glycine max]
 gb|KHN16571.1| Transcription factor BEE 3 [Glycine soja]
Length=252

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRA+RGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMA+MLDEII
Sbjct  124  DKKPNEVVHVRAKRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAIMLDEII  183

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLSMKLT AS+YYD NSE++ +ETMQRA+A E  ++ K V++G E +S 
Sbjct  184  NYVQSLQHQVEFLSMKLTAASTYYDLNSESDALETMQRARASEVKELGKCVREGSEEVSC  243

Query  90   SNP  82
              P
Sbjct  244  FEP  246



>ref|XP_010264190.1| PREDICTED: transcription factor bHLH75-like [Nelumbo nucifera]
Length=281

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 173/264 (66%), Gaps = 19/264 (7%)
 Frame = -1

Query  846  FRQLFPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ  670
            F+  FP L  D +ME+  Q  ELNP        N  + MGFS    F  Q P   EFS  
Sbjct  11   FKPSFPFLEFDSNMELLNQIAELNPTAFLNPSLNLQSFMGFSGDISFAQQQP---EFSMS  67

Query  669  --EYAVNSLHYEAKTGHRAVILPE---NDAL--ETKMKPADYTTMEscsanssspavSEI  511
              +     L+  +     AV+ P     D +  E+K++ A     ES S  +SS  VSE 
Sbjct  68   FADETTGLLYQGSPNALPAVVQPAASVGDVVVHESKIQKAT-AASESSSGITSSATVSET  126

Query  510  G-------TrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKIN  352
            G        +RK S+G+GKRK+++E+E  KP +V+HVRARRGQATDSHSLAERVRR KIN
Sbjct  127  GLGGDTHQIKRKSSLGRGKRKRNNEKEGEKPKDVIHVRARRGQATDSHSLAERVRREKIN  186

Query  351  ERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEII  172
            +RL+CLQ +VPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKL+ ASS+YDFNSE E+ 
Sbjct  187  DRLRCLQGLVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLSAASSFYDFNSEVEVN  246

Query  171  ETMQRAKAYEDMKMQKQVKDGYEG  100
            ETMQ A AYE  ++++ +++GY G
Sbjct  247  ETMQGANAYEAQEIERLMREGYGG  270



>ref|XP_010498227.1| PREDICTED: transcription factor BEE 1 [Camelina sativa]
Length=257

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  139  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  198

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASS+YDFNSET+ ++++QRAKA E ++M +Q +DG
Sbjct  199  QNQVEFLSMKLTAASSFYDFNSETDAVDSVQRAKARETVEMGRQTRDG  246



>ref|XP_010036900.1| PREDICTED: transcription factor BEE 3 [Eucalyptus grandis]
 gb|KCW48557.1| hypothetical protein EUGRSUZ_K02229 [Eucalyptus grandis]
Length=281

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            +P EVVHVRARRGQATDSHSLAERVRR KINERL+CLQDIVPGCYKTMG+AVMLDEIINY
Sbjct  157  RPKEVVHVRARRGQATDSHSLAERVRRSKINERLRCLQDIVPGCYKTMGLAVMLDEIINY  216

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            VQSLQNQVEFLSMKLT ASS+YDFN+E++ IE MQRAKA+E  ++++ +++G
Sbjct  217  VQSLQNQVEFLSMKLTAASSFYDFNAESDAIERMQRAKAFEAKELERLIREG  268



>emb|CDY65027.1| BnaC05g50040D [Brassica napus]
Length=263

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK+MGMA MLDEIINYVQSL
Sbjct  145  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKSMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVE LSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  205  QNQVELLSMKLTAASSFYDFNSETDAVDSMQRAKAREAVEMGRQTRDG  252



>ref|XP_010428323.1| PREDICTED: transcription factor BEE 3 isoform X1 [Camelina sativa]
Length=263

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHS+AER RRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSL
Sbjct  146  VVHVRARRGQATDSHSIAERARRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSL  205

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMK+T ASSYYDFNSET+ +ETMQRAKA E ++M  Q +DG
Sbjct  206  QNQVEFLSMKITAASSYYDFNSETDAVETMQRAKAREAVEM-GQGRDG  252



>gb|AAW81732.1| putative bZIPtranscription factor protein [Brassica oleracea]
Length=263

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK+MGMA MLDEIINYVQSL
Sbjct  145  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKSMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVE LSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  205  QNQVELLSMKLTAASSFYDFNSETDAVDSMQRAKAREAVEMGRQTRDG  252



>ref|XP_004137476.1| PREDICTED: transcription factor BEE 3-like [Cucumis sativus]
 ref|XP_004172754.1| PREDICTED: transcription factor BEE 3-like [Cucumis sativus]
 gb|KGN64122.1| hypothetical protein Csa_1G042340 [Cucumis sativus]
Length=278

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 168/296 (57%), Gaps = 63/296 (21%)
 Frame = -1

Query  834  FPLLNVDPSMEVAQFPELN----------------------PNFGDLSGPNFHTLMGFSQ  721
            FPL+++DP+    Q P LN                      P F +  G NF  +    Q
Sbjct  16   FPLMDIDPN----QNPNLNFLDNIPILFSESFFNNQTAVPSPRFLENWGENFQGIFSHHQ  71

Query  720  QDQFLSQVPSAAEFSPQEYAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsa  541
             +Q ++   S   F P+    N LH     G +   L  NDA E+              +
Sbjct  72   ANQIITPTSSPV-FEPKNLFGNDLH-----GSKKRKLENNDAYESS-------------S  112

Query  540  nssspavSEIGTrrkhsvgkgkrkksseeEDT-KPMEVVHVRARRGQATDSHSLAERVRR  364
             +S+P VSE G   K++ GK KR K  +  D  KP EVVHVRARRGQATDSHS+AER+RR
Sbjct  113  GNSTPQVSENGINTKNNNGKEKRSKKGDTNDGEKPREVVHVRARRGQATDSHSVAERIRR  172

Query  363  GKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSE  184
            GKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT ASSY+DFNS+
Sbjct  173  GKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASSYHDFNSD  232

Query  183  TEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS------NPFDQQSFGCYPSLPHNT  34
            ++           ED    K++++G  G+S         PFD   FG Y +LP NT
Sbjct  233  SDA----------EDKLKGKEIREGNGGISMIGSSTQLGPFD-LCFGSYSTLPFNT  277



>ref|XP_009149281.1| PREDICTED: transcription factor BEE 1 [Brassica rapa]
 emb|CDY26165.1| BnaA06g12520D [Brassica napus]
Length=263

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK+MGMA MLDEIINYVQSL
Sbjct  145  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKSMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVE LSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  205  QNQVELLSMKLTAASSFYDFNSETDAVDSMQRAKAREAVEMGRQTRDG  252



>ref|XP_007160380.1| hypothetical protein PHAVU_002G316900g [Phaseolus vulgaris]
 gb|ESW32374.1| hypothetical protein PHAVU_002G316900g [Phaseolus vulgaris]
Length=245

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 4/120 (3%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP +VVHVRA+RGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMA+MLDEII
Sbjct  121  DKKPNQVVHVRAKRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAIMLDEII  180

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            NYVQSLQ+QVEFLSMKL+ AS+YYDFNSE++ +ETMQRAKA E     K++ +G EG+S 
Sbjct  181  NYVQSLQHQVEFLSMKLSAASTYYDFNSESDALETMQRAKASE----AKELGEGSEGVSC  236



>ref|XP_008393318.1| PREDICTED: transcription factor BEE 3 [Malus domestica]
Length=264

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 163/254 (64%), Gaps = 19/254 (7%)
 Frame = -1

Query  834  FPLLNVDPSME-VAQFPE-LN-PNFGDLSGPNFHTLMGFSQQDQFLS-QVPSAAEFSPQE  667
            FP L++DP+ME V QF +  N P+  +    NFHT M F+      S Q P   EF    
Sbjct  15   FPFLDIDPNMELVNQFADQFNVPSVMEYPSLNFHTYMPFTTDSYLFSNQEP---EFPAGN  71

Query  666  YAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsv  487
               N    E    H+ V     D  ETK + A        S+  S+P VSE G  RK+S 
Sbjct  72   MVENFPKLEV---HQTVX----DGSETKKRIA-VGDASQSSSGISTPPVSETGITRKNSA  123

Query  486  gkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCY-  310
            G+GKR KS+E+ED KP EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGC  
Sbjct  124  GRGKRVKSNEKEDEKPKEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCSN  183

Query  309  KTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKM  130
            KTMGMAVMLDEIINYVQSLQNQ+EFLSM+L  ASS+YDFNS T+  ETMQ A   E +K 
Sbjct  184  KTMGMAVMLDEIINYVQSLQNQIEFLSMRLAAASSFYDFNSNTDXTETMQIAAELERLKR  243

Query  129  QKQVKDGYEGLSTS  88
            +     GY G   S
Sbjct  244  EAA---GYGGFGAS  254



>ref|XP_009106040.1| PREDICTED: transcription factor BEE 3 [Brassica rapa]
Length=262

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D K  EVVHVRA+RGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK MGMA MLDEII
Sbjct  139  DKKEREVVHVRAKRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKAMGMATMLDEII  198

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            NYVQSLQNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  199  NYVQSLQNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  251



>emb|CDX73020.1| BnaC06g34680D [Brassica napus]
Length=262

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D K  EVVHVRA+RGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK MGMA MLDEII
Sbjct  139  DKKEREVVHVRAKRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKAMGMATMLDEII  198

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            NYVQSLQNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  199  NYVQSLQNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  251



>emb|CDY67050.1| BnaA07g38970D [Brassica napus]
Length=262

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D K  EVVHVRA+RGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK MGMA MLDEII
Sbjct  139  DKKEREVVHVRAKRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKAMGMATMLDEII  198

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            NYVQSLQNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  199  NYVQSLQNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  251



>gb|KGN63829.1| hypothetical protein Csa_1G024150 [Cucumis sativus]
Length=481

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRARRGQATDSHSLAERVRRGKINERL+CL+DIVPGCYKTMGMAVMLDEIINYVQS
Sbjct  360  EVVHVRARRGQATDSHSLAERVRRGKINERLRCLKDIVPGCYKTMGMAVMLDEIINYVQS  419

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            LQNQVEFLSMKL  ASS+YDFNSE + I  +QRAKA+E  ++++ +K+GY G++
Sbjct  420  LQNQVEFLSMKLAAASSFYDFNSEADAISKLQRAKAHEAKELERLMKEGYGGIA  473



>gb|AAG52074.1|AC012679_12 putative helix-loop-helix DNA-binding protein; 87971-89290 [Arabidopsis 
thaliana]
Length=250

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AERVRRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  135  HVRARRGQATDSHSIAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  194

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMKLT ASSYYDFNSET+ +E+MQ+AKA E ++M  Q +DG
Sbjct  195  QVEFLSMKLTAASSYYDFNSETDAVESMQKAKAREAVEM-GQGRDG  239



>ref|NP_177524.2| transcription factor BEE 3 [Arabidopsis thaliana]
 sp|Q8GWK7.1|BEE3_ARATH RecName: Full=Transcription factor BEE 3; AltName: Full=Basic 
helix-loop-helix protein 50; Short=AtbHLH50; Short=bHLH 50; 
AltName: Full=Protein Brassinosteroid enhanced expression 3; 
AltName: Full=Transcription factor EN 76; AltName: Full=bHLH 
transcription factor bHLH050 [Arabidopsis thaliana]
 dbj|BAC43374.1| putative bHLH transcription factor bHLH050 [Arabidopsis thaliana]
 gb|AAP04040.1| putative helix-loop-helix DNA-binding protein [Arabidopsis thaliana]
 gb|AEE35513.1| transcription factor BEE 3 [Arabidopsis thaliana]
Length=261

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AERVRRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  146  HVRARRGQATDSHSIAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  205

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMKLT ASSYYDFNSET+ +E+MQ+AKA E ++M  Q +DG
Sbjct  206  QVEFLSMKLTAASSYYDFNSETDAVESMQKAKAREAVEM-GQGRDG  250



>ref|XP_010459453.1| PREDICTED: transcription factor BEE 1-like [Camelina sativa]
Length=261

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  143  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  202

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKD  112
            QNQVEFLSMKLT ASS+YDFNSET+ ++++QRAKA E ++M  Q +D
Sbjct  203  QNQVEFLSMKLTAASSFYDFNSETDAVDSVQRAKARETVEMGGQTRD  249



>gb|KFK41823.1| hypothetical protein AALP_AA2G175900 [Arabis alpina]
Length=268

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRA+RGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  153  HVRAKRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  212

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMKLT ASSYYDFNSET+ +++MQRAKA E ++M  Q +DG
Sbjct  213  QVEFLSMKLTAASSYYDFNSETDAVDSMQRAKAREAVEM-GQGRDG  257



>ref|XP_006374179.1| hypothetical protein POPTR_0015s03760g, partial [Populus trichocarpa]
 gb|ERP51976.1| hypothetical protein POPTR_0015s03760g, partial [Populus trichocarpa]
Length=123

 Score =   186 bits (471),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCYKTMGMAVMLDEIINY
Sbjct  17   KTREVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEIINY  76

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAY  145
            VQSLQNQVEFLSMKLT AS++YDFN+ETE IET+Q  K +
Sbjct  77   VQSLQNQVEFLSMKLTAASTFYDFNAETEAIETVQVLKYF  116



>ref|XP_010416202.1| PREDICTED: transcription factor BEE 3-like [Camelina sativa]
Length=265

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AER RRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  150  HVRARRGQATDSHSIAERARRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  209

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMK+T ASSYYDFNSET+ +E+MQRAKA E ++M  Q +DG
Sbjct  210  QVEFLSMKITAASSYYDFNSETDAVESMQRAKAREAVEM-GQGRDG  254



>ref|XP_010471458.1| PREDICTED: transcription factor BEE 3 [Camelina sativa]
Length=265

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AER RRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  150  HVRARRGQATDSHSIAERARRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  209

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMK+T ASSYYDFNSET+ +E+MQRAKA E ++M  Q +DG
Sbjct  210  QVEFLSMKITAASSYYDFNSETDAVESMQRAKAREAVEM-GQGRDG  254



>ref|XP_004300517.1| PREDICTED: transcription factor BEE 3-like [Fragaria vesca subsp. 
vesca]
Length=295

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 5/123 (4%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D KP EVVHVRARRGQATDSHSLAERVRRGKINER++CLQDIVPGC KTMGMAVMLDEII
Sbjct  166  DEKPREVVHVRARRGQATDSHSLAERVRRGKINERMRCLQDIVPGCSKTMGMAVMLDEII  225

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSETE-IIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            NYVQSLQNQVEFLSMKLT ASS++DFNSETE  +ETMQRAK  E +K++     GY G+ 
Sbjct  226  NYVQSLQNQVEFLSMKLTAASSFHDFNSETEDAMETMQRAKELEIVKIEA----GYGGVV  281

Query  93   TSN  85
             S+
Sbjct  282  DSS  284



>ref|XP_009360148.1| PREDICTED: transcription factor BEE 3-like [Pyrus x bretschneideri]
 ref|XP_009360149.1| PREDICTED: transcription factor BEE 3-like [Pyrus x bretschneideri]
Length=264

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 163/254 (64%), Gaps = 19/254 (7%)
 Frame = -1

Query  834  FPLLNVDPSME-VAQFPE-LN-PNFGDLSGPNFHTLMGFSQQDQFLS-QVPSAAEFSPQE  667
            FP L++DP+ME V QF +  N P+  +    NFHT M FS      S Q P   EF    
Sbjct  15   FPFLDIDPNMELVNQFADQFNIPSVMEYPSLNFHTYMPFSNDSCLFSNQEP---EFPAGN  71

Query  666  YAVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkhsv  487
               N    E    H+ V     D  E+K + A        S+  S+P VSE G  RK+S 
Sbjct  72   MVENFPKLEV---HQIVA----DGNESKKRIA-VDDASQSSSGISTPPVSETGITRKNSA  123

Query  486  gkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCY-  310
            G+GKR KS+E+ED KP EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQ+IVPGC  
Sbjct  124  GRGKRVKSNEKEDEKPKEVVHVRARRGQATDSHSLAERVRRGKINERLRCLQNIVPGCSN  183

Query  309  KTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKM  130
            KTMGMAVMLDEIINYVQSLQNQ+EFLSM+L  ASS+YDF S T++ ETMQ A   E +K 
Sbjct  184  KTMGMAVMLDEIINYVQSLQNQIEFLSMRLAAASSFYDFKSSTDVTETMQIAAELERLKR  243

Query  129  QKQVKDGYEGLSTS  88
            +     GY G   S
Sbjct  244  EAA---GYGGFGAS  254



>emb|CAN76460.1| hypothetical protein VITISV_010828 [Vitis vinifera]
Length=237

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 4/128 (3%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            + KP EV+HVRA+RGQATDSHSLAERVRR KINE+L+CLQD+VPGCYKTMGMAVMLD II
Sbjct  110  NNKPREVIHVRAKRGQATDSHSLAERVRREKINEKLRCLQDLVPGCYKTMGMAVMLDVII  169

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKMQKQVKDGYEG--  100
            NYVQSLQNQ+EFLSMKL+ AS++YDFN SE E +ETMQ   AYE  ++++ VK+GY G  
Sbjct  170  NYVQSLQNQIEFLSMKLSAASTFYDFNSSEAEALETMQGTNAYEVHEVERSVKEGYGGPS  229

Query  99   -LSTSNPF  79
             L ++ PF
Sbjct  230  HLHSTWPF  237



>ref|XP_002279412.1| PREDICTED: transcription factor bHLH75 [Vitis vinifera]
Length=258

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 4/128 (3%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            + KP EV+HVRA+RGQATDSHSLAERVRR KINE+L+CLQD+VPGCYKTMGMAVMLD II
Sbjct  131  NNKPREVIHVRAKRGQATDSHSLAERVRREKINEKLRCLQDLVPGCYKTMGMAVMLDVII  190

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKMQKQVKDGYEG--  100
            NYVQSLQNQ+EFLSMKL+ AS++YDFN SE E +ETMQ   AYE  ++++ VK+GY G  
Sbjct  191  NYVQSLQNQIEFLSMKLSAASTFYDFNSSEAEALETMQGTNAYEVHEVERSVKEGYGGPS  250

Query  99   -LSTSNPF  79
             L ++ PF
Sbjct  251  HLHSTWPF  258



>emb|CBI27002.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 4/128 (3%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            + KP EV+HVRA+RGQATDSHSLAERVRR KINE+L+CLQD+VPGCYKTMGMAVMLD II
Sbjct  114  NNKPREVIHVRAKRGQATDSHSLAERVRREKINEKLRCLQDLVPGCYKTMGMAVMLDVII  173

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKMQKQVKDGYEG--  100
            NYVQSLQNQ+EFLSMKL+ AS++YDFN SE E +ETMQ   AYE  ++++ VK+GY G  
Sbjct  174  NYVQSLQNQIEFLSMKLSAASTFYDFNSSEAEALETMQGTNAYEVHEVERSVKEGYGGPS  233

Query  99   -LSTSNPF  79
             L ++ PF
Sbjct  234  HLHSTWPF  241



>ref|XP_006302692.1| hypothetical protein CARUB_v10020802mg [Capsella rubella]
 gb|EOA35590.1| hypothetical protein CARUB_v10020802mg [Capsella rubella]
Length=267

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AER RRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  152  HVRARRGQATDSHSIAERARRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  211

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMK+T ASSYYDFNSET+ +E+MQRAKA E ++M  Q +DG
Sbjct  212  QVEFLSMKITAASSYYDFNSETDDVESMQRAKAREAVEM-GQGRDG  256



>emb|CDY47737.1| BnaA02g16580D [Brassica napus]
Length=262

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRA+RGQATDSHSLAERVRRGKINERLKCL+DIVPGCYK MGMA MLDEIINYVQSL
Sbjct  145  VVHVRAKRGQATDSHSLAERVRRGKINERLKCLKDIVPGCYKAMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  205  QNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  251



>gb|AFK47662.1| unknown [Lotus japonicus]
Length=274

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHSLAERVRRGKINE+L+CLQ+IVPGCYKTMGMAVMLDEIINYVQSLQ+
Sbjct  156  HVRARRGQATDSHSLAERVRRGKINEKLRCLQNIVPGCYKTMGMAVMLDEIINYVQSLQH  215

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNP  82
            QVEFLS+KLT AS+YYDFNSET+ IETMQRA+A E  ++ +  ++ Y G+S   P
Sbjct  216  QVEFLSLKLTAASTYYDFNSETDAIETMQRARASEAKELARYKREEYGGISCFQP  270



>ref|XP_009128012.1| PREDICTED: transcription factor BEE 3-like isoform X1 [Brassica 
rapa]
Length=262

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRA+RGQATDSHSLAERVRRGKINERLKCL+DIVPGCYK MGMA MLDEIINYVQSL
Sbjct  145  VVHVRAKRGQATDSHSLAERVRRGKINERLKCLKDIVPGCYKAMGMATMLDEIINYVQSL  204

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  205  QNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  251



>emb|CDY45873.1| BnaC02g22470D [Brassica napus]
Length=199

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHV A+RGQATDSHSLAERVRRGKINERLKCL+DIVPGCYK MGMA MLDEIINYV SL
Sbjct  82   VVHVSAKRGQATDSHSLAERVRRGKINERLKCLKDIVPGCYKAMGMATMLDEIINYVHSL  141

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  142  QNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  188



>ref|XP_009128013.1| PREDICTED: transcription factor BEE 3-like isoform X2 [Brassica 
rapa]
Length=242

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRA+RGQATDSHSLAERVRRGKINERLKCL+DIVPGCYK MGMA MLDEIINYVQSL
Sbjct  125  VVHVRAKRGQATDSHSLAERVRRGKINERLKCLKDIVPGCYKAMGMATMLDEIINYVQSL  184

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QNQVEFLSMKLT ASSYYDFNSE + +++MQ+AKA E ++M  Q +DG
Sbjct  185  QNQVEFLSMKLTAASSYYDFNSEADAVDSMQKAKAREAVEM-GQGRDG  231



>ref|NP_001185394.1| transcription factor BEE 3 [Arabidopsis thaliana]
 gb|AEE35514.1| transcription factor BEE 3 [Arabidopsis thaliana]
Length=260

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 97/106 (92%), Gaps = 2/106 (2%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRARRGQATDSHS+AERVRRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSLQN
Sbjct  146  HVRARRGQATDSHSIAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQN  205

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMKLT ASSYYDFNSET+ +E+MQ AKA E ++M  Q +DG
Sbjct  206  QVEFLSMKLTAASSYYDFNSETDAVESMQ-AKAREAVEM-GQGRDG  249



>ref|XP_010094743.1| hypothetical protein L484_019953 [Morus notabilis]
 gb|EXB56908.1| hypothetical protein L484_019953 [Morus notabilis]
Length=348

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 172/264 (65%), Gaps = 15/264 (6%)
 Frame = -1

Query  861  FMADHFRQLFPLLNVDPSME-VAQFPELNPNFGDLSGPNFHTLMGF---SQQDQFLSQVP  694
            F AD    + P L+VDP+ME + QF  ++P    +   +  +L+ F   S  + F +  P
Sbjct  4    FAADFQSLIKPFLDVDPNMELITQFSGISPRINHVMDNS--SLLNFPFSSDHNMFGNPAP  61

Query  693  ----SAAEFSPQEY--AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanss  532
                + AE  P  +  + N L+  A++    +      + E+K + A      +  ++S 
Sbjct  62   HFPGNMAENFPGNFNSSNNQLYVNAQSTSAPIGNNNEYSHESKKRKAVKNLDVASESSSG  121

Query  531  spavSEIGTrrkhsvgkgkrkksseeEDT-KPMEVVHVRARRGQATDSHSLAERVRRGKI  355
              + +  G ++K+S GKGKR KS+++ED  KP EVVHVRARRGQATDSHSLAERVRRGKI
Sbjct  122  ISSETGTGIKKKNSSGKGKRVKSNDKEDQEKPKEVVHVRARRGQATDSHSLAERVRRGKI  181

Query  354  NERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            NERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS+YYDFNSET+ 
Sbjct  182  NERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTYYDFNSETDD  241

Query  174  IETMQ--RAKAYEDMKMQKQVKDG  109
            +E MQ  R K  E ++  + +  G
Sbjct  242  MEKMQVRRGKINERLRCLQDIVPG  265


 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -1

Query  375  RVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYD  196
            +VRRGKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLT AS+YYD
Sbjct  246  QVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTAASTYYD  305

Query  195  FNSETEIIETM-QRAKAYEDMKMQKQVKDGYEGLST  91
            FNSET+ +E M QRAKA E  +M++ +++GY G + 
Sbjct  306  FNSETDDMEKMQQRAKANEAKEMERLIREGYGGFAC  341



>ref|XP_006390502.1| hypothetical protein EUTSA_v10019010mg [Eutrema salsugineum]
 gb|ESQ27788.1| hypothetical protein EUTSA_v10019010mg [Eutrema salsugineum]
Length=264

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            HVRA+RGQATDSHSLAERVRRGKINERL+CLQDIVPGCYK MGMA MLDEIINYVQSLQN
Sbjct  149  HVRAKRGQATDSHSLAERVRRGKINERLRCLQDIVPGCYKAMGMATMLDEIINYVQSLQN  208

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
            QVEFLSMKLT ASSYYDFN+E + +++MQ+AKA E ++M  Q +DG
Sbjct  209  QVEFLSMKLTAASSYYDFNAEADAVDSMQKAKAREAVEM-GQWRDG  253



>ref|XP_008458311.1| PREDICTED: transcription factor BEE 3-like [Cucumis melo]
Length=277

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 154/253 (61%), Gaps = 35/253 (14%)
 Frame = -1

Query  777  PNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEYAVNSLHYEAKTGHRAVILPEND  598
            P F +  G NF  +  FSQ +Q ++ + S+  F P++   N LH   K       L  ND
Sbjct  54   PRFLENWGENFQGI--FSQANQIITPI-SSPVFEPKDPFGNDLHGSIKKRK----LENND  106

Query  597  ALETKMKPADYTTMEscsanssspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVR  418
            A E+    +     E+            I T+  +  GK  +K  + + D KP EVVHVR
Sbjct  107  AYESSSGNSTPQVSENG-----------INTKNNNGKGKRSKKGDTYDGD-KPREVVHVR  154

Query  417  ARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVE  238
            ARRGQATDSHS+AER+RRGKINERL+CLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVE
Sbjct  155  ARRGQATDSHSVAERIRRGKINERLRCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVE  214

Query  237  FLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEG--LSTS---NPFDQ  73
            FLSMKLT ASSY+DFNS+++           E     K++++G  G  +++S     FD 
Sbjct  215  FLSMKLTAASSYHDFNSDSDA----------EGKLKGKEMREGNGGSMIASSTQLGAFD-  263

Query  72   QSFGCYPSLPHNT  34
              FG Y +LP NT
Sbjct  264  LCFGSYSTLPFNT  276



>ref|XP_010428324.1| PREDICTED: transcription factor BEE 3 isoform X2 [Camelina sativa]
Length=242

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRARRGQATDSHS+AER RRGKINERLKCLQDIVPGCYKTMGMA MLDEIINYVQSL
Sbjct  146  VVHVRARRGQATDSHSIAERARRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSL  205

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQ  160
            QNQVEFLSMK+T ASSYYDFNSET+ +ETMQ
Sbjct  206  QNQVEFLSMKITAASSYYDFNSETDAVETMQ  236



>ref|XP_009347236.1| PREDICTED: transcription factor BEE 3-like [Pyrus x bretschneideri]
Length=263

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 161/255 (63%), Gaps = 22/255 (9%)
 Frame = -1

Query  834  FPLLNVDPSME-VAQFPE-LN-PNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
             P L++D +ME   Q+ +  N P+  +    NFHT M FS  D +L        FS QE 
Sbjct  15   LPFLDIDQNMEPTNQYADQFNIPSVVEYPSLNFHTYMPFSN-DTYL--------FSNQEP  65

Query  663  ---AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrkh  493
               A N +    K    +++    D  E+K + A     ES S  S+ P   E G +RK+
Sbjct  66   EFPAGNMIENFPKLQVHSIV---TDGNESKKRIAVDDATESSSGISTPPVS-ETGVKRKN  121

Query  492  svgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGC  313
            S  +GKR KS+E+ED KP E VHVRARRGQAT SHSLAERVRRGKINERL CLQDIVPGC
Sbjct  122  SAERGKRVKSNEKEDEKPKEFVHVRARRGQATHSHSLAERVRRGKINERLTCLQDIVPGC  181

Query  312  YKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMK  133
             KTMGMAVMLDEIINYVQSLQNQ+EFLSMKL  ASS+YD NS+T++ ETMQ A   E +K
Sbjct  182  SKTMGMAVMLDEIINYVQSLQNQIEFLSMKLATASSFYDSNSQTDVTETMQIAGELERLK  241

Query  132  MQKQVKDGYEGLSTS  88
             +     GY G   S
Sbjct  242  REAA---GYGGFGAS  253



>gb|AAF25996.1|AC013354_15 F15H18.11 [Arabidopsis thaliana]
Length=1154

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  432   VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
             VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  1036  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  1095

Query  252   QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
             QNQVEFLSMKLT ASS+YDFNSET+ +++MQRAKA E ++M +Q +DG
Sbjct  1096  QNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDG  1143



>ref|XP_010032051.1| PREDICTED: transcription factor BEE 1-like [Eucalyptus grandis]
 gb|KCW83870.1| hypothetical protein EUGRSUZ_B00731 [Eucalyptus grandis]
Length=261

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRARRGQATDSHSLAERVRRGKI ERL+ LQD+VPGCY+TMGMAVMLDEIINY
Sbjct  140  KPKEVVHVRARRGQATDSHSLAERVRRGKIKERLRYLQDLVPGCYQTMGMAVMLDEIINY  199

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            V+SLQ+QVEFLSMKL  ASSYYDFNSE + IET+QR + Y + +++  ++ G+     S+
Sbjct  200  VKSLQSQVEFLSMKLEAASSYYDFNSEADAIETLQREQMYGNRELESLMRIGHANFHPSS  259



>ref|XP_006469087.1| PREDICTED: transcription factor bHLH75-like [Citrus sinensis]
Length=238

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  114  KPKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQDLVPGCYKTMGMAVMLDVIINY  173

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            V+SLQNQ+EFLSMKL+ AS YYDFNSE +  ETM      +   M++ V++GY G S
Sbjct  174  VRSLQNQIEFLSMKLSAASMYYDFNSELDTTETMPGTNECDAQDMERMVREGYGGPS  230



>gb|KDO76971.1| hypothetical protein CISIN_1g042908mg [Citrus sinensis]
Length=242

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  118  KPKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQDLVPGCYKTMGMAVMLDVIINY  177

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            V+SLQNQ+EFLSMKL+ AS YYDFNSE +  ETM      +   M++ V++GY G S
Sbjct  178  VRSLQNQIEFLSMKLSAASMYYDFNSELDTTETMPGTNECDAQDMERMVREGYGGPS  234



>ref|XP_006448452.1| hypothetical protein CICLE_v10016461mg [Citrus clementina]
 gb|ESR61692.1| hypothetical protein CICLE_v10016461mg [Citrus clementina]
Length=237

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR +INERL+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  113  KPKEVIHVRAKRGQATDSHSLAERVRRERINERLRCLQDLVPGCYKTMGMAVMLDVIINY  172

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            V+SLQNQ+EFLSMKL+ AS YYDFNSE +  ETM      +   M++ V++GY G S
Sbjct  173  VRSLQNQIEFLSMKLSAASMYYDFNSELDTTETMPGTNECDAQDMERMVREGYGGPS  229



>ref|XP_006448451.1| hypothetical protein CICLE_v10016461mg [Citrus clementina]
 gb|ESR61691.1| hypothetical protein CICLE_v10016461mg [Citrus clementina]
Length=242

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR +INERL+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  118  KPKEVIHVRAKRGQATDSHSLAERVRRERINERLRCLQDLVPGCYKTMGMAVMLDVIINY  177

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLS  94
            V+SLQNQ+EFLSMKL+ AS YYDFNSE +  ETM      +   M++ V++GY G S
Sbjct  178  VRSLQNQIEFLSMKLSAASMYYDFNSELDTTETMPGTNECDAQDMERMVREGYGGPS  234



>gb|KDP29431.1| hypothetical protein JCGZ_18352 [Jatropha curcas]
Length=217

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR KINE+L+ LQD+VPGCYKTMGMAVMLD IINY
Sbjct  93   KPKEVIHVRAKRGQATDSHSLAERVRREKINEKLRSLQDLVPGCYKTMGMAVMLDVIINY  152

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            VQSLQNQ+EFLSMKL+ AS YYDFN E + +ET+Q   AYE   M++   +GY G S+
Sbjct  153  VQSLQNQIEFLSMKLSAASMYYDFNLERDNMETIQGTNAYEIQDMERMESEGYGGASS  210



>ref|XP_002890272.1| F15H18.11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66531.1| F15H18.11 [Arabidopsis lyrata subsp. lyrata]
Length=1143

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -1

Query  432   VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
             VVHVRARRGQATDSHSLAERVRRGKINERL+CLQD+VPGCYK MGMA MLDEIINYVQSL
Sbjct  1025  VVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSL  1084

Query  252   QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDG  109
             QNQVEFLSMKL  ASS+YDF+SET+ +++MQRAKA E ++M +Q +DG
Sbjct  1085  QNQVEFLSMKLNAASSFYDFSSETDAVDSMQRAKARETVEMGRQTRDG  1132



>ref|XP_006842314.1| hypothetical protein AMTR_s00079p00137860 [Amborella trichopoda]
 gb|ERN03989.1| hypothetical protein AMTR_s00079p00137860 [Amborella trichopoda]
Length=279

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRARRGQATDSHSLAERVRR KINER++CLQD+VPGCYKTMGMAVMLDEIINY
Sbjct  160  KPNEVIHVRARRGQATDSHSLAERVRREKINERMRCLQDLVPGCYKTMGMAVMLDEIINY  219

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            VQSLQ+QVEFLSMKLT ASS +DF+ +T+ IE      ++E   +++ V++GY GL++
Sbjct  220  VQSLQHQVEFLSMKLTAASSLFDFSLDTDAIEAPNGTNSWEVPDVERVVREGYGGLTS  277



>ref|XP_003620453.1| Transcription factor BEE [Medicago truncatula]
 gb|AES76671.1| transcription factor [Medicago truncatula]
Length=263

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 161/265 (61%), Gaps = 27/265 (10%)
 Frame = -1

Query  846  FRQLFPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ  670
             R   P L+ D SME+  QF E N N   +     H LM FS  D  L        F P+
Sbjct  12   IRPSLPFLDSDQSMELLNQFME-NSNMNMM-----HNLMPFSC-DSILEHHQQEHVF-PR  63

Query  669  EYAVN---SLHYEAKTGHRAV------ILPENDALETKMKPADYTTMEscsanssspavS  517
                N    +H+     H AV      I  E + +  + K       +  S+ +S+PAVS
Sbjct  64   NLEENFHGLVHHVNNQNHNAVQLSLPTIFQEENKVHHEGKKRKMMDFQETSSGNSTPAVS  123

Query  516  EIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKC  337
            E G++ K S G+GKR KS E E+ K  EVVHVRARRGQATDSHSLAERVRRGKINE+LKC
Sbjct  124  ESGSKTKLSGGRGKRVKSYETEEEKAKEVVHVRARRGQATDSHSLAERVRRGKINEKLKC  183

Query  336  LQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQR  157
            LQ+IVPGCYKTMGMAVMLDEIINY         FLS+KLT AS+YYDFNSE + +ETMQR
Sbjct  184  LQNIVPGCYKTMGMAVMLDEIINY---------FLSLKLTAASTYYDFNSEADDLETMQR  234

Query  156  AKAYEDMKMQKQVKDGYEGLSTSNP  82
            A+A E  ++ +  +DGY G+S   P
Sbjct  235  ARASEAKELARYKRDGYGGISCFQP  259



>ref|XP_010537455.1| PREDICTED: transcription factor BEE 3 isoform X3 [Tarenaya hassleriana]
Length=256

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EVVHVRARRGQATDSHSLAERVRRGKIN+RL+CLQD+VPGCYKTMGMA MLDEIINY
Sbjct  143  KEREVVHVRARRGQATDSHSLAERVRRGKINDRLRCLQDMVPGCYKTMGMATMLDEIINY  202

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQ  160
            VQSLQNQVEFLSMKLT AS++YDFNSET+ ++++Q
Sbjct  203  VQSLQNQVEFLSMKLTAASTFYDFNSETDAMDSLQ  237



>ref|XP_010677996.1| PREDICTED: transcription factor BEE 3 [Beta vulgaris subsp. vulgaris]
Length=257

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P EVVHVRARRGQATDSHS+AERVRRGKINERL+CLQDIVPGCYKTMGMAVMLDEIINYV
Sbjct  128  PKEVVHVRARRGQATDSHSIAERVRRGKINERLRCLQDIVPGCYKTMGMAVMLDEIINYV  187

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQ  127
            QSLQNQV+FLSMKLT AS ++DFN+E E +E  Q+ K   + + Q
Sbjct  188  QSLQNQVDFLSMKLTAASQFHDFNTEAEPMEKKQKIKGCNNDEAQ  232



>ref|XP_003545405.1| PREDICTED: transcription factor BEE 1-like [Glycine max]
Length=305

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 163/254 (64%), Gaps = 14/254 (6%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ----  670
            FP L++DPSME+  QF  +N     L   +   LM +   D FL   P   EF       
Sbjct  16   FPFLDIDPSMELLNQFIGMN----QLYVLDNSNLMPYFSFDTFLLG-PQEPEFPGNLEED  70

Query  669  -EYAVNSL-HYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrk  496
              +  N + H  A      +   EN+  E K + +    +   S+ +S+P VSE G + K
Sbjct  71   FPFLFNHVNHNNALPISLPIFQAENEIHEGKKRKS--MDLPETSSVNSTPKVSESGNKFK  128

Query  495  hsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPG  316
            HS G+GKR K++  E+ K  EVV+VRAR GQATDS +LAERVRRGKINE+L+ LQ+IVPG
Sbjct  129  HSSGRGKRVKNNVTEEEKAKEVVNVRARSGQATDSRNLAERVRRGKINEKLRYLQNIVPG  188

Query  315  CYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDM  136
            CYKTMGMAVMLDEIINYVQSLQNQVEFLS+KLT  S++YDFNSE + +ETMQRA+A E  
Sbjct  189  CYKTMGMAVMLDEIINYVQSLQNQVEFLSLKLTAPSTFYDFNSEIDALETMQRARASEAK  248

Query  135  KMQKQVKDGYEGLS  94
            ++    ++GY G +
Sbjct  249  ELGMYKREGYGGCA  262



>gb|EYU40766.1| hypothetical protein MIMGU_mgv1a025086mg [Erythranthe guttata]
Length=270

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 101/119 (85%), Gaps = 2/119 (2%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KIN++L+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  144  KPREVVHVRAKRGQATDSHSLAERLRREKINDKLRCLQDLVPGCYKTMGMAVMLDVIINY  203

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKM-QKQVKDGYEGLS  94
            V+SLQNQ++FLSMKL+ AS +YDFN S+ E +E +Q    YE ++M +K V +GY G+S
Sbjct  204  VRSLQNQIDFLSMKLSAASLFYDFNSSDAEAMEALQGTNGYEAVQMVEKLVGEGYGGIS  262



>ref|XP_011078318.1| PREDICTED: transcription factor bHLH75 [Sesamum indicum]
Length=250

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 5/124 (4%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            +VVHVRA+RGQATDSHSLAER+RR KINE+L+CLQD+VPGCYKTMGMAVMLD IINYV+S
Sbjct  127  DVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQDLVPGCYKTMGMAVMLDVIINYVRS  186

Query  255  LQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMK-MQKQVKDGYEGLS---T  91
            LQNQ++FLSMKL+ AS +YDFN SE E +ET+Q +  YE  + M+K V++GY GLS   T
Sbjct  187  LQNQIDFLSMKLSAASLFYDFNSSEAEAMETIQGSSGYEAAQGMEKLVEEGYGGLSHFQT  246

Query  90   SNPF  79
            S P 
Sbjct  247  SWPL  250



>ref|XP_003550247.1| PREDICTED: transcription factor BEE 1-like [Glycine max]
 gb|KHN37086.1| Transcription factor BEE 1 [Glycine soja]
Length=268

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -1

Query  426  HVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQN  247
            + RARRGQATDSH+LAERVRRGKINE+L+ LQ+IVPGCYKTM MAVMLDEIINYVQSLQ+
Sbjct  150  NARARRGQATDSHNLAERVRRGKINEKLRYLQNIVPGCYKTMSMAVMLDEIINYVQSLQH  209

Query  246  QVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNP  82
            QVEFLS++LT AS++YDFNSE +  ETMQR++AYE  ++ K  ++G+ G+S   P
Sbjct  210  QVEFLSLELTAASTFYDFNSEIDAFETMQRSRAYEAKELGKYKREGHGGVSLLQP  264



>ref|XP_010926028.1| PREDICTED: transcription factor bHLH75-like [Elaeis guineensis]
Length=281

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRARRGQATDSHSLAERVRR KINER++CLQD+VPGCYK MGMA MLDEIINY
Sbjct  157  KPGEVVHVRARRGQATDSHSLAERVRREKINERMRCLQDLVPGCYKAMGMAGMLDEIINY  216

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            VQSLQNQVEFLSMKL+ ASS+YD+N + E   T Q   A E   + + +++GY   +T
Sbjct  217  VQSLQNQVEFLSMKLSAASSFYDYNLDLEATATPQVLNACEAHDVDRVLREGYGCCTT  274



>ref|XP_009409985.1| PREDICTED: transcription factor bHLH75-like [Musa acuminata subsp. 
malaccensis]
Length=274

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRARRGQATDSHSLAERVRR KINER++CLQD+VPGCYKTMGMA MLDEIINY
Sbjct  148  KPKEVVHVRARRGQATDSHSLAERVRRRKINERMRCLQDLVPGCYKTMGMAGMLDEIINY  207

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            VQSLQNQVEFLSMKL+ ASS+YD++   E +   Q   AYE  + ++  + G+   ++ +
Sbjct  208  VQSLQNQVEFLSMKLSAASSFYDYSLGVEAVAITQVDGAYEGEEAERAQRKGHGDCTSVH  267

Query  84   PFDQQSF  64
                 SF
Sbjct  268  SISMPSF  274



>ref|XP_007033256.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOY04182.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=256

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRARRGQATDSHSLAERVRR KINE+++CLQD+VPGC+KTMGMAVMLDEIINY
Sbjct  132  KAEEVIHVRARRGQATDSHSLAERVRREKINEKMRCLQDLVPGCHKTMGMAVMLDEIINY  191

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V SLQNQVEFLSM+L  ASS YD N ETE I+  Q   ++   +M+K  +D Y
Sbjct  192  VHSLQNQVEFLSMELAAASSAYDLNLETECIKKAQGTNSHAAQQMEKWARDRY  244



>gb|KHN15301.1| Transcription factor BEE 1 [Glycine soja]
Length=270

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 167/264 (63%), Gaps = 18/264 (7%)
 Frame = -1

Query  834  FPLLNVDPSMEVA-QFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSAAEFSPQ----  670
            FP L++DPSME+  QF  +N     L   +   LM +   D FL   P   EF       
Sbjct  16   FPFLDIDPSMELLNQFIGMN----QLYVLDNSNLMPYFSFDTFLLG-PQEPEFPGNLEED  70

Query  669  -EYAVNSL-HYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTrrk  496
              +  N + H  A      +   EN+  E K + +    +   S+ +S+P VSE G + K
Sbjct  71   FPFLFNHVNHNNALPISLPIFQAENEIHEGKKRKS--MDLPETSSVNSTPKVSESGNKFK  128

Query  495  hsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPG  316
            HS G+GKR K++  E+ K  EVV+VRAR GQATDS +LAERVRRGKINE+L+ LQ+IVPG
Sbjct  129  HSSGRGKRVKNNVTEEEKAKEVVNVRARSGQATDSRNLAERVRRGKINEKLRYLQNIVPG  188

Query  315  CYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDM  136
            CYKTMGMAVMLDEIINY QSLQ+QVEFLS+KLT  S++Y FNSE + +ETMQRA+A E  
Sbjct  189  CYKTMGMAVMLDEIINYAQSLQHQVEFLSLKLTAPSTFYGFNSEIDALETMQRARASEAK  248

Query  135  KMQKQVKDGYEGLSTSNPFDQQSF  64
            ++    ++GY G+S    F QQ++
Sbjct  249  ELGMYKREGYGGVS----FFQQTW  268



>ref|XP_010681492.1| PREDICTED: transcription factor bHLH75-like [Beta vulgaris subsp. 
vulgaris]
Length=257

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +V+HVRA+RGQATDSHSLAERVRR +INE+LK LQD+VPGCYKTMGMAVMLD IINY
Sbjct  130  KPKDVIHVRAKRGQATDSHSLAERVRRERINEKLKVLQDLVPGCYKTMGMAVMLDVIINY  189

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQV-KDGYEG---  100
            V+SLQNQ+EFLSMKL+ AS +YDFNS E E IET+QR     D +  ++V K+GY G   
Sbjct  190  VRSLQNQIEFLSMKLSAASMFYDFNSPEAEAIETLQRTTNPCDAEETERVAKEGYGGMLP  249

Query  99   -LSTSNPF  79
             L +S PF
Sbjct  250  KLHSSWPF  257



>ref|XP_004299055.1| PREDICTED: transcription factor bHLH75-like [Fragaria vesca subsp. 
vesca]
Length=235

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR KIN+RL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  107  KPKEVIHVRAKRGQATDSHSLAERVRREKINDRLRCLQNLVPGCYKTMGMAVMLDVVISY  166

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS--ETEIIETMQRAKAYEDMKMQKQVKDGYEGLST  91
            VQSLQNQ+EFLSMKL+ AS+YYDFNS    + ++TMQ   AYE  +   + + GY G   
Sbjct  167  VQSLQNQIEFLSMKLSAASAYYDFNSPGHADPVDTMQGTNAYEVQENMVRSEQGYGG---  223

Query  90   SNPFDQQS  67
              PF Q +
Sbjct  224  GLPFSQST  231



>ref|XP_008807118.1| PREDICTED: transcription factor bHLH75-like [Phoenix dactylifera]
Length=252

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 141/259 (54%), Gaps = 30/259 (12%)
 Frame = -1

Query  819  VDPSMEV-AQFPELNPNFGDLSGPNFHTLMGFSQQDQF-----LSQVPSAAEFSPQEYAV  658
            +DPS+E+  QFPELN    +    +   LMGF  ++ +     +    S + F P E A 
Sbjct  1    MDPSLELMGQFPELNGTAVECCYSSM-GLMGFPSENYYQPEFSMPLADSLSSFLPLECAK  59

Query  657  NSLHYEAKTGHR----------AVILPENDALETKMKPADYTTMEscsanssspavSEIG  508
             +      T  R          A   PE  +  +   P +    +  S   +     + G
Sbjct  60   PNTASRPVTADRERGPGDRKRKAKAAPETSSTNSSEPPTESLLRDDKSKKKNVSGNVKRG  119

Query  507  TrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQD  328
             +    V              KP EVVHVRARRGQATDSHSLAERVRR +INER++CLQD
Sbjct  120  RKNSEEVE-------------KPKEVVHVRARRGQATDSHSLAERVRRERINERMRCLQD  166

Query  327  IVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            +VPGCYK MGMA MLDEIINYVQSLQNQVEFLSMKL+ ASS+YD+N + E   T Q   A
Sbjct  167  LVPGCYKAMGMAGMLDEIINYVQSLQNQVEFLSMKLSAASSFYDYNLDLEATATPQVVNA  226

Query  147  YEDMKMQKQVKDGYEGLST  91
            +E   + + +++ Y   +T
Sbjct  227  FEAHDVDRVLRERYGCCTT  245



>ref|XP_010916401.1| PREDICTED: transcription factor bHLH75-like isoform X2 [Elaeis 
guineensis]
Length=269

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 120/268 (45%), Positives = 165/268 (62%), Gaps = 25/268 (9%)
 Frame = -1

Query  852  DHFRQL---FPLLNVDPSMEV--AQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSA  688
            D+F  L    P + +DPS E+  A F ELN    D+   +   LMGFS ++  LS +P  
Sbjct  6    DNFNCLKPSLPFVEMDPSFELMMAHFAELNGT--DMENSS-EGLMGFSSEN-CLSHLP--  59

Query  687  AEFSPQEYAVNSLHYEAKTGHRAVILPENDALET---------KMKPADYTTMEscsans  535
             EFS   +A N   + +    + + + +  A +          K K A  T+  + S   
Sbjct  60   -EFS-MPFADNLPSFLSPECAKPITISQPVASDGEQSHGDRKRKAKAAPETSSANSSEPR  117

Query  534  sspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKI  355
            +   + +  +++K   G  KR++S+ +E  KP EVVHVRARRGQATDSHSLAERVRR +I
Sbjct  118  TQSCIRDDKSKKKTGSGSVKRRRSNSKEVEKPKEVVHVRARRGQATDSHSLAERVRRERI  177

Query  354  NERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            NE+++CLQD+VPGCYK MGMA MLDEIINYVQSLQNQVEFLSMKL+ ASS+YD++ E E 
Sbjct  178  NEKMRCLQDLVPGCYKAMGMAGMLDEIINYVQSLQNQVEFLSMKLSAASSFYDYSLELEA  237

Query  174  IETMQRAKAYEDMKMQKQVKDGYEGLST  91
            + T Q  +A E   M +  ++GY G ++
Sbjct  238  MATPQVGEAQE---MGRVGREGYGGCTS  262



>ref|XP_009602728.1| PREDICTED: transcription factor BEE 1-like [Nicotiana tomentosiformis]
Length=279

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+CLQ++VPGCYKTMGMAVMLD IINY
Sbjct  154  KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQELVPGCYKTMGMAVMLDVIINY  213

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKMQKQVKDGYEGL  97
            V+SLQNQ++FLSMKL+ AS +YDFN SE + +++MQ    Y    M K V +GY G+
Sbjct  214  VRSLQNQIDFLSMKLSAASLFYDFNSSEMDDMDSMQGTNGYAAQGMGKIVGEGYGGV  270



>ref|XP_009779032.1| PREDICTED: transcription factor bHLH75-like [Nicotiana sylvestris]
Length=277

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+CLQ++VPGCYKTMGMAVMLD IINY
Sbjct  151  KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQELVPGCYKTMGMAVMLDVIINY  210

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V+SLQNQ++FLSMKL+ AS +YDFN SE + +++MQ    Y    M K V +GY
Sbjct  211  VRSLQNQIDFLSMKLSAASLFYDFNSSEMDDMDSMQGTNGYAAQGMGKIVGEGY  264



>ref|XP_008797805.1| PREDICTED: transcription factor bHLH75-like [Phoenix dactylifera]
Length=271

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRARRGQATDSHSLAERVRR +INE+++CLQD+VPGCYK MGMA MLDEIINY
Sbjct  147  KPKEVVHVRARRGQATDSHSLAERVRRERINEKMRCLQDLVPGCYKAMGMAGMLDEIINY  206

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS-  88
            VQSLQNQVEFLSMKL+ ASS+YD + + E + T Q   A E   +++   + Y G  TS 
Sbjct  207  VQSLQNQVEFLSMKLSAASSFYDCSLDLEPMATPQVGDACEAQDVERARTEAY-GWCTSF  265

Query  87   ---NPF  79
               NPF
Sbjct  266  HSTNPF  271



>emb|CDY36107.1| BnaA08g19410D [Brassica napus]
Length=224

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 98/122 (80%), Gaps = 4/122 (3%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVML+ II+Y
Sbjct  98   KPRDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLEVIIDY  157

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTS  88
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +T Q    Y   +M++ ++   EG+ T 
Sbjct  158  VRSLQNQIEFLSMKLSAASAYYDLNSLDIEPTDTFQGGNMYSAEEMERILR---EGVGTQ  214

Query  87   NP  82
             P
Sbjct  215  TP  216



>ref|XP_009797954.1| PREDICTED: transcription factor bHLH75-like isoform X3 [Nicotiana 
sylvestris]
Length=219

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+ LQ++VPGCYKTMGMAVMLD IINY
Sbjct  92   KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRSLQELVPGCYKTMGMAVMLDVIINY  151

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAK-AYEDMKMQKQVKDGYEGLST  91
            V+SLQNQ++FLS+KL+ AS +YDFN SE E +++MQ+ K  YE   M K   +GY G   
Sbjct  152  VRSLQNQIDFLSLKLSAASLFYDFNSSEMEAMDSMQQGKNVYEAQGMGKIDGEGYGGFPH  211

Query  90   SNPFDQQSFGCYPSL  46
              P        +PSL
Sbjct  212  FQP-------SWPSL  219



>ref|XP_010660417.1| PREDICTED: transcription factor bHLH75-like isoform X1 [Vitis 
vinifera]
Length=297

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRARRGQATD+HS+AERVRR KI  RL+CLQD+VPGCYK  GMAVMLDEIINY
Sbjct  173  KPDEVIHVRARRGQATDNHSIAERVRREKIKTRLRCLQDLVPGCYKNKGMAVMLDEIINY  232

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V SLQNQVEFLS +L  ASS ++FNSETE I+  Q    +E  +M+K V+ GY
Sbjct  233  VHSLQNQVEFLSRELAAASSLHNFNSETEAIKNAQGTNTHEGQEMEKIVRKGY  285



>ref|XP_006360470.1| PREDICTED: transcription factor bHLH75-like, partial [Solanum 
tuberosum]
Length=137

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 100/128 (78%), Gaps = 6/128 (5%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+CLQ++VPGCYKTMGMAVMLD IINY
Sbjct  10   KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQELVPGCYKTMGMAVMLDVIINY  69

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMK-MQKQ-VKDGYEG--  100
            V+SLQNQ++FLSMKL+ AS +YDFN SE + +++MQ    Y   + M K  V +GY G  
Sbjct  70   VRSLQNQIDFLSMKLSAASLFYDFNSSEMDDMDSMQGTNGYAAAQGMGKNTVGEGYGGFP  129

Query  99   -LSTSNPF  79
               TS P 
Sbjct  130  QFQTSWPL  137



>emb|CBI33645.3| unnamed protein product [Vitis vinifera]
Length=319

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRARRGQATD+HS+AERVRR KI  RL+CLQD+VPGCYK  GMAVMLDEIINY
Sbjct  195  KPDEVIHVRARRGQATDNHSIAERVRREKIKTRLRCLQDLVPGCYKNKGMAVMLDEIINY  254

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V SLQNQVEFLS +L  ASS ++FNSETE I+  Q    +E  +M+K V+ GY
Sbjct  255  VHSLQNQVEFLSRELAAASSLHNFNSETEAIKNAQGTNTHEGQEMEKIVRKGY  307



>emb|CDY24404.1| BnaCnng04710D [Brassica napus]
Length=224

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVML+ II+Y
Sbjct  98   KPRDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLEVIIDY  157

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +T Q    Y   +M+K +++
Sbjct  158  VRSLQNQIEFLSMKLSAASAYYDLNSLDIEPTDTFQGGNMYSAEEMEKILRE  209



>ref|XP_009797953.1| PREDICTED: transcription factor bHLH75-like isoform X2 [Nicotiana 
sylvestris]
Length=261

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+ LQ++VPGCYKTMGMAVMLD IINY
Sbjct  134  KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRSLQELVPGCYKTMGMAVMLDVIINY  193

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAK-AYEDMKMQKQVKDGYEGLST  91
            V+SLQNQ++FLS+KL+ AS +YDFN SE E +++MQ+ K  YE   M K   +GY G   
Sbjct  194  VRSLQNQIDFLSLKLSAASLFYDFNSSEMEAMDSMQQGKNVYEAQGMGKIDGEGYGGFPH  253

Query  90   SNPFDQQSFGCYPSL  46
              P        +PSL
Sbjct  254  FQP-------SWPSL  261



>ref|XP_009797952.1| PREDICTED: transcription factor bHLH75-like isoform X1 [Nicotiana 
sylvestris]
Length=262

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+ LQ++VPGCYKTMGMAVMLD IINY
Sbjct  135  KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRSLQELVPGCYKTMGMAVMLDVIINY  194

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAK-AYEDMKMQKQVKDGYEGLST  91
            V+SLQNQ++FLS+KL+ AS +YDFN SE E +++MQ+ K  YE   M K   +GY G   
Sbjct  195  VRSLQNQIDFLSLKLSAASLFYDFNSSEMEAMDSMQQGKNVYEAQGMGKIDGEGYGGFPH  254

Query  90   SNPFDQQSFGCYPSL  46
              P        +PSL
Sbjct  255  FQP-------SWPSL  262



>ref|XP_010916400.1| PREDICTED: transcription factor BEE 1-like isoform X1 [Elaeis 
guineensis]
Length=275

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 153/245 (62%), Gaps = 22/245 (9%)
 Frame = -1

Query  852  DHFRQL---FPLLNVDPSMEV--AQFPELNPNFGDLSGPNFHTLMGFSQQDQFLSQVPSA  688
            D+F  L    P + +DPS E+  A F ELN    D+   +   LMGFS ++  LS +P  
Sbjct  6    DNFNCLKPSLPFVEMDPSFELMMAHFAELNGT--DMENSS-EGLMGFSSEN-CLSHLP--  59

Query  687  AEFSPQEYAVNSLHYEAKTGHRAVILPENDALE---------TKMKPADYTTMEscsans  535
             EFS   +A N   + +    + + + +  A +          K K A  T+  + S   
Sbjct  60   -EFS-MPFADNLPSFLSPECAKPITISQPVASDGEQSHGDRKRKAKAAPETSSANSSEPR  117

Query  534  sspavSEIGTrrkhsvgkgkrkksseeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKI  355
            +   + +  +++K   G  KR++S+ +E  KP EVVHVRARRGQATDSHSLAERVRR +I
Sbjct  118  TQSCIRDDKSKKKTGSGSVKRRRSNSKEVEKPKEVVHVRARRGQATDSHSLAERVRRERI  177

Query  354  NERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            NE+++CLQD+VPGCYK MGMA MLDEIINYVQSLQNQVEFLSMKL+ ASS+YD++ E E 
Sbjct  178  NEKMRCLQDLVPGCYKAMGMAGMLDEIINYVQSLQNQVEFLSMKLSAASSFYDYSLELEA  237

Query  174  IETMQ  160
            + T Q
Sbjct  238  MATPQ  242



>ref|XP_009415914.1| PREDICTED: transcription factor BEE 1-like [Musa acuminata subsp. 
malaccensis]
Length=248

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 1/98 (1%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRARRGQATDSHSLAERVRR KINER++CLQD+VPGCYKTMGMA +LDEIINYVQS
Sbjct  135  EVVHVRARRGQATDSHSLAERVRRKKINERMRCLQDLVPGCYKTMGMAGVLDEIINYVQS  194

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYE  142
            LQNQVEFLSM+L+ ASS+YD+    E I T Q A+AYE
Sbjct  195  LQNQVEFLSMRLSAASSFYDYGMGVEAITTNQ-AEAYE  231



>ref|XP_009109880.1| PREDICTED: transcription factor bHLH75 [Brassica rapa]
Length=224

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVML+ II+Y
Sbjct  98   KARDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLEVIIDY  157

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKDG  109
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +T Q    Y   +M++ +++G
Sbjct  158  VRSLQNQIEFLSMKLSAASAYYDLNSLDIEPTDTFQGGNMYSAEEMERILREG  210



>ref|XP_008243254.1| PREDICTED: transcription factor bHLH75-like isoform X4 [Prunus 
mume]
Length=230

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  99   KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKTMGMAVMLDVVISY  158

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRA---KAYEDMKMQKQVKDGYEG  100
            VQSLQNQ+EFLSMKL+ AS YYDFNS   + ++TMQ+     AY +++ +    +GY G
Sbjct  159  VQSLQNQIEFLSMKLSAASVYYDFNSPGVDALDTMQQQGTNNAYGEVQEEMVRSEGYGG  217



>ref|XP_008243253.1| PREDICTED: transcription factor bHLH75-like isoform X3 [Prunus 
mume]
Length=231

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 4/119 (3%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  100  KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKTMGMAVMLDVVISY  159

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRA---KAYEDMKMQKQVKDGYEG  100
            VQSLQNQ+EFLSMKL+ AS YYDFNS   + ++TMQ+     AY +++ +    +GY G
Sbjct  160  VQSLQNQIEFLSMKLSAASVYYDFNSPGVDALDTMQQQGTNNAYGEVQEEMVRSEGYGG  218



>ref|XP_004236997.1| PREDICTED: transcription factor bHLH75 [Solanum lycopersicum]
Length=296

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KINE+L+CLQ++VPGCYKTMGMAVMLD IINY
Sbjct  169  KPREVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQELVPGCYKTMGMAVMLDVIINY  228

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN-SETEIIETMQRAKAYEDMK-MQKQ-VKDGYEGL  97
            V+SLQNQ++FLSMKL+ AS +YDFN SE + +++MQ    Y   + M K  V +GY G 
Sbjct  229  VRSLQNQIDFLSMKLSAASLFYDFNSSEMDDMDSMQGTNGYAAAQGMGKNIVGEGYGGF  287



>ref|XP_007223899.1| hypothetical protein PRUPE_ppa010885mg [Prunus persica]
 gb|EMJ25098.1| hypothetical protein PRUPE_ppa010885mg [Prunus persica]
Length=232

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 96/119 (81%), Gaps = 4/119 (3%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  100  KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKTMGMAVMLDVVISY  159

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQR---AKAYEDMKMQKQVKDGYEG  100
            VQSLQNQ+EFLSMKL+ AS YYDFN+   + ++TMQ+     AY +++ +     GY G
Sbjct  160  VQSLQNQIEFLSMKLSAASVYYDFNAPGVDALDTMQQLGTNNAYGEVQEEMVRSGGYGG  218



>ref|XP_006415858.1| hypothetical protein EUTSA_v10008699mg [Eutrema salsugineum]
 gb|ESQ34211.1| hypothetical protein EUTSA_v10008699mg [Eutrema salsugineum]
Length=226

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINE+LKCLQD+VPGCYKTMGMAVML+ II+Y
Sbjct  98   KPRDVVHVRAKRGQATDSHSLAERVRREKINEKLKCLQDLVPGCYKTMGMAVMLEVIIDY  157

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +  Q    Y   +M+K +++
Sbjct  158  VRSLQNQIEFLSMKLSVASAYYDLNSLDIEPTDMYQGGNMYGAEEMEKILRE  209



>ref|XP_009380294.1| PREDICTED: transcription factor BEE 3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380295.1| PREDICTED: transcription factor BEE 3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380297.1| PREDICTED: transcription factor BEE 3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380298.1| PREDICTED: transcription factor BEE 3-like [Musa acuminata subsp. 
malaccensis]
Length=290

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRARRGQATDSHSLAERVRR +INER++CLQ +VPGCYK MGMA MLDEIINYVQS
Sbjct  169  EVVHVRARRGQATDSHSLAERVRRERINERMRCLQGLVPGCYKAMGMAGMLDEIINYVQS  228

Query  255  LQNQVEFLSMKLTEASSYYD--FNSETEIIETMQRAKAYE-DMKMQKQVKDGYEGLSTSN  85
            LQNQVEFLS+KL+ ASS+YD  F+   E + T+Q     E D    + V++ Y G +T  
Sbjct  229  LQNQVEFLSLKLSAASSFYDCCFDMGMETLSTLQAGDGQETDEAAVRPVREEYGGCTTGF  288

Query  84   PF  79
            P 
Sbjct  289  PL  290



>ref|XP_007223898.1| hypothetical protein PRUPE_ppa010885mg [Prunus persica]
 gb|EMJ25097.1| hypothetical protein PRUPE_ppa010885mg [Prunus persica]
Length=208

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  100  KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKTMGMAVMLDVVISY  159

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQ  160
            VQSLQNQ+EFLSMKL+ AS YYDFN+   + ++TMQ
Sbjct  160  VQSLQNQIEFLSMKLSAASVYYDFNAPGVDALDTMQ  195



>gb|KDP32956.1| hypothetical protein JCGZ_12987 [Jatropha curcas]
Length=280

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/257 (42%), Positives = 147/257 (57%), Gaps = 38/257 (15%)
 Frame = -1

Query  795  QFPELNPNFGDLSGPNFHTLMGF-------SQQDQFLSQVPSAAEFSPQEYAVNSLH---  646
            Q PELNPN  ++S  +  + +         +Q DQF           P  YA NSL    
Sbjct  31   QLPELNPNTFNISDFSLDSFLAHHHHHHCHTQPDQF-----------PANYAHNSLSNAL  79

Query  645  ------------YEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspavSEIGTr  502
                        +   +     I P+N+    K + A+  +       S S +     T+
Sbjct  80   NHPDILNSAHILHSVNSASSQNIFPDNN----KKRKAEAQSTSGSQICSPSASTVITSTK  135

Query  501  rkhsvgkgkrkksseeEDTKPME-VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDI  325
            +K+++ KGK+ K+ E    + ME V+HVRA+RGQATDSHS+AERVRR KIN++L+CLQD+
Sbjct  136  KKNNLDKGKKWKNKERGGVEKMEEVIHVRAKRGQATDSHSIAERVRREKINKKLRCLQDL  195

Query  324  VPGCYKTMGMAVMLDEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAY  145
            VPGC+K+MGMAVML+EIINYV SLQNQVEFLSM+L  AS  YD N ETE  + +Q   + 
Sbjct  196  VPGCHKSMGMAVMLEEIINYVHSLQNQVEFLSMELAAASCCYDLNLETESSKKVQVTSSS  255

Query  144  EDMKMQKQVKDGYEGLS  94
               + QK +++GY  LS
Sbjct  256  GAQETQKWLREGYGELS  272



>ref|XP_010499123.1| PREDICTED: transcription factor bHLH75-like isoform X2 [Camelina 
sativa]
Length=222

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVMLD II+Y
Sbjct  99   KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLDVIIDY  158

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS  187
            V+SLQNQ+EFLS KL+ AS+YYD NS
Sbjct  159  VRSLQNQIEFLSTKLSAASAYYDLNS  184



>ref|XP_010499122.1| PREDICTED: transcription factor bHLH75-like isoform X1 [Camelina 
sativa]
Length=225

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVMLD II+Y
Sbjct  102  KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLDVIIDY  161

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS  187
            V+SLQNQ+EFLS KL+ AS+YYD NS
Sbjct  162  VRSLQNQIEFLSTKLSAASAYYDLNS  187



>ref|XP_006303530.1| hypothetical protein CARUB_v10010961mg [Capsella rubella]
 gb|EOA36428.1| hypothetical protein CARUB_v10010961mg [Capsella rubella]
Length=227

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVMLD II Y
Sbjct  101  KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLDVIIEY  160

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS  187
            V+SL+NQ+EFLSMKL+ AS+YYD NS
Sbjct  161  VRSLENQIEFLSMKLSAASAYYDLNS  186



>gb|AAG28811.2|AC079374_14 helix-loop-helix protein homolog, putative [Arabidopsis thaliana]
Length=166

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYK MGMAVMLD II+Y
Sbjct  40   KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKAMGMAVMLDVIIDY  99

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+ YD NS + E  +  Q    +   +M++ +++
Sbjct  100  VRSLQNQIEFLSMKLSAASACYDLNSLDIEPTDIFQGGNIHSAAEMERILRE  151



>ref|XP_008339657.1| PREDICTED: transcription factor bHLH75-like [Malus domestica]
Length=242

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 8/127 (6%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYKTMGMAVMLD +I+Y
Sbjct  107  KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKTMGMAVMLDVVISY  166

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAK----AY---EDMKMQKQVKDG  109
            VQSLQ Q+EFLSMKL+ AS+YYDFNS   +  + MQ+ +    AY   ++M ++ +++ G
Sbjct  167  VQSLQKQIEFLSMKLSAASAYYDFNSPGVDAADAMQQQQGTNTAYHEVQEMAVRSEIQKG  226

Query  108  YEGLSTS  88
             E   TS
Sbjct  227  MEDFLTS  233



>ref|XP_010477946.1| PREDICTED: transcription factor bHLH75-like [Camelina sativa]
Length=210

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR +INERLKCLQD+VPGCYKTMGMAVMLD II+Y
Sbjct  87   KPKDVVHVRAKRGQATDSHSLAERVRRERINERLKCLQDLVPGCYKTMGMAVMLDVIIDY  146

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS  187
            V+SLQNQ+EFLS KL+ AS+YYD NS
Sbjct  147  VRSLQNQIEFLSTKLSAASAYYDLNS  172



>ref|XP_008389280.1| PREDICTED: transcription factor bHLH75-like isoform X1 [Malus 
domestica]
Length=238

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 98/125 (78%), Gaps = 5/125 (4%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAER+RR KINERL+CLQ++VPGCYKTMGMAVMLD + +Y
Sbjct  108  KLKEVIHVRAKRGQATDSHSLAERLRREKINERLRCLQNLVPGCYKTMGMAVMLDVVCSY  167

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSE-TEIIETMQR----AKAYEDMKMQKQVKDGYEG  100
            VQSLQNQ+EFLSMKL+ AS+YYDFN+   + ++ MQ+    + AY +++      +GY G
Sbjct  168  VQSLQNQIEFLSMKLSAASAYYDFNTPGVDAVDAMQQQQGTSTAYPEVQEMVVRSEGYGG  227

Query  99   LSTSN  85
            L   N
Sbjct  228  LPHYN  232



>ref|XP_009356252.1| PREDICTED: transcription factor bHLH75-like [Pyrus x bretschneideri]
Length=238

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 97/121 (80%), Gaps = 5/121 (4%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAER+RR KINERL+CLQ++VPGCYKTMGMAVMLD + +Y
Sbjct  108  KLKEVIHVRAKRGQATDSHSLAERLRREKINERLRCLQNLVPGCYKTMGMAVMLDVVCSY  167

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQR----AKAYEDMKMQKQVKDGYEG  100
            VQSLQNQ+EFLSMKL+ AS+YYDFN+   + ++ MQ+    + AY +++      +GY G
Sbjct  168  VQSLQNQIEFLSMKLSAASAYYDFNTPGVDAVDAMQQQQGTSTAYPEVQEMVVRSEGYGG  227

Query  99   L  97
            L
Sbjct  228  L  228



>ref|XP_010099250.1| hypothetical protein L484_015439 [Morus notabilis]
 gb|EXB77514.1| hypothetical protein L484_015439 [Morus notabilis]
Length=185

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EV+HVRA+RGQATDSHSLAERVRR KINERLKCLQ +VPGCYKTMGMAVMLD +I+YVQS
Sbjct  61   EVIHVRAKRGQATDSHSLAERVRRKKINERLKCLQTLVPGCYKTMGMAVMLDVVISYVQS  120

Query  255  LQNQVEFLSMKLTEASSYYDFNS  187
            LQNQ+EFLSMKL+ AS YYDF+S
Sbjct  121  LQNQIEFLSMKLSAASMYYDFSS  143



>ref|NP_564229.1| transcription factor CESTA [Arabidopsis thaliana]
 sp|A4D998.1|BH075_ARATH RecName: Full=Transcription factor bHLH75; AltName: Full=Basic 
helix-loop-helix protein 75; Short=AtbHLH75; Short=bHLH 75; 
AltName: Full=Transcription factor EN 78; AltName: Full=bHLH 
transcription factor bHLH075 [Arabidopsis thaliana]
 gb|AAM67191.1| helix-loop-helix protein homolog, putative [Arabidopsis thaliana]
 dbj|BAD43520.1| putative bHLH transcription factor (bHLH075) [Arabidopsis thaliana]
 gb|ABE65654.1| basic helix-loop-helix family protein [Arabidopsis thaliana]
 gb|AEE30607.1| transcription factor bHLH75 [Arabidopsis thaliana]
Length=223

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYK MGMAVMLD II+Y
Sbjct  97   KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKAMGMAVMLDVIIDY  156

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+ YD NS + E  +  Q    +   +M++ +++
Sbjct  157  VRSLQNQIEFLSMKLSAASACYDLNSLDIEPTDIFQGGNIHSAAEMERILRE  208



>gb|ABK28414.1| unknown [Arabidopsis thaliana]
Length=224

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 91/112 (81%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQATDSHSLAERVRR KINERLKCLQD+VPGCYK MGMAVMLD II+Y
Sbjct  97   KPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKAMGMAVMLDVIIDY  156

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+ YD NS + E  +  Q    +   +M++ +++
Sbjct  157  VRSLQNQIEFLSMKLSAASACYDLNSLDIEPTDIFQGGNIHSAAEMERILRE  208



>ref|XP_010462908.1| PREDICTED: transcription factor bHLH75-like [Camelina sativa]
Length=211

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP +VVHVRA+RGQAT+SHSLAERVRR KINERLKCLQD+VPGCYKTMGMAVMLD II+Y
Sbjct  88   KPKDVVHVRAKRGQATESHSLAERVRREKINERLKCLQDLVPGCYKTMGMAVMLDVIIDY  147

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS  187
            V+SLQNQ+EFLS KL+ AS+YYD NS
Sbjct  148  VRSLQNQIEFLSTKLSAASAYYDLNS  173



>ref|XP_008243252.1| PREDICTED: transcription factor bHLH75-like isoform X2 [Prunus 
mume]
Length=234

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 8/123 (7%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK----TMGMAVMLDE  277
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYK    TMGMAVMLD 
Sbjct  99   KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKVGEVTMGMAVMLDV  158

Query  276  IINYVQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRA---KAYEDMKMQKQVKDG  109
            +I+YVQSLQNQ+EFLSMKL+ AS YYDFNS   + ++TMQ+     AY +++ +    +G
Sbjct  159  VISYVQSLQNQIEFLSMKLSAASVYYDFNSPGVDALDTMQQQGTNNAYGEVQEEMVRSEG  218

Query  108  YEG  100
            Y G
Sbjct  219  YGG  221



>ref|XP_008243251.1| PREDICTED: transcription factor bHLH75-like isoform X1 [Prunus 
mume]
Length=235

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 8/123 (7%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYK----TMGMAVMLDE  277
            K  EV+HVRA+RGQATDSHSLAERVRR KINERL+CLQ++VPGCYK    TMGMAVMLD 
Sbjct  100  KLKEVIHVRAKRGQATDSHSLAERVRREKINERLRCLQNLVPGCYKVGEVTMGMAVMLDV  159

Query  276  IINYVQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRA---KAYEDMKMQKQVKDG  109
            +I+YVQSLQNQ+EFLSMKL+ AS YYDFNS   + ++TMQ+     AY +++ +    +G
Sbjct  160  VISYVQSLQNQIEFLSMKLSAASVYYDFNSPGVDALDTMQQQGTNNAYGEVQEEMVRSEG  219

Query  108  YEG  100
            Y G
Sbjct  220  YGG  222



>emb|CDP00640.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAER+RR KIN++L+CLQD+VPGCYK+MGMAVMLD IINY
Sbjct  135  KPKEVVHVRAKRGQATDSHSLAERMRREKINQKLRCLQDLVPGCYKSMGMAVMLDVIINY  194

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYE-DMKMQKQVKDGY  106
            V+SLQNQ++FLSMKL+ AS +YDFNS + + +   Q    +     ++K V +GY
Sbjct  195  VRSLQNQIDFLSMKLSAASLFYDFNSLDMDAVPPTQACANFPVPQGLEKMVGEGY  249



>gb|EPS58961.1| hypothetical protein M569_15851, partial [Genlisea aurea]
Length=107

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 82/92 (89%), Gaps = 1/92 (1%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EVVHVRA+RGQATDSHSLAER+RR KINE+L+CLQD+VPGCYKTM MA MLD IINYV+S
Sbjct  16   EVVHVRAKRGQATDSHSLAERLRREKINEKLRCLQDLVPGCYKTMRMAGMLDVIINYVRS  75

Query  255  LQNQVEFLSMKLTEASSYYDFN-SETEIIETM  163
            LQNQ++FLSMKL+ AS +YDFN SE E +E +
Sbjct  76   LQNQIDFLSMKLSAASLFYDFNSSEAEAMEAL  107



>ref|XP_010660418.1| PREDICTED: transcription factor BEE 1-like isoform X2 [Vitis 
vinifera]
Length=272

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRARRGQATD+HS+AERVRR KI  RL+CLQD+VPGCYK  GMAVMLDEIINY
Sbjct  173  KPDEVIHVRARRGQATDNHSIAERVRREKIKTRLRCLQDLVPGCYKNKGMAVMLDEIINY  232

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQ  160
            V SLQNQVEFLS +L  ASS ++FNSETE I+  Q
Sbjct  233  VHSLQNQVEFLSRELAAASSLHNFNSETEAIKNAQ  267



>ref|XP_008389281.1| PREDICTED: transcription factor bHLH75-like isoform X2 [Malus 
domestica]
Length=231

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHSLAER+RR KINERL+CLQ++VPGCYKTMGMAVMLD + +Y
Sbjct  108  KLKEVIHVRAKRGQATDSHSLAERLRREKINERLRCLQNLVPGCYKTMGMAVMLDVVCSY  167

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQR  157
            VQSLQNQ+EFLSMKL+ AS+YYDFN+   + ++ MQ+
Sbjct  168  VQSLQNQIEFLSMKLSAASAYYDFNTPGVDAVDAMQQ  204



>ref|XP_006383447.1| hypothetical protein POPTR_0005s15590g [Populus trichocarpa]
 gb|ERP61244.1| hypothetical protein POPTR_0005s15590g [Populus trichocarpa]
Length=265

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHS+AERVRR KIN +L+CLQD+VPGC+++MGMAVML+EIINY
Sbjct  141  KAEEVIHVRAKRGQATDSHSIAERVRREKINNKLRCLQDLVPGCHRSMGMAVMLEEIINY  200

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V SLQNQVEFLSM+L  ASS  D N+ TE  +  Q   + E  K QK +++ Y
Sbjct  201  VHSLQNQVEFLSMELAAASSSNDLNNLTESSKRAQGTDSTEAQKTQKWLRERY  253



>gb|KFK44530.1| hypothetical protein AALP_AA1G268600 [Arabis alpina]
Length=224

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  +VVHVRA+RGQATDSHSLAERVRR KIN+RL+ LQD+VPGCYK MGMAVMLD II+Y
Sbjct  98   KTRDVVHVRAKRGQATDSHSLAERVRREKINDRLRSLQDLVPGCYKAMGMAVMLDVIIDY  157

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +  Q    Y   +M++ +++
Sbjct  158  VRSLQNQIEFLSMKLSAASAYYDLNSLDIEPTDMFQGGNTYSAEEMERILRE  209



>gb|KFK44529.1| hypothetical protein AALP_AA1G268600 [Arabis alpina]
Length=227

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  +VVHVRA+RGQATDSHSLAERVRR KIN+RL+ LQD+VPGCYK MGMAVMLD II+Y
Sbjct  101  KTRDVVHVRAKRGQATDSHSLAERVRREKINDRLRSLQDLVPGCYKAMGMAVMLDVIIDY  160

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNS-ETEIIETMQRAKAYEDMKMQKQVKD  112
            V+SLQNQ+EFLSMKL+ AS+YYD NS + E  +  Q    Y   +M++ +++
Sbjct  161  VRSLQNQIEFLSMKLSAASAYYDLNSLDIEPTDMFQGGNTYSAEEMERILRE  212



>ref|XP_011021250.1| PREDICTED: transcription factor bHLH75-like [Populus euphratica]
Length=265

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQ TDSHS+AERVRR KIN +L+CLQD+VPGC+++MGMAVML+EIINY
Sbjct  141  KAEEVIHVRAKRGQETDSHSIAERVRREKINNKLRCLQDLVPGCHRSMGMAVMLEEIINY  200

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
            V SLQNQVEFLSM+L  ASS  D N+ TE  +  Q   + E  K QK +++ Y
Sbjct  201  VHSLQNQVEFLSMELAAASSSNDLNNVTESSKRAQGTDSTEAQKTQKWLRERY  253



>ref|XP_002533944.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28430.1| DNA binding protein, putative [Ricinus communis]
Length=267

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            V+HVRA+RGQATDSHS+AERVRR KIN +L+CLQD+VPGC+K+MGMAVML+EIINYV SL
Sbjct  146  VIHVRAKRGQATDSHSIAERVRREKINNKLRCLQDLVPGCHKSMGMAVMLEEIINYVHSL  205

Query  252  QNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGL  97
            QNQVEFLSM+L  AS  YD N ETE  +  Q   +    + QK +++ Y  L
Sbjct  206  QNQVEFLSMELAAASCSYDLNLETESSKKAQVTSSAGTQETQKWLRERYGDL  257



>ref|XP_009405138.1| PREDICTED: transcription factor BEE 3 [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRARRGQATDSHSLAERVRR +INER+ CLQ +VP C+K MG A MLDEIINY
Sbjct  123  KPKEVIHVRARRGQATDSHSLAERVRRKRINERMHCLQGLVPCCHKAMGTARMLDEIINY  182

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQ  160
            VQSLQNQVEFLSMKL+ ASS+Y +  + E I T Q
Sbjct  183  VQSLQNQVEFLSMKLSAASSFYGYCFDMETIATPQ  217



>ref|XP_006430772.1| hypothetical protein CICLE_v10012453mg [Citrus clementina]
 gb|ESR44012.1| hypothetical protein CICLE_v10012453mg [Citrus clementina]
Length=272

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P  ++HVRA+RGQATDSHS+AERVRR KIN++++CLQD+VPGC+K MGMA ML+EIINYV
Sbjct  149  PERIIHVRAKRGQATDSHSIAERVRREKINKKMRCLQDLVPGCHKDMGMAGMLEEIINYV  208

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
             SLQNQVEFLSM+L  A S  D N ETE     Q   ++E ++M+   K+ Y
Sbjct  209  HSLQNQVEFLSMELAAACSSNDLNIETESSRKTQGTNSHEALEMEIWAKEAY  260



>ref|XP_006482245.1| PREDICTED: transcription factor BEE 3-like [Citrus sinensis]
 gb|KDO59023.1| hypothetical protein CISIN_1g017964mg [Citrus sinensis]
Length=272

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P  ++HVRA+RGQATDSHS+AERVRR KIN++++CLQD+VPGC+K MGMA ML+EIINYV
Sbjct  149  PERIIHVRAKRGQATDSHSIAERVRREKINKKMRCLQDLVPGCHKDMGMAGMLEEIINYV  208

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGY  106
             SLQNQVEFLSM+L  A S  D N ETE     Q   ++E ++M+   K+ Y
Sbjct  209  HSLQNQVEFLSMELAAACSSNDLNIETESSRKTQGTNSHEALEMEIWAKEAY  260



>emb|CAN71967.1| hypothetical protein VITISV_017400 [Vitis vinifera]
Length=271

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 5/100 (5%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKT-----MGMAVMLD  280
            KP EV+HVRARRGQATD+HS+AERVRR KI  RL+CLQD+VPGCYK       GMAVMLD
Sbjct  141  KPDEVIHVRARRGQATDNHSIAERVRREKIKTRLRCLQDLVPGCYKVYDPQNKGMAVMLD  200

Query  279  EIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQ  160
            EIINYV SLQNQVEFLS +L  ASS ++FNSETE I+  Q
Sbjct  201  EIINYVHSLQNQVEFLSRELAAASSLHNFNSETEAIKNAQ  240



>ref|XP_002305819.2| hypothetical protein POPTR_0004s09850g [Populus trichocarpa]
 gb|EEE86330.2| hypothetical protein POPTR_0004s09850g [Populus trichocarpa]
Length=259

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            K  EV+HVRA+RGQATDSHS+AER+RR KIN +L+CLQDIVPGC+K+MGMAVML+EIINY
Sbjct  134  KSKEVIHVRAKRGQATDSHSIAERIRREKINNKLRCLQDIVPGCHKSMGMAVMLEEIINY  193

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMK-MQKQVKDGY  106
            V SLQNQVEFLSM+L  AS   D  + TE  +  Q   + +D +  QK  ++ Y
Sbjct  194  VHSLQNQVEFLSMELAAASCSNDLKNLTESSKKAQGTNSTDDAQETQKWSRERY  247



>ref|XP_011035067.1| PREDICTED: transcription factor BEE 1-like [Populus euphratica]
Length=269

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            EV+HVRA+RGQATDSHS+AER+RR KIN +L+CLQDIVPGC+K MGMAVML+EIINYV S
Sbjct  147  EVIHVRAKRGQATDSHSIAERIRREKINSKLRCLQDIVPGCHKPMGMAVMLEEIINYVHS  206

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMK-MQKQVKDGY  106
            LQNQVEFLS++L  AS   D  + TE  +  Q   + +D +  QK  ++ Y
Sbjct  207  LQNQVEFLSLELAAASCSNDLKNLTESSKKAQGTNSTDDAQETQKWSRERY  257



>gb|KDO57469.1| hypothetical protein CISIN_1g024653mg [Citrus sinensis]
Length=206

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 123/204 (60%), Gaps = 21/204 (10%)
 Frame = -1

Query  834  FPLLNVDPSMEVAQFPELNPNFGDLSGP---NFHTLMGFSQQDQFLSQVPSAAEFSPQEY  664
            FP L++DP++E     ++N N   L      N+ + M FS  D F     + AE  P  +
Sbjct  17   FPFLDIDPNIE-----QINNNLSVLDNTSLLNYQSFMPFSNPDNFFEFPGNLAENFPGNF  71

Query  663  AVNSLHYEAKTGHRAVILPENDALETKMKPADYTTMEscsanssspa-vSEIGTrrkhsv  487
              N++     T              TK +  +   +E   +++   + VSEI T ++   
Sbjct  72   IQNNMLPVCHT-----------VTSTKCESKNRKAVEISESSNEDSSPVSEIETNKRKKN  120

Query  486  gkgkrkks-seeEDTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCY  310
               +++   +E+E+ K  EVVHVRARRGQATDSHSLAERVRRGKINERL+CLQDIVPGCY
Sbjct  121  SGRRKRVKGNEKEEEKSKEVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDIVPGCY  180

Query  309  KTMGMAVMLDEIINYVQSLQNQVE  238
            KTMGM +MLDEIINYVQSLQNQVE
Sbjct  181  KTMGMTMMLDEIINYVQSLQNQVE  204



>ref|XP_009383609.1| PREDICTED: transcription factor bHLH75-like [Musa acuminata subsp. 
malaccensis]
Length=250

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRARRG+ATDSHSLAER RR KINER++ LQ+ +PGC+KTMGMA MLD+ I+Y
Sbjct  128  KPEEVVHVRARRGEATDSHSLAERERRKKINERMRRLQNQIPGCHKTMGMARMLDQTISY  187

Query  264  VQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYE  142
            V+SLQNQVEFLSM+L+ AS   DF    + I T Q  KA+E
Sbjct  188  VRSLQNQVEFLSMELSAASYLSDFGLGVDAIATAQAEKAHE  228



>gb|KGN57761.1| hypothetical protein Csa_3G282490 [Cucumis sativus]
Length=228

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EVVHVRA+RGQATDSHSLAERVRR KIN +LKCLQ+I+PGC+K+MGMA++LDE INY
Sbjct  127  KPGEVVHVRAKRGQATDSHSLAERVRREKINHKLKCLQNIIPGCHKSMGMAMVLDETINY  186

Query  264  VQSLQNQVEFLSMKLTEASSYYDFN  190
            V SLQNQVEFLSM+L  A S    N
Sbjct  187  VYSLQNQVEFLSMELAAACSTLGIN  211



>gb|KDO59022.1| hypothetical protein CISIN_1g017964mg [Citrus sinensis]
Length=363

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P  ++HVRA+RGQATDSHS+AERVRR KIN++++CLQD+VPGC+K MGMA ML+EIINYV
Sbjct  149  PERIIHVRAKRGQATDSHSIAERVRREKINKKMRCLQDLVPGCHKDMGMAGMLEEIINYV  208

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETE  178
             SLQNQVEFLSM+L  A S  D N ETE
Sbjct  209  HSLQNQVEFLSMELAAACSSNDLNIETE  236



>emb|CDY45835.1| BnaA02g14180D [Brassica napus]
Length=453

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 13/130 (10%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  264  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  323

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  +      AK   +++++        G S++ PF Q 
Sbjct  324  RQVEFLSMKLATVNPQMDFNLEALL------AKDVRELQLRG-------GSSSATPFPQN  370

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  371  MSMVYPPLPH  380



>ref|XP_009127689.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127690.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127691.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127693.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
 ref|XP_009127694.1| PREDICTED: transcription factor bHLH49-like [Brassica rapa]
Length=473

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 89/130 (68%), Gaps = 13/130 (10%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  284  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  343

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E+ +      AK   +++++        G S++ PF Q 
Sbjct  344  RQVEFLSMKLATVNPQMDFNLESLL------AKDVRELQLRG-------GSSSATPFPQN  390

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  391  MPMVYPPLPH  400



>ref|XP_009401352.1| PREDICTED: transcription factor BEE 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 75/104 (72%), Gaps = 9/104 (9%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P EVVHVRARRGQAT+SHSLAER RR KINER+ CLQ +VPGC+K MG+A MLDEIINYV
Sbjct  127  PKEVVHVRARRGQATNSHSLAERARREKINERMSCLQGLVPGCHKAMGIAAMLDEIINYV  186

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKM  130
            QSLQNQV+ LSMKL    S          +E MQ A   + M M
Sbjct  187  QSLQNQVQMLSMKLAVCESS---------LERMQAAATLQVMMM  221



>ref|XP_002977203.1| hypothetical protein SELMODRAFT_106386, partial [Selaginella 
moellendorffii]
 gb|EFJ21812.1| hypothetical protein SELMODRAFT_106386, partial [Selaginella 
moellendorffii]
Length=158

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  52   PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  111

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL   +   +FN E+
Sbjct  112  QSLQRQVEFLSMKLAAVNPRLEFNVES  138



>gb|EPS62866.1| hypothetical protein M569_11921, partial [Genlisea aurea]
Length=101

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            VH+RARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  13   VHIRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQSLQ  72

Query  249  NQVEFLSMKLTEASSYYDFNSE  184
             QVEFLSMKL   +S+ D N E
Sbjct  73   RQVEFLSMKLAAVNSHMDLNIE  94



>emb|CDX81575.1| BnaC02g18790D [Brassica napus]
Length=475

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 88/130 (68%), Gaps = 13/130 (10%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  289  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  348

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  +      AK   +++++        G S++ PF Q 
Sbjct  349  RQVEFLSMKLATVNPQMDFNLEALL------AKDVRELQLRG-------GSSSATPFPQN  395

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  396  MPMVYPPLPH  405



>ref|XP_002526990.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35362.1| DNA binding protein, putative [Ricinus communis]
Length=189

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  444  KPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINY  265
            KP EV+HVRA+RGQATDSHSLAERVRR +INE+L+CLQD+VPGCYKTMGMAVMLD IINY
Sbjct  114  KPKEVIHVRAKRGQATDSHSLAERVRRERINEKLRCLQDLVPGCYKTMGMAVMLDVIINY  173

Query  264  VQSLQNQVE  238
            VQSLQNQ+E
Sbjct  174  VQSLQNQIE  182



>ref|XP_010511918.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=497

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 85/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  312  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  371

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF Q 
Sbjct  372  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPQN  416

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  417  MSMAYPPLPH  426



>ref|XP_009380954.1| PREDICTED: transcription factor BEE 1-like [Musa acuminata subsp. 
malaccensis]
Length=203

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = -1

Query  447  TKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIIN  268
            ++P EVVHVRARRG+ATDSHSLAERVRR KIN +++ L+D+VPGC K MGMA MLDEIIN
Sbjct  72   SEPKEVVHVRARRGEATDSHSLAERVRREKINRKMRFLRDLVPGCCKAMGMAGMLDEIIN  131

Query  267  YVQSLQNQVEFLSMKLTEASSYYDFNSETE  178
            YV+SLQNQVE LSM++  A+S YD NS  E
Sbjct  132  YVRSLQNQVELLSMEIAAAASSYD-NSWVE  160



>ref|XP_006391072.1| hypothetical protein EUTSA_v10018444mg [Eutrema salsugineum]
 gb|ESQ28358.1| hypothetical protein EUTSA_v10018444mg [Eutrema salsugineum]
Length=497

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 85/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  312  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  371

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF Q 
Sbjct  372  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSAAPFPQN  416

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  417  VSMVYPPLPH  426



>ref|XP_009372199.1| PREDICTED: transcription factor bHLH62 [Pyrus x bretschneideri]
Length=569

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  370  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  429

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL+  ++  DFN ET
Sbjct  430  QSLQRQVEFLSMKLSSVNTRLDFNMET  456



>ref|XP_008456996.1| PREDICTED: transcription factor BEE 3-like isoform X2 [Cucumis 
melo]
Length=236

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRA+RGQATDSHSLAERVRR KIN +LKCLQ+I+PGC+K+MGMA++LDE INYV SL
Sbjct  149  VVHVRAKRGQATDSHSLAERVRREKINHKLKCLQNIIPGCHKSMGMAMVLDETINYVYSL  208

Query  252  QNQVEFLSMKLTEASSYYDFN  190
            QNQVEFLSM+L  A S    N
Sbjct  209  QNQVEFLSMELAAACSTLGIN  229



>ref|XP_008809649.1| PREDICTED: transcription factor bHLH78-like isoform X1 [Phoenix 
dactylifera]
Length=560

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  348  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYV  407

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E  + + M +A  
Sbjct  408  QSLQRQVEFLSMKLAAVNPQLDFNVENLLPKDMHQASG  445



>ref|XP_008809650.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Phoenix 
dactylifera]
Length=557

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  348  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYV  407

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E  + + M +A  
Sbjct  408  QSLQRQVEFLSMKLAAVNPQLDFNVENLLPKDMHQASG  445



>ref|XP_010907240.1| PREDICTED: transcription factor bHLH62 [Elaeis guineensis]
Length=547

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  348  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYV  407

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E  + + M +A  
Sbjct  408  QSLQRQVEFLSMKLATVNPRLDFNMENLLPKDMHQASG  445



>emb|CAE00874.1| TA1 protein [Oryza sativa Japonica Group]
Length=204

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRG+ATDSHSLAERVRR KI++R+K LQD+VPGC K +G AVMLDEIINYV
Sbjct  68   PKDYIHVRARRGEATDSHSLAERVRREKISQRMKLLQDLVPGCNKVVGKAVMLDEIINYV  127

Query  261  QSLQNQVEFLSMKLTEASSYYDFNS  187
            QSLQ QVEFLSMKL   +   DFN+
Sbjct  128  QSLQRQVEFLSMKLATVNPQLDFNN  152



>ref|XP_008382580.1| PREDICTED: transcription factor bHLH62 isoform X3 [Malus domestica]
Length=569

 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  370  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  429

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL+  ++  DFN ET
Sbjct  430  QSLQRQVEFLSMKLSSVNTRLDFNMET  456



>ref|XP_011024588.1| PREDICTED: transcription factor bHLH62 [Populus euphratica]
Length=563

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  352  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  411

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  DFN +T I + M
Sbjct  412  QSLQRQVEFLSMKLASVNTRLDFNVDTLISKDM  444



>gb|KDO70234.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=225

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            E +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQS
Sbjct  56   EYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQS  115

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            LQ QVEFLSMKL   +   DFN E  + + + +++A
Sbjct  116  LQRQVEFLSMKLATVNPRLDFNIEELLAKDVLQSRA  151



>emb|CDY33568.1| BnaC06g29840D [Brassica napus]
Length=482

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  295  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  354

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  355  RQVEFLSMKLATVNPQMDFNREGLLAKDALQLRA---------------GTSSATPFPPN  399

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  400  MPMVYPPLPH  409



>gb|KDO70235.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=218

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            E +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQS
Sbjct  56   EYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQS  115

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            LQ QVEFLSMKL   +   DFN E  + + + +++A
Sbjct  116  LQRQVEFLSMKLATVNPRLDFNIEELLAKDVLQSRA  151



>ref|XP_008382579.1| PREDICTED: transcription factor bHLH62 isoform X2 [Malus domestica]
Length=579

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  370  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  429

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL+  ++  DFN ET
Sbjct  430  QSLQRQVEFLSMKLSSVNTRLDFNMET  456



>gb|KDP45272.1| hypothetical protein JCGZ_15137 [Jatropha curcas]
Length=566

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  359  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  418

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            QSLQ QVEFLSMKL   ++  DFN +T I
Sbjct  419  QSLQRQVEFLSMKLASVNTRLDFNMDTLI  447



>ref|XP_008456998.1| PREDICTED: transcription factor BEE 3-like isoform X3 [Cucumis 
melo]
Length=231

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -1

Query  432  VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSL  253
            VVHVRA+RGQATDSHSLAERVRR KIN +LKCLQ+I+PGC+K+MGMA++LDE INYV SL
Sbjct  149  VVHVRAKRGQATDSHSLAERVRREKINHKLKCLQNIIPGCHKSMGMAMVLDETINYVYSL  208

Query  252  QNQVEFLSMKLTEASS  205
            QNQVEFLSM+L  A S
Sbjct  209  QNQVEFLSMELAAACS  224



>gb|EPS74146.1| hypothetical protein M569_00610, partial [Genlisea aurea]
Length=101

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            +++  + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A MLDEII
Sbjct  13   ESQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  72

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNSE  184
            NYVQSLQ QVE LSMKL   S   DFN E
Sbjct  73   NYVQSLQRQVELLSMKLAAVSPRLDFNME  101



>ref|XP_002966517.1| hypothetical protein SELMODRAFT_72702, partial [Selaginella moellendorffii]
 ref|XP_002982358.1| hypothetical protein SELMODRAFT_72704, partial [Selaginella moellendorffii]
 gb|EFJ16603.1| hypothetical protein SELMODRAFT_72704, partial [Selaginella moellendorffii]
 gb|EFJ32544.1| hypothetical protein SELMODRAFT_72702, partial [Selaginella moellendorffii]
Length=102

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  14   IHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQSLQ  73

Query  249  NQVEFLSMKLTEASSYYDFN  190
             QVEFLSMKL   +   D N
Sbjct  74   RQVEFLSMKLAAVNPRLDIN  93



>ref|XP_008382578.1| PREDICTED: transcription factor bHLH62 isoform X1 [Malus domestica]
Length=603

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  370  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  429

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL+  ++  DFN ET
Sbjct  430  QSLQRQVEFLSMKLSSVNTRLDFNMET  456



>ref|XP_009612948.1| PREDICTED: transcription factor bHLH77-like [Nicotiana tomentosiformis]
Length=444

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATD+HSLAERVRR KI ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  259  PKDYIHVRARRGQATDAHSLAERVRREKIGERMKFLQDLVPGCNKVTGKAVMLDEIINYV  318

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL+  +   DFN+E+ I + M
Sbjct  319  QSLQCQVEFLSMKLSNMNPRMDFNTESLISKNM  351



>gb|KDO70232.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=253

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            E +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQS
Sbjct  56   EYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQS  115

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            LQ QVEFLSMKL   +   DFN E  + + + +++A
Sbjct  116  LQRQVEFLSMKLATVNPRLDFNIEELLAKDVLQSRA  151



>ref|XP_009392658.1| PREDICTED: transcription factor bHLH77 [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI++R+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  125  PKDYIHVRARRGQATDSHSLAERVRREKISKRMKLLQDLVPGCNKITGKAMMLDEIINYV  184

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   +   DF+ ET + E M
Sbjct  185  QSLQRQVEFLSMKLATINPQLDFDLETLLQENM  217



>ref|XP_009105442.1| PREDICTED: transcription factor bHLH49 [Brassica rapa]
 ref|XP_009105443.1| PREDICTED: transcription factor bHLH49 [Brassica rapa]
Length=476

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  288  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  347

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  348  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GTSSATPFPPN  392

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  393  MPMVYPPLPH  402



>ref|XP_006347483.1| PREDICTED: transcription factor bHLH137-like [Solanum tuberosum]
Length=258

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 86/138 (62%), Gaps = 17/138 (12%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P   VHVRARRGQATDSHSLAERVRR KI+ER+K LQ +VPGC K  G A+MLDEIINYV
Sbjct  119  PTGYVHVRARRGQATDSHSLAERVRREKISERMKILQALVPGCDKVTGKALMLDEIINYV  178

Query  261  QSLQNQVEFLSMKLTEASS-YYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            QSLQNQVEFLSMKL   +  YYDF  E + +           M    Q   G EG     
Sbjct  179  QSLQNQVEFLSMKLASLNPMYYDFGMELDAL-----------MVKPDQSWSGLEG-----  222

Query  84   PFDQQSFGCYPSLPHNTS  31
            P  + +   YP L  +TS
Sbjct  223  PLLENTTSSYPLLDSSTS  240



>ref|NP_177058.1| transcription factor bHLH49 [Arabidopsis thaliana]
 ref|NP_849863.2| transcription factor bHLH49 [Arabidopsis thaliana]
 sp|Q9CAA9.1|BH049_ARATH RecName: Full=Transcription factor bHLH49; AltName: Full=Basic 
helix-loop-helix protein 49; Short=AtbHLH49; Short=bHLH 49; 
AltName: Full=Protein ACTIVATOR FOR CELL ELONGATION 1; AltName: 
Full=Transcription factor EN 82; AltName: Full=bHLH transcription 
factor bHLH049 [Arabidopsis thaliana]
 gb|AAG51583.1|AC011665_4 putative DNA-binding protein [Arabidopsis thaliana]
 gb|AAM91106.1| At1g68920/T6L1_10 [Arabidopsis thaliana]
 gb|AAN72270.1| At1g68920/T6L1_10 [Arabidopsis thaliana]
 gb|AEE34861.1| transcription factor bHLH49 [Arabidopsis thaliana]
 gb|AEE34862.1| transcription factor bHLH49 [Arabidopsis thaliana]
Length=486

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  301  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  360

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  361  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPPN  405

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  406  MSMAYPPLPH  415



>gb|EPS73774.1| hypothetical protein M569_00982 [Genlisea aurea]
Length=200

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + VHVRARRGQATDSHSLAER+RR +I+ER+K LQ +VPGC K  G AVMLDEIINYV
Sbjct  28   PTDYVHVRARRGQATDSHSLAERMRRERISERMKLLQALVPGCDKVTGKAVMLDEIINYV  87

Query  261  QSLQNQVEFLSMKLTEASSYYDF  193
            QSLQNQVEFLSMKL   +  YDF
Sbjct  88   QSLQNQVEFLSMKLASVNPMYDF  110



>ref|XP_006302168.1| hypothetical protein CARUB_v10020178mg [Capsella rubella]
 gb|EOA35066.1| hypothetical protein CARUB_v10020178mg [Capsella rubella]
Length=499

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  314  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  373

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  374  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPPN  418

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  419  MSMAYPPLPH  428



>ref|XP_002303073.2| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE82346.2| basic helix-loop-helix family protein [Populus trichocarpa]
Length=563

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  352  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  411

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            QSLQ QVEFLSMKL   ++  DFN +T I
Sbjct  412  QSLQRQVEFLSMKLASVNTRLDFNMDTLI  440



>ref|NP_001031255.1| transcription factor bHLH49 [Arabidopsis thaliana]
 dbj|BAH57052.1| AT1G68920 [Arabidopsis thaliana]
 gb|AEE34863.1| transcription factor bHLH49 [Arabidopsis thaliana]
Length=485

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  300  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  359

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  360  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPPN  404

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  405  MSMAYPPLPH  414



>ref|XP_010470832.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=505

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 85/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRA+RGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  320  IHVRAQRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  379

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF Q 
Sbjct  380  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPQN  424

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  425  MSMAYPPLPH  434



>gb|KDO70233.1| hypothetical protein CISIN_1g0086311mg, partial [Citrus sinensis]
Length=245

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            E +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQS
Sbjct  56   EYIHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQS  115

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            LQ QVEFLSMKL   +   DFN E  + + + +++A
Sbjct  116  LQRQVEFLSMKLATVNPRLDFNIEELLAKDVLQSRA  151



>ref|XP_009760399.1| PREDICTED: transcription factor bHLH78-like [Nicotiana sylvestris]
Length=440

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATD+HSLAERVRR KI ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  255  PKDYIHVRARRGQATDAHSLAERVRREKIGERMKFLQDLVPGCNKVTGKAVMLDEIINYV  314

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL+  +   DFN+E+ + + M
Sbjct  315  QSLQCQVEFLSMKLSNMNPRMDFNAESLLSKNM  347



>ref|XP_008813505.1| PREDICTED: transcription factor bHLH62-like isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 88/143 (62%), Gaps = 21/143 (15%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  354  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  413

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI-----------------IETMQRAKAY----  145
            QSLQ QVEFLSMKL   +   DF+ E  +                 +E M  A +Y    
Sbjct  414  QSLQRQVEFLSMKLATVNPRLDFHMENLLPKDMHQARGPMPTPVYPLEAMSTAFSYPHPP  473

Query  144  EDMKMQKQVKDGYEGLSTSNPFD  76
            +   +Q  V DG E   + NP D
Sbjct  474  QGTPLQSVVTDGLENQRSLNPLD  496



>ref|XP_008799570.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH78-like 
[Phoenix dactylifera]
Length=518

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI++R++ LQD+VPGC K  G AVMLDEIINYV
Sbjct  308  PKDYIHVRARRGQATDSHSLAERVRREKISQRMRLLQDLVPGCNKVTGKAVMLDEIINYV  367

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEII  172
            QSLQ QVEFLSMKL  A+   DFN+  ++I
Sbjct  368  QSLQRQVEFLSMKLATANPRLDFNNVADLI  397



>ref|XP_010415500.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
 ref|XP_010415501.1| PREDICTED: transcription factor bHLH49-like [Camelina sativa]
Length=507

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  322  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  381

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  382  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPPN  426

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  427  MSMAYPPLPH  436



>gb|AAM10942.1|AF488584_1 putative bHLH transcription factor [Arabidopsis thaliana]
Length=486

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  301  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  360

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A               G S++ PF   
Sbjct  361  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRA---------------GSSSTTPFPPN  405

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  406  MSMSYPPLPH  415



>ref|XP_008813504.1| PREDICTED: transcription factor bHLH62-like isoform X1 [Phoenix 
dactylifera]
Length=573

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 88/143 (62%), Gaps = 21/143 (15%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  354  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  413

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI-----------------IETMQRAKAY----  145
            QSLQ QVEFLSMKL   +   DF+ E  +                 +E M  A +Y    
Sbjct  414  QSLQRQVEFLSMKLATVNPRLDFHMENLLPKDMHQARGPMPTPVYPLEAMSTAFSYPHPP  473

Query  144  EDMKMQKQVKDGYEGLSTSNPFD  76
            +   +Q  V DG E   + NP D
Sbjct  474  QGTPLQSVVTDGLENQRSLNPLD  496



>ref|XP_001780050.1| predicted protein [Physcomitrella patens]
 gb|EDQ55153.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D    + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEII
Sbjct  60   DLSKQDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKITGKAVMLDEII  119

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFN  190
            NYVQSLQ Q+EFLSMKL   +   D++
Sbjct  120  NYVQSLQRQIEFLSMKLAAVNPRLDYS  146



>ref|XP_004253164.1| PREDICTED: transcription factor bHLH62-like [Solanum lycopersicum]
Length=404

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            + +HVRARRGQATD+HSLAERVRR KI ER+K LQD+VPGC K  G AVMLDEIINYVQS
Sbjct  215  DYIHVRARRGQATDAHSLAERVRREKIGERMKFLQDLVPGCNKVTGKAVMLDEIINYVQS  274

Query  255  LQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            LQ QVEFLSMKL+  +S  DFN+E+   + M
Sbjct  275  LQCQVEFLSMKLSNLNSTTDFNAESLTSKNM  305



>ref|XP_010036765.1| PREDICTED: transcription factor bHLH62-like [Eucalyptus grandis]
 gb|KCW48405.1| hypothetical protein EUGRSUZ_K02109 [Eucalyptus grandis]
Length=521

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  326  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  385

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  DFN++  + + M
Sbjct  386  QSLQRQVEFLSMKLASVNTTLDFNADALMSKDM  418



>ref|XP_011084194.1| PREDICTED: transcription factor bHLH78-like [Sesamum indicum]
Length=519

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATD+HSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  323  PKDYIHVRARRGQATDAHSLAERVRREKISERMKVLQDLVPGCNKVTGKAVMLDEIINYV  382

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   +   DFN E  + + M
Sbjct  383  QSLQRQVEFLSMKLATVNPRMDFNMEALMSKDM  415



>ref|XP_002865830.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42089.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER++ LQ++VPGC K  G A+MLDEIINYV
Sbjct  131  PKDYIHVRARRGQATDSHSLAERVRREKISERMRTLQNLVPGCDKVTGKALMLDEIINYV  190

Query  261  QSLQNQVEFLSMKLTEASS-YYDFNSE  184
            Q+LQNQVEFLSMKLT  S   YDF S+
Sbjct  191  QTLQNQVEFLSMKLTSISPVVYDFGSD  217



>ref|XP_008372543.1| PREDICTED: transcription factor bHLH62-like [Malus domestica]
Length=568

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VP C K  G A+MLDEIINYV
Sbjct  369  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPNCNKVTGKALMLDEIINYV  428

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL+  ++  DFN ET
Sbjct  429  QSLQRQVEFLSMKLSSVNTRLDFNMET  455



>ref|XP_002887213.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63472.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 83/130 (64%), Gaps = 14/130 (11%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  301  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  360

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DFN E  + +   + +A                 ST+ PF   
Sbjct  361  RQVEFLSMKLATVNPQMDFNLEGLLAKDALQLRAGSS--------------STTTPFTPN  406

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  407  MAMAYPPLPH  416



>gb|KHG16496.1| Transcription factor bHLH62 -like protein [Gossypium arboreum]
Length=441

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 79/105 (75%), Gaps = 4/105 (4%)
 Frame = -1

Query  450  DTKPME----VVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVML  283
            D+KP E     +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVML
Sbjct  247  DSKPAEPPKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVML  306

Query  282  DEIINYVQSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            DEIINYVQSLQ QVEFLSMKL   +   D N ET + + M +++ 
Sbjct  307  DEIINYVQSLQRQVEFLSMKLATVNPRMDVNMETLLSKDMFQSRG  351



>gb|KEH22550.1| BHLH transcription factor [Medicago truncatula]
Length=517

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  311  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  370

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  DF+ E+ I + M
Sbjct  371  QSLQRQVEFLSMKLATVNTRVDFSIESLISKDM  403



>ref|XP_010318148.1| PREDICTED: basic helix-loop-helix isoform X1 [Solanum lycopersicum]
Length=330

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P   +HVRARRGQATDSHSLAERVRR KI+ER+K LQ +VPGC K  G A+MLDEIINYV
Sbjct  147  PTGYIHVRARRGQATDSHSLAERVRREKISERMKILQSLVPGCDKVTGKALMLDEIINYV  206

Query  261  QSLQNQVEFLSMKLTEASS-YYDF  193
            QSLQNQVEFLSMKLT  +  YYDF
Sbjct  207  QSLQNQVEFLSMKLTSLNPMYYDF  230



>ref|NP_001266190.1| basic helix-loop-helix [Solanum lycopersicum]
 gb|AFM30927.1| basic helix-loop-helix [Solanum lycopersicum]
Length=330

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P   +HVRARRGQATDSHSLAERVRR KI+ER+K LQ +VPGC K  G A+MLDEIINYV
Sbjct  147  PTGYIHVRARRGQATDSHSLAERVRREKISERMKILQSLVPGCDKVTGKALMLDEIINYV  206

Query  261  QSLQNQVEFLSMKLTEASS-YYDF  193
            QSLQNQVEFLSMKLT  +  YYDF
Sbjct  207  QSLQNQVEFLSMKLTSLNPMYYDF  230



>gb|AFK37834.1| unknown [Lotus japonicus]
Length=493

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  284  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  343

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            +SLQ QVEFLSMKL+  ++  DF++E+ I
Sbjct  344  RSLQRQVEFLSMKLSSVNTRLDFSTESLI  372



>emb|CBI17295.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  257  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  316

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSE  184
            QSLQ QVEFLSMKL   +   DFN E
Sbjct  317  QSLQRQVEFLSMKLATVNPRMDFNME  342



>gb|ABR16552.1| unknown [Picea sitchensis]
Length=605

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  398  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYV  457

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   +   DFN +  I + M
Sbjct  458  QSLQRQVEFLSMKLATVNPRLDFNMDGLIAKDM  490



>ref|XP_004248023.1| PREDICTED: transcription factor bHLH62 [Solanum lycopersicum]
Length=431

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATD+HSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  228  PKDYIHVRARRGQATDAHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYV  287

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E  + + M +++ 
Sbjct  288  QSLQRQVEFLSMKLATVNPRMDFNMEALLSKDMFQSRG  325



>ref|XP_010552022.1| PREDICTED: transcription factor bHLH62-like [Tarenaya hassleriana]
Length=517

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  310  PKDYIHVRARRGQATDSHSLAERVRREKIGERMKLLQDLVPGCNKVTGKALMLDEIINYV  369

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  DFN +  + + M
Sbjct  370  QSLQRQVEFLSMKLASVNTRLDFNVDALVSKDM  402



>ref|XP_006358792.1| PREDICTED: transcription factor bHLH62-like [Solanum tuberosum]
Length=439

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATD+HSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  236  PKDYIHVRARRGQATDAHSLAERVRREKISERMKLLQDLVPGCNKVTGKAVMLDEIINYV  295

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E  + + M +++ 
Sbjct  296  QSLQRQVEFLSMKLATVNPRMDFNMEALLSKDMFQSRG  333



>ref|XP_003603935.1| Transcription factor BEE [Medicago truncatula]
 gb|KEH36364.1| BHLH transcription factor [Medicago truncatula]
Length=398

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D +  + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A MLDEII
Sbjct  182  DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNS----ETEIIETMQRAKAYEDMKMQKQVKDGYE  103
            NYVQSLQ QVEFLSMKL   +   DFN     E E+        +++ M M         
Sbjct  242  NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEVFPNCDANASFQAMGMST-------  294

Query  102  GLSTSNPFDQ  73
            GL+++NP+ Q
Sbjct  295  GLNSNNPYLQ  304



>ref|XP_006363974.1| PREDICTED: transcription factor bHLH137-like [Solanum tuberosum]
Length=338

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P   +HVRARRGQATDSHSLAERVRR KI+ER+K LQ +VPGC K  G A+MLDEIINYV
Sbjct  155  PTGYIHVRARRGQATDSHSLAERVRREKISERMKILQSLVPGCDKVTGKALMLDEIINYV  214

Query  261  QSLQNQVEFLSMKLTEASS-YYDF  193
            QSLQNQVEFLSMKLT  +  YYDF
Sbjct  215  QSLQNQVEFLSMKLTSLNPMYYDF  238



>gb|AES74186.2| BHLH transcription factor [Medicago truncatula]
Length=397

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D +  + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A MLDEII
Sbjct  182  DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNS----ETEIIETMQRAKAYEDMKMQKQVKDGYE  103
            NYVQSLQ QVEFLSMKL   +   DFN     E E+        +++ M M         
Sbjct  242  NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEVFPNCDANASFQAMGMST-------  294

Query  102  GLSTSNPFDQ  73
            GL+++NP+ Q
Sbjct  295  GLNSNNPYLQ  304



>gb|AFK40379.1| unknown [Medicago truncatula]
Length=397

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = -1

Query  450  DTKPMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEII  271
            D +  + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A MLDEII
Sbjct  182  DVQKTDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEII  241

Query  270  NYVQSLQNQVEFLSMKLTEASSYYDFNS----ETEIIETMQRAKAYEDMKMQKQVKDGYE  103
            NYVQSLQ QVEFLSMKL   +   DFN     E E+        +++ M M         
Sbjct  242  NYVQSLQKQVEFLSMKLATVNPRLDFNIDDLFEKEVFPNCDANASFQAMGMST-------  294

Query  102  GLSTSNPFDQ  73
            GL+++NP+ Q
Sbjct  295  GLNSNNPYLQ  304



>gb|EMS64147.1| Transcription factor bHLH49 [Triticum urartu]
Length=368

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRG+ATDSHSLAERVRR KI++R+K LQD+VPGC K +G AVMLDEIINYV
Sbjct  121  PKDFIHVRARRGEATDSHSLAERVRREKISQRMKLLQDLVPGCNKVVGKAVMLDEIINYV  180

Query  261  QSLQNQVEFLSMKLTEASSYYDFNS  187
            QSLQ QVEFLSMKL   +   DFNS
Sbjct  181  QSLQRQVEFLSMKLATVNPQLDFNS  205



>gb|KDP32569.1| hypothetical protein JCGZ_13119 [Jatropha curcas]
Length=483

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  283  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  342

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL   +   DFN E 
Sbjct  343  QSLQRQVEFLSMKLATVNPRMDFNMEA  369



>ref|XP_010322508.1| PREDICTED: transcription factor bHLH137-like [Solanum lycopersicum]
Length=289

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 86/138 (62%), Gaps = 17/138 (12%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P   VHVRARRGQATDSHSLAERVRR KI+ER+K LQ +VPGC K  G A+MLDEIINYV
Sbjct  119  PTGYVHVRARRGQATDSHSLAERVRREKISERMKILQALVPGCDKVTGKALMLDEIINYV  178

Query  261  QSLQNQVEFLSMKLTEASS-YYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSN  85
            QSLQNQVEFLSMKL   +  YYDF  + + +           M    Q   G EG     
Sbjct  179  QSLQNQVEFLSMKLASLNPMYYDFGMDLDAL-----------MVKPDQSWSGLEG-----  222

Query  84   PFDQQSFGCYPSLPHNTS  31
            P  + +   YP L  +TS
Sbjct  223  PLLENTTSNYPHLDSSTS  240



>gb|KEH22551.1| BHLH transcription factor [Medicago truncatula]
Length=535

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  311  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  370

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  DF+ E+ I + M
Sbjct  371  QSLQRQVEFLSMKLATVNTRVDFSIESLISKDM  403



>ref|XP_010542232.1| PREDICTED: transcription factor bHLH49-like, partial [Tarenaya 
hassleriana]
Length=191

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 82/131 (63%), Gaps = 16/131 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +H+RARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  53   IHMRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  112

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   + N                D  M K+      G S++ PF Q 
Sbjct  113  RQVEFLSMKLATVNPQLELNL---------------DGLMAKEALQLRPGPSSAPPFPQS  157

Query  69   SFG-CYPSLPH  40
                 YP LPH
Sbjct  158  IMPMAYPPLPH  168



>gb|KFK38192.1| hypothetical protein AALP_AA3G081200 [Arabis alpina]
Length=450

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYVQS
Sbjct  250  DFIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  309

Query  255  LQNQVEFLSMKLTEASSYYDFNSE  184
            LQ QVEFLSMKL+  ++  DFN E
Sbjct  310  LQRQVEFLSMKLSSVNTRLDFNME  333



>ref|XP_009406341.1| PREDICTED: transcription factor bHLH62-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  325  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  384

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   +   DFN E  + + M
Sbjct  385  QSLQRQVEFLSMKLAALNPQLDFNMEALLPKDM  417



>ref|XP_006407846.1| hypothetical protein EUTSA_v10020729mg [Eutrema salsugineum]
 gb|ESQ49299.1| hypothetical protein EUTSA_v10020729mg [Eutrema salsugineum]
Length=447

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = -1

Query  435  EVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQS  256
            + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYVQS
Sbjct  262  DFIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYVQS  321

Query  255  LQNQVEFLSMKLTEASSYYDFNSE  184
            LQ QVEFLSMKL+  ++  DFN E
Sbjct  322  LQRQVEFLSMKLSSVNTRLDFNME  345



>ref|XP_010547134.1| PREDICTED: transcription factor bHLH62-like [Tarenaya hassleriana]
Length=503

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  316  PKDYIHVRARRGQATDSHSLAERVRREKISERMKMLQDLVPGCNKVTGKALMLDEIINYV  375

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETM  163
            QSLQ QVEFLSMKL   ++  D+N +T + + M
Sbjct  376  QSLQRQVEFLSMKLASVNTRLDYNVDTLVSKDM  408



>ref|XP_007201182.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica]
 gb|EMJ02381.1| hypothetical protein PRUPE_ppa003350mg [Prunus persica]
Length=583

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  381  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  440

Query  261  QSLQNQVEFLSMKLTEASSYYDFN  190
            QSLQ QVEFLSMKL   ++  DFN
Sbjct  441  QSLQRQVEFLSMKLASVNTRLDFN  464



>gb|KHG19333.1| Transcription factor bHLH62 -like protein [Gossypium arboreum]
Length=547

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQ++VPGC K  G A+MLDEIINYV
Sbjct  336  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQNLVPGCNKVTGKALMLDEIINYV  395

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL   ++  DFN E+
Sbjct  396  QSLQRQVEFLSMKLASVNTRLDFNVES  422



>ref|XP_001783811.1| predicted protein [Physcomitrella patens]
 gb|EDQ51403.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  71   IHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCSKVTGKAVMLDEIINYVQSLQ  130

Query  249  NQVEFLSMKLTEASSYYDFN  190
             Q+EFLSMKL   +   D+ 
Sbjct  131  RQIEFLSMKLAAVNPRLDYG  150



>ref|XP_007140690.1| hypothetical protein PHAVU_008G133600g [Phaseolus vulgaris]
 gb|ESW12684.1| hypothetical protein PHAVU_008G133600g [Phaseolus vulgaris]
Length=570

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  364  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  423

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            QSLQ QVEFLSMKL   ++  DF+ E+ I
Sbjct  424  QSLQRQVEFLSMKLASVNTRLDFSIESLI  452



>emb|CAN73299.1| hypothetical protein VITISV_005183 [Vitis vinifera]
Length=569

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  366  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  425

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL   +   DFN E 
Sbjct  426  QSLQRQVEFLSMKLATVNPRMDFNMEA  452



>ref|XP_008244684.1| PREDICTED: transcription factor bHLH62 [Prunus mume]
Length=580

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  378  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  437

Query  261  QSLQNQVEFLSMKLTEASSYYDFN  190
            QSLQ QVEFLSMKL   ++  DFN
Sbjct  438  QSLQRQVEFLSMKLASVNTRLDFN  461



>ref|XP_006602464.1| PREDICTED: transcription factor bHLH78-like isoform X2 [Glycine 
max]
Length=541

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A+MLDEIINYV
Sbjct  335  PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGKALMLDEIINYV  394

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEI  175
            QSLQ QVEFLSMKL   ++  DF+ E+ I
Sbjct  395  QSLQRQVEFLSMKLASVNTRLDFSIESLI  423



>ref|XP_007034153.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY05079.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=578

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  372  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  431

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRA  154
            QSLQ QVEFLSMKL+  +   D N E  + + M R+
Sbjct  432  QSLQRQVEFLSMKLSTVNPRMDINMEALLSKDMFRS  467



>emb|CDX95974.1| BnaA07g27570D [Brassica napus]
Length=479

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 84/130 (65%), Gaps = 15/130 (12%)
 Frame = -1

Query  429  VHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYVQSLQ  250
            +HVRARRGQAT+SHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYVQSLQ
Sbjct  291  IHVRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYVQSLQ  350

Query  249  NQVEFLSMKLTEASSYYDFNSETEIIETMQRAKAYEDMKMQKQVKDGYEGLSTSNPFDQQ  70
             QVEFLSMKL   +   DF+ E  + +   + +A               G S++ PF   
Sbjct  351  RQVEFLSMKLATVNPQMDFSLEGLLAKDALQLRA---------------GTSSATPFPPN  395

Query  69   SFGCYPSLPH  40
                YP LPH
Sbjct  396  MPMVYPPLPH  405



>ref|XP_002264969.2| PREDICTED: transcription factor bHLH77-like [Vitis vinifera]
Length=569

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G AVMLDEIINYV
Sbjct  366  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKAVMLDEIINYV  425

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSET  181
            QSLQ QVEFLSMKL   +   DFN E 
Sbjct  426  QSLQRQVEFLSMKLATVNPRMDFNMEA  452



>ref|XP_010243164.1| PREDICTED: transcription factor bHLH62-like [Nelumbo nucifera]
Length=598

 Score =   135 bits (339),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  441  PMEVVHVRARRGQATDSHSLAERVRRGKINERLKCLQDIVPGCYKTMGMAVMLDEIINYV  262
            P + +HVRARRGQATDSHSLAERVRR KI+ER+K LQD+VPGC K  G A MLDEIINYV
Sbjct  388  PKDYIHVRARRGQATDSHSLAERVRREKISERMKFLQDLVPGCNKVTGKATMLDEIINYV  447

Query  261  QSLQNQVEFLSMKLTEASSYYDFNSETEIIETMQRAKA  148
            QSLQ QVEFLSMKL   +   DFN E+ + + + +++A
Sbjct  448  QSLQRQVEFLSMKLATVNPRMDFNMESLLSKDILQSRA  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280