BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20402_g1_i5 len=784 path=[3870:0-311 4181:312-671 7011:672-672
7012:673-783]

Length=784
                                                                      Score     E

gb|KDO56861.1|  hypothetical protein CISIN_1g039964mg                   112   2e-26   
gb|KDO41706.1|  hypothetical protein CISIN_1g0098352mg                  106   5e-25   
gb|KDO56862.1|  hypothetical protein CISIN_1g0025142mg                  111   8e-25   
gb|KDO41143.1|  hypothetical protein CISIN_1g0401091mg                  106   6e-24   
ref|XP_006421141.1|  hypothetical protein CICLE_v10004374mg             111   7e-24   
ref|XP_006493499.1|  PREDICTED: probable LRR receptor-like serine...    107   8e-24   
ref|XP_006421142.1|  hypothetical protein CICLE_v10004251mg             111   9e-24   
ref|XP_006490598.1|  PREDICTED: probable LRR receptor-like serine...    111   9e-24   
ref|XP_006490597.1|  PREDICTED: probable LRR receptor-like serine...    111   1e-23   
gb|KDO37548.1|  hypothetical protein CISIN_1g0482902mg                  103   1e-23   
ref|XP_006493513.1|  PREDICTED: LRR receptor-like serine/threonin...    111   1e-23   
gb|KDO38587.1|  hypothetical protein CISIN_1g043041mg                   107   2e-23   
ref|XP_006422087.1|  hypothetical protein CICLE_v10007014mg             109   3e-23   
ref|XP_006490687.1|  PREDICTED: probable LRR receptor-like serine...    109   4e-23   
ref|XP_006493494.1|  PREDICTED: probable LRR receptor-like serine...    105   6e-23   
ref|XP_006494168.1|  PREDICTED: leucine-rich repeat receptor prot...    108   9e-23   
ref|XP_006493496.1|  PREDICTED: LRR receptor-like serine/threonin...    106   1e-22   
gb|KDO37095.1|  hypothetical protein CISIN_1g045886mg                   102   1e-22   
ref|XP_010662626.1|  PREDICTED: LRR receptor-like serine/threonin...    107   1e-22   
ref|XP_006420957.1|  hypothetical protein CICLE_v10006412mg             107   1e-22   
gb|KDO41677.1|  hypothetical protein CISIN_1g047190mg                   107   2e-22   
ref|XP_006493495.1|  PREDICTED: LRR receptor-like serine/threonin...    106   2e-22   
ref|XP_006493493.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...    105   3e-22   
gb|KDO56839.1|  hypothetical protein CISIN_1g0483511mg                  105   4e-22   
ref|XP_006421143.1|  hypothetical protein CICLE_v10004253mg             106   4e-22   
ref|XP_006493087.1|  PREDICTED: LRR receptor-like serine/threonin...    106   4e-22   
ref|XP_006422085.1|  hypothetical protein CICLE_v10006573mg             106   5e-22   
ref|XP_006421144.1|  hypothetical protein CICLE_v10007027mg             105   6e-22   
ref|XP_006421134.1|  hypothetical protein CICLE_v10006453mg             105   9e-22   
ref|XP_006421147.1|  hypothetical protein CICLE_v10006774mg             104   2e-21   
ref|XP_002268910.2|  PREDICTED: LRR receptor-like serine/threonin...    104   2e-21   Vitis vinifera
gb|KEH25182.1|  LRR receptor-like kinase family protein                 104   2e-21   
ref|XP_006422068.1|  hypothetical protein CICLE_v10007021mg             103   2e-21   
ref|XP_004301719.1|  PREDICTED: LRR receptor-like serine/threonin...    104   2e-21   
emb|CAN64227.1|  hypothetical protein VITISV_011552                     104   2e-21   Vitis vinifera
ref|XP_010662440.1|  PREDICTED: LRR receptor-like serine/threonin...    104   3e-21   
ref|XP_004243038.2|  PREDICTED: probable LRR receptor-like serine...    103   3e-21   
gb|KEH25178.1|  LRR receptor-like kinase family protein                 103   3e-21   
gb|KDO38052.1|  hypothetical protein CISIN_1g002556mg                   103   3e-21   
gb|AAR28378.1|  EIX receptor 2                                          103   4e-21   Solanum lycopersicum
gb|KEH16824.1|  leucine-rich receptor-like kinase family protein,...    103   4e-21   
ref|XP_006490685.1|  PREDICTED: probable LRR receptor-like serine...    103   6e-21   
ref|XP_006493510.1|  PREDICTED: probable LRR receptor-like serine...    102   7e-21   
ref|XP_006422088.1|  hypothetical protein CICLE_v10007102mg             102   7e-21   
emb|CAN63562.1|  hypothetical protein VITISV_037178                   96.7    8e-21   Vitis vinifera
emb|CAN77037.1|  hypothetical protein VITISV_012666                     102   1e-20   Vitis vinifera
gb|KDO50394.1|  hypothetical protein CISIN_1g0477971mg                98.6    2e-20   
gb|KEH25184.1|  LRR receptor-like kinase family protein                 101   2e-20   
gb|KEH25183.1|  leucine-rich receptor-like kinase family protein      99.0    2e-20   
gb|KDO48216.1|  hypothetical protein CISIN_1g037539mg                   100   3e-20   
gb|AAS79568.1|  putative disease resistance protein                   99.4    3e-20   Ipomoea trifida
ref|XP_002270042.1|  PREDICTED: receptor-like protein 12                100   3e-20   Vitis vinifera
ref|XP_011099243.1|  PREDICTED: LRR receptor-like serine/threonin...    100   4e-20   
ref|XP_010662623.1|  PREDICTED: receptor-like protein 12 isoform X1     100   5e-20   
ref|XP_006421148.1|  hypothetical protein CICLE_v10006496mg             100   5e-20   
gb|KEH16823.1|  leucine-rich receptor-like kinase family protein,...  99.8    5e-20   
gb|KEH16826.1|  LRR receptor-like kinase                              99.8    6e-20   
ref|XP_010266617.1|  PREDICTED: probable LRR receptor-like serine...    100   6e-20   
emb|CBI22583.3|  unnamed protein product                              99.4    7e-20   
ref|XP_010671924.1|  PREDICTED: probable leucine-rich repeat rece...  97.8    2e-19   
ref|XP_004507279.1|  PREDICTED: probable leucine-rich repeat rece...  98.6    2e-19   
gb|KEH25176.1|  LRR receptor-like kinase family protein               98.6    2e-19   
ref|XP_004309282.1|  PREDICTED: phytosulfokine receptor 1-like        95.1    2e-19   
ref|XP_006493507.1|  PREDICTED: probable LRR receptor-like serine...  97.8    3e-19   
ref|XP_008364570.1|  PREDICTED: DNA-damage-repair/toleration prot...  93.2    3e-19   
ref|XP_010672172.1|  PREDICTED: probable leucine-rich repeat rece...  97.4    5e-19   
ref|XP_003636154.1|  Receptor-like protein kinase                     93.6    9e-19   
ref|XP_008226021.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  96.3    1e-18   
ref|XP_010662638.1|  PREDICTED: probable leucine-rich repeat rece...  95.9    1e-18   
gb|KDP36592.1|  hypothetical protein JCGZ_08359                       95.5    1e-18   
ref|XP_008344477.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    1e-18   
ref|XP_006421133.1|  hypothetical protein CICLE_v10006997mg           95.5    1e-18   
ref|XP_006490686.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    2e-18   
ref|XP_006421149.1|  hypothetical protein CICLE_v10004252mg           95.5    2e-18   
ref|XP_007214009.1|  hypothetical protein PRUPE_ppa014796mg           95.5    2e-18   
ref|XP_008362832.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
gb|KEH33791.1|  LRR receptor-like kinase                              91.7    2e-18   
ref|XP_008367532.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-18   
gb|KEH16822.1|  LRR receptor-like kinase family protein               95.1    3e-18   
ref|XP_010323339.1|  PREDICTED: LRR receptor-like serine/threonin...  95.1    3e-18   
ref|XP_007220272.1|  hypothetical protein PRUPE_ppa000998mg           94.7    3e-18   
emb|CAN64389.1|  hypothetical protein VITISV_018647                   94.4    4e-18   Vitis vinifera
ref|XP_008382520.1|  PREDICTED: LRR receptor-like serine/threonin...  94.4    4e-18   
ref|XP_009378505.1|  PREDICTED: receptor-like protein 2               93.6    5e-18   
ref|XP_007212689.1|  hypothetical protein PRUPE_ppa018526m1g          90.1    5e-18   
ref|XP_008244901.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    5e-18   
ref|XP_006421146.1|  hypothetical protein CICLE_v10006889mg           94.0    5e-18   
ref|XP_007212410.1|  hypothetical protein PRUPE_ppa016435mg           94.4    6e-18   
ref|XP_009610906.1|  PREDICTED: LRR receptor-like serine/threonin...  94.0    7e-18   
ref|XP_007214101.1|  hypothetical protein PRUPE_ppa016834mg           94.0    7e-18   
ref|XP_007218828.1|  hypothetical protein PRUPE_ppa010140mg           90.1    7e-18   
gb|KHN09226.1|  Probably inactive leucine-rich repeat receptor-li...  90.1    9e-18   
ref|XP_004308379.1|  PREDICTED: probable LRR receptor-like serine...  91.7    1e-17   
gb|KHN10053.1|  Leucine-rich repeat receptor-like serine/threonin...  89.4    1e-17   
ref|XP_010662639.1|  PREDICTED: probable leucine-rich repeat rece...  93.2    1e-17   
ref|XP_010662437.1|  PREDICTED: receptor-like protein 12 isoform X2   92.4    1e-17   
ref|XP_008343845.1|  PREDICTED: probable LRR receptor-like serine...  92.8    1e-17   
emb|CAN59765.1|  hypothetical protein VITISV_036905                   89.7    2e-17   Vitis vinifera
ref|XP_010662436.1|  PREDICTED: LRR receptor-like serine/threonin...  92.4    2e-17   
ref|XP_009375612.1|  PREDICTED: probable LRR receptor-like serine...  92.0    2e-17   
emb|CAN79130.1|  hypothetical protein VITISV_029207                   92.4    2e-17   Vitis vinifera
ref|XP_007219202.1|  hypothetical protein PRUPE_ppa017031mg           92.0    3e-17   
ref|XP_004296191.1|  PREDICTED: receptor-like protein 2-like          91.7    3e-17   
ref|XP_008226588.1|  PREDICTED: receptor-like protein 2               91.3    3e-17   
ref|XP_007151892.1|  hypothetical protein PHAVU_004G084600g           92.0    3e-17   
gb|EYU34016.1|  hypothetical protein MIMGU_mgv1a0176472mg             88.2    3e-17   
ref|XP_010266618.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    3e-17   
ref|NP_001234427.1|  EIX receptor 1 precursor                         91.7    4e-17   
ref|XP_010323160.1|  PREDICTED: EIX receptor 1 isoform X1             91.7    4e-17   
ref|XP_009624409.1|  PREDICTED: receptor-like protein 12              91.3    4e-17   
ref|XP_007214523.1|  hypothetical protein PRUPE_ppa015660mg           91.3    5e-17   
ref|XP_010662782.1|  PREDICTED: probable LRR receptor-like serine...  91.3    5e-17   
ref|XP_002526134.1|  serine-threonine protein kinase, plant-type,...  87.4    5e-17   Ricinus communis
ref|XP_009375566.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    5e-17   
ref|XP_009375609.1|  PREDICTED: probable LRR receptor-like serine...  90.9    6e-17   
ref|XP_006599520.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    6e-17   
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    9e-17   Vitis vinifera
ref|XP_008376669.1|  PREDICTED: probable leucine-rich repeat rece...  90.5    9e-17   
ref|XP_009801726.1|  PREDICTED: receptor-like protein kinase          90.5    9e-17   
ref|XP_007021416.1|  Disease resistance family protein / LRR fami...  89.7    1e-16   
ref|XP_010662799.1|  PREDICTED: receptor-like protein 12              89.7    1e-16   
ref|XP_008232926.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    1e-16   
ref|XP_010671925.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    1e-16   
ref|XP_009368772.1|  PREDICTED: DNA-damage-repair/toleration prot...  85.9    1e-16   
ref|XP_009378506.1|  PREDICTED: receptor-like protein 2               89.0    1e-16   
ref|XP_006599518.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    1e-16   
ref|XP_004296198.1|  PREDICTED: probable leucine-rich repeat rece...  89.7    1e-16   
ref|XP_008226203.1|  PREDICTED: receptor-like protein 12              89.7    2e-16   
gb|KHN26502.1|  Putative LRR receptor-like serine/threonine-prote...  89.4    2e-16   
ref|XP_007212428.1|  hypothetical protein PRUPE_ppa016649mg           83.6    2e-16   
ref|XP_009627877.1|  PREDICTED: probable leucine-rich repeat rece...  89.4    2e-16   
ref|XP_007214755.1|  hypothetical protein PRUPE_ppa024905mg           89.4    2e-16   
gb|EYU34019.1|  hypothetical protein MIMGU_mgv1a002019mg              89.0    2e-16   
ref|XP_008365984.1|  PREDICTED: receptor-like protein 12              86.7    2e-16   
ref|XP_009355165.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    2e-16   
ref|XP_008366594.1|  PREDICTED: receptor-like protein 2               89.0    2e-16   
ref|XP_007021422.1|  Disease resistance family protein / LRR fami...  89.0    2e-16   
emb|CAN79880.1|  hypothetical protein VITISV_031344                   89.0    2e-16   Vitis vinifera
ref|XP_006374305.1|  hypothetical protein POPTR_0015s05870g           89.0    2e-16   
ref|XP_006607058.1|  PREDICTED: probable LRR receptor-like serine...  89.0    2e-16   
ref|XP_004305479.1|  PREDICTED: probable LRR receptor-like serine...  89.0    3e-16   
ref|XP_009394659.1|  PREDICTED: probable leucine-rich repeat rece...  85.9    3e-16   
ref|XP_007219854.1|  hypothetical protein PRUPE_ppa027060mg           88.6    3e-16   
ref|XP_007213359.1|  hypothetical protein PRUPE_ppa026938mg           86.3    3e-16   
ref|XP_007203166.1|  hypothetical protein PRUPE_ppa025019mg           88.6    3e-16   
ref|XP_007219665.1|  hypothetical protein PRUPE_ppa025228mg           88.2    3e-16   
emb|CBI17238.3|  unnamed protein product                              88.2    3e-16   
ref|XP_007021417.1|  Disease resistance family protein / LRR fami...  88.6    3e-16   
ref|XP_009387210.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    4e-16   
ref|XP_006446689.1|  hypothetical protein CICLE_v10017769mg           88.6    4e-16   
ref|XP_010650299.1|  PREDICTED: probable LRR receptor-like serine...  88.2    4e-16   
ref|XP_003629986.1|  Receptor-like protein kinase                     88.2    4e-16   
ref|XP_009352122.1|  PREDICTED: probable leucine-rich repeat rece...  88.2    4e-16   
ref|XP_006599523.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    5e-16   
ref|XP_010650298.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    5e-16   
ref|XP_009760943.1|  PREDICTED: LRR receptor-like serine/threonin...  87.8    6e-16   
ref|XP_008362830.1|  PREDICTED: receptor-like protein 12              87.8    6e-16   
emb|CBI22716.3|  unnamed protein product                              87.4    7e-16   
ref|XP_008376041.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    7e-16   
ref|XP_007219249.1|  hypothetical protein PRUPE_ppa018051mg           87.4    8e-16   
ref|XP_008231965.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    8e-16   
ref|XP_011099254.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    9e-16   
ref|XP_007214288.1|  hypothetical protein PRUPE_ppb000367mg           87.4    9e-16   
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  87.4    9e-16   Vitis vinifera
gb|KHN09276.1|  Protein BRASSINOSTEROID INSENSITIVE 1                 85.5    9e-16   
ref|XP_006599527.1|  PREDICTED: probable LRR receptor-like serine...  86.7    9e-16   
ref|XP_010650302.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    9e-16   
ref|XP_008355013.1|  PREDICTED: receptor-like protein 2               85.9    9e-16   
ref|XP_009370715.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    1e-15   
gb|KEH33781.1|  LRR receptor-like kinase                              87.0    1e-15   
ref|XP_010671582.1|  PREDICTED: receptor-like protein 12              87.0    1e-15   
gb|KHN02657.1|  LRR receptor-like serine/threonine-protein kinase...  87.0    1e-15   
ref|XP_009368581.1|  PREDICTED: receptor-like protein 12              87.0    1e-15   
ref|XP_006360385.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    1e-15   
ref|XP_008226566.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  86.3    1e-15   
ref|XP_011010632.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    1e-15   
ref|XP_006599537.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    2e-15   
ref|XP_009367835.1|  PREDICTED: probable LRR receptor-like serine...  86.3    2e-15   
ref|XP_006470464.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    2e-15   
ref|XP_008384510.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  82.8    2e-15   
emb|CAN71913.1|  hypothetical protein VITISV_032859                   86.3    2e-15   Vitis vinifera
gb|KHN19731.1|  Probably inactive leucine-rich repeat receptor-li...  85.5    2e-15   
ref|XP_006599535.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    2e-15   
ref|XP_008376042.1|  PREDICTED: serine/threonine-protein kinase B...  85.1    2e-15   
ref|XP_011015141.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   
ref|XP_006600020.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   
ref|XP_011010633.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   
ref|XP_006599536.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    3e-15   
ref|XP_003599887.1|  Receptor-like kinase                             85.1    3e-15   
ref|XP_003629983.1|  Receptor-like kinase                             85.9    3e-15   
ref|XP_007021415.1|  Disease resistance family protein / LRR fami...  85.5    3e-15   
ref|XP_008226571.1|  PREDICTED: receptor-like protein 2               85.5    3e-15   
ref|XP_009340406.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    3e-15   
gb|KHN34667.1|  Serine/threonine-protein kinase BRI1-like 2           85.1    3e-15   
ref|XP_008232801.1|  PREDICTED: probable LRR receptor-like serine...  85.5    3e-15   
emb|CBI22713.3|  unnamed protein product                              84.7    3e-15   
ref|XP_006600027.1|  PREDICTED: probable LRR receptor-like serine...  84.7    4e-15   
emb|CAN65307.1|  hypothetical protein VITISV_031879                   85.1    4e-15   Vitis vinifera
ref|XP_008226590.1|  PREDICTED: receptor-like protein 2               84.3    5e-15   
ref|XP_007219364.1|  hypothetical protein PRUPE_ppa019703mg           84.7    5e-15   
ref|XP_008393125.1|  PREDICTED: receptor-like protein kinase 2        84.3    5e-15   
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  84.7    5e-15   
ref|XP_009394655.1|  PREDICTED: probable leucine-rich repeat rece...  85.1    5e-15   
ref|XP_002276171.1|  PREDICTED: receptor-like protein 12              84.7    6e-15   Vitis vinifera
gb|KEH33780.1|  receptor-like protein                                 84.3    6e-15   
ref|XP_009367839.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    6e-15   
ref|XP_008383310.1|  PREDICTED: probable LRR receptor-like serine...  84.7    6e-15   
gb|KEH25984.1|  LRR receptor-like kinase                              83.2    7e-15   
ref|XP_009340411.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    7e-15   
ref|XP_009385818.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    7e-15   
gb|KEH33782.1|  receptor-like protein                                 84.3    8e-15   
ref|XP_008352735.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  84.0    8e-15   
ref|XP_009352118.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    8e-15   
ref|XP_009341489.1|  PREDICTED: receptor-like protein 2               84.0    8e-15   
ref|XP_008355014.1|  PREDICTED: receptor-like protein 2               84.0    8e-15   
ref|XP_006599542.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    9e-15   
ref|XP_004295535.1|  PREDICTED: serine/threonine-protein kinase B...  80.9    9e-15   
ref|XP_006599541.1|  PREDICTED: LRR receptor-like serine/threonin...  84.3    9e-15   
ref|XP_006599543.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    1e-14   
ref|XP_006599538.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    1e-14   
ref|XP_006599539.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    1e-14   
ref|XP_006599540.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    1e-14   
ref|XP_010087568.1|  LRR receptor-like serine/threonine-protein k...  84.0    1e-14   
ref|XP_009368629.1|  PREDICTED: probable LRR receptor-like serine...  84.0    1e-14   
ref|XP_008355404.1|  PREDICTED: receptor-like protein 2               80.9    1e-14   
ref|XP_008244648.1|  PREDICTED: systemin receptor SR160-like          83.2    1e-14   
ref|XP_010671855.1|  PREDICTED: receptor-like protein 12              84.0    1e-14   
ref|XP_004295756.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  82.8    1e-14   
ref|XP_008345134.1|  PREDICTED: receptor-like protein 2               83.2    1e-14   
gb|KHN09228.1|  Probably inactive leucine-rich repeat receptor-li...  83.2    1e-14   
emb|CAN71149.1|  hypothetical protein VITISV_040339                   83.6    1e-14   Vitis vinifera
ref|XP_009376584.1|  PREDICTED: receptor-like protein 2               83.2    2e-14   
ref|XP_009766484.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    2e-14   
ref|XP_008384515.1|  PREDICTED: receptor-like protein 2               82.4    2e-14   
ref|XP_009367863.1|  PREDICTED: receptor-like protein 12              83.2    2e-14   
ref|XP_010111049.1|  LRR receptor-like serine/threonine-protein k...  83.2    2e-14   
ref|XP_009342503.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    2e-14   
ref|XP_010646953.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-14   
ref|XP_008233039.1|  PREDICTED: systemin receptor SR160-like          83.2    2e-14   
ref|XP_009342502.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    2e-14   
ref|XP_008365880.1|  PREDICTED: receptor-like protein 2               82.8    2e-14   
emb|CAN67736.1|  hypothetical protein VITISV_022720                   83.6    2e-14   Vitis vinifera
ref|XP_010105709.1|  LRR receptor-like serine/threonine-protein k...  83.2    2e-14   
ref|XP_009365374.1|  PREDICTED: leucine-rich repeat receptor prot...  83.2    2e-14   
ref|XP_007021418.1|  Disease resistance family protein / LRR fami...  83.2    2e-14   
ref|XP_009389817.1|  PREDICTED: receptor-like protein 12              83.2    2e-14   
ref|XP_008349105.1|  PREDICTED: receptor-like protein 2               79.3    2e-14   
ref|XP_004295501.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-14   
ref|XP_009388360.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-14   
gb|KEH33796.1|  LRR receptor-like kinase                              82.4    2e-14   
ref|XP_009340165.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-14   
gb|KEH16228.1|  LRR receptor-like kinase                              79.3    2e-14   
ref|XP_008226514.1|  PREDICTED: receptor-like protein 2               82.8    2e-14   
ref|XP_008378408.1|  PREDICTED: DNA-damage-repair/toleration prot...  80.9    2e-14   
ref|XP_008371982.1|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-14   
gb|AES64024.2|  Serine/Threonine kinase, plant-type protein           82.8    2e-14   
ref|XP_009340164.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    2e-14   
ref|XP_007152115.1|  hypothetical protein PHAVU_004G1036001g          82.0    2e-14   
ref|XP_002273824.2|  PREDICTED: probable leucine-rich repeat rece...  82.8    2e-14   Vitis vinifera
ref|XP_003593773.1|  Receptor protein kinase-like protein             82.8    3e-14   
ref|XP_003553344.2|  PREDICTED: probably inactive leucine-rich re...  82.4    3e-14   
ref|XP_003599911.1|  Receptor-like protein kinase BRI1-like protein   82.4    3e-14   
ref|XP_011099231.1|  PREDICTED: probable leucine-rich repeat rece...  82.8    3e-14   
emb|CAN82211.1|  hypothetical protein VITISV_027552                   82.4    3e-14   Vitis vinifera
gb|AES70162.2|  receptor-like protein                                 82.4    3e-14   
ref|XP_008226031.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    3e-14   
gb|KEH28717.1|  LRR receptor-like kinase                              82.4    3e-14   
gb|KEH18521.1|  DNA-directed RNA polymerase                           82.8    3e-14   
ref|XP_007152110.1|  hypothetical protein PHAVU_004G1032001g          80.9    3e-14   
ref|XP_008372144.1|  PREDICTED: uncharacterized protein LOC103435527  78.6    3e-14   
ref|XP_008358880.1|  PREDICTED: receptor-like protein 2               82.0    3e-14   
ref|XP_008365987.1|  PREDICTED: DNA-damage-repair/toleration prot...  81.6    3e-14   
ref|XP_008360818.1|  PREDICTED: probable LRR receptor-like serine...  82.4    3e-14   
ref|XP_008226592.1|  PREDICTED: receptor-like protein 2               82.0    4e-14   
ref|XP_008364270.1|  PREDICTED: probable leucine-rich repeat rece...  82.0    4e-14   
ref|XP_009604029.1|  PREDICTED: probable LRR receptor-like serine...  82.4    4e-14   
ref|XP_009389812.1|  PREDICTED: probable LRR receptor-like serine...  81.6    4e-14   
ref|XP_009351266.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    4e-14   
ref|XP_008226593.1|  PREDICTED: receptor-like protein 2               82.0    4e-14   
ref|XP_007214150.1|  hypothetical protein PRUPE_ppa018847mg           82.0    4e-14   
ref|XP_004506955.1|  PREDICTED: probable leucine-rich repeat rece...  81.6    4e-14   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   82.0    5e-14   
gb|KEH25981.1|  disease resistance family protein/LRR protein, pu...  82.0    5e-14   
ref|XP_008383312.1|  PREDICTED: leucine-rich repeat receptor prot...  78.2    5e-14   
ref|XP_008372137.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    5e-14   
ref|XP_003604806.1|  Receptor-like protein kinase                     81.6    5e-14   
ref|XP_008349123.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    6e-14   
ref|XP_009610905.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    6e-14   
ref|XP_007151421.1|  hypothetical protein PHAVU_004G044800g           81.6    6e-14   
ref|XP_003599673.1|  Receptor kinase-like protein                     81.3    6e-14   
ref|XP_009376560.1|  PREDICTED: receptor-like protein 2               81.3    6e-14   
ref|XP_009367845.1|  PREDICTED: LRR receptor-like serine/threonin...  81.6    6e-14   
emb|CAN78140.1|  hypothetical protein VITISV_019846                   81.3    6e-14   
ref|XP_002273469.1|  PREDICTED: receptor-like protein 12              81.3    7e-14   
ref|XP_009365382.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    7e-14   
ref|XP_007024895.1|  Disease resistance family protein / LRR fami...  81.3    7e-14   
ref|XP_007213197.1|  hypothetical protein PRUPE_ppa026674mg           81.3    8e-14   
ref|XP_010660821.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    8e-14   
ref|XP_009367821.1|  PREDICTED: probable LRR receptor-like serine...  80.5    8e-14   
emb|CBI21366.3|  unnamed protein product                              80.9    9e-14   
dbj|BAF98231.1|  CM0545.560.nc                                        76.3    9e-14   
ref|XP_008338509.1|  PREDICTED: receptor-like protein 2               80.9    9e-14   
ref|XP_003599904.1|  Receptor-like protein kinase                     80.5    1e-13   
ref|XP_009356800.1|  PREDICTED: receptor-like protein 2               80.5    1e-13   
ref|XP_003633782.1|  PREDICTED: receptor-like protein 12              80.9    1e-13   
ref|XP_009365390.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  77.4    1e-13   
ref|XP_003596742.1|  Receptor-like protein kinase                     80.5    1e-13   
ref|XP_009394674.1|  PREDICTED: receptor-like protein 12              80.9    1e-13   
ref|XP_007151422.1|  hypothetical protein PHAVU_004G044900g           80.9    1e-13   
ref|XP_010662750.1|  PREDICTED: receptor-like protein 2               77.8    1e-13   
ref|XP_003633783.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    1e-13   
gb|KEH33739.1|  receptor-like protein                                 79.7    1e-13   
ref|XP_002264905.3|  PREDICTED: LRR receptor-like serine/threonin...  80.5    1e-13   
ref|XP_009777089.1|  PREDICTED: leucine-rich repeat receptor prot...  80.1    1e-13   
gb|KHN09274.1|  Putative LRR receptor-like serine/threonine-prote...  80.1    1e-13   
ref|XP_008351469.1|  PREDICTED: receptor-like protein 2               79.7    1e-13   
ref|XP_009375006.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  80.5    1e-13   
ref|XP_007220047.1|  hypothetical protein PRUPE_ppa026338mg           80.5    1e-13   
ref|XP_006599971.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    1e-13   
gb|KEH33540.1|  leucine-rich receptor-like kinase family protein      80.5    1e-13   
emb|CAN75075.1|  hypothetical protein VITISV_026260                   80.5    1e-13   
ref|XP_008244921.1|  PREDICTED: probable LRR receptor-like serine...  80.5    1e-13   
ref|XP_009365385.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    1e-13   
ref|XP_007031845.1|  Serine/threonine-protein kinase bri1, putative   80.5    2e-13   
ref|XP_004308378.1|  PREDICTED: probable LRR receptor-like serine...  75.9    2e-13   
emb|CBI22742.3|  unnamed protein product                              80.1    2e-13   
ref|XP_003635305.2|  PREDICTED: leucine-rich repeat receptor prot...  80.1    2e-13   
ref|XP_006374272.1|  hypothetical protein POPTR_0015s05580g           80.1    2e-13   
ref|XP_007152117.1|  hypothetical protein PHAVU_004G103700g           80.1    2e-13   
gb|AES70145.2|  receptor-like protein                                 79.7    2e-13   
gb|AFK41089.1|  unknown                                               74.7    2e-13   
ref|XP_003599902.1|  LRR receptor-like serine/threonine-protein k...  79.7    2e-13   
ref|XP_002273126.2|  PREDICTED: leucine-rich repeat receptor prot...  79.7    2e-13   
ref|XP_008226578.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  79.3    2e-13   
ref|XP_010662758.1|  PREDICTED: receptor-like protein 12 isoform X2   79.7    2e-13   
ref|XP_010662757.1|  PREDICTED: receptor-like protein 12 isoform X1   79.7    2e-13   
ref|XP_008227330.1|  PREDICTED: receptor-like protein 2               79.3    3e-13   
ref|XP_006600026.1|  PREDICTED: leucine-rich repeat receptor prot...  79.7    3e-13   
ref|XP_004308368.1|  PREDICTED: probable LRR receptor-like serine...  79.3    3e-13   
ref|XP_009766483.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    3e-13   
ref|XP_009766482.1|  PREDICTED: probable LRR receptor-like serine...  79.7    3e-13   
gb|KHN28133.1|  LRR receptor-like serine/threonine-protein kinase...  79.3    3e-13   
ref|XP_008237614.1|  PREDICTED: receptor-like protein 2               77.0    3e-13   
ref|XP_008353997.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    3e-13   
ref|XP_009389813.1|  PREDICTED: receptor-like protein 12              79.3    3e-13   
ref|XP_008354989.1|  PREDICTED: probable LRR receptor-like serine...  79.3    3e-13   
ref|XP_006350057.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    3e-13   
ref|XP_003616941.1|  Receptor kinase                                  79.3    3e-13   
gb|KEH25999.1|  receptor-like protein                                 79.3    3e-13   
ref|XP_010646995.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    3e-13   
gb|KEH33608.1|  LRR receptor-like kinase family protein               79.0    3e-13   
ref|XP_004297583.1|  PREDICTED: probable LRR receptor-like serine...  77.4    3e-13   
ref|XP_008382164.1|  PREDICTED: receptor-like protein 2               79.0    3e-13   
ref|XP_010662760.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    4e-13   
ref|XP_002322196.2|  hypothetical protein POPTR_0015s05940g           79.0    4e-13   
gb|KHN23033.1|  Serine/threonine-protein kinase BRI1-like 2           78.6    4e-13   
ref|XP_010660819.1|  PREDICTED: receptor-like protein 12              79.3    4e-13   
ref|XP_009364149.1|  PREDICTED: receptor-like protein 2               79.0    4e-13   
ref|XP_010672176.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    4e-13   
emb|CCH50972.1|  T4.11                                                74.3    4e-13   
gb|KEH33696.1|  LRR receptor-like kinase                              78.6    4e-13   
ref|XP_010046670.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  76.3    4e-13   
gb|KHN09223.1|  Somatic embryogenesis receptor kinase 1               75.9    5e-13   
ref|XP_007212434.1|  hypothetical protein PRUPE_ppa017185mg           79.0    5e-13   
gb|KEH16825.1|  LRR receptor-like kinase family protein               78.6    5e-13   
gb|AES99899.2|  receptor-like protein                                 79.0    5e-13   
ref|XP_008232934.1|  PREDICTED: leucine-rich repeat receptor prot...  77.0    5e-13   
emb|CBI40045.3|  unnamed protein product                              79.0    5e-13   
gb|KEH25986.1|  leucine-rich receptor-like kinase family protein,...  78.6    5e-13   
gb|KEH25985.1|  leucine-rich receptor-like kinase family protein,...  78.2    5e-13   
gb|KEH33711.1|  receptor-like protein                                 78.6    5e-13   
ref|XP_008349126.1|  PREDICTED: probable LRR receptor-like serine...  77.4    5e-13   
ref|XP_009335211.1|  PREDICTED: receptor-like protein 2               78.6    5e-13   
gb|KEH33792.1|  LRR receptor-like kinase                              78.6    5e-13   
emb|CAN78838.1|  hypothetical protein VITISV_037334                   78.6    6e-13   
ref|XP_010662622.1|  PREDICTED: putative leucine-rich repeat rece...  78.2    6e-13   
ref|XP_009363373.1|  PREDICTED: uncharacterized protein LOC103953355  75.1    6e-13   
ref|XP_009394657.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    6e-13   
ref|XP_009340407.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    6e-13   
ref|XP_009371763.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    6e-13   
gb|KEH33797.1|  receptor-like protein                                 76.6    6e-13   
emb|CBI22585.3|  unnamed protein product                              77.8    6e-13   
ref|XP_004242808.2|  PREDICTED: probable leucine-rich repeat rece...  78.6    6e-13   
ref|XP_009385819.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    7e-13   
ref|XP_008231133.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    7e-13   
ref|XP_008349122.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    7e-13   
ref|XP_010646952.1|  PREDICTED: receptor-like protein 12              75.9    8e-13   
ref|XP_008384509.1|  PREDICTED: receptor-like protein 2               77.0    8e-13   
ref|XP_007038696.1|  Disease resistance family protein / LRR fami...  78.2    8e-13   
ref|XP_006600065.1|  PREDICTED: probably inactive leucine-rich re...  76.6    8e-13   
ref|XP_003599915.1|  Receptor-like protein kinase                     77.8    8e-13   
gb|ACU21035.1|  unknown                                               73.9    8e-13   
ref|XP_009361867.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    9e-13   
ref|XP_007213308.1|  hypothetical protein PRUPE_ppb023904mg           77.8    9e-13   
ref|XP_010671922.1|  PREDICTED: receptor-like protein 12              78.2    9e-13   
ref|XP_009365387.1|  PREDICTED: receptor-like protein 12              77.4    9e-13   
gb|KEH33784.1|  LRR receptor-like kinase                              77.8    1e-12   
ref|XP_008226320.1|  PREDICTED: probable LRR receptor-like serine...  77.8    1e-12   
ref|XP_004295504.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
ref|XP_008355012.1|  PREDICTED: receptor-like protein 2               77.4    1e-12   
ref|XP_003633794.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
ref|XP_008240711.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    1e-12   
ref|XP_009367822.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    1e-12   
ref|XP_007148700.1|  hypothetical protein PHAVU_005G007200g           77.4    1e-12   
ref|XP_008383307.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    1e-12   
ref|XP_006600046.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    1e-12   
ref|XP_003599884.1|  LRR receptor-like serine/threonine-protein k...  77.4    1e-12   
ref|XP_003631326.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    1e-12   
ref|XP_009349424.1|  PREDICTED: receptor-like protein 2               77.0    1e-12   
ref|XP_008341164.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...  75.9    1e-12   
ref|XP_006362463.1|  PREDICTED: receptor-like protein 12-like         77.4    1e-12   
ref|XP_009376551.1|  PREDICTED: receptor-like protein 2               77.0    1e-12   
ref|XP_007152275.1|  hypothetical protein PHAVU_004G115700g           77.0    1e-12   
gb|AES70135.2|  LRR receptor-like kinase                              77.0    1e-12   
ref|XP_006447088.1|  hypothetical protein CICLE_v10017744mg           77.0    1e-12   
ref|XP_009394666.1|  PREDICTED: uncharacterized protein LOC103980107  77.4    1e-12   
ref|XP_009335209.1|  PREDICTED: receptor-like protein 2               77.0    2e-12   
ref|XP_009368583.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    2e-12   
ref|XP_010046668.1|  PREDICTED: leucine-rich repeat receptor-like...  77.4    2e-12   
ref|XP_009340288.1|  PREDICTED: receptor-like protein 12              77.0    2e-12   
ref|XP_009367876.1|  PREDICTED: probable LRR receptor-like serine...  77.0    2e-12   
ref|XP_010662747.1|  PREDICTED: leucine-rich repeat receptor-like...  76.6    2e-12   
ref|XP_007152274.1|  hypothetical protein PHAVU_004G115700g           77.0    2e-12   
ref|XP_010911655.1|  PREDICTED: receptor-like protein 12              75.9    2e-12   
ref|XP_004296172.1|  PREDICTED: receptor-like protein 2-like          74.3    2e-12   
ref|XP_003634127.2|  PREDICTED: LRR receptor-like serine/threonin...  77.0    2e-12   
ref|XP_010907952.1|  PREDICTED: DNA-damage-repair/toleration prot...  75.1    2e-12   
ref|XP_006368502.1|  hypothetical protein POPTR_0001s03540g           77.0    2e-12   
ref|XP_002267411.3|  PREDICTED: polygalacturonase inhibitor-like      75.9    2e-12   
gb|KEH33788.1|  LRR receptor-like kinase                              76.6    2e-12   
ref|XP_010046665.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...  74.3    2e-12   
ref|XP_009342313.1|  PREDICTED: receptor-like protein 2               76.6    2e-12   
ref|XP_009335214.1|  PREDICTED: receptor-like protein 2               76.6    2e-12   
ref|XP_010907955.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    2e-12   
emb|CBI22612.3|  unnamed protein product                              76.3    2e-12   
ref|XP_007219119.1|  hypothetical protein PRUPE_ppa015797mg           76.6    2e-12   
gb|KEH19136.1|  receptor-like protein                                 72.0    3e-12   
ref|XP_007011099.1|  Disease resistance family protein / LRR fami...  75.9    3e-12   
ref|XP_010646797.1|  PREDICTED: receptor-like protein 12              74.7    3e-12   
ref|XP_004296183.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  75.9    3e-12   
ref|XP_003635304.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    3e-12   
ref|XP_008226567.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  75.9    3e-12   
ref|XP_009364147.1|  PREDICTED: receptor-like protein 2               76.3    3e-12   
ref|XP_009346965.1|  PREDICTED: receptor-like protein 12              76.3    3e-12   
ref|XP_007219738.1|  hypothetical protein PRUPE_ppa026113mg           76.3    3e-12   
ref|XP_010646994.1|  PREDICTED: probable LRR receptor-like serine...  75.9    3e-12   
gb|KHN13345.1|  Receptor-like protein 12                              75.9    3e-12   
gb|KEH19137.1|  leucine-rich receptor-like kinase family protein      72.0    3e-12   
ref|XP_007219810.1|  hypothetical protein PRUPE_ppa026594mg           75.9    3e-12   
ref|XP_010323482.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    3e-12   
ref|XP_006600069.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    3e-12   
ref|XP_003549056.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    3e-12   
gb|KHN11184.1|  Receptor-like protein 12                              75.9    4e-12   
ref|XP_006599582.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    4e-12   
gb|KHN45763.1|  LRR receptor-like serine/threonine-protein kinase...  75.9    4e-12   
gb|KHN42550.1|  LRR receptor-like serine/threonine-protein kinase...  75.9    4e-12   
ref|XP_006374306.1|  hypothetical protein POPTR_0015s05880g           75.9    4e-12   
ref|XP_006599588.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    4e-12   
ref|XP_009390490.1|  PREDICTED: probable leucine-rich repeat rece...  75.5    4e-12   
ref|XP_007220374.1|  hypothetical protein PRUPE_ppa018600mg           75.5    4e-12   
ref|XP_008244922.1|  PREDICTED: protein BRASSINOSTEROID INSENSITI...  75.1    4e-12   
ref|XP_009350829.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    4e-12   
ref|XP_008354000.1|  PREDICTED: LRR receptor-like serine/threonin...  75.9    4e-12   
ref|XP_004491130.1|  PREDICTED: probable LRR receptor-like serine...  75.9    5e-12   
ref|XP_008343401.1|  PREDICTED: putative leucine-rich repeat rece...  75.5    5e-12   
ref|XP_009351293.1|  PREDICTED: probable LRR receptor-like serine...  75.1    5e-12   
ref|XP_008226551.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  75.5    5e-12   
ref|XP_004491131.1|  PREDICTED: probable LRR receptor-like serine...  75.5    5e-12   
ref|XP_008355611.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  75.5    5e-12   
ref|XP_009366031.1|  PREDICTED: probable LRR receptor-like serine...  74.7    5e-12   
gb|KEH25993.1|  receptor-like protein, putative                       75.5    6e-12   
ref|XP_009342316.1|  PREDICTED: receptor-like protein 2               75.1    6e-12   
ref|XP_008383306.1|  PREDICTED: serine/threonine-protein kinase B...  74.7    6e-12   
ref|XP_004296307.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  75.1    6e-12   
ref|XP_010112629.1|  Receptor-like protein 12                         75.5    6e-12   
emb|CBI22744.3|  unnamed protein product                              73.9    6e-12   
ref|XP_009342314.1|  PREDICTED: receptor-like protein 2               75.1    6e-12   
ref|XP_009357570.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  74.3    6e-12   
gb|KHN35706.1|  LRR receptor-like serine/threonine-protein kinase...  75.1    6e-12   
ref|XP_003543996.2|  PREDICTED: LRR receptor-like serine/threonin...  75.1    6e-12   
ref|XP_009389815.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    6e-12   
ref|XP_003614276.1|  Receptor protein kinase-like protein             75.1    6e-12   
ref|XP_006480247.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    6e-12   
ref|XP_007031844.1|  Serine/threonine-protein kinase bri1, putative   75.1    7e-12   
gb|AES97234.2|  receptor-like protein                                 75.1    7e-12   
ref|XP_002514939.1|  serine-threonine protein kinase, plant-type,...  75.1    7e-12   
gb|AAF19213.1|AF215729_1  unknown                                     74.7    7e-12   
ref|XP_009592881.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  72.8    7e-12   
ref|XP_007220932.1|  hypothetical protein PRUPE_ppa023754mg           75.1    7e-12   
ref|XP_002264037.2|  PREDICTED: LRR receptor-like serine/threonin...  74.7    8e-12   
ref|XP_008383284.1|  PREDICTED: receptor-like protein 12              75.1    8e-12   
ref|XP_008345386.1|  PREDICTED: tyrosine-sulfated glycopeptide re...  74.3    8e-12   
gb|KEH25922.1|  receptor-like protein                                 75.1    8e-12   
gb|KEH25977.1|  receptor-like protein                                 75.1    8e-12   
ref|XP_010046667.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    8e-12   
ref|XP_010038437.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    9e-12   
ref|XP_008243684.1|  PREDICTED: receptor-like protein 2               74.7    9e-12   
gb|KCW46428.1|  hypothetical protein EUGRSUZ_K00259                   74.7    9e-12   
ref|XP_008232918.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    1e-11   
ref|XP_009418865.1|  PREDICTED: LRR receptor-like serine/threonin...  74.7    1e-11   



>gb|KDO56861.1| hypothetical protein CISIN_1g039964mg [Citrus sinensis]
Length=175

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS NA +YAGN  LCG PLP KC  +  A     D+    E++D+ +TL FY
Sbjct  61   KIPSGTQLQSFNALTYAGNE-LCGLPLPNKCPTEESAPGPGKDNANTLEEEDQFITLGFY  119

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL   K+W YVT  V+  +LQR+F
Sbjct  120  VSLILGFFVGFWGFCGTLLVKSSWRHHYYNFLPGIKNWFYVTAVVNIAKLQRRF  173



>gb|KDO41706.1| hypothetical protein CISIN_1g0098352mg, partial [Citrus sinensis]
Length=117

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P           E++DD+ +TL 
Sbjct  1    KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLG  60

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+ ++LGF V FWG   TL L  SWR+ YY FL+  KDW+YVT  ++  +LQ+
Sbjct  61   FYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQK  114



>gb|KDO56862.1| hypothetical protein CISIN_1g0025142mg, partial [Citrus sinensis]
Length=439

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS NA++YAGN  LCG PLP KC ++  A +   DD    E++D+ +TL FY
Sbjct  325  KIPSGTQLQSFNASTYAGNE-LCGLPLPNKCPDEDLAPRPGKDDANTPEEEDQFITLGFY  383

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL+  ++W YVT  V+  +LQR+ 
Sbjct  384  VSLILGFFVGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYVTAVVNIAKLQRRL  437



>gb|KDO41143.1| hypothetical protein CISIN_1g0401091mg, partial [Citrus sinensis]
Length=232

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQ   A++YAGN  LCG PLP KC   E  P+          ++D D+ +TL 
Sbjct  115  KIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLG  174

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            FY+SM+LGF V FWG   TL +K SWR  YY FL+  KDW+YV   V+  +LQR+
Sbjct  175  FYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRR  229



>ref|XP_006421141.1| hypothetical protein CICLE_v10004374mg [Citrus clementina]
 gb|ESR34381.1| hypothetical protein CICLE_v10004374mg [Citrus clementina]
Length=773

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLPK C   E  P           E++DD+ +TL 
Sbjct  656  KIPLGTQLQSFNASVYAGNLELCGLPLPKKCPNEESTPCPGRNDGANTLEDEDDQFMTLG  715

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S++LGF V FWG   TL L  SWRY ++ FL+  KDW+YV   V+  +LQRKF
Sbjct  716  FYVSLILGFFVGFWGVCGTLMLNRSWRYGFFNFLTGMKDWIYVIAAVNIAKLQRKF  771



>ref|XP_006493499.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X1 [Citrus sinensis]
 ref|XP_006493500.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like isoform X2 [Citrus sinensis]
Length=253

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED---VPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL   + D    P+     D    E++DD+L+TL 
Sbjct  136  KIPLGTQLQSFNASVYAGNLELCGLPLANMYPDEESTPSPGTDDDSDTLEDEDDQLITLG  195

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG   TL L   WR+ Y+ FL+  KDWVYV + V+  +LQRKF
Sbjct  196  FYVSSILGFFVGFWGVCGTLMLNRPWRHGYFNFLTGMKDWVYVIVAVNIAKLQRKF  251



>ref|XP_006421142.1| hypothetical protein CICLE_v10004251mg [Citrus clementina]
 gb|ESR34382.1| hypothetical protein CICLE_v10004251mg [Citrus clementina]
Length=963

 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL       E  P      D    E++DD+ LTLE
Sbjct  846  KIPLGTQLQSFNASVYAGNLELCGLPLANMCPDEESTPTPGTDDDSDTLEDEDDQFLTLE  905

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG   TL L  SWR+ Y+ FL+  KDWVYVT  V+  +LQRKF
Sbjct  906  FYVSSILGFFVGFWGVCGTLMLNRSWRHGYFNFLTGMKDWVYVTAAVNIAKLQRKF  961



>ref|XP_006490598.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like isoform X2 [Citrus sinensis]
Length=940

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS NA++YAGN  LCG PLP KC ++  A +   DD    E++D+ +TL FY
Sbjct  826  KIPSGTQLQSFNASTYAGNE-LCGLPLPNKCPDEDLAPRPGKDDANTPEEEDQFITLGFY  884

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL+  ++W YVT  V+  +LQR+ 
Sbjct  885  VSLILGFFVGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYVTAVVNIAKLQRRL  938



>ref|XP_006490597.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like isoform X1 [Citrus sinensis]
Length=972

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS NA++YAGN  LCG PLP KC ++  A +   DD    E++D+ +TL FY
Sbjct  858  KIPSGTQLQSFNASTYAGNE-LCGLPLPNKCPDEDLAPRPGKDDANTPEEEDQFITLGFY  916

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL+  ++W YVT  V+  +LQR+ 
Sbjct  917  VSLILGFFVGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYVTAVVNIAKLQRRL  970



>gb|KDO37548.1| hypothetical protein CISIN_1g0482902mg, partial [Citrus sinensis]
Length=118

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL  KC   E  P+     D    E+++D+ +TL 
Sbjct  1    KIPLGTQLQSFNASVYAGNLELCGLPLANKCPDEESTPSPGTDDDSDTLEDENDQFITLG  60

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG   TL L  SWRY ++ FL+  KDWVYV   V+  +L RKF
Sbjct  61   FYLSSILGFFVGFWGVCGTLMLNRSWRYGFFNFLTSMKDWVYVIWAVNIAKLLRKF  116



>ref|XP_006493513.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=978

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL  KC   E  P           E++DD+ +TL 
Sbjct  861  KIPLGTQLQSFNASVYAGNLELCGLPLANKCPNEESTPCPGRNDGANTLEDEDDQFMTLG  920

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S++LGF V FWG   TL L  SWR+ Y+ FL+  KDWVYVT  V+  +LQRKF
Sbjct  921  FYVSLILGFFVGFWGVCGTLMLNRSWRHGYFNFLTSMKDWVYVTAAVNIAKLQRKF  976



>gb|KDO38587.1| hypothetical protein CISIN_1g043041mg [Citrus sinensis]
Length=395

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHE-DVPAIKekgddyeeeeddDRLLTLEF  498
            KIPSGTQLQS NA++YAGN  LCG PLP KC + D+P  +   DD    E++D+ +TL F
Sbjct  281  KIPSGTQLQSFNASTYAGNE-LCGLPLPNKCPDGDLPP-RPGKDDANTREEEDQFITLGF  338

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+S++LGF   FWGF  TL +K SWR+ YY FL+  ++W Y+T  V+  +LQR+F
Sbjct  339  YVSLILGFFSGFWGFCGTLLVKSSWRHRYYNFLTGIENWFYMTAVVNIAKLQRRF  393



>ref|XP_006422087.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
 gb|ESR35327.1| hypothetical protein CICLE_v10007014mg [Citrus clementina]
Length=956

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS + + YAGN  LCG PLP KC ++  A     DD +  ED+D+ +TL FY
Sbjct  842  KIPSGTQLQSFSTSMYAGNE-LCGLPLPNKCPDEDSAPGPGKDDAKTSEDEDQFITLGFY  900

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL+  K+W YVT  V+  +LQR+F
Sbjct  901  VSLILGFVVGFWGFCGTLLVKSSWRHRYYNFLTGVKNWFYVTAVVNIAKLQRRF  954



>ref|XP_006490687.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
 gb|KDO56859.1| hypothetical protein CISIN_1g046848mg [Citrus sinensis]
Length=956

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS + + YAGN  LCG PLP KC ++  A     DD    ED+D+ +TL FY
Sbjct  842  KIPSGTQLQSFSTSMYAGNE-LCGLPLPNKCPDEDSAPGPGKDDANTSEDEDQFITLGFY  900

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF V FWGF  TL +K SWR+ YY FL+  K+W YVT  V+  +LQR+F
Sbjct  901  VSLILGFFVGFWGFCGTLLVKSSWRHRYYNFLTGVKNWFYVTAVVNIAKLQRRF  954



>ref|XP_006493494.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g12460-like [Citrus sinensis]
Length=356

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED---VPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL   + D    P+     D    E++DD+L+TL 
Sbjct  239  KIPLGTQLQSFNASVYAGNLELCGLPLANMYPDEESTPSPGTDDDSDTLEDEDDQLITLG  298

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG   TL L   WR+ Y+ FL+  KDWVYV   V+  +LQRKF
Sbjct  299  FYVSSILGFFVGFWGVCGTLMLNRPWRHGYFNFLTGMKDWVYVIAAVNISKLQRKF  354



>ref|XP_006494168.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Citrus sinensis]
Length=1009

 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIK--ekgddyeeeeddDRLLTLE  501
            KIP GTQLQS  A++YAGNS LCG PLP KC ++  A+           +EDDD+ +T+ 
Sbjct  861  KIPKGTQLQSFGASTYAGNSELCGLPLPNKCPDEESALSPGRDDAYNTPDEDDDQFITVG  920

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            FY+SM+LGF V FWG   TL +K SWR+ YY FL+  KDW+YV   V+  +LQR+
Sbjct  921  FYLSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTGVKDWLYVKAVVNIAKLQRR  975



>ref|XP_006493496.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Citrus sinensis]
Length=524

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P           E++DD+ +TL 
Sbjct  408  KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLG  467

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+ ++LGF V FWG   TL L  SWR+ YY FL+  KDW+YVT  ++  +LQ+
Sbjct  468  FYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQK  521



>gb|KDO37095.1| hypothetical protein CISIN_1g045886mg [Citrus sinensis]
Length=184

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL       E  P+     D    E++DD+ +TL 
Sbjct  67   KIPLGTQLQSFNASVYAGNLELCGLPLANMCPDEESTPSPGTDDDSDTLEDEDDQFITLG  126

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG    L L  SW Y Y+ FL+  KDWVYV   V+  +LQRKF
Sbjct  127  FYVSSILGFFVGFWGVCGYLMLNRSWSYGYFNFLTGMKDWVYVISAVNIAKLQRKF  182



>ref|XP_010662626.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
 ref|XP_010662627.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
 ref|XP_010662628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
Length=660

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = -3

Query  683  ILH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT  507
            IL  KIPSGTQLQS NA++Y GN GLCG PL  KC ED            EE+  D    
Sbjct  541  ILSGKIPSGTQLQSFNASTYDGNPGLCGPPLLKKCQEDENREVSFTGLSNEEDIQDDANN  600

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            + FY ++VLGF + FWG   TL L  SWRYAY++FLS  KDW+YVT  V+  +++R  
Sbjct  601  IWFYGNIVLGFIIGFWGVCGTLLLNSSWRYAYFQFLSKIKDWLYVTTTVNMNKVRRSL  658



>ref|XP_006420957.1| hypothetical protein CICLE_v10006412mg, partial [Citrus clementina]
 gb|ESR34197.1| hypothetical protein CICLE_v10006412mg, partial [Citrus clementina]
Length=956

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQ   A++YAGN  LCG PLP KC   E  P+       Y  ++D D+ +TL 
Sbjct  842  KIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYYTPDDDGDQFITLG  901

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            FY+SM+LGF V FWG   TL +K SWR+ YY FL+  KDW+YV   V+  +LQR+
Sbjct  902  FYMSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTRVKDWLYVEAVVNIAKLQRR  956



>gb|KDO41677.1| hypothetical protein CISIN_1g047190mg [Citrus sinensis]
Length=1025

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 74/115 (64%), Gaps = 3/115 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQ   A++YAGN  LCG PLP KC   E  P+       Y  ++D D+ +TL 
Sbjct  838  KIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYYTPDDDGDQFITLG  897

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            FY+SM+LGF V FWG   TL +K SWR+ YY FL+  KDW+YV   V+  +LQR+
Sbjct  898  FYMSMILGFFVGFWGVCGTLLVKSSWRHGYYNFLTRVKDWLYVEAVVNIAKLQRR  952



>ref|XP_006493495.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Citrus sinensis]
Length=704

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P           E++DD+ +TL 
Sbjct  588  KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLG  647

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+ ++LGF V FWG   TL L  SWR+ YY FL+  KDW+YVT  ++  +LQ+
Sbjct  648  FYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQK  701



>ref|XP_006493493.1| PREDICTED: protein BRASSINOSTEROID INSENSITIVE 1-like [Citrus 
sinensis]
Length=543

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL       E  P+     D    E++DD+ +TL 
Sbjct  427  KIPLGTQLQSFNASVYAGNLELCGFPLANMCPDEESAPSPGTDDDSDTLEDEDDQFITLG  486

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+S++LGF V FWG   TL L  SWRY YY FL+  KDW+YVT  V+  +LQ+
Sbjct  487  FYVSLILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYVTAAVNIAKLQK  540



>gb|KDO56839.1| hypothetical protein CISIN_1g0483511mg, partial [Citrus sinensis]
Length=574

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDV----PAIKekgddyeeeeddDRLLT  507
            KIP+GTQLQS NA+ Y GN  LCG PLP KC ++     PAI +  DD +  ED+D+ +T
Sbjct  455  KIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFIT  514

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            L F+++++LGF V FWG   TL L +SW++ +Y FL+ +KDW+YVT  V+  ++Q+K
Sbjct  515  LGFFVTLILGFIVGFWGVCGTLLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQK  571



>ref|XP_006421143.1| hypothetical protein CICLE_v10004253mg [Citrus clementina]
 gb|ESR34383.1| hypothetical protein CICLE_v10004253mg [Citrus clementina]
Length=959

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P           E++DD+ +TL 
Sbjct  843  KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPDEESTPLPGRNDGANTLEDEDDQFMTLG  902

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+ ++LGF V FWG   TL L  SWR+ YY FL+  KDW+YVT  ++  +LQ+
Sbjct  903  FYVGLILGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAALNIAKLQK  956



>ref|XP_006493087.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=1457

 Score =   106 bits (265),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
             KIP GTQLQ   A++YAGN  LCG PLP KC   E  P+          ++D D+ +TL 
Sbjct  1340  KIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLG  1399

Query  500   FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             FY+SM+LGF V FWG   TL +K SWR  YY FL+  KDW+YV   V+  +LQR+
Sbjct  1400  FYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRR  1454



>ref|XP_006422085.1| hypothetical protein CICLE_v10006573mg [Citrus clementina]
 gb|ESR35325.1| hypothetical protein CICLE_v10006573mg [Citrus clementina]
Length=875

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQS NA+ YAGN  LCG PL  KC ++  A   + DD    E +D+L+T  FY
Sbjct  760  KIPLGTQLQSFNASVYAGNPELCGLPLRNKCPDEDSAASPERDDANTPEGEDQLITFGFY  819

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S++LGF + FWG   TL +  SWR+ Y++FL+  KDWVY+   V+  +LQR F
Sbjct  820  VSVILGFFIGFWGVCGTLLVNTSWRHGYFKFLTSVKDWVYLITAVNIAKLQRTF  873



>ref|XP_006421144.1| hypothetical protein CICLE_v10007027mg [Citrus clementina]
 gb|ESR34384.1| hypothetical protein CICLE_v10007027mg [Citrus clementina]
Length=959

 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS  A+ YAGN  LCG PLPK C   E  P      D    E++DD+ +TL 
Sbjct  843  KIPFGTQLQSFCASVYAGNPELCGLPLPKKCPDEESTPLPGRNDDANTLEDEDDQFMTLR  902

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+ ++LGF V FWG   TL L  SWRY YY FL+  KDW+YVT  V+  +LQ+
Sbjct  903  FYVGLILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYVTAAVNIAKLQK  956



>ref|XP_006421134.1| hypothetical protein CICLE_v10006453mg [Citrus clementina]
 gb|ESR34374.1| hypothetical protein CICLE_v10006453mg [Citrus clementina]
Length=962

 Score =   105 bits (262),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 61/116 (53%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P      +    E++DD+ +TL 
Sbjct  845  KIPLGTQLQSFNASVYAGNLELCGLPLPNKCPDEESHPCPGRDDNANTTEDEDDQFITLG  904

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S+ LGF V FWG   TL L  S RY YY FL+  KDW+ VT  V+  +LQRKF
Sbjct  905  FYVSLFLGFFVGFWGVCGTLMLNRSSRYGYYNFLTGMKDWLSVTAAVNIAKLQRKF  960



>ref|XP_006421147.1| hypothetical protein CICLE_v10006774mg [Citrus clementina]
 gb|ESR34387.1| hypothetical protein CICLE_v10006774mg [Citrus clementina]
Length=959

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS +A+ YAGN  LCG PLP KC   E  P           E++DD+ +TL 
Sbjct  843  KIPLGTQLQSFSASVYAGNLELCGLPLPNKCPDEESTPCPGGNDGANTLEDEDDQFMTLG  902

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+S+ LGF V FWG   TL L  SWR+ YY FL+  KDW+YVT  V+  +LQ+
Sbjct  903  FYVSLFLGFFVGFWGVCGTLMLNRSWRHGYYNFLTGMKDWLYVTAAVNIAKLQK  956



>ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=1198

 Score =   104 bits (260),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT-LEF  498
             KIP GTQLQS N  SY GN  LCG PL  KC ED   IK+    Y  E+   +    + F
Sbjct  1084  KIPQGTQLQSFNIDSYKGNPALCGLPLLKKCSED--KIKQGSPTYNIEDKIQQDGNDMWF  1141

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             YIS+ LGF V FWG   TL L +SWRYAY++FL+  KDW+Y+ + ++  RLQR F
Sbjct  1142  YISVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYMIIAINMARLQRSF  1196



>gb|KEH25182.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1069

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP GTQLQ+ + ++Y GNSGLCG PL   C  DV +  +  D +   ED+D+L+T+ FY
Sbjct  952   KIPLGTQLQTFHPSAYVGNSGLCGQPLINLCPGDVISPTKSHDKHATGEDEDKLITIGFY  1011

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             +S+V+GF V FWG   TL +K SWR+AY++F ++  DW++V + V   RL+++F
Sbjct  1012  VSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVILSVFVNRLKKRF  1065



>ref|XP_006422068.1| hypothetical protein CICLE_v10007021mg [Citrus clementina]
 ref|XP_006490611.1| PREDICTED: receptor-like protein 12-like [Citrus sinensis]
 gb|ESR35308.1| hypothetical protein CICLE_v10007021mg [Citrus clementina]
Length=512

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 81/118 (69%), Gaps = 5/118 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDV----PAIKekgddyeeeeddDRLLT  507
            KIP+GTQLQS NA+ Y GN  LCG PLP KC ++     PAI +  DD +  ED+D+ +T
Sbjct  393  KIPTGTQLQSFNASVYDGNPELCGLPLPSKCWDEESAPGPAITKGRDDADTSEDEDQFIT  452

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            L F+++++LGF V FWG   T  L +SW++ +Y FL+ +KDW+YVT  V+  ++Q+K 
Sbjct  453  LGFFVTLILGFIVGFWGVCGTQLLNNSWKHCFYNFLTVTKDWLYVTAVVNIGKIQQKM  510



>ref|XP_004301719.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Fragaria vesca subsp. vesca]
Length=813

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 12/148 (8%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P++F+  L+F  +L         +IP GTQLQS NAT Y GN GLCG P
Sbjct  668  DLSRNQISGGIPASFS-KLNFLSVLDLSHNNLSGRIPLGTQLQSFNATVYMGNFGLCGPP  726

Query  593  L-PKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRY  417
            L P C E+      + DD  +E+DDD L++L F+IS VLGF   FW    +L LK SWRY
Sbjct  727  LTPNCSENGTT---QADDDMKEDDDDGLISLGFFISTVLGFVSGFWIVCGSLLLKSSWRY  783

Query  416  AYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            AY++FL DS+DW++V   V   ++QR+ 
Sbjct  784  AYFKFLDDSRDWIHVKTAVYKEKMQRRL  811



>emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera]
Length=1270

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = -3

Query  683  ILH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT  507
            IL  KIPSGTQLQS NA++Y GN GLCG PL  KC ED            EE+  D    
Sbjct  776  ILSGKIPSGTQLQSFNASTYDGNPGLCGPPLLKKCQEDENREVSFTGLSNEEDIQDDANN  835

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRL  345
            + FY ++VLGF + FWG   TL L  SWRYAY++FLS  KDW+YVT  V+  ++
Sbjct  836  IWFYGNIVLGFIIGFWGVCGTLLLNSSWRYAYFQFLSKIKDWLYVTTTVNMNKI  889



>ref|XP_010662440.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Vitis vinifera]
Length=1078

 Score =   104 bits (259),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 72/115 (63%), Gaps = 4/115 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT-LEF  498
             KIP GTQLQS N  SY GN  LCG PL  KC ED   IK+    Y  E+   +    + F
Sbjct  964   KIPQGTQLQSFNIDSYKGNPALCGLPLLKKCSED--KIKQGSPTYNIEDKIQQDGNDMWF  1021

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             YIS+ LGF V FWG   TL L +SWRYAY++FL+  KDW+Y+ + ++  RLQR F
Sbjct  1022  YISVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYMIIAINMARLQRSF  1076



>ref|XP_004243038.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Solanum lycopersicum]
Length=700

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAI-KekgddyeeeeddDRLLTLEFY  495
            +IPS TQLQS + +SY+GN+ LCG PL +C    P I +    + +E +DDD   +LEFY
Sbjct  585  RIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDDDDEFSSLEFY  644

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +SMVLGF V+FWG +  L +  SWR AY+ FL+D K W+++T +V F RL+ K 
Sbjct  645  VSMVLGFFVTFWGILGCLIVNRSWRNAYFTFLTDMKSWLHMTSRVCFARLKGKL  698



>gb|KEH25178.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=946

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 89/148 (60%), Gaps = 8/148 (5%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R   +  +P++F+N          F  L  KIP  TQLQ+ ++ SY GN+ LCG PL
Sbjct  795  DLSRNHLSGRMPTSFSNLTFLNNMNLSFNNLDGKIPVSTQLQTFDSYSYVGNNRLCGPPL  854

Query  590  PK-CHEDV-PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRY  417
               C  DV  + +        EED+D+L+T  FY+S+VLGF + FWG   TL +K SWR 
Sbjct  855  INLCPSDVISSTRTNDKHVTSEEDEDKLITFGFYVSLVLGFIIGFWGVCGTLVIKTSWRR  914

Query  416  AYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            AY++F ++ KDW+YVT+ V   RL+++F
Sbjct  915  AYFKFFNNMKDWIYVTLAVFVNRLKKRF  942



>gb|KDO38052.1| hypothetical protein CISIN_1g002556mg [Citrus sinensis]
Length=908

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP +C   E  P     GD    E++DD+ +TL 
Sbjct  791  KIPLGTQLQSFNASVYAGNLELCGPPLPNQCPNEESTPCPGRDGDANTPEDEDDQFITLG  850

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S+ LGF V FWG   TL L  SWRY Y+ FL++ +DW+Y+   V+  + Q KF
Sbjct  851  FYVSLTLGFIVGFWGVCGTLMLNRSWRYGYFNFLTNMRDWLYIVGAVNAAKPQTKF  906



>gb|AAR28378.1| EIX receptor 2 [Solanum lycopersicum]
Length=1021

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAI-KekgddyeeeeddDRLLTLEFY  495
             +IPS TQLQS + +SY+GN+ LCG PL +C    P I +    + +E +DDD   +LEFY
Sbjct  906   RIPSSTQLQSFDRSSYSGNAQLCGPPLEECPGYAPPIDRGSNTNPQEHDDDDEFSSLEFY  965

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             +SMVLGF V+FWG +  L +  SWR AY+ FL+D K W+++T +V F RL+ K 
Sbjct  966   VSMVLGFFVTFWGILGCLIVNRSWRNAYFTFLTDMKSWLHMTSRVCFARLKGKL  1019



>gb|KEH16824.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=992

 Score =   103 bits (257),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 88/147 (60%), Gaps = 7/147 (5%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L RK  +  +P++ TN     ++      L  KIP  TQLQS + ++Y GN+ LCG PL
Sbjct  842  DLSRKHISGRMPTSLTNLTFLSYMDLSFNNLEGKIPLSTQLQSFDPSTYTGNNRLCGPPL  901

Query  590  PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
               C +DV +  +  D     ED+D+L+T  FY+S+ LGF + FWG   TL LK SWR+A
Sbjct  902  INLCPDDVISPNKSYDKTVTSEDEDKLITFGFYVSLGLGFIIGFWGVCGTLVLKTSWRHA  961

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y++F ++  DW++VT+ V    L +KF
Sbjct  962  YFKFFNNVNDWIHVTLAVFVNSLNKKF  988



>ref|XP_006490685.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=959

 Score =   103 bits (256),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 59/116 (51%), Positives = 79/116 (68%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC-HEDVPAIKekgddye-eeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC +ED  + + + D    E+ED+D  +TL 
Sbjct  842  KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPNEDSASGQGRDDANTPEDEDEDEFITLG  901

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYIS++LGF   FWGF   + +  SWR +Y+ FL+  K+WVYVT+ V   +L+R+F
Sbjct  902  FYISLILGFFTGFWGFCSAILVNSSWRRSYFNFLTGVKNWVYVTVAVKIDKLKRRF  957



>ref|XP_006493510.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=986

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP +C   E  P     GD    E++DD+ +TL 
Sbjct  869  KIPLGTQLQSFNASVYAGNLELCGLPLPNQCPNEESTPCPGRDGDANTPEDEDDQFITLG  928

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S+ LGF V FWG   TL L  SWRY Y+ FL++ +DW+Y+   V+  + Q KF
Sbjct  929  FYVSLTLGFIVGFWGVCGTLMLNRSWRYGYFNFLTNMRDWLYIVGAVNAAKPQTKF  984



>ref|XP_006422088.1| hypothetical protein CICLE_v10007102mg [Citrus clementina]
 gb|ESR35328.1| hypothetical protein CICLE_v10007102mg [Citrus clementina]
Length=652

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 78/116 (67%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC-HEDVPAIKe-kgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC +ED  + +     +  E+ED+D  +TL 
Sbjct  535  KIPLGTQLQSFNASVYAGNPELCGLPLPNKCPNEDSASGQGRDDANTAEDEDEDESITLG  594

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYIS++LGF   FWGF   + +  SWR +Y+ FL+  K+WVYVT+ V   +L+R+F
Sbjct  595  FYISLILGFFTGFWGFCSAILVNSSWRRSYFNFLTGVKNWVYVTVAVKIDKLKRRF  650



>emb|CAN63562.1| hypothetical protein VITISV_037178 [Vitis vinifera]
Length=158

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 70/117 (60%), Gaps = 10/117 (9%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPL-PKCHED----VPAIKekgddyeeeeddDRLLTL  504
            IP GTQLQS N +SY GN  LCG PL  KC  D     P +    DD +++ +      +
Sbjct  45   IPRGTQLQSFNTSSYEGNPTLCGPPLLKKCPRDKVEGAPNVYSYEDDIQQDGN-----DM  99

Query  503  EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             FY+S+ LGF V FWG   TL L +SWRYAY+RFL+  KDW+YVT  ++  RL R  
Sbjct  100  WFYVSIALGFIVGFWGVCGTLLLNNSWRYAYFRFLNKIKDWLYVTTTINMARLWRSL  156



>emb|CAN77037.1| hypothetical protein VITISV_012666 [Vitis vinifera]
Length=1085

 Score =   102 bits (254),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 54/118 (46%), Positives = 72/118 (61%), Gaps = 1/118 (1%)
 Frame = -3

Query  683  ILH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT  507
            IL  KIPSGTQL S NA++Y GN GLCG PL  KC ED            E++  D    
Sbjct  686  ILSGKIPSGTQLHSFNASTYDGNPGLCGPPLLKKCQEDETKEVSFTSLINEKDIQDDTNN  745

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            + FY ++VLGF + FWG   TL L  SWRY+Y++ L+  KDW+++T   +  RL+R+F
Sbjct  746  IWFYGNIVLGFIIGFWGVCGTLLLNRSWRYSYFQTLNKIKDWLHMTTTTNINRLRRRF  803



>gb|KDO50394.1| hypothetical protein CISIN_1g0477971mg, partial [Citrus sinensis]
Length=378

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P+     D    E++D++ +TL 
Sbjct  267  KIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGRDDDANTVEDEDNQFITLG  326

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVS  357
            FY+S+ LGF V FWG   TL L  SWRY YY FL+  KDW+Y    ++
Sbjct  327  FYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMN  374



>gb|KEH25184.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=988

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R   +  +P++F+N     ++      L  KIP  TQLQS + ++Y GNSGLCG PL
Sbjct  838  DLSRNHLSGKMPTSFSNLTFLSYMNLSFNNLEGKIPLSTQLQSFDPSTYVGNSGLCGSPL  897

Query  590  PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
               C  DV +     D Y   ED+D+L+T  FY+++VLGF + FWG   TL +K SWR+ 
Sbjct  898  MNLCPGDVVSSTTSHDKYIPNEDEDKLITFGFYVTLVLGFIIGFWGVCGTLVIKTSWRHV  957

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y++F  +  DW++VT+ V   + +  F
Sbjct  958  YFQFFKNMNDWIHVTLAVFINKFKNNF  984



>gb|KEH25183.1| leucine-rich receptor-like kinase family protein, partial [Medicago 
truncatula]
Length=442

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 87/146 (60%), Gaps = 7/146 (5%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R   +  +P++F+N     ++      L  KIP  TQLQ+ +++SY GN+ LCG PL
Sbjct  290  DLSRNHLSGRMPTSFSNLTFLGYMNLSFNNLEGKIPLSTQLQTFDSSSYVGNNRLCGQPL  349

Query  590  PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
               C  DV +     +    +ED+D+L+T  FY+++ LGF V FWG   TL +K SWR+A
Sbjct  350  INLCPGDVTSPTRSPEKQLPDEDEDKLITFGFYVTLGLGFFVGFWGVCGTLVIKTSWRHA  409

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y++F  +  DW++VT+ V   RL++ 
Sbjct  410  YFKFFKNMNDWIHVTLAVFMKRLKKN  435



>gb|KDO48216.1| hypothetical protein CISIN_1g037539mg, partial [Citrus sinensis]
Length=622

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIPSGTQLQS NA+ YAGN  LCG PL       E  P      D    E++DD+ +TL 
Sbjct  505  KIPSGTQLQSFNASVYAGNLELCGLPLANMCLDEESTPGPGTDDDSDTLEDEDDQFITLG  564

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +L F V FWG   TL L  SW Y Y+ FL+  KDWV V   V+  +LQRKF
Sbjct  565  FYVSSILSFFVGFWGVSGTLMLNRSWSYGYFNFLTGMKDWVSVISAVNISKLQRKF  620



>gb|AAS79568.1| putative disease resistance protein, partial [Ipomoea trifida]
 dbj|BAF36281.1| hypothetical protein, partial [Ipomoea trifida]
Length=476

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 64/86 (74%), Gaps = 6/86 (7%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIPS TQ+QS NA+SYA NSGLCGDPLPKC  +VP         E+E+DDD L+T  FYI
Sbjct  388  KIPSSTQMQSFNASSYAHNSGLCGDPLPKCPRNVPN------KDEDEDDDDGLITQGFYI  441

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYA  414
            SMVLGFS+SFWGF+V  F K SWR A
Sbjct  442  SMVLGFSLSFWGFLVIFFFKGSWRNA  467



>ref|XP_002270042.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1024

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT-LEF  498
             KIP GTQLQS N  SY GN  LCG PL  KC ED   IK+    +  E+   +    + F
Sbjct  910   KIPQGTQLQSFNIDSYKGNPALCGLPLLKKCFED--KIKQDSPTHNIEDKIQQDGNDMWF  967

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             Y+S+ LGF V FWG   TL L +SWRYAY++FL+  KDW+YV + ++  RLQR  
Sbjct  968   YVSVALGFIVGFWGVCGTLLLNNSWRYAYFQFLNKIKDWLYVIIAINMARLQRSL  1022



>ref|XP_011099243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Sesamum indicum]
Length=831

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 0/114 (0%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
             IPSGTQL+  NA+++AGN+GLCG PL  C               ++  +D +L + FYI
Sbjct  718  SIPSGTQLRGFNASAFAGNNGLCGPPLAACLTPDGPPTPHPTPTHDQGKEDSILGMGFYI  777

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKFW  330
            S+VLGF + FWGF++ L LK SWR AY+ F +   DW+YVT+ + + R  R  W
Sbjct  778  SVVLGFLLGFWGFILILILKKSWRIAYFGFWNKIYDWLYVTITIIYQRKSRSQW  831



>ref|XP_010662623.1| PREDICTED: receptor-like protein 12 isoform X1 [Vitis vinifera]
Length=998

 Score =   100 bits (249),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 54/118 (46%), Positives = 71/118 (60%), Gaps = 1/118 (1%)
 Frame = -3

Query  683  ILH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT  507
            IL  KIPSGTQL S NA++Y GN GLCG PL  KC ED            E++  D    
Sbjct  881  ILSGKIPSGTQLHSFNASTYDGNPGLCGPPLLKKCQEDETKEVSFTSLINEKDIQDDTNN  940

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            + FY ++VLGF + FWG   TL L  SWRY+Y++ L+  KDW+++T   +  RL+R F
Sbjct  941  IWFYGNIVLGFIIGFWGVCGTLLLNRSWRYSYFQTLNKIKDWLHMTTTTNINRLRRSF  998



>ref|XP_006421148.1| hypothetical protein CICLE_v10006496mg, partial [Citrus clementina]
 gb|ESR34388.1| hypothetical protein CICLE_v10006496mg, partial [Citrus clementina]
Length=792

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PL       E  P+     D    E++DD+ +TL 
Sbjct  675  KIPLGTQLQSFNASVYAGNLELCGLPLANMCLDEESTPSPGTDDDSNTLEDEDDQFITLG  734

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY+S +LGF V FWG   TL L  SW Y Y+ FL+  K WVYV   V+  +LQRKF
Sbjct  735  FYVSSILGFFVGFWGVCGTLMLNRSWSYGYFNFLTGMKYWVYVIWAVNIAKLQRKF  790



>gb|KEH16823.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=661

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 87/144 (60%), Gaps = 7/144 (5%)
 Frame = -3

Query  743  RKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPLPK-  585
            R   +  +P++F+N     ++      L  KIP  TQLQS   ++YAGN+ LCG PL   
Sbjct  514  RNHISGRMPTSFSNLTFLSYMDLSFNNLEGKIPLCTQLQSFGPSTYAGNNRLCGPPLINL  573

Query  584  CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYR  405
            C +DV +     D     ED+D+L+T  FY+S+ LGF + FWG   TL +K SWR+AY++
Sbjct  574  CPDDVISPNRSYDKTVTSEDEDKLITFGFYVSLGLGFLIGFWGVCGTLVIKTSWRHAYFK  633

Query  404  FLSDSKDWVYVTMKVSFVRLQRKF  333
            F  +  +W++VT++V   RL+++F
Sbjct  634  FFKNINEWIHVTLEVFVNRLKKRF  657



>gb|KEH16826.1| LRR receptor-like kinase [Medicago truncatula]
Length=723

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP  TQLQS + ++Y GNSGLCG PL   C  DV +  +  D +   ED+D+L+T+ FY
Sbjct  606  KIPLSTQLQSFDPSTYVGNSGLCGQPLINLCPSDVISPTKSHDKHATSEDEDKLITIGFY  665

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +S+V+GF V FWG   TL +K SWR+AY++F ++  DW++VT+ V
Sbjct  666  VSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVTLSV  710



>ref|XP_010266617.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Nelumbo nucifera]
Length=1000

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLE-  501
            +IPSG QLQ++N +S Y GN  LCG PL  KC +D    +          +D      E 
Sbjct  878  RIPSGNQLQTLNDSSIYNGNPYLCGSPLSRKCEDDEKPSQGPTSLVNAGSEDKDSSDSEM  937

Query  500  --FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
              FYISM+ GF V FWG   TL LK SWR+AY+ FL+D KDWV++ + +S +RLQRK 
Sbjct  938  QWFYISMLPGFVVGFWGVCGTLLLKKSWRHAYFNFLNDMKDWVFIVIALSVIRLQRKL  995



>emb|CBI22583.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 71/118 (60%), Gaps = 1/118 (1%)
 Frame = -3

Query  683  ILH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLT  507
            IL  KIPSGTQL S NA++Y GN GLCG PL  KC ED            E++  D    
Sbjct  633  ILSGKIPSGTQLHSFNASTYDGNPGLCGPPLLKKCQEDETKEVSFTSLINEKDIQDDTNN  692

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            + FY ++VLGF + FWG   TL L  SWRY+Y++ L+  KDW+++T   +  RL+R F
Sbjct  693  IWFYGNIVLGFIIGFWGVCGTLLLNRSWRYSYFQTLNKIKDWLHMTTTTNINRLRRSF  750



>ref|XP_010671924.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
Length=645

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 2/103 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP GTQLQS NA+ YAGN GLCGDPLPKC  D    +    +  +++D+D    L  YI
Sbjct  541  RIPMGTQLQSFNASQYAGNPGLCGDPLPKCPGDTQPARPMNANQHKDDDNDIFPGL--YI  598

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMK  363
            S+V GF V FWG   TL +K SWR AY+RF  ++KD +Y T K
Sbjct  599  SIVFGFIVGFWGVCGTLVIKTSWRRAYFRFFDETKDKLYRTWK  641



>ref|XP_004507279.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Cicer arietinum]
Length=1017

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 89/147 (61%), Gaps = 10/147 (7%)
 Frame = -3

Query  752   ELIRKPSTAPLPSAFTNTLHF------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
             +L R      +P++F+N          F  L  KIP  TQL+S ++++Y GNSGLCG PL
Sbjct  867   DLSRNHLYGRMPTSFSNLTFLSSMNLSFNNLEGKIPQSTQLESFDSSTYLGNSGLCGSPL  926

Query  590   PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
                C  D+ + K   ++ E+E+   +L+T  FYIS+ LGF V FWG   TL +K SWR+ 
Sbjct  927   GNHCLGDMISPKHVTNEDEDED---KLITFGFYISLWLGFFVGFWGVCGTLVIKTSWRHV  983

Query  413   YYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             Y++F ++  DW++VT+ V  +R+++ F
Sbjct  984   YFQFFNNMSDWIHVTLVVFVIRMKKVF  1010



>gb|KEH25176.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=871

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCH-EDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP  TQLQ+ + +SY GNS LCG PL     +DV +     D +   E++D+L+T  FY
Sbjct  754  KIPLSTQLQTFDPSSYVGNSRLCGPPLINLFPDDVISPTSSNDKHVTSEEEDKLITFGFY  813

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S+V+GF V FWG   TL +K SWR+AY++F ++  DW++VT+ V   RL+++F
Sbjct  814  VSLVIGFFVGFWGVCGTLVIKTSWRHAYFKFFNNLNDWIHVTLSVFVNRLKKRF  867



>ref|XP_004309282.1| PREDICTED: phytosulfokine receptor 1-like, partial [Fragaria 
vesca subsp. vesca]
Length=296

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP+GTQLQS NA+SY GN  LCG PL  C    P    + +    E+D D L+T  FYI
Sbjct  199  EIPTGTQLQSFNASSYIGNPWLCGLPLHVCD---PEGTGRPNVSSGEDDADELITQGFYI  255

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            S+ LGF+V FWG   +L  K SWRYAYY FL+ S DW+YV
Sbjct  256  SLGLGFAVGFWGICGSLIFKKSWRYAYYNFLNASNDWLYV  295



>ref|XP_006493507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like isoform X1 [Citrus sinensis]
 ref|XP_006493508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like isoform X2 [Citrus sinensis]
Length=887

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 3/108 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  LCG PLP KC   E  P+     D    E++DD+ +TL 
Sbjct  776  KIPLGTQLQSFNASVYAGNLELCGLPLPNKCADEESTPSPGRDDDANTLEDEDDQFITLG  835

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVS  357
            FY+S+ LGF V FWG   TL L  SWRY YY FL+  KDW+Y    ++
Sbjct  836  FYVSLTLGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLYAAAAMN  883



>ref|XP_008364570.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Malus 
domestica]
Length=220

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ ++GN GLCG P
Sbjct  84   DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFSGNLGLCGQP  142

Query  593  L-PKCHEDVP----AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  D P    A+       + ++DDD L++  FY+S+VLGF + FW    TL LK 
Sbjct  143  LTPECPGDAPTEGPAVPNGSGSDKTKQDDDGLISFGFYVSLVLGFIIGFWSVCGTLVLKT  202

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  203  SWRYAYFRFFDDIK  216



>ref|XP_010672172.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672173.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672174.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
 ref|XP_010672175.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Beta vulgaris subsp. vulgaris]
Length=997

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 7/113 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIPSGTQLQ  +A+ +AGN  LCG PLPKC  D PA        ++         L  YI
Sbjct  891  KIPSGTQLQGFDASVFAGNPALCGSPLPKCPGDQPADNNSPAREDD-------FLLGLYI  943

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            S+ LGF + FWG   +L LK SWR+A+++F  D +D + V + V   R+QR+ 
Sbjct  944  SVTLGFIIGFWGVCGSLVLKTSWRHAFFQFFDDMRDKLCVMVSVKKARVQRRL  996



>ref|XP_003636154.1| Receptor-like protein kinase [Medicago truncatula]
Length=371

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             IP  TQLQ+   +SY GNS LCG P+   C  DV   +        EED+D+L+T  FY
Sbjct  256  NIPISTQLQTFGPSSYVGNSRLCGPPITNLCPGDV--TRSHDKHVTNEEDEDKLITFGFY  313

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S+V+GF + FWG   TL +K SWR+AY++F ++  DW++VT+ V   RL+++ 
Sbjct  314  VSLVIGFFIGFWGVCGTLVIKTSWRHAYFKFFNNINDWIHVTLSVFVNRLKKRL  367



>ref|XP_008226021.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Prunus mume]
Length=1096

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             +IPSG QLQ++N +S Y GN  LCG+PL KC    P  +       +  + D    L  Y
Sbjct  987   RIPSGNQLQTLNDSSIYEGNKLLCGEPLSKC----PGDETLTATNAKYSNADGNDKLWLY  1042

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             +SMVLGF V FWG   TL +K SWRYAY+RF  D K+ V + +++   RLQRK
Sbjct  1043  VSMVLGFIVGFWGVCGTLLVKKSWRYAYFRFFDDIKNKVALAIELKLARLQRK  1095



>ref|XP_010662638.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=988

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDR--LLTLE  501
            KIP GTQLQS +A++Y GN GLCG PL K C ED             +++D +     + 
Sbjct  871  KIPLGTQLQSFDASTYEGNPGLCGPPLLKRCPEDELGGVSFTSGLSSKKEDIQDDANNIW  930

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY ++VLGF + FWG   TL    SWRYAY++FLS  KDW+YVT  V+  R++R  
Sbjct  931  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQFLSKIKDWLYVTTIVNMNRIRRSL  986



>gb|KDP36592.1| hypothetical protein JCGZ_08359 [Jatropha curcas]
Length=742

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = -3

Query  767  VRQNEELIRKPSTAPLPSAFTNTL---HFFFILH*KIPSGTQLQSINATSYAGNSGLCGD  597
            + QN+   R P++    S F NTL   H  F+   KIPSGTQLQ+ NA++Y+ N  LCG 
Sbjct  590  LSQNQLSGRLPASIS-NSNFLNTLNLSHNNFLG--KIPSGTQLQTFNASTYSNNPALCGS  646

Query  596  PLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWR  420
            PLP KC ED   I +    +++ ++ +       Y+ M +GF+V FWG    L LK S+R
Sbjct  647  PLPQKCPED--NIHDSPSSHDDHDNQEDEFNKSLYLGMGVGFAVGFWGVSGVLLLKRSYR  704

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +A+++F+ D KDW+YV   +   +LQ+
Sbjct  705  HAFFKFVDDLKDWIYVRTVIYMKKLQQ  731



>ref|XP_008344477.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
 ref|XP_008363235.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=456

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 8/113 (7%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + + YAGN  LCG PLPK  +D    +++      EE+ D L+T  FY+
Sbjct  351  KIPTGTQLQSFDPSDYAGNPQLCGPPLPKMCDD----QQETPISSNEEEKDELITWGFYV  406

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            SM LGF V FWGF  +L     WRY+Y+RFL+   DW YV +    + ++R+F
Sbjct  407  SMALGFIVGFWGFCGSLIFIRPWRYSYFRFLNILNDWFYVRV----ILIKRRF  455



>ref|XP_006421133.1| hypothetical protein CICLE_v10006997mg, partial [Citrus clementina]
 gb|ESR34373.1| hypothetical protein CICLE_v10006997mg, partial [Citrus clementina]
Length=709

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 78/142 (55%), Gaps = 9/142 (6%)
 Frame = -3

Query  731  TAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPLP-KC--H  579
            T  LPS+  N      +      L  KI  GTQLQS NA+ YA N  LC  PLP +C   
Sbjct  566  TGELPSSLKNCSQLRVLDLSYNNLSGKISLGTQLQSFNASVYARNLELCSLPLPNQCPNE  625

Query  578  EDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFL  399
            E  P      D    E++DD+ +TL FY+S+ LGF V FWG    L L  SWRY Y+ FL
Sbjct  626  ESTPCPGRDDDANTPEDEDDQFITLGFYVSLTLGFFVGFWGLCGMLMLSRSWRYGYFNFL  685

Query  398  SDSKDWVYVTMKVSFVRLQRKF  333
            ++ +DW+Y+   V+  +LQ KF
Sbjct  686  TNMRDWLYIVGAVNAAKLQTKF  707



>ref|XP_006490686.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=907

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KC-HEDVPAIKekgddye-eeeddDRLLTLE  501
            KIP GTQLQS NA+ YAGN  L G P P KC +ED  + + + D    E+ED+D  +TL 
Sbjct  790  KIPLGTQLQSFNASVYAGNPELWGLPPPNKCPNEDSASGQGRDDANTPEDEDEDEFITLG  849

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYIS++LGF   FWGF   + +  SWR +Y+ FL+  K+WVYVT+ V   +L+R+F
Sbjct  850  FYISLILGFFTGFWGFCSAILVNSSWRRSYFNFLTGVKNWVYVTVAVKIDKLKRRF  905



>ref|XP_006421149.1| hypothetical protein CICLE_v10004252mg [Citrus clementina]
 gb|ESR34389.1| hypothetical protein CICLE_v10004252mg [Citrus clementina]
Length=960

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R   +  +PS+ +      F+      L  KIP GTQLQS NA+ YA N   CG PL
Sbjct  811  DLSRNLFSGSIPSSLSQLSGLGFLDLSYNNLSGKIPLGTQLQSFNASVYAENLEFCGLPL  870

Query  590  PKC---HEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWR  420
                   E  P+     D    E++DD+  T  FY+S +LGF V FWG   TL L  SWR
Sbjct  871  ANMCPDEESTPSPGTDDDSNTLEDEDDQFTTRGFYVSSILGFFVGFWGVCGTLMLNRSWR  930

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            + YY FL+  KDW+YVT  V+  +LQ+
Sbjct  931  HGYYNFLTGMKDWLYVTAAVNIAKLQK  957



>ref|XP_007214009.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica]
 gb|EMJ15208.1| hypothetical protein PRUPE_ppa014796mg [Prunus persica]
Length=1013

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 3/114 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             +IP G QLQ+++  S Y GN  LCG PLPKC  D  +  ++  D  EE +D+ +L   FY
Sbjct  902   RIPLGNQLQTLDDPSIYEGNPSLCGVPLPKCPGDDTSTTKEAKDNIEEGNDNGVLW--FY  959

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             +SMVLGF V FWG   TL LK SWRYAY++F  D KD V + + +    LQRKF
Sbjct  960   VSMVLGFVVGFWGVCGTLLLKKSWRYAYFQFFDDIKDKVSLAIALKLAHLQRKF  1013



>ref|XP_008362832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=964

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LHF  +L         +IP  TQLQS NA+ + GN GLCG P
Sbjct  828  DLSRNQISGSIPPSFS-SLHFLGVLDLSYNNLSGRIPLSTQLQSFNASQFTGNLGLCGQP  886

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  DV    P++       + ++D D L++L FY+S+ LGF + FW    TL LK 
Sbjct  887  LTPECPRDVTTEDPSVPNGSGSDKNKQDSDGLISLGFYVSLALGFIIGFWSVCGTLVLKT  946

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF+ D K
Sbjct  947  SWRYAYFRFIDDIK  960



>gb|KEH33791.1| LRR receptor-like kinase [Medicago truncatula]
Length=280

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 68/117 (58%), Gaps = 6/117 (5%)
 Frame = -3

Query  680  LH*KIPSGTQLQSINATSYAGNSGLCGDPLPKC--HEDVPAIKekgddyeeeeddDRLLT  507
            L+ KIP+GTQLQ INA+SY GN  LCG PL  C   E+ P         E+++     L 
Sbjct  168  LNGKIPTGTQLQRINASSYIGNPKLCGAPLNNCTMKEENPKTATPSTKNEDDDSIKESL-  226

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
               Y+ M +GF+V FWG   +LFL   W++AY+RF+   +D +YVT+ V   R +R 
Sbjct  227  ---YLGMGVGFAVGFWGICGSLFLIRKWKHAYFRFVDRVRDKIYVTLIVKLNRFKRN  280



>ref|XP_008367532.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
 ref|XP_008367533.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=947

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + + YAGN  LCG PLPK   D    +++      EE++D  +T EFYI
Sbjct  842  KIPTGTQLQSFDPSDYAGNPQLCGPPLPKMCGD----QQETPISSNEEEEDEPITWEFYI  897

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTM  366
            SMVLGF V FWG   +L    SWRY+Y+RFL+   DW YVT+
Sbjct  898  SMVLGFIVGFWGVCGSLIFVRSWRYSYFRFLNVLNDWFYVTV  939



>gb|KEH16822.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=918

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP  TQLQ+   +SY GNS LCG P+   C  DV   +        EED+D+L+T  FY+
Sbjct  804  IPISTQLQTFGPSSYVGNSRLCGPPITNLCPGDV--TRSHDKHVTNEEDEDKLITFGFYV  861

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            S+V+GF + FWG   TL +K SWR+AY++F ++  DW++VT +V   RL+++F
Sbjct  862  SLVIGFFIGFWGVCGTLVIKTSWRHAYFKFFNNINDWIHVTQEVFVNRLKKRF  914



>ref|XP_010323339.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=1045

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekg--ddyeeeeddDRLLTLEF  498
             +IPS TQLQ  + ++Y GN  LCG PLP C    P+          +E +DDD   + EF
Sbjct  929   RIPSSTQLQGFDPSTYGGNIQLCGPPLPACPTFAPSNPHVVFDRTSQENDDDDEFPSKEF  988

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             YISM LGF V+FWG + +L+  DSWR AY+++L+  ++W+Y++  + F RL+ K 
Sbjct  989   YISMALGFIVAFWGILGSLYFNDSWRNAYFKWLNGCQNWLYLSSAICFARLKAKL  1043



>ref|XP_007220272.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
 gb|EMJ21471.1| hypothetical protein PRUPE_ppa000998mg [Prunus persica]
Length=936

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 84/144 (58%), Gaps = 13/144 (9%)
 Frame = -3

Query  734  STAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDPL-PKCH  579
            S   +P +F+ +LH+  +L         +IP  TQLQ+ NA+++ GN GLCG PL P+C 
Sbjct  794  SAGRIPISFS-SLHYLSVLDLSQNNLSERIPLSTQLQTFNASAFMGNLGLCGPPLTPECP  852

Query  578  EDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAY  411
             D     PA+       + +++DD L++  FY+SMVLG  + FWG   TL LK SWRYAY
Sbjct  853  GDGATQDPAVPNGDGGDKTKQEDDGLISFGFYVSMVLGLIIGFWGVCGTLLLKSSWRYAY  912

Query  410  YRFLSDSKDWVYVTMKVSFVRLQR  339
            +R+L + KD + +       RLQR
Sbjct  913  FRYLDNIKDRITMHKAKLQRRLQR  936



>emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera]
Length=971

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 71/118 (60%), Gaps = 7/118 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHED----VPAIKekgddyeeeeddDRLLT  507
            KIP GTQLQS +A++Y GN GLCG PL K C ED    V  I       E+ +DD     
Sbjct  854  KIPLGTQLQSFDASTYEGNPGLCGPPLLKRCPEDELGGVSFISGLSSKKEDIQDDAN--N  911

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            + FY ++VLGF + FWG   TL    SWRYAY++ LS  KDW+YVT  V+  R++R  
Sbjct  912  IWFYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYVTTIVNMNRIRRSL  969



>ref|XP_008382520.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=963

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 80/134 (60%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ + GN GLCG P
Sbjct  827  DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFTGNLGLCGQP  885

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  DV    PA+       + ++DDD L++  FY+S+VLGF + FW    TLFLK 
Sbjct  886  LTPECPGDVTTEDPAVPNGSGSDKTKQDDDGLISFGFYVSLVLGFIIGFWSVCGTLFLKT  945

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY++F  D K
Sbjct  946  SWRYAYFQFFDDIK  959



>ref|XP_009378505.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=580

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 84/146 (58%), Gaps = 10/146 (7%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L +   +  +PS+ T +L+F       +  L  +IP+GTQLQS NA+++ GN  LCG P
Sbjct  435  DLSKNHLSGKIPSSMT-SLNFLKELDVSYNNLEGQIPTGTQLQSFNASTFEGNLQLCGAP  493

Query  593  LPKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
            LP    DV A  +   D + + + D LL +  YI   LGF V FWG   +L L  +WRYA
Sbjct  494  LPNECRDVDADNKSNIDQDADNERDELLGI--YIFAALGFIVGFWGVCGSLVLNKTWRYA  551

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y++F  + +D +YV M V   R++R+
Sbjct  552  YFQFFDNVQDSLYVKMAVCMARMKRR  577



>ref|XP_007212689.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica]
 gb|EMJ13888.1| hypothetical protein PRUPE_ppa018526m1g, partial [Prunus persica]
Length=214

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 65/114 (57%), Gaps = 18/114 (16%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP G+QLQ+++ +S Y  N  LCG PLP  +ED                      L FY
Sbjct  115  RIPLGSQLQTLSDSSIYMDNPSLCGVPLPN-NEDGNDNG----------------ALWFY  157

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +SM+LGF V FWG   TL LK SWRYAY+RF  D+KD V + + +   RLQRKF
Sbjct  158  VSMILGFIVGFWGVCGTLLLKKSWRYAYFRFFDDTKDKVTLAIALKVARLQRKF  211



>ref|XP_008244901.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Prunus mume]
Length=221

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 69/112 (62%), Gaps = 9/112 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP GTQLQS + + YA N  LCG PL K   D P+      +Y   ED D L+TL FYI
Sbjct  115  QIPIGTQLQSFDRSVYAENPQLCGAPLLKMCAD-PS------EYSNTEDTDELITLGFYI  167

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            SM LGF+  FWG   TL  K SWRY Y++FL+   DW+YV  +V+ ++ Q K
Sbjct  168  SMALGFAAGFWGVCFTLIFKRSWRYEYFKFLNGLNDWLYV--RVALIKRQLK  217



>ref|XP_006421146.1| hypothetical protein CICLE_v10006889mg [Citrus clementina]
 gb|ESR34386.1| hypothetical protein CICLE_v10006889mg [Citrus clementina]
Length=959

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 68/114 (60%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED---VPAIKekgddyeeeeddDRLLTLE  501
            KIP GTQLQS NA+ YA N  LCG PL     D    P+     D    E++DD+ +T  
Sbjct  843  KIPLGTQLQSFNASVYAENLELCGLPLANMCPDEQSTPSPVTDDDSNTLEDEDDQFITRG  902

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            FY+S +LGF V FWG   TL L  SWRY YY FL+  KDW+ VT  V+  +LQ+
Sbjct  903  FYVSSILGFFVGFWGVCGTLMLNRSWRYGYYNFLTGMKDWLSVTAAVNIAKLQK  956



>ref|XP_007212410.1| hypothetical protein PRUPE_ppa016435mg [Prunus persica]
 ref|XP_007213156.1| hypothetical protein PRUPE_ppa025207mg [Prunus persica]
 gb|EMJ13609.1| hypothetical protein PRUPE_ppa016435mg [Prunus persica]
 gb|EMJ14355.1| hypothetical protein PRUPE_ppa025207mg [Prunus persica]
Length=1243

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
             KIP+GTQLQS +   YAGN  LCG PL K   D    + +  D   EED D  +TL FYI
Sbjct  1136  KIPTGTQLQSFDPLDYAGNPQLCGPPLKKMCAD----QNEPTDLSNEEDKDEFITLGFYI  1191

Query  491   SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQ  342
             SM +GF+V FWG   TL    SWRYAY +FL+   DW+YV + +S  +L+
Sbjct  1192  SMAIGFAVGFWGVCGTLIFNRSWRYAYLKFLNGLNDWLYVKIALSKRQLK  1241



>ref|XP_009610906.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=1032

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeedd-----DRLLT  507
             +IPS TQLQS  ++SY+GN+ LCG PL +C    P              +     +   +
Sbjct  913   RIPSSTQLQSFESSSYSGNAQLCGPPLQECPGYAPPSPRIDHSSNMNPQEHDDDGEDFPS  972

Query  506   LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             LEFYISMVLGF V+FWG + +L +  SWR AY+ FL D+K W+ +T +V   RL+ K 
Sbjct  973   LEFYISMVLGFFVAFWGILGSLIVNRSWRNAYFTFLMDTKSWLDMTSRVCCSRLKGKL  1030



>ref|XP_007214101.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
 gb|EMJ15300.1| hypothetical protein PRUPE_ppa016834mg, partial [Prunus persica]
Length=977

 Score = 94.0 bits (232),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 3/114 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP G+QLQ+++ +S Y  N  LCG PLPKC  D            E+ +D+    L FY
Sbjct  863  RIPLGSQLQTLSDSSIYMDNPSLCGVPLPKCPGDDTFTATNAKHSNEDGNDNG--ALWFY  920

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +SM+LGF V FWG   TL LK SWRYAY+RF  ++KD V + + +   RLQ+KF
Sbjct  921  VSMILGFIVGFWGVCGTLLLKKSWRYAYFRFFDNTKDKVTLAIALKVARLQKKF  974



>ref|XP_007218828.1| hypothetical protein PRUPE_ppa010140mg [Prunus persica]
 gb|EMJ20027.1| hypothetical protein PRUPE_ppa010140mg [Prunus persica]
Length=262

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 3/113 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + YAGN  LCG PL K C ++V   + +  D+  +ED D L+T  FY
Sbjct  150  KIPVGTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGQSEQTDFINQEDKDELITPGFY  209

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF+  FWG   TL    SWRY Y +FL+D  DW++V  +++ ++ Q +
Sbjct  210  ISMGLGFAAGFWGVCGTLIFSRSWRYTYLKFLNDLNDWLFV--RIALLKRQLR  260



>gb|KHN09226.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=289

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 69/112 (62%), Gaps = 4/112 (4%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP+GTQLQS NA+ Y  N  LCG PL K C +  PA K      E+E+    L T EFY+
Sbjct  180  IPTGTQLQSFNASCYEDNLDLCGPPLEKLCVDGKPAQKPIVKLPEDEKL---LFTCEFYM  236

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            SM +GF +SFWG   ++ +K SWR+AY++F+S+  D +YV   V   + + +
Sbjct  237  SMAIGFVISFWGVFGSILIKRSWRHAYFKFISNLSDAIYVMAAVKVFKWRHR  288



>ref|XP_004308379.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g08850-like [Fragaria vesca subsp. vesca]
Length=461

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 68/109 (62%), Gaps = 4/109 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP+GTQLQ  NA+SY  N  LCG PL  C    P    + +    E+D + L+T  FYI
Sbjct  306  EIPTGTQLQGFNASSYIENPWLCGLPLHVCD---PEGTGRPNVSSGEDDANELITQGFYI  362

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRL  345
            S+ LGF+V FWG   +L  K SWRYAYY FL+ S DW+YV + + F RL
Sbjct  363  SLGLGFAVGFWGICGSLIFKKSWRYAYYNFLNASNDWLYVKLLL-FKRL  410



>gb|KHN10053.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=243

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 71/113 (63%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E+    L T EFY
Sbjct  133  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDEKL---LFTREFY  189

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            +SM +GF +SFWG   ++ +K SWR+AY++F+S+  D +YV + V   + + +
Sbjct  190  MSMAIGFVISFWGVFGSILIKRSWRHAYFKFISNLSDAIYVMVAVKVSKWRHR  242



>ref|XP_010662639.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Vitis vinifera]
Length=941

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDR--LLTLE  501
            KIP GTQLQS +A++Y GN GLCG PL K C ED             +++D +     + 
Sbjct  824  KIPLGTQLQSFDASTYEGNPGLCGPPLLKRCPEDELGGVSFTSGLSSKKEDIQDDANNIW  883

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY ++VLGF + FWG   TL    SWRYAY++ LS  KDW+YVT  V+  R++R  
Sbjct  884  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYVTTIVNMNRIRRSL  939



>ref|XP_010662437.1| PREDICTED: receptor-like protein 12 isoform X2 [Vitis vinifera]
Length=665

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQS N+ SY GN  LCG PL  KC ED    ++      E++       + FY
Sbjct  551  KIPKGTQLQSFNSYSYKGNPTLCGLPLLKKCPED-EMKQDSPTRSIEDKIQQDGNDMWFY  609

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            IS+ LGF V FWG   TL L +S RYAY+ FL+  KDW YVT+ ++  +++R  
Sbjct  610  ISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  663



>ref|XP_008343845.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=916

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ ++GN GLCG P
Sbjct  780  DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFSGNLGLCGQP  838

Query  593  L-PKCHEDVP----AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  D P    A+       + ++DDD L++  FY+S+VLGF + FW    TL LK 
Sbjct  839  LTPECPGDAPTEGPAVPNGSGSDKTKQDDDGLISFGFYVSLVLGFIIGFWSVCGTLVLKT  898

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  899  SWRYAYFRFFDDIK  912



>emb|CAN59765.1| hypothetical protein VITISV_036905 [Vitis vinifera]
Length=336

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 65/118 (55%), Gaps = 9/118 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS++A SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  130  RIPSSTQLQSLDAISYIGNAELCGAPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  183

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKFWP  327
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV +     RLQ    P
Sbjct  184  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYHVKDWVYVAIARRLNRLQNNLRP  241



>ref|XP_010662436.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Vitis vinifera]
Length=1117

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP GTQLQS N+ SY GN  LCG PL  KC ED    ++      E++       + FY
Sbjct  1003  KIPKGTQLQSFNSYSYKGNPTLCGLPLLKKCPED-EMKQDSPTRSIEDKIQQDGNDMWFY  1061

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             IS+ LGF V FWG   TL L +S RYAY+ FL+  KDW YVT+ ++  +++R  
Sbjct  1062  ISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  1115



>ref|XP_009375612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=964

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 78/134 (58%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LHF  +L         +IP  TQLQS +A+ + GN GLCG P
Sbjct  828  DLSRNQISGSIPPSFS-SLHFLGVLDLSYNNLSGRIPVSTQLQSFDASQFTGNLGLCGQP  886

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  DV    PA+       + ++DDD L++L FY+ + LGF + FW    TL LK 
Sbjct  887  LTPECPGDVTTEDPAVPNGSGSDKTKQDDDGLISLGFYVGLALGFIIGFWSVCGTLVLKT  946

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  947  SWRYAYFRFFDDIK  960



>emb|CAN79130.1| hypothetical protein VITISV_029207 [Vitis vinifera]
Length=1107

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP GTQLQS N+ SY GN  LCG PL  KC ED    ++      E++       + FY
Sbjct  993   KIPKGTQLQSFNSYSYKGNPTLCGLPLLKKCPED-EMKQDSPTRSIEDKIQQDGNDMWFY  1051

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             IS+ LGF V FWG   TL L +S RYAY+ FL+  KDW YVT+ ++  +++R  
Sbjct  1052  ISIALGFIVGFWGVCGTLLLNNSLRYAYFHFLNKIKDWFYVTIAINMAKVRRSL  1105



>ref|XP_007219202.1| hypothetical protein PRUPE_ppa017031mg, partial [Prunus persica]
 gb|EMJ20401.1| hypothetical protein PRUPE_ppa017031mg, partial [Prunus persica]
Length=846

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 5/101 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + YAGN  LCG PL K C + +  I     + +++     L+TL FY
Sbjct  748  KIPIGTQLQGFDPSVYAGNPQLCGPPLKKTCADQIVQIDLSNQEDDKD----ELITLGFY  803

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            ISM LGF+  FWG   TL  K SWRYAY++FL+   DW+YV
Sbjct  804  ISMGLGFAAGFWGVCGTLIFKRSWRYAYFKFLNGLNDWLYV  844



>ref|XP_004296191.1| PREDICTED: receptor-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=820

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 75/144 (52%), Gaps = 18/144 (13%)
 Frame = -3

Query  731  TAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKCHE-  576
            +  +P++FT +LHF       F  L   IPS TQLQS NA+++ GN  LCGDPLPKC   
Sbjct  681  SGNIPTSFT-SLHFLSKLNVSFNNLEGPIPSSTQLQSFNASAFEGNRNLCGDPLPKCKRT  739

Query  575  ---DVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYR  405
               D P +     D +E +         FYIS  LGF + FWG    L L   WRYAYY 
Sbjct  740  KGTDEPDMNNTDADMKEHQFPW------FYISAALGFIIGFWGVFGPLVLLKKWRYAYYH  793

Query  404  FLSDSKDWVYVTMKVSFVRLQRKF  333
            FL +  +   V +     RL+R+F
Sbjct  794  FLDNGYERFMVMILKRMARLKRRF  817


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 9/110 (8%)
 Frame = -3

Query  731  TAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED  573
            +  +P++FT +LHF       +  L   IPS TQLQS +A+++ GN  LCGDPLP   + 
Sbjct  170  SGNIPASFT-SLHFLSKFNVSYNNLEGPIPSSTQLQSFDASAFEGNLKLCGDPLPNKCKR  228

Query  572  VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
                 E   +  + +  +R     FY+S  LGF + FWG    L     W
Sbjct  229  TEGTDEPDMNNTDADMKERQFPW-FYVSAALGFFIGFWGVFGPLVFLQKW  277



>ref|XP_008226588.1| PREDICTED: receptor-like protein 2 [Prunus mume]
Length=675

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 79/147 (54%), Gaps = 9/147 (6%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*K-------IPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +PS    +LHF   L+         IP+ TQLQS+NA+++ GN  LCG P
Sbjct  529  DLSRNALSGNIPSPLA-SLHFLHALNVSYNDLRGPIPTSTQLQSLNASAFEGNPKLCGAP  587

Query  593  LPKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
            +P     +  I         + D D      FYIS+VLGF V FWG   +L +K +WR+A
Sbjct  588  VPNECGPIMGIDAADKKNNHDVDSDHQFPW-FYISVVLGFIVGFWGVCGSLVIKRTWRHA  646

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+RF  + +D V V M VS  R++RK 
Sbjct  647  YFRFTDNVQDRVCVMMTVSVNRMKRKL  673



>ref|XP_007151892.1| hypothetical protein PHAVU_004G084600g [Phaseolus vulgaris]
 gb|ESW23886.1| hypothetical protein PHAVU_004G084600g [Phaseolus vulgaris]
Length=1302

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  668   IPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYIS  489
             IP+ TQLQS NA+SY  N  LCG PL KC +D P  +      E       L   EFYI 
Sbjct  1199  IPTSTQLQSFNASSYEDNLNLCGPPLEKCIDDEPTEEAIVKIDEYS-----LFGHEFYIG  1253

Query  488   MVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSF  354
             MVLGF +SFW    T+  K SWR+AY++FL++  D ++V + + F
Sbjct  1254  MVLGFVISFWTVFGTILFKQSWRHAYFKFLNNLSDEIHVMIAMKF  1298



>gb|EYU34016.1| hypothetical protein MIMGU_mgv1a0176472mg, partial [Erythranthe 
guttata]
Length=264

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 71/123 (58%), Gaps = 12/123 (10%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED--VPAIKekgddyeeeeddDR------  516
            KIPS TQLQS N +SYAGN  LCG PL  C  D  +P   ++G    +E  DD       
Sbjct  141  KIPSSTQLQSFNESSYAGNPKLCGPPLSSCPGDKLIPDTTDQGKRNNKEIKDDEDEGGFI  200

Query  515  LLTLEFY----ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVR  348
            L+ + F+    IS+V GF V FWGFV +L +K SWR AY+ F     DW YVT  V F +
Sbjct  201  LMRISFWKEVGISIVFGFIVGFWGFVGSLLIKRSWRVAYFDFWGRVGDWFYVTTIVFFGK  260

Query  347  LQR  339
            L+R
Sbjct  261  LRR  263



>ref|XP_010266618.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=700

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLE-  501
            +IPSG QLQ++N +S YA N  LCG PL  KC +D  + +       +   D+     E 
Sbjct  578  RIPSGNQLQTLNDSSIYADNPNLCGLPLSRKCEDDDKSSEGPTSFVNDANGDNDSSDSEM  637

Query  500  --FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
              FYIS++ GF V FWG   TL LK +WR+AY+  L D KDWV++ +  S +RL+RK 
Sbjct  638  QWFYISILPGFVVGFWGVCGTLLLKKTWRHAYFNLLDDMKDWVFLVIASSVIRLKRKL  695



>ref|NP_001234427.1| EIX receptor 1 precursor [Solanum lycopersicum]
 gb|AAR28377.1| EIX receptor 1 [Solanum lycopersicum]
Length=1031

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 4/117 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAI----KekgddyeeeeddDRLLTL  504
             +IPS TQLQS + +SY+ N+ LCG PL +C    P          ++ +E ++++   +L
Sbjct  911   RIPSSTQLQSFDRSSYSDNAQLCGPPLQECPGYAPPSPLIDHGSNNNPQEHDEEEEFPSL  970

Query  503   EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             EFYISMVL F V+FWG +  L +  SWR AY++FL+D+  W+ +  +V F RL++K 
Sbjct  971   EFYISMVLSFFVAFWGILGCLIVNSSWRNAYFKFLTDTTSWLDMISRVWFARLKKKL  1027



>ref|XP_010323160.1| PREDICTED: EIX receptor 1 isoform X1 [Solanum lycopersicum]
Length=1027

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 4/117 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAI----KekgddyeeeeddDRLLTL  504
             +IPS TQLQS + +SY+ N+ LCG PL +C    P          ++ +E ++++   +L
Sbjct  907   RIPSSTQLQSFDRSSYSDNAQLCGPPLQECPGYAPPSPLIDHGSNNNPQEHDEEEEFPSL  966

Query  503   EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             EFYISMVL F V+FWG +  L +  SWR AY++FL+D+  W+ +  +V F RL++K 
Sbjct  967   EFYISMVLSFFVAFWGILGCLIVNSSWRNAYFKFLTDTTSWLDMISRVWFARLKKKL  1023



>ref|XP_009624409.1| PREDICTED: receptor-like protein 12 [Nicotiana tomentosiformis]
Length=1025

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
             +IPS TQLQ  ++++Y GN  LCG PLP+C       P +    +    +E+DD   + E
Sbjct  908   RIPSSTQLQGFDSSTYGGNIQLCGRPLPQCPTFAPPNPHVGYDSNVRTSKENDDEFPSKE  967

Query  500   FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             FYISM LGF V+FWG + ++FL DSWR AY++ L    +W +++  + F RL+ K 
Sbjct  968   FYISMALGFIVAFWGVLGSIFLIDSWRNAYFKGLYGLNNWFHLSSALCFARLKAKL  1023



>ref|XP_007214523.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
 gb|EMJ15722.1| hypothetical protein PRUPE_ppa015660mg, partial [Prunus persica]
Length=881

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 3/112 (3%)
 Frame = -3

Query  668  IPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP G+QLQ+++ +S Y  N  LCG PLPKC  D            E+ +D+ +L   FY+
Sbjct  725  IPLGSQLQTLDDSSIYMDNPSLCGVPLPKCPGDDTFTATNAKHSNEDGNDNGVLW--FYV  782

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            SM+LGF   FWG  +TL LK SWRYAY++F  D+KD V + + +   RLQ+K
Sbjct  783  SMILGFISGFWGVCITLLLKQSWRYAYFQFFDDTKDKVTLAIALKVARLQKK  834



>ref|XP_010662782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Vitis vinifera]
Length=966

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDR--LLTLE  501
            KIP GTQLQS +A++Y GN GLCG PL  +C ED             +++D +     + 
Sbjct  849  KIPLGTQLQSFDASTYEGNPGLCGPPLLIRCPEDELGGVSFTSGLSSKKEDIQDDANNIW  908

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FY ++VLGF + FWG   TL    SWRYAY++ LS  KDW+Y+T  V+  R++R  
Sbjct  909  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYMTTIVNMNRIRRSL  964



>ref|XP_002526134.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF36210.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=256

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 86/158 (54%), Gaps = 11/158 (7%)
 Frame = -3

Query  776  VECVRQNE--ELIRKPSTAPLPSA-----FTNTLHFFF-ILH*KIPSGTQLQSINATSYA  621
            + C++Q E  +L +   +  LPS+     F NTL+  +  L  +IPS  QLQS +A+ + 
Sbjct  96   IGCLKQLESLDLSQNQLSGKLPSSMAGLNFLNTLNLSYNDLSGRIPSSNQLQSFSASVFI  155

Query  620  GNSGLCGDPL-PKCHED--VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFV  450
            GN  LCG PL  KC E+    A K   D  + +ED D       Y  M LGF V FWG  
Sbjct  156  GNHALCGLPLTQKCPEESTTQAPKSSTDSQQNQEDGDNEFRRWLYAGMGLGFIVGFWGVS  215

Query  449  VTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             TL LK SWR+AY++ L    D +YVT+ V   RLQ+K
Sbjct  216  CTLLLKRSWRHAYFQLLDKLADRLYVTLAVYRRRLQQK  253



>ref|XP_009375566.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=964

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ + GN GLCG P
Sbjct  828  DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFTGNHGLCGQP  886

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  D     PA+       + ++DDD L++  FY+S+ LGF + FW    TL LK 
Sbjct  887  LTPECPVDATTEEPAVPNGSGSDQTKQDDDGLISFGFYVSLALGFIIGFWSVCGTLVLKT  946

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  947  SWRYAYFRFFDDIK  960



>ref|XP_009375609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=961

 Score = 90.9 bits (224),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ + GN GLCG P
Sbjct  825  DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFTGNLGLCGQP  883

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  DV    P++       + ++DDD L++L FY+S+ LGF + FW    TL L  
Sbjct  884  LTPECPGDVTTEDPSVPNGSGSDKTKQDDDGLISLGFYVSLALGFIIGFWSVCGTLVLNA  943

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  944  SWRYAYFRFFDDIK  957



>ref|XP_006599520.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=733

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E     L T EFY
Sbjct  623  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDENL---LFTREFY  679

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            +SM +GF +SFWG   ++ +  SWR+AY++F+S+  D +YV   V   +L  +
Sbjct  680  MSMAIGFVISFWGVFGSILMNRSWRHAYFKFISNFSDAIYVMAAVKVFKLHHR  732



>ref|XP_002268246.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=909

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R     FY
Sbjct  790  RIPLSTQLQSFDAFSYIGNAQLCGAPLTKNCTEDDESQGMDTIDENEEGSEMRW----FY  845

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG    L  K++WRYAY++FL D +DWVYV + +
Sbjct  846  ISMGLGFIVGFWGVCGALLFKENWRYAYFQFLYDIRDWVYVAVAI  890



>ref|XP_008376669.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Malus domestica]
Length=964

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDV----PAIKekgddyeeeeddDRLLT  507
            +IP  TQLQ+ +A+++ GN GLCG PL P+C  D     PA+       + ++DDD  ++
Sbjct  861  RIPLSTQLQTFDASAFTGNLGLCGQPLTPECPGDATTEDPAVPNGSGSDKTKQDDDGFIS  920

Query  506  LEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWV  378
            L FY+S+VLGF + FW    TL LK +WRYAY+RFL D KD +
Sbjct  921  LGFYVSLVLGFVIGFWSVCGTLVLKTTWRYAYFRFLDDIKDRI  963



>ref|XP_009801726.1| PREDICTED: receptor-like protein kinase [Nicotiana sylvestris]
Length=1002

 Score = 90.5 bits (223),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (59%), Gaps = 10/139 (7%)
 Frame = -3

Query  731  TAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED  573
            T  +P++    LHF  +L         KIPS TQLQS + +SY GN+ LCG PL +C ED
Sbjct  861  TGRIPTSLA-QLHFLSVLDLSSNNLSGKIPSSTQLQSFDPSSYEGNNELCGPPLAECPED  919

Query  572  --VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFL  399
                ++          ++DD++L+  FY+ +  GF + FWG + TL LK S+R AY++ L
Sbjct  920  RNTQSLSADHSKINNLDEDDKILSFGFYVCVASGFILGFWGVIFTLALKQSFRDAYFQKL  979

Query  398  SDSKDWVYVTMKVSFVRLQ  342
            ++  +W++VT+ +S  RL+
Sbjct  980  TNFANWIFVTIIMSLHRLK  998



>ref|XP_007021416.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12941.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=625

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 6/113 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP G+QLQ  + ++++ N+GLCG P+ P C  + P  + +    + +E         FY
Sbjct  515  KIPPGSQLQLFDPSTFSHNNGLCGPPVTPNCSMETPRGQLERGHDDSDESMKW-----FY  569

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
              M LGF V FWGF     LK SWR++Y+RFL   KDW+YVT  +   RL+R+
Sbjct  570  AGMGLGFVVGFWGFCGAFLLKSSWRHSYFRFLDKVKDWLYVTYALQKARLERR  622



>ref|XP_010662799.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=777

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R     FY
Sbjct  380  RIPLSTQLQSFDAFSYIGNAQLCGVPLTKNCTEDDESQGMDTIDENEEGSEMRW----FY  435

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG    L LK SWR+AY++FL D +DWVYV + +
Sbjct  436  ISMGLGFIVGFWGVCGALLLKKSWRHAYFQFLYDIRDWVYVAVAI  480


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R     FY
Sbjct  545  RIPLSTQLQSFDAFSYIGNAQLCGVPLTKNCTEDDESQGMDTIDENEEGSEMRW----FY  600

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG    L  K SWR+AY++FL D +DWVYV + +
Sbjct  601  ISMGLGFIVGFWGVCGALLFKKSWRHAYFQFLYDIRDWVYVAVAI  645



>ref|XP_008232926.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Prunus mume]
Length=982

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 70/113 (62%), Gaps = 3/113 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + Y GN  LCG PL K C ++V     K  D+  +ED D L+TL FY
Sbjct  870  KIPVGTQLQGFDPSFYVGNLQLCGPPLKKMCADEVEKGPRKHTDFINQEDKDELITLGFY  929

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF V FWG   TL    SWRYAY +FL+   DW++V  +++ ++ Q K
Sbjct  930  ISMGLGFVVGFWGVCGTLIFSRSWRYAYMKFLNGLNDWLFV--RIALLKRQLK  980



>ref|XP_010671925.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Beta vulgaris subsp. vulgaris]
Length=975

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 6/118 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDV-PAIKekgddyeeeeddDRL-----L  510
            KIP GTQLQS + +SY GN  LCG+PL +C  D  PA K   +    + + +        
Sbjct  857  KIPYGTQLQSFDPSSYMGNPSLCGEPLKECPGDEHPATKPNREKIIPQGEHEHEHGNGNF  916

Query  509  TLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             L  YIS+VLGF + FWG   ++ LK SWR+A++RF  + KD +YV + ++  R+ RK
Sbjct  917  YLGLYISVVLGFIIGFWGVCGSIVLKRSWRHAFFRFFDNMKDKLYVMVFINVARVWRK  974



>ref|XP_009368772.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Pyrus 
x bretschneideri]
Length=219

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDV---PAIKekgddyeeeeddDRLLTL  504
            +IP  TQLQ+ NA+++ GN GLCG PL  +C  D    PA+       + E+DDD  ++L
Sbjct  117  RIPLSTQLQTFNASAFTGNLGLCGQPLTLECPGDTTEDPAVPHGSGSDKTEQDDDGFISL  176

Query  503  EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSK  387
             FY+S+VLGF + FW    TL LK SWRYAY++FL D K
Sbjct  177  GFYVSLVLGFVIGFWSVCGTLVLKTSWRYAYFQFLDDIK  215



>ref|XP_009378506.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=521

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 10/146 (7%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L +   +  +PS+ T +L+F       +  L  +IP+GTQLQS NA+++ GN  LCG P
Sbjct  376  DLSKNHLSGKIPSSMT-SLNFLKELDVSYNNLEGQIPTGTQLQSFNASTFEGNLQLCGAP  434

Query  593  LPKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
            LP    DV A  +   D + + +   LL +  YI   LGF V FWG   +L L  +WR A
Sbjct  435  LPNECRDVDADNKSNIDQDADNERVELLGI--YIFAALGFIVGFWGVCGSLVLNKTWRNA  492

Query  413  YYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y++F  + +D +Y+ M +   R++R+
Sbjct  493  YFQFFDNVQDSLYMNMAMCMARMKRR  518



>ref|XP_006599518.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Glycine max]
Length=317

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E     L T EFY
Sbjct  207  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDENL---LFTREFY  263

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +SM +GF +SFWG   ++ +  SWR+AY++F+S+  D +YV   V
Sbjct  264  MSMAIGFVISFWGVFGSILINRSWRHAYFKFISNFSDAIYVMAAV  308



>ref|XP_004296198.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Fragaria vesca subsp. vesca]
Length=987

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 2/104 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP GTQLQ+  A+S+ GN  LCG PL  C  ++    +     ++E+ D++ +T  FYI
Sbjct  845  KIPIGTQLQNYGASSFLGNPKLCGIPLEIC--NLEGTGQPNVSSDQEDSDNKQITRGFYI  902

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            S+ LGF V FWG   +L  K SWRY YY FL+ S DW+YV  K+
Sbjct  903  SLGLGFVVGFWGLCGSLIFKRSWRYKYYNFLNASHDWLYVKYKI  946



>ref|XP_008226203.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=982

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IP G+QLQ+    S Y GN  LCG PLP KC    P          +  ++D    L F
Sbjct  869  RIPLGSQLQTFTDPSIYMGNPSLCGVPLPTKC----PGDDTFTTTDAKPINEDGSDKLWF  924

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+SM LGF + FWG   TL +K SWRYAY+RF  ++KD V + + +   RLQRKF
Sbjct  925  YVSMALGFVLGFWGVCGTLLVKKSWRYAYFRFFDNTKDKVTLAIVLKVARLQRKF  979



>gb|KHN26502.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=711

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 68/105 (65%), Gaps = 4/105 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E+    L T EFY
Sbjct  601  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDEKL---LFTREFY  657

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +SM +GF +SFWG   ++ +K SWR+AY++F+S+  D +YV + V
Sbjct  658  MSMAIGFVISFWGVFGSILIKRSWRHAYFKFISNLSDAIYVMVAV  702



>ref|XP_007212428.1| hypothetical protein PRUPE_ppa016649mg, partial [Prunus persica]
 gb|EMJ13627.1| hypothetical protein PRUPE_ppa016649mg, partial [Prunus persica]
Length=132

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 11/140 (8%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED  573
            +L R   +  +PS    +LHF   L+          S+NA+++ GN  LCG P+P     
Sbjct  2    DLSRNDLSGNIPSPLA-SLHFLHALN---------VSLNASAFEGNPKLCGAPVPNECGP  51

Query  572  VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSD  393
            +  I         + D    L   FYIS+VLGF V FWG   +L +K +WR+ Y+RF  +
Sbjct  52   INGIDAADKKNNHDVDSGHQLPW-FYISVVLGFIVGFWGVCGSLIIKGTWRHGYFRFTDN  110

Query  392  SKDWVYVTMKVSFVRLQRKF  333
             +D VYV M VS  R++RK 
Sbjct  111  IQDRVYVMMTVSMNRMKRKL  130



>ref|XP_009627877.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nicotiana tomentosiformis]
Length=999

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 83/146 (57%), Gaps = 10/146 (7%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   T  +P++    LHF  +L         KIPS TQLQS + +SY GN+ LCG P
Sbjct  851  DLSRNQLTGRIPTSLA-QLHFLSVLDLSSNNLSGKIPSSTQLQSFDPSSYEGNNELCGLP  909

Query  593  LPKCHED--VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWR  420
            L +C ED  + +           + DD++L+  FY+ +  GF + FWG + TL LK S+R
Sbjct  910  LAECPEDRDIQSPFVDHSKINNLDKDDKILSFGFYVCVASGFILGFWGVIFTLVLKQSFR  969

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQ  342
             AY++ L++  +W++VT  +S  RL+
Sbjct  970  DAYFQKLTNVANWIFVTTIMSLHRLK  995



>ref|XP_007214755.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica]
 gb|EMJ15954.1| hypothetical protein PRUPE_ppa024905mg [Prunus persica]
Length=972

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/114 (45%), Positives = 69/114 (61%), Gaps = 6/114 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IP G QLQ++N +S Y GN  LCG+PL  KC    P  +       ++ + D    L F
Sbjct  862  RIPLGNQLQTLNDSSIYEGNKLLCGEPLSTKC----PGDETLTATNAKDSNADANDKLWF  917

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y+SMVLGF V FWG   TL +K SWRYAY+RF  D K+ V + +++   R+QRK
Sbjct  918  YVSMVLGFIVGFWGVWGTLLVKKSWRYAYFRFFDDIKNKVLLAIELKLARMQRK  971



>gb|EYU34019.1| hypothetical protein MIMGU_mgv1a002019mg [Erythranthe guttata]
Length=725

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 70/123 (57%), Gaps = 12/123 (10%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED--VPAIKekgddyeeeeddDR-----L  513
            KIPS TQLQS N  SYAGN  LCG PL  C  D  +P   ++G    +E  DD      +
Sbjct  602  KIPSSTQLQSFNEFSYAGNPKLCGPPLASCPGDKLIPDTTDQGKRNNKEIKDDEDDGGFI  661

Query  512  LTL-----EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVR  348
            LT      E  IS+V GF V FWGFV +LF+K SWR AYY F     DW YVT  V F +
Sbjct  662  LTRISFWKEVGISIVFGFIVGFWGFVGSLFVKRSWRIAYYNFWGRVGDWFYVTTIVFFRK  721

Query  347  LQR  339
            L+R
Sbjct  722  LRR  724



>ref|XP_008365984.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=324

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            KIPSG QLQ++   S Y GN  LCG PL  KC    P  +      E++ ++D    L F
Sbjct  214  KIPSGNQLQTLEDPSIYKGNLLLCGXPLSTKC----PGDETFTATDEKDSNEDGNDKLWF  269

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+SMVLGF+V FWG   TL +K SWRYAY+R   D KD V + + V     QRK 
Sbjct  270  YVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQRKL  324



>ref|XP_009355165.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=946

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + + YAGN  LCG PLPK   D    +++      EE+ D L+T  FY+
Sbjct  841  KIPTGTQLQSFDPSDYAGNPQLCGPPLPKMCGD----QQETPISSNEEEKDELITWGFYV  896

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            SM LGF V FWG   +L     WRY+Y+RFL+   DW YV +    + ++R F
Sbjct  897  SMALGFIVGFWGVCGSLIFIRPWRYSYFRFLNTLNDWFYVRV----ILIKRHF  945



>ref|XP_008366594.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=766

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+ TQLQ+ NA+++ GN  LCG PLP    ++ A  +   D +     D L    FYI
Sbjct  654  KIPTSTQLQNFNASAFEGNPKLCGAPLPNECREIDAYNKNIVDQDANNKGDELPW--FYI  711

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
               LGF V FWG   +LFLK +WRY+Y++FL + +D +YV M V   +++R+
Sbjct  712  FATLGFIVGFWGVCGSLFLKKTWRYSYFQFLDNVQDSLYVKMAVCMGKMKRR  763



>ref|XP_007021422.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12947.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=969

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQ  + + ++ N GLCG P+ P C   V   K + +  +++ D+       FY
Sbjct  857  KIPSGTQLQGFDPSIFSHNHGLCGPPVTPNCSGSVELPKGQLERGQDDFDE---FLKWFY  913

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
              MVLGF V FWGF   L  K SWR++Y+RFL   KDW+YV   +   RL+R+
Sbjct  914  AGMVLGFVVGFWGFCGALLFKRSWRHSYFRFLDKVKDWLYVAYALQKARLERR  966



>emb|CAN79880.1| hypothetical protein VITISV_031344 [Vitis vinifera]
Length=722

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPSGTQLQS +A++Y GN  LCG PL  KC  D             +   D    + F 
Sbjct  606  KIPSGTQLQSFSASTYQGNPRLCGPPLLKKCLGDETREASFVGPSNRDNIQDDANKIWFS  665

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV-TMKVSFVRLQRKF  333
             S+VLGF + FWG   TL    SWRYAY++FL+  KDW+Y+ T  ++  RL+R F
Sbjct  666  GSIVLGFIIGFWGVCGTLLFNSSWRYAYFQFLNKIKDWLYMTTTTITMNRLRRSF  720



>ref|XP_006374305.1| hypothetical protein POPTR_0015s05870g [Populus trichocarpa]
 gb|ERP52102.1| hypothetical protein POPTR_0015s05870g [Populus trichocarpa]
Length=1108

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 77/148 (52%), Gaps = 15/148 (10%)
 Frame = -3

Query  725   PLPSAFTNTLHFFFI----LH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDV---  570
             P+  A  N L F  +    L  +IPS TQLQ  NA+ + GN  LCG PL  +C  D    
Sbjct  963   PITMADLNFLAFLNLSNNHLSGRIPSSTQLQGFNASQFTGNLALCGKPLLQRCPGDETNQ  1022

Query  569   --PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLS  396
               PA  +        ++  +     F  +M +GFSV FWG    L LK SWR+AY+RFL 
Sbjct  1023  SPPANDDNRGKEVVADEFMKW----FCTAMGIGFSVFFWGVSGALLLKRSWRHAYFRFLD  1078

Query  395   DSKDWVYVTMKVSFVRLQRKF-WPH*MG  315
             +S DW+YV + V   RLQR F W H  G
Sbjct  1079  ESWDWLYVKVAVRKARLQRAFQWLHEHG  1106



>ref|XP_006607058.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like [Glycine max]
Length=819

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQ  NA+ Y  N  LCG PL K C +  PA +      E+E+    L T EFY
Sbjct  709  EIPTGTQLQGFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDEKL---LFTREFY  765

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            +SM +GF +SFWG   ++ +K SWR+AY++F+S+  D +YV + V   + + +
Sbjct  766  MSMAIGFVISFWGVFGSILIKRSWRHAYFKFISNLSDAIYVMVAVKVSKWRHR  818



>ref|XP_004305479.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Fragaria vesca subsp. vesca]
Length=1089

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 81/136 (60%), Gaps = 13/136 (10%)
 Frame = -3

Query  752   ELIRKPSTAPLPSAFTNTLHFFFI-------LH*KIPSGTQLQSINATSYAGNSGLCGDP  594
             +L R   +  +P++F+  L+F  +       L  +IP GTQLQS NA+SY  N GLCG P
Sbjct  951   DLSRNQLSGNIPASFSG-LNFLSVMDLSYNNLSGRIPLGTQLQSFNASSYMDNLGLCGPP  1009

Query  593   L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
             L P+C  D      A     +  + EE+DD L+TL FY+S+VLGF + FWGF   L LK 
Sbjct  1010  LTPRCPGDATNQDSAGTSGAEGDKTEEEDDGLITLGFYVSLVLGFIIGFWGFCGPLLLKV  1069

Query  428   SWRYAYYRFLSDSKDW  381
             SWR AY++  +D+K W
Sbjct  1070  SWRNAYFQVWNDTKIW  1085



>ref|XP_009394659.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Musa acuminata subsp. malaccensis]
Length=325

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (57%), Gaps = 12/139 (9%)
 Frame = -3

Query  728  APLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDV  570
              +PS+F+  +HF       +  L  KIP+  QL + ++ +Y GN GLCG PLP C    
Sbjct  188  GEIPSSFS-AMHFLERLNLSYNNLSGKIPTSGQLSTFDSWTYVGNKGLCGMPLPDC----  242

Query  569  PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDS  390
            P  +   D   + EDD +L  L  Y S+V+GF V FW F+ TL LK + R+A++R++  +
Sbjct  243  PVYQTPPDARVKHEDDGKLDKLLEYTSIVVGFVVGFWLFIGTLILKQAIRFAFFRWIDKT  302

Query  389  KDWVYVTMKVSFVRLQRKF  333
             DWVYV   V   +L+ K+
Sbjct  303  SDWVYVQFAVKLAKLKSKW  321



>ref|XP_007219854.1| hypothetical protein PRUPE_ppa027060mg [Prunus persica]
 gb|EMJ21053.1| hypothetical protein PRUPE_ppa027060mg [Prunus persica]
Length=763

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + YAGN  LCG PL K C ++V     +  D+  ++D D L+TL FY
Sbjct  651  KIPIGTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGPSEQTDFINQKDKDELITLGFY  710

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF+  FWG   TL    SWRY Y +FL+   DW +V  +++ ++ Q K
Sbjct  711  ISMGLGFAAGFWGVCGTLIFSRSWRYTYLKFLNGLNDWFFV--RIALLKRQLK  761



>ref|XP_007213359.1| hypothetical protein PRUPE_ppa026938mg, partial [Prunus persica]
 gb|EMJ14558.1| hypothetical protein PRUPE_ppa026938mg, partial [Prunus persica]
Length=356

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 6/113 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS +   YA N  LCG PL K   D    + +      EED D  +TL FYI
Sbjct  247  KIPTGTQLQSFDPLDYAENPLLCGPPLKKMCAD----QNEQTGLSNEEDKDEFITLGFYI  302

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            SM +GF+  FWG   TL     WRY Y++FL+   +W+YV  K++ ++ Q K 
Sbjct  303  SMGIGFAAGFWGVCSTLIFNRPWRYTYFKFLNHLNNWLYV--KIALIKRQLKL  353



>ref|XP_007203166.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica]
 gb|EMJ04365.1| hypothetical protein PRUPE_ppa025019mg, partial [Prunus persica]
Length=765

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 6/115 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IP G+QLQ+   +S Y GN  LCG PLP KC    P          +  ++D    + F
Sbjct  652  RIPLGSQLQTFTDSSIYMGNPSLCGFPLPTKC----PGDDTLTITNAKHNNEDGNDKMWF  707

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+ M LGF V FWG   TL +K SWRYAY+RF  D+KD V + +++   RLQRKF
Sbjct  708  YVGMGLGFIVGFWGVFGTLLVKKSWRYAYFRFFDDTKDKVTLAIELKVTRLQRKF  762



>ref|XP_007219665.1| hypothetical protein PRUPE_ppa025228mg, partial [Prunus persica]
 gb|EMJ20864.1| hypothetical protein PRUPE_ppa025228mg, partial [Prunus persica]
Length=623

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (60%), Gaps = 9/112 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP GTQLQS + + YA N  LCG PL K   D P+      +Y   +D   L+TL FYI
Sbjct  517  QIPIGTQLQSFDRSVYAENPQLCGAPLLKMCAD-PS------EYSNTKDTYELITLGFYI  569

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            SM LGF   FWG   TL  K SWRY Y++FL+   DW+YV  +V+ ++ Q K
Sbjct  570  SMALGFVAGFWGVCFTLIFKRSWRYEYFKFLNGLNDWLYV--RVALIKRQLK  619



>emb|CBI17238.3| unnamed protein product [Vitis vinifera]
Length=653

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS +A SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  541  RIPSSTQLQSFDAISYIGNAELCGVPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  594

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV + +   RLQ   
Sbjct  595  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYRVKDWVYVAIAIRLNRLQNNL  650



>ref|XP_007021417.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12942.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=906

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 6/113 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP+G+QLQ  + ++++ N GLCG P+ P C  + P  + +  + + +E         FY
Sbjct  796  KIPTGSQLQLFDPSTFSHNHGLCGPPVTPNCSMETPQGQLERGEDDFDEFMKW-----FY  850

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
              M LGF V FWGF     LK SWR++Y+RFL   KDW+YVT  +   RL+R+
Sbjct  851  AGMGLGFVVGFWGFCGAFLLKRSWRHSYFRFLDKVKDWLYVTYALQKARLERR  903



>ref|XP_009387210.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=717

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (59%), Gaps = 12/140 (9%)
 Frame = -3

Query  731  TAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKCHED  573
            T  +PS+F+  +HF       +  L  KIP+  QL + ++ +Y GN GLCG PLP C   
Sbjct  579  TGEIPSSFS-AMHFLERLNLSYNNLSGKIPTSGQLSTFDSWTYVGNKGLCGIPLPDC---  634

Query  572  VPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSD  393
             P  +   D   + EDD++L  L  Y S+V+GF V FW F+ TL +K + R+A++R++ +
Sbjct  635  -PVYQTPPDATVKHEDDEKLDKLLEYTSVVIGFVVGFWLFIGTLIMKQAIRFAFFRWIDE  693

Query  392  SKDWVYVTMKVSFVRLQRKF  333
            + DW+YV   V   +L+ K+
Sbjct  694  ASDWIYVQFAVKLAKLKSKW  713



>ref|XP_006446689.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
 gb|ESR59929.1| hypothetical protein CICLE_v10017769mg [Citrus clementina]
Length=996

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 4/112 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPS  +LQ  +A++YAGN  LCG PLP KC ED PA   +      +  +D +++  FY
Sbjct  888  KIPSSNKLQGFDASAYAGNLELCGSPLPVKCPEDEPA---QSPAITMQHSEDGIVSTGFY  944

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +S+ LGF V FWGFV +L L  SWR AY++FL  +K+ +      +  + QR
Sbjct  945  VSVALGFIVGFWGFVSSLLLNRSWRRAYWQFLDHTKERLCTNTVPNAAKRQR  996



>ref|XP_010650299.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X2 [Vitis vinifera]
Length=749

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS +A SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  637  RIPSSTQLQSFDAISYIGNAELCGVPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  690

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV + +   RLQ   
Sbjct  691  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYRVKDWVYVAIAIRLNRLQNNL  746



>ref|XP_003629986.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AET04462.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=907

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 56/149 (38%), Positives = 81/149 (54%), Gaps = 19/149 (13%)
 Frame = -3

Query  722  LPSAFTNTLHF------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHED---  573
            +P++  N L        +  L  KIPSG Q ++    SY GN  LCG PL K C ED   
Sbjct  752  IPTSMVNMLSLEILNLSYNTLSGKIPSGKQFETFWNDSYIGNPHLCGSPLTKACPEDGNS  811

Query  572  ------VPAIKekgddyeeeeddDRLLTLE---FYISMVLGFSVSFWGFVVTLFLKDSWR  420
                     I+   +   ++  +D++L +E   FYISM +GFS  FW F  +L L  SWR
Sbjct  812  WFKDTHCSDIEGSIEHESDDNHEDKVLGMEINPFYISMAMGFSTGFWVFWGSLILIASWR  871

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +AY+RFL +  D +YVT+ V+  +L++KF
Sbjct  872  HAYFRFLGNMNDKIYVTVVVALNKLRKKF  900



>ref|XP_009352122.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Pyrus x bretschneideri]
Length=964

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS NA+ + GN GL G P
Sbjct  828  DLSRNQISGSIPLSFS-SLHYLSVLDLSYNNLSGRIPLSTQLQSFNASQFTGNLGLYGQP  886

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  D     PA+       + ++DDD L+T  FY+S+VLGF + FW    TL LK 
Sbjct  887  LTPECPGDATTEDPAVPIGSGSDQTKQDDDGLITFGFYVSLVLGFIIGFWSVCGTLVLKT  946

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  947  SWRYAYFRFFDDIK  960



>ref|XP_006599523.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Glycine max]
 ref|XP_006599524.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Glycine max]
Length=947

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E+    L T EFY
Sbjct  837  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDEKL---LFTREFY  893

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            +SM +GF +S WG   ++ +K SWR+AY++F+S+  D +YV + V   + + +
Sbjct  894  MSMAIGFVISLWGVFGSILIKRSWRHAYFKFISNLSDAIYVMVAVKVSKWRHR  946



>ref|XP_010650298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=876

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 64/116 (55%), Gaps = 9/116 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS +A SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  764  RIPSSTQLQSFDAISYIGNAELCGVPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  817

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV + +   RLQ   
Sbjct  818  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYRVKDWVYVAIAIRLNRLQNNL  873



>ref|XP_009760943.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana sylvestris]
Length=1025

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKC---HEDVPAIKekgddyeeeeddDRLLTLE  501
             +IPS TQLQ  ++++Y GN  LCG PLP+C       P +    +    +E+DD   + E
Sbjct  908   RIPSSTQLQGFDSSTYGGNIQLCGRPLPQCPTFAPPNPHVGYDSNVSTSQENDDDFPSKE  967

Query  500   FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             FYISM LGF V+FWG +  +F  +SWR AY++ L    +W +++  + F RL+ K 
Sbjct  968   FYISMALGFIVAFWGVLGPIFFLESWRNAYFKRLDGVDNWFHLSSALCFARLKAKL  1023



>ref|XP_008362830.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=863

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P +F+ +LH+  +L         +IP  TQLQS N + + GN GLCG P
Sbjct  727  DLSRNQISGSIPPSFS-SLHYLSVLDLSYNNLSGRIPXSTQLQSFNXSQFTGNLGLCGQP  785

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C   V    PA+       + ++D D L++  FY+S+ LGF + FW    TL LK 
Sbjct  786  LXPECPGXVTTEDPAVPNGSGSXKTKQDXDGLISFGFYVSLXLGFIIGFWSVCGTLVLKT  845

Query  428  SWRYAYYRFLSDSK  387
            SWRYAY+RF  D K
Sbjct  846  SWRYAYFRFFDDIK  859



>emb|CBI22716.3| unnamed protein product [Vitis vinifera]
Length=721

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R L    Y
Sbjct  606  RIPLSTQLQSFDAFSYIGNAQLCGVPLTKNCTEDDESQGMDTIDENEEGSEMRWL----Y  661

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG    L  K SWR+AY++FL D +DWVYV + +
Sbjct  662  ISMGLGFIVGFWGVCGALLFKKSWRHAYFQFLYDIRDWVYVAVAI  706



>ref|XP_008376041.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=481

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP G+QLQ+   +S+ GN  LCG PL +C E+ P  +      ++       +T  FY+
Sbjct  374  KIPMGSQLQTYEPSSFDGNPLLCGIPLQQCPEEQPEEQPNQVKKKDG-----FITTGFYV  428

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            S+ LGF V FWG   +L    SWRY YY+FL+   DW+YV  +V+ +R +R
Sbjct  429  SLALGFVVGFWGICGSLIFIKSWRYTYYKFLNYVYDWLYV--RVALIRRRR  477



>ref|XP_007219249.1| hypothetical protein PRUPE_ppa018051mg [Prunus persica]
 gb|EMJ20448.1| hypothetical protein PRUPE_ppa018051mg [Prunus persica]
Length=873

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + Y GN  LCG PL K C ++      +  D+  +ED + L+TL FY
Sbjct  761  KIPVGTQLQGFDPSFYVGNLQLCGPPLKKMCADEEERGPSEQSDFINQEDKEELITLGFY  820

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG   TL    SWRYAY +FL++  DW++V + +
Sbjct  821  ISMGLGFIVGFWGVCSTLIFSRSWRYAYLKFLNNLNDWLFVRIAL  865



>ref|XP_008231965.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Prunus mume]
Length=1051

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 10/115 (9%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK--CHEDVPAIKekgddyeeeeddDRLLTLEF  498
             +IP+GTQLQS +   YA N  LCG PL K   +++ P       D   EED D  +TL F
Sbjct  942   EIPTGTQLQSFDPLDYAENPLLCGPPLKKMCVNQNEPT------DLSNEEDKDEFITLGF  995

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             YISM +GF+  FWG   TL    SWRYAY++FL++  DW+YV  +++ ++ Q K 
Sbjct  996   YISMGIGFAAGFWGVCGTLIFNRSWRYAYFKFLNNLNDWLYV--RIALIKRQLKL  1048



>ref|XP_011099254.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Sesamum indicum]
Length=1075

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 58/111 (52%), Gaps = 12/111 (11%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHE-DVPAIKekgddyeeeeddDRLLTLEFY  495
             IPSGTQLQ  NA+ YAGN GLCG PL  C   D P+                    +FY
Sbjct  390  NIPSGTQLQGFNASVYAGNDGLCGPPLAACLPLDGPSSATGIK-----------FDTDFY  438

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQ  342
            IS VLGF V FWGF+V+L L +SWR  Y+ F +   DW   T     +R +
Sbjct  439  ISTVLGFVVGFWGFIVSLVLNNSWRKTYFDFWNKIWDWTTSTTNARRLRCE  489



>ref|XP_007214288.1| hypothetical protein PRUPE_ppb000367mg [Prunus persica]
 gb|EMJ15487.1| hypothetical protein PRUPE_ppb000367mg [Prunus persica]
Length=1121

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
             KIP+GTQLQS +   YA N  LCG PL K   D      + +    EED D  +TL FYI
Sbjct  1014  KIPTGTQLQSFDPLDYAENPQLCGPPLKKMCAD------QNEPLSNEEDKDEFITLGFYI  1067

Query  491   SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQ  342
             SM +GF+  FWG   TL    SWRYAY +FL+   DW+YV + +S  +L+
Sbjct  1068  SMGIGFAAGFWGVCGTLIFNRSWRYAYLKFLNGLNDWLYVKIALSKRQLK  1117



>ref|XP_002268170.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Vitis vinifera]
Length=905

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R L    Y
Sbjct  790  RIPLSTQLQSFDAFSYIGNAQLCGVPLTKNCTEDDESQGMDTIDENEEGSEMRWL----Y  845

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF V FWG    L  K SWR+AY++FL D +DWVYV + +
Sbjct  846  ISMGLGFIVGFWGVCGALLFKKSWRHAYFQFLYDIRDWVYVAVAI  890



>gb|KHN09276.1| Protein BRASSINOSTEROID INSENSITIVE 1 [Glycine soja]
Length=405

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R      +PS+ T       +      L  +IP+GTQLQS NA+ Y  N  LCG PL
Sbjct  261  DLSRNQLVGSIPSSLTQIDRLSMLDLSHNNLSGEIPTGTQLQSFNASCYEDNLYLCGPPL  320

Query  590  PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
             K C +  PA +      E+E+    L   EFYISM +GF  SFWG   ++ +K SWR+ 
Sbjct  321  KKLCIDGKPAQEPIVKLLEDEKL---LFAREFYISMAIGFVTSFWGVFGSILIKRSWRHV  377

Query  413  YYRFLSDSKDWVYVTMKV  360
            Y++FL++  D +YV + V
Sbjct  378  YFKFLNNLSDNIYVKVAV  395



>ref|XP_006599527.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like isoform X1 [Glycine max]
 ref|XP_006599528.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110-like isoform X2 [Glycine max]
Length=633

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E     L T EFY
Sbjct  523  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDENL---LFTREFY  579

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +SM +GF +SFWG   ++ +  SWR+AY++F+S+  D +YV   V
Sbjct  580  MSMAIGFVISFWGVFGSILINRSWRHAYFKFISNFSDAIYVMAAV  624



>ref|XP_010650302.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=534

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS +  SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  422  RIPSSTQLQSFDEISYIGNAELCGVPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  475

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV + +   RLQ   
Sbjct  476  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYRVKDWVYVAIAIRLNRLQNNL  531



>ref|XP_008355013.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=442

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 16/133 (12%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P++ +N LHF       +  L  ++P GTQ+Q  +AT++ GN GLCG P
Sbjct  312  DLSRNHLSGGIPASLSN-LHFLASLSVAYNNLQGQVPLGTQIQGFDATAFEGNPGLCGSP  370

Query  593  LP-KCHEDVP--AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
            LP KC ++    A K   D +    +        FYIS+ LGF V FWG   +L L  SW
Sbjct  371  LPNKCQQNTSDNATKNMEDVHGNGNEIPW-----FYISVALGFIVGFWGVCGSLALITSW  425

Query  422  RYAYYRFLSDSKD  384
            RYAY++FLSD KD
Sbjct  426  RYAYFQFLSDVKD  438



>ref|XP_009370715.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
 ref|XP_009344456.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=348

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ+ + + +AGN  LCG PL + C  +  + KE+    ++ +++D L+T  FY
Sbjct  235  KIPMGTQLQTYDPSDFAGNPLLCGIPLQQLCSPEETSPKEQPMFGDQVKENDGLITTGFY  294

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +S+  GF V FWG   +L    SWRY YY+FLS   DW+YV  +V+ +R +R
Sbjct  295  LSLAFGFVVGFWGVCGSLIFIRSWRYTYYKFLSCVYDWLYV--RVALIRRRR  344



>gb|KEH33781.1| LRR receptor-like kinase [Medicago truncatula]
Length=886

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC--HEDVPAIKekgddyeeeeddDRLLTLEF  498
            KIP GTQLQS NA+SY GN  LCG PL  C   E+ P         E+++     L    
Sbjct  777  KIPIGTQLQSFNASSYVGNPKLCGAPLNNCTKKEENPKTAMPSTKNEDDDSIKESL----  832

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            Y+ M +GF+V FWG   +LFL   WR+AY+RF+   +D +YVT+ V     +R
Sbjct  833  YLGMGVGFAVGFWGICRSLFLIRKWRHAYFRFVDRVRDKIYVTLIVKLNGFKR  885



>ref|XP_010671582.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=1007

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 9/111 (8%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVP---AIKekgddyeeeeddDRLLTLE  501
             KIP GTQLQ  + +SY GNS LCG PL KC  D P    +    + ++ E  +  L  L 
Sbjct  903   KIPVGTQLQGFDPSSYMGNSQLCGAPLSKCPGDEPPASKVNRDNNAHQNEGGNSDLFDLG  962

Query  500   FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVR  348
             FYIS++LGF + FWG   TL +K +WR+A+++ L D K+      K SF+R
Sbjct  963   FYISVLLGFILGFWGVCGTLVIKTNWRHAFFKLLDDVKN------KFSFMR  1007



>gb|KHN02657.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1083

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +  E E     L + EFY
Sbjct  972   KIPTSTQLQSFNASSYEDNLDLCGPPLEKFCIDGRPTQKPNVEVQEGEYS---LFSREFY  1028

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             ISM  GF +SFW    ++ LK SWR+AY++FL++  D +YV + V
Sbjct  1029  ISMTFGFVISFWVVFGSILLKRSWRHAYFKFLNNLSDNIYVKVAV  1073



>ref|XP_009368581.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=1048

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 66/115 (57%), Gaps = 6/115 (5%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
             KIPSG QLQ++   S Y GN  LCG PL  KC    P  +       ++ D+D    L F
Sbjct  938   KIPSGNQLQTLEDPSIYKGNLLLCGVPLSNKC----PGDETFTATDAKDSDEDGNNKLWF  993

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             Y+SMVLGF+V FWG   TL +K SWRYAY+R   D KD V + + V   R QRK 
Sbjct  994   YVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVARFQRKL  1048



>ref|XP_006360385.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Solanum tuberosum]
Length=151

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 77/146 (53%), Gaps = 15/146 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   T  +P++    L+F  +L         +IPS TQLQS N +SYAGN+ LCG P
Sbjct  8    DLSRNQLTGRIPTSLAR-LNFLSVLDLSSNNLSGEIPSSTQLQSFNPSSYAGNNELCGPP  66

Query  593  LPKC--HEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWR  420
            L KC  H+D             +EDDD LL+  FY S+  GF V FWG + TL    S R
Sbjct  67   LEKCTVHDD-----HTSRTNNVDEDDDMLLSFGFYASVCSGFIVGFWGVIFTLVFNKSCR  121

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQ  342
             AY+    +  +W++VT  +   RL+
Sbjct  122  DAYFHLFINVANWIFVTTIMCLRRLK  147



>ref|XP_008226566.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Prunus 
mume]
Length=571

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYIS  489
            IP GTQLQS NA+++ GN  LCG PLP   E    I     + ++E +    L   FYI 
Sbjct  459  IPIGTQLQSFNASAFEGNPKLCGVPLPNKCEPNKCIDADNKNNKDEGNGHHQLPW-FYIF  517

Query  488  MVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +VLGF V FWG   +L + ++WRYAY+RF+ + +D +YV + V    ++R+ 
Sbjct  518  VVLGFIVGFWGVCGSLVINNTWRYAYFRFIDNVQDRLYVMVTVCINTMKRRL  569



>ref|XP_011010632.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Populus euphratica]
Length=1140

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 65/119 (55%), Gaps = 10/119 (8%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDV-----PAIKekgddyeeeeddDRLL  510
             +IP  TQLQ  NA+ + GN  LCG PL  KC  D      PA  +        ++  +  
Sbjct  1017  RIPLSTQLQGFNASQFTGNLALCGKPLLQKCPGDETNQSPPANDDNRGKEVVADEFMKW-  1075

Query  509   TLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
                F  +M +GFSV FWG    L LK SWR+AY+RFL +S DW+YV + V   RLQR F
Sbjct  1076  ---FCTAMGIGFSVFFWGVSGALLLKRSWRHAYFRFLDESWDWLYVMVAVRKARLQRAF  1131



>ref|XP_006599537.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X3 [Glycine max]
Length=872

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
            +L R      +PS+ T       +      L  +IP+GTQLQS NA+ Y  N  LCG PL
Sbjct  728  DLSRNQLVGSIPSSLTQIDRLSMLDLSHNNLSGEIPTGTQLQSFNASCYEDNLYLCGPPL  787

Query  590  PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
             K C +  PA +      E+E+    L   EFYISM +GF  SFWG   ++ +K SWR+ 
Sbjct  788  KKLCIDGKPAQEPIVKLLEDEKL---LFAREFYISMAIGFVTSFWGVFGSILIKRSWRHV  844

Query  413  YYRFLSDSKDWVYVTMKV  360
            Y++FL++  D +YV + V
Sbjct  845  YFKFLNNLSDNIYVKVAV  862



>ref|XP_009367835.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=727

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 66/101 (65%), Gaps = 1/101 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ+ +++ +AGN  LCG PL + C  +  + +E     ++ +++DRL+T  FY
Sbjct  607  KIPMGTQLQTYDSSDFAGNPLLCGIPLQQLCSSEETSPEELPMFGDQVKENDRLITTGFY  666

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            +S+ LGF V FWG   +L    SWRY YYRFL+   DW+YV
Sbjct  667  LSLALGFVVGFWGVCGSLIFIKSWRYTYYRFLNCVYDWLYV  707



>ref|XP_006470464.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=807

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 67/112 (60%), Gaps = 4/112 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIPS  +L   +A++YAGN  LCG PLP KC ED PA   +      +  +D +++  FY
Sbjct  699  KIPSSNKLLGFDASAYAGNLELCGSPLPVKCPEDEPA---QSPAITMQHSEDGIISTGFY  755

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +S+ LGF V FWGFV +L L  SWR AY++FL  +K+ +      +  + QR
Sbjct  756  VSVALGFIVGFWGFVGSLLLNRSWRRAYWQFLDHTKERLCTNTVPNVAKRQR  807



>ref|XP_008384510.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Malus 
domestica]
Length=231

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P + + +LHF       +  L  +IPSGTQLQ  +AT++ GN GLCG P
Sbjct  100  DLSRNHLSGGIPPSLS-SLHFLASLSVAYNNLQGQIPSGTQLQGFDATAFEGNPGLCGSP  158

Query  593  LP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRY  417
            LP KC +   +     +  +E ++ + +  L  YIS+ LGF V FWG   +L L  SWR+
Sbjct  159  LPNKCQQMNTSDDATKNLEDEHDNGNEISWL--YISVALGFIVGFWGXCGSLALSMSWRW  216

Query  416  AYYRFLSDSKD  384
            AY++FLSD KD
Sbjct  217  AYFQFLSDVKD  227



>emb|CAN71913.1| hypothetical protein VITISV_032859 [Vitis vinifera]
Length=813

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 63/116 (54%), Gaps = 9/116 (8%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-C--HEDVPAIKekgddyeeeeddDRLLTLE  501
            +IPS TQLQS +  SY GN+ LCG PL K C   ED   I    ++ E  E         
Sbjct  696  RIPSSTQLQSFDXISYIGNAELCGVPLTKNCTEDEDFQGIDVIDENEEGSEIPW------  749

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            FYI M LGF V FWG    L  K +WR+AY++FL   KDWVYV + +   RLQ   
Sbjct  750  FYIGMGLGFIVGFWGVCGALLFKKAWRHAYFQFLYRVKDWVYVAIAIRLNRLQNNL  805



>gb|KHN19731.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=567

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQ+ NA+ Y  N  LCG PL K C +  P  +      E+E+    L T EFY
Sbjct  424  EIPTGTQLQTFNASCYEDNLDLCGPPLEKLCADGKPPQEPIVKLPEDEKL---LFTREFY  480

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTM  366
            +SM +GF +SFWG   ++ +K SWR+AY++F+S+  D +YV +
Sbjct  481  MSMAIGFVISFWGVFGSILIKRSWRHAYFKFISNLSDAIYVMV  523



>ref|XP_006599535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X1 [Glycine max]
Length=1117

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  752   ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
             +L R      +PS+ T       +      L  +IP+GTQLQS NA+ Y  N  LCG PL
Sbjct  973   DLSRNQLVGSIPSSLTQIDRLSMLDLSHNNLSGEIPTGTQLQSFNASCYEDNLYLCGPPL  1032

Query  590   PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
              K C +  PA +      E+E+    L   EFYISM +GF  SFWG   ++ +K SWR+ 
Sbjct  1033  KKLCIDGKPAQEPIVKLLEDEKL---LFAREFYISMAIGFVTSFWGVFGSILIKRSWRHV  1089

Query  413   YYRFLSDSKDWVYVTMKV  360
             Y++FL++  D +YV + V
Sbjct  1090  YFKFLNNLSDNIYVKVAV  1107



>ref|XP_008376042.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Malus 
domestica]
Length=474

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 64/111 (58%), Gaps = 7/111 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP G+QLQ+   +S+ GN  LCG PL +C E  P  +      ++       +T  FY+
Sbjct  367  KIPMGSQLQTYEPSSFDGNPLLCGIPLQQCPEXQPEEZPNQVKKKDG-----FITTGFYV  421

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            S+ LGF V FWG   +L    SWRY YY+FL+   DW+YV  +V+ +R +R
Sbjct  422  SLALGFVVGFWGICGSLIFIKSWRYTYYKFLNYVYDWLYV--RVALIRRRR  470



>ref|XP_011015141.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Populus euphratica]
Length=907

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -3

Query  725  PLPSAFTNTLHFFFI----LH*KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDV---  570
            P+  A  N L F  +    L  +IP  TQLQ  NA+ + GN  LCG PL  KC  D    
Sbjct  762  PITMADLNFLAFLNLSYNHLSGRIPLSTQLQGFNASQFTGNLALCGLPLLQKCPGDETNQ  821

Query  569  --PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLS  396
              PA  +        ++  +     F  +M +GFSV FWG    L LK SWR+AY+RFL 
Sbjct  822  SPPANDDNRGKEVVADEFMKW----FCTAMGIGFSVFFWGVSGALLLKRSWRHAYFRFLD  877

Query  395  DSKDWVYVTMKVSFVRLQRKF  333
            +S DW+YV + V   RLQR F
Sbjct  878  ESWDWLYVMVAVRKARLQRAF  898



>ref|XP_006600020.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=867

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP+ TQLQS NA+SY  N  LCG PL K C ++ P  K   +  E+E     LL+ EFY
Sbjct  756  KIPTSTQLQSFNASSYEDNLDLCGPPLEKFCIDERPTQKPNVEVQEDEYS---LLSREFY  812

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +SM  GF +SFW    ++  K SWR+AY++FL++  + +YV + V
Sbjct  813  MSMTFGFVISFWVVFGSILFKSSWRHAYFKFLNNLSNNIYVKVAV  857



>ref|XP_011010633.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 isoform X2 [Populus euphratica]
Length=1116

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 65/119 (55%), Gaps = 10/119 (8%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDV-----PAIKekgddyeeeeddDRLL  510
             +IP  TQLQ  NA+ + GN  LCG PL  KC  D      PA  +        ++  +  
Sbjct  993   RIPFSTQLQGFNASQFTGNLALCGKPLLQKCPGDETNQSPPANDDNRGKEFVADEFMKW-  1051

Query  509   TLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
                F  +M +GFSV FWG    L LK SWR+AY+RFL +S DW+YV + V   RLQR F
Sbjct  1052  ---FCTAMGIGFSVFFWGVSGALLLKRSWRHAYFRFLDESWDWLYVKVAVRKARLQRAF  1107



>ref|XP_006599536.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like isoform X2 [Glycine max]
Length=1093

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  752   ELIRKPSTAPLPSAFTNTLHFFFI------LH*KIPSGTQLQSINATSYAGNSGLCGDPL  591
             +L R      +PS+ T       +      L  +IP+GTQLQS NA+ Y  N  LCG PL
Sbjct  949   DLSRNQLVGSIPSSLTQIDRLSMLDLSHNNLSGEIPTGTQLQSFNASCYEDNLYLCGPPL  1008

Query  590   PK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYA  414
              K C +  PA +      E+E+    L   EFYISM +GF  SFWG   ++ +K SWR+ 
Sbjct  1009  KKLCIDGKPAQEPIVKLLEDEKL---LFAREFYISMAIGFVTSFWGVFGSILIKRSWRHV  1065

Query  413   YYRFLSDSKDWVYVTMKV  360
             Y++FL++  D +YV + V
Sbjct  1066  YFKFLNNLSDNIYVKVAV  1083



>ref|XP_003599887.1| Receptor-like kinase [Medicago truncatula]
 gb|AES70138.1| LRR receptor-like kinase [Medicago truncatula]
Length=557

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 61/104 (59%), Gaps = 6/104 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP GTQLQS NA+SY GN  LCG PL  C  +    K   ++ +E       L    Y+
Sbjct  445  KIPVGTQLQSFNASSYIGNLKLCGSPLNNCSTEEENPKNAENEDDES------LKESLYL  498

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             M +GF+V FWG   +LFL   WR+AY+RF+    + +YVT+KV
Sbjct  499  GMGVGFAVGFWGICGSLFLIRKWRHAYFRFIYGVGNRLYVTLKV  542



>ref|XP_003629983.1| Receptor-like kinase [Medicago truncatula]
 gb|AET04459.1| receptor-like protein, putative [Medicago truncatula]
Length=938

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 13/125 (10%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPK-CHED---------VPAIKekgddyeeeeddD  519
            IP G Q+++ + +S+ GN  LCG PL K C ED            I+   +   ++  +D
Sbjct  807  IPIGIQMETFDESSFQGNPHLCGSPLTKACLEDGNSWFKDKHCSDIEGSIEHESDDNHED  866

Query  518  RLLTLE---FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVR  348
            ++L +E    YISM +GFS  FW F  +L L  SWR+AY+RFLS+  D +YVT+ V+  +
Sbjct  867  KVLGMEINPLYISMAMGFSTGFWVFWGSLILIASWRHAYFRFLSNLNDKIYVTVVVTLNK  926

Query  347  LQRKF  333
            LQRK 
Sbjct  927  LQRKL  931



>ref|XP_007021415.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12940.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=882

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 81/150 (54%), Gaps = 10/150 (7%)
 Frame = -3

Query  761  QNEELIRKPSTAPLPSA-----FTNTLHFFF-ILH*KIPSGTQLQSINATSYAGNSGLCG  600
            Q+ +L R   +  +PS+     F +TL   +  L  KIP+GTQ+Q  + ++++ N  LCG
Sbjct  734  QSLDLSRNNFSGSIPSSLSEITFLSTLDLSYNYLSGKIPTGTQIQLFDPSTFSHNHALCG  793

Query  599  DPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
             P+ P C       + +    +++ D+ R     FY  M LGF V FWG    L  K SW
Sbjct  794  PPVTPNCSGSAETPQGQPRRGQDDFDEFRKW---FYAGMGLGFIVGFWGICGALLFKRSW  850

Query  422  RYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            R+AY+RFL D KDW+YV   +   RL+R+ 
Sbjct  851  RHAYFRFLDDMKDWLYVRFVLQKARLERRI  880



>ref|XP_008226571.1| PREDICTED: receptor-like protein 2 [Prunus mume]
Length=746

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLP-KC--HEDVPAIKekgddyeeeeddDRLLTLEF  498
            IP+GTQLQS N +++ GN  LCG PLP KC  ++D+ A  +   D              F
Sbjct  634  IPTGTQLQSFNTSTFEGNPKLCGAPLPNKCRPNKDMNAYNKNNKDEGNGHHQLPW----F  689

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            YI + LGF + FWG   +L +K +WRYAY++F+ + +D +YV + V   R++RK 
Sbjct  690  YIFVALGFIIGFWGVCGSLVIKKTWRYAYFQFIDNLQDRLYVMITVPLSRMKRKL  744



>ref|XP_009340406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
 ref|XP_009340409.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=839

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + ++YAGN  LCG PL    +D    +++      EE+ D L+T  FY+
Sbjct  734  KIPTGTQLQSFDPSNYAGNPQLCGPPLQNMCDD----QQETVISSNEEEKDELITWGFYV  789

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            S+VLGF V FWG   +L     WRY+Y RFL+   DW+YV +    + ++R F
Sbjct  790  SIVLGFIVGFWGVCGSLIFIRQWRYSYIRFLNVLNDWLYVRV----ILIKRHF  838



>gb|KHN34667.1| Serine/threonine-protein kinase BRI1-like 2 [Glycine soja]
Length=618

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP GTQLQS +A+SY GN  LCG PLPKC+ +        ++ + + + + L     Y+
Sbjct  507  QIPVGTQLQSFDASSYIGNPELCGAPLPKCNTEDNNHGNATENTDGDSEKESL-----YL  561

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSF  354
             M +GF+V FWGF  +L L   WR+ YYRF     D +YVT  V F
Sbjct  562  GMGVGFAVGFWGFCGSLLLLRKWRHKYYRFFDRLADQLYVTYMVKF  607



>ref|XP_008232801.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Prunus mume]
Length=984

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ  + + +AGN  LCG PL K C ++V     +  D+  +ED D  +TL FY
Sbjct  872  KIPVGTQLQGFDPSFFAGNLQLCGPPLKKMCADEVGKGPSEQTDFINQEDKDEPITLGFY  931

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF   FWG   TL    SWRYAY++FL+   DW +V  +++ ++ Q K
Sbjct  932  ISMGLGFVAGFWGVCGTLIFSRSWRYAYWKFLNGLNDWFFV--RIALLKQQLK  982



>emb|CBI22713.3| unnamed protein product [Vitis vinifera]
Length=577

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  +E  + R     FY
Sbjct  427  RIPLSTQLQSFDAFSYIGNAQLCGAPLTKNCTEDEESQGMDTIDENDEGSEMRW----FY  482

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            ISM LGF V   G    L  K +WRYAY++FL D +DWVYV   +   RL    
Sbjct  483  ISMGLGFIVGCGGVCGALLFKKNWRYAYFQFLYDIRDWVYVAAAIRLNRLHDNL  536



>ref|XP_006600027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g20940-like [Glycine max]
Length=633

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP+ TQLQS NA+SY  N  LCG PL K C ++ P  K   +  E+E     LL+ EFY
Sbjct  522  KIPTSTQLQSFNASSYEDNLDLCGPPLEKFCIDERPTQKPNVEVQEDEY---SLLSREFY  578

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            +SM  GF +SFW    ++  K SWR+AY++FL++  + +YV + V
Sbjct  579  MSMTFGFVISFWVVFGSILFKRSWRHAYFKFLNNLSNNIYVKVAV  623



>emb|CAN65307.1| hypothetical protein VITISV_031879 [Vitis vinifera]
Length=780

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 62/105 (59%), Gaps = 5/105 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  EE  + R L    Y
Sbjct  649  RIPLSTQLQSFDAFSYIGNAQLCGVPLTKNCTEDDESQGMDTIDENEEGSEMRWL----Y  704

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
            ISM LGF   FWG    L  K SWR+AY++FL D +DWVYV + +
Sbjct  705  ISMGLGFIXGFWGVCGALLXKKSWRHAYFQFLYDIRDWVYVAVAI  749



>ref|XP_008226590.1| PREDICTED: receptor-like protein 2 [Prunus mume]
Length=646

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP+GTQLQS NA+++ GN  LCG PL  KC      I E      ++ D+ R     FYI
Sbjct  533  IPTGTQLQSFNASAFEGNPKLCGAPLANKCSRPNKGIDEDNKKNNKDMDNGRHQIPWFYI  592

Query  491  S-MVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            S +VLGF V FWG   +L +  +WRYAY+RF+ + +D +YV + V    ++R+
Sbjct  593  SSIVLGFIVGFWGVCGSLIINKTWRYAYFRFIYNIQDRLYVMITVRINMIKRR  645



>ref|XP_007219364.1| hypothetical protein PRUPE_ppa019703mg [Prunus persica]
 gb|EMJ20563.1| hypothetical protein PRUPE_ppa019703mg [Prunus persica]
Length=757

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP  TQLQ  + + YAGN  LCG PL K C ++V     +  D+  +ED D L+TL FY
Sbjct  611  KIPVRTQLQGFDPSFYAGNLQLCGPPLKKMCADEVEKGPSEQTDFINQEDKDELITLGFY  670

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKFWP  327
            ISM LGF+  FWG   TL    SW YAY +FL+   DW++V      +   +KF P
Sbjct  671  ISMGLGFAAGFWGVCGTLIFSRSWSYAYLKFLNGLNDWLFVK-SSKLLSKNKKFMP  725



>ref|XP_008393125.1| PREDICTED: receptor-like protein kinase 2 [Malus domestica]
Length=547

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + + Y GN  LCG PLPK   D    + +      EE+ D  +T  FY+
Sbjct  442  KIPTGTQLQSFDPSDYXGNPQLCGPPLPKMCGD----QXETPIXSNEEEKDEPITWGFYV  497

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            SM LGF V FWG   +L     WRY+Y+RFL+   DW YV
Sbjct  498  SMALGFIVGFWGVCGSLIFMRPWRYSYFRFLNVLNDWFYV  537



>ref|XP_010662800.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Vitis vinifera]
Length=863

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A SY GN+ LCG PL K C ED  +      D  +E  + R     FY
Sbjct  745  RIPLSTQLQSFDAFSYIGNAQLCGAPLTKNCTEDEESQGMDTIDENDEGSEMRW----FY  800

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            ISM LGF V   G    L  K +WRYAY++FL D +DWVYV   +   RL    
Sbjct  801  ISMGLGFIVGCGGVCGALLFKKNWRYAYFQFLYDIRDWVYVAAAIRLNRLHDNL  854



>ref|XP_009394655.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Musa acuminata subsp. malaccensis]
Length=1219

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 49/142 (35%), Positives = 80/142 (56%), Gaps = 18/142 (13%)
 Frame = -3

Query  731   TAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLPKC--H  579
             T  +PS+F+  +HF       +  L  KIP+  QL + ++ +Y GN  LCG PLP C  +
Sbjct  1083  TGEIPSSFS-AMHFLERLNLSYNNLSGKIPTSGQLSTFDSWTYVGNKDLCGTPLPACPVY  1141

Query  578   EDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFL  399
             +  P  + K D+        +L  L  Y S+V+GF V FW F+ TL +K + R+A++R++
Sbjct  1142  QTPPDARVKDDE--------KLDKLLEYTSIVVGFVVGFWLFIGTLIMKQAIRFAFFRWI  1193

Query  398   SDSKDWVYVTMKVSFVRLQRKF  333
               + DW+YV   V+  +L+ K+
Sbjct  1194  DKANDWIYVQFAVNLAKLKSKW  1215



>ref|XP_002276171.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1021

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             +IPSGTQLQ   A+SY GN  LCG PL  KC ED  A      D  E++  D      FY
Sbjct  922   QIPSGTQLQGFEASSYMGNPELCGSPLKTKCQEDETAQTSPTSDGNEDDLQDDEFDPWFY  981

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVY  375
             +S+ LGF V FWG   TL LK SW  AY+RFL+  KDW +
Sbjct  982   VSIALGFLVGFWGVWGTLVLKSSWSEAYFRFLNKIKDWFF  1021



>gb|KEH33780.1| receptor-like protein [Medicago truncatula]
Length=780

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 64/114 (56%), Gaps = 6/114 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC--HEDVPAIKekgddyeeeeddDRLLTLEF  498
            KIP+GTQLQS NA+SY GN  LCG PL  C   E+ P       D E+++     L    
Sbjct  671  KIPTGTQLQSFNASSYIGNPKLCGAPLNNCTMKEENPKTAMPSTDNEDDDS----LRESL  726

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y+ M +GF+  FWG   +LFL   WR+AY+RF+    D +YVT+ V     +R 
Sbjct  727  YLGMRVGFAAGFWGICGSLFLIRKWRHAYFRFVYRVGDKIYVTLIVKLNMFKRN  780



>ref|XP_009367839.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1084

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP GTQLQ+ +++ +AGN  LCG PL + C  +  + +E+    ++ +++D L+T  FY
Sbjct  964   KIPMGTQLQTYDSSDFAGNPLLCGIPLQQLCSPEETSPEEQPMFGDQVKENDGLITTGFY  1023

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
             +S+ LGF V FWG   +L    SWRY YYRFL+   DW+YV  +V+ ++ +R
Sbjct  1024  LSLALGFVVGFWGVCGSLIFIKSWRYTYYRFLNCVYDWLYV--RVALIKRRR  1073



>ref|XP_008383310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=1048

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 64/115 (56%), Gaps = 6/115 (5%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
             KIPSG QLQ++   S Y GN  LCG PL  KC    P          ++ ++D    L F
Sbjct  938   KIPSGNQLQTLEDPSIYKGNLLLCGVPLSTKC----PGDXTFTATDXKDSNEDGNXKLWF  993

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             Y+SMVLGF+V FWG   TL +K SWRYAY+R   D KD V + + V     QRK 
Sbjct  994   YVSMVLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQRKL  1048



>gb|KEH25984.1| LRR receptor-like kinase [Medicago truncatula]
Length=410

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 4/104 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+ TQLQS NATSY  N  LCG PL K C ++ P  K K +  ++E+    LL   FY
Sbjct  305  EIPTSTQLQSFNATSYEDNLDLCGPPLVKLCAQEEPQHKLKVEIQDDEDL---LLNRGFY  361

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMK  363
            IS+  GF + FWG   ++ +K SWR+AY+RF+++  D +Y+  +
Sbjct  362  ISLTFGFIIGFWGVFGSILIKRSWRHAYFRFMNNLGDSIYMKCR  405



>ref|XP_009340411.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Pyrus x bretschneideri]
Length=842

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 8/113 (7%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + ++YAGN  LCG PL    +D    +++      EE+ D L+T  FY+
Sbjct  737  KIPTGTQLQSFDPSNYAGNPQLCGPPLQNMCDD----QQETVISSNEEEKDELITWGFYV  792

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            SM LGF V FWG   +L     WRY+Y RFL+   DW+Y+ +    + ++R F
Sbjct  793  SMALGFIVGFWGVCGSLIFIRQWRYSYIRFLNVLNDWLYLRV----ILIKRHF  841



>ref|XP_009385818.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=917

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IP+G QLQ++N  S Y GN+ LCG P  K CH +  A     +  +E  +      L F
Sbjct  809  RIPTGHQLQTLNDPSIYMGNANLCGPPTSKSCHNNKTAQNNIQEYEKEISEW-----LWF  863

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRL  345
            YISMVLGF + FW F   LFLKD+WRYAY+R + D  D ++V  ++   RL
Sbjct  864  YISMVLGFVMGFWTFCGILFLKDAWRYAYFRMIDDMYDRIWVQWQLILRRL  914



>gb|KEH33782.1| receptor-like protein [Medicago truncatula]
Length=817

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 47/112 (42%), Positives = 64/112 (57%), Gaps = 6/112 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP GTQLQS NA+SY GN  LCG PL  C  +  +         E+ +  R      Y+
Sbjct  666  KIPIGTQLQSFNASSYIGNPKLCGAPLNNCTAEEESKNATQSTRNEDSESIRE---SLYL  722

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             M +GF+V FWG   +LFL   WR+AY++F++   D +YVT+    V+L RK
Sbjct  723  GMGVGFAVGFWGICGSLFLIRKWRHAYFQFINRVGDKLYVTL---IVKLNRK  771



>ref|XP_008352735.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Malus 
domestica]
Length=731

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 16/133 (12%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P++ + +LHF       +  L  ++P GTQ+Q  NAT++ GN GLCG P
Sbjct  601  DLSRNHLSGGIPASLS-SLHFLGSLSVAYNNLQGQVPLGTQIQGFNATAFEGNPGLCGFP  659

Query  593  LP-KCHEDVP--AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
            LP KC ++    A K   D +    D        FYIS+ LGF V FWG   +L L  SW
Sbjct  660  LPNKCQQNTSDNATKNMEDVHGNGNDIPW-----FYISVALGFIVGFWGVCGSLALITSW  714

Query  422  RYAYYRFLSDSKD  384
            RYAY++FLSD KD
Sbjct  715  RYAYFQFLSDVKD  727



>ref|XP_009352118.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=946

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 13/134 (10%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*-------KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L +   +  +P +F+ +LHF  +L         +IP  TQLQS +A+ + GN GLCG P
Sbjct  810  DLSQNQISGSIPPSFS-SLHFLGVLDLSYNNLSGRIPLSTQLQSFDASQFTGNLGLCGQP  868

Query  593  L-PKCHEDV----PAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKD  429
            L P+C  DV    PA+       + ++DDD L++L FY+ + LGF + FW    TL LK 
Sbjct  869  LTPECPGDVTSEDPAVPNGSGSDKTKQDDDGLISLGFYVGLALGFIIGFWSVCGTLCLKT  928

Query  428  SWRYAYYRFLSDSK  387
            SWRYA  RF  D K
Sbjct  929  SWRYACCRFFDDIK  942



>ref|XP_009341489.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=728

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYIS  489
            IP+GT LQS +A+++ GN  LCG PLP    ++ A  +   D + +   D L    FYI 
Sbjct  617  IPTGTHLQSFDASTFVGNPKLCGAPLPNECREIDADNKNNVDQDVDNKGDELPW--FYIF  674

Query  488  MVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
              LGF V FWG   +L LK +WRY Y++FL + +D +YV M +   +++R+
Sbjct  675  ATLGFIVGFWGVCGSLLLKKTWRYKYFQFLDNVQDLLYVKMAICMRKMKRR  725



>ref|XP_008355014.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=731

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 16/133 (12%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P++ + +LHF       +  L  ++P GTQ+Q  NAT++ GN GLCG P
Sbjct  601  DLSRNHLSGGIPASLS-SLHFLGSLSVAYNNLQGQVPLGTQIQGFNATAFEGNPGLCGFP  659

Query  593  LP-KCHEDVP--AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
            LP KC ++    A K   D +    D        FYIS+ LGF V FWG   +L L  SW
Sbjct  660  LPNKCQQNTSDNATKNMEDVHGNGNDIPW-----FYISVALGFIVGFWGVCGSLALITSW  714

Query  422  RYAYYRFLSDSKD  384
            RYAY++FLSD KD
Sbjct  715  RYAYFQFLSDVKD  727



>ref|XP_006599542.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X2 [Glycine max]
Length=1116

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +   +E     L   EFY
Sbjct  1005  KIPASTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQHDEFS---LFNREFY  1061

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + V
Sbjct  1062  MSMTFGFVISFWMVFGSILFKRSWRHAYFKFLNNLSDNIYVKVAV  1106



>ref|XP_004295535.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Fragaria 
vesca subsp. vesca]
Length=236

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCG-DPLPKCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IPS TQL ++N +S Y GNS LCG  P  KC  D+      G   ++E+ + +L    F
Sbjct  124  RIPSSTQLTTLNDSSIYEGNSLLCGVPPATKCWGDITTAGRNGKGDKDEDYNGKL---GF  180

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y+S VLGF + FWG   TL +K+SWRYAY++F    KD V + + V+  R  R+
Sbjct  181  YVSSVLGFIIGFWGVCGTLLVKNSWRYAYFQFFDKIKDNVALAIAVTMARWHRR  234



>ref|XP_006599541.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X1 [Glycine max]
Length=1140

 Score = 84.3 bits (207),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +   +E     L   EFY
Sbjct  1029  KIPASTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQHDEFS---LFNREFY  1085

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + V
Sbjct  1086  MSMTFGFVISFWMVFGSILFKRSWRHAYFKFLNNLSDNIYVKVAV  1130



>ref|XP_006599543.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X3 [Glycine max]
Length=1116

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +   +E     L   EFY
Sbjct  1005  KIPASTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQHDEFS---LFNREFY  1061

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + V
Sbjct  1062  MSMTFGFVISFWMVFGSILFKRSWRHAYFKFLNNLSDNIYVKVAV  1106



>ref|XP_006599538.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X1 [Glycine max]
Length=1113

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +  E+E     L + EFY
Sbjct  1002  KIPTSTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQEDEFS---LFSREFY  1058

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + +
Sbjct  1059  MSMAFGFVISFWVVFGSILFKLSWRHAYFKFLNNLSDNIYVKVAI  1103



>ref|XP_006599539.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X2 [Glycine max]
Length=1097

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +  E+E     L + EFY
Sbjct  986   KIPTSTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQEDEFS---LFSREFY  1042

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + +
Sbjct  1043  MSMAFGFVISFWVVFGSILFKLSWRHAYFKFLNNLSDNIYVKVAI  1087



>ref|XP_006599540.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X3 [Glycine max]
Length=1089

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
             KIP+ TQLQS NA+SY  N  LCG PL K C +  P  K   +  E+E     L + EFY
Sbjct  978   KIPTSTQLQSFNASSYEDNLDLCGQPLEKFCIDGRPTQKPNVEVQEDEFS---LFSREFY  1034

Query  494   ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKV  360
             +SM  GF +SFW    ++  K SWR+AY++FL++  D +YV + +
Sbjct  1035  MSMAFGFVISFWVVFGSILFKLSWRHAYFKFLNNLSDNIYVKVAI  1079



>ref|XP_010087568.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
 gb|EXB29383.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
Length=810

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP+  QLQ++N  S Y  N  LCG PLPKCH D           +E+ +DD+   + FY
Sbjct  690  KIPTSNQLQTLNDPSIYVANLQLCGYPLPKCHHDSVQPPTSTVHKDEDHEDDKKEKILFY  749

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
              + +G++   WG + TL LK +WR AY+RF+  +KD + V + V   RL+++
Sbjct  750  FVVFVGYATGLWGVIGTLVLKRNWRLAYFRFVDSTKDRIIVAVAVEVARLKQR  802



>ref|XP_009368629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=893

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/114 (46%), Positives = 66/114 (58%), Gaps = 4/114 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHED-VPAIKekgddyeeeeddDRLLTLEF  498
            +IPSG QLQ++   S Y GN  LCG PL KC  D  P          ++EDD+  L L  
Sbjct  781  RIPSGNQLQTLEDPSIYEGNPLLCGVPLTKCPGDKTPPFPSSDAGDNKDEDDNGKLWL--  838

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y+S+ LGF   FWG   TL +K SWRYAY+RF  D KD V + + +   +LQRK
Sbjct  839  YVSITLGFITGFWGVCGTLIIKKSWRYAYFRFFDDMKDKVALAIALKVAQLQRK  892



>ref|XP_008355404.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=275

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP+ TQLQS  A+++ GN  LCG PLPK C  D        D+ +  +         FYI
Sbjct  168  IPTSTQLQSFEASAFEGNPKLCGAPLPKQCRIDAHNKNNGDDEDDGHQLPW------FYI  221

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +  LGF   FWG   +L +K +WRYAY+RF  + +D +YV + V   R++R
Sbjct  222  AAALGFICGFWGVCGSLIIKKTWRYAYFRFTDNVQDRLYVMLAVRMNRMKR  272



>ref|XP_008244648.1| PREDICTED: systemin receptor SR160-like [Prunus mume]
Length=550

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ+ ++ +Y GN  LCG+PLP+ C E+             E+D D L+T  FY
Sbjct  441  KIPIGTQLQTFDS-AYGGNPLLCGEPLPRTCSEE--GKGPGQSMLVNEDDKDGLITQGFY  497

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF+V FWG   TL L  S RY Y+ FL+   DW+YV +++   R+  K
Sbjct  498  ISMGLGFAVGFWGVCGTLLLNRSCRYMYFNFLTFLNDWLYVKVEIIRQRILNK  550



>ref|XP_010671855.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=1106

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 47/116 (41%), Positives = 74/116 (64%), Gaps = 4/116 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEF  498
             +IP+G QLQ+++  S YAGN  LCGDPLPK C     + K  GD  + + + D+ +  + 
Sbjct  985   QIPTGRQLQTLDDPSKYAGNPYLCGDPLPKKCKNKNDSSKGSGDKNDTQGEGDKDMHEKM  1044

Query  497   YISMVL--GFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
             +  +++  GF+  FWG V TL LK SWR+A +R + D++DW+YV + V   +L++K
Sbjct  1045  WFCLIVMSGFATGFWGVVGTLVLKKSWRHALFRRVEDAQDWLYVAIVVRMAKLKKK  1100



>ref|XP_004295756.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Fragaria 
vesca subsp. vesca]
Length=495

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 75/145 (52%), Gaps = 20/145 (14%)
 Frame = -3

Query  731  TAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDPLP-KCH-  579
            +  +P++FT +LHF       +  L   IPS TQLQS +A+++ GN  LCGDPLP KC  
Sbjct  356  SGNIPASFT-SLHFLSKFNVSYNNLEGPIPSSTQLQSFDASAFEGNLKLCGDPLPNKCKG  414

Query  578  ---EDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRYAYY  408
                D P +     D E++          FY+S  LGF + FWG    +     WRYAYY
Sbjct  415  TEGTDEPDMNNTDADMEQQFPW-------FYVSAALGFIIGFWGVFGPIVFLQKWRYAYY  467

Query  407  RFLSDSKDWVYVTMKVSFVRLQRKF  333
             FL +  D   V +  S  R++R+F
Sbjct  468  HFLDNVHDRFMVMIAKSMARVKRRF  492



>ref|XP_008345134.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=582

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP+GTQLQS  A+++ GN  LCG PLP KC  D    + + D  +            FYI
Sbjct  475  IPTGTQLQSFEASAFEGNPKLCGAPLPNKCRIDEHDKRNRDDMDDGHRHPW------FYI  528

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            S  LGF   FWG   +L +K +WRYAY+RF  +  D +YV + V   R++R
Sbjct  529  STALGFIFGFWGVCGSLIVKKTWRYAYFRFTDNVHDRLYVMLAVRMNRMKR  579



>gb|KHN09228.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=606

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 4/109 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP+GTQLQS NA+ Y  N  LCG PL K C +  PA +      E+E       T EFY
Sbjct  496  EIPTGTQLQSFNASCYEDNLDLCGPPLEKLCIDGKPAQEPIVKLPEDENL---FFTCEFY  552

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVR  348
            +SM +GF +SF G   ++ +K SWR+AY++F+S+  D +YV   V   +
Sbjct  553  MSMAIGFVISFCGVFGSILIKRSWRHAYFKFISNLSDAIYVMAAVKVFK  601



>emb|CAN71149.1| hypothetical protein VITISV_040339 [Vitis vinifera]
Length=925

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 44/113 (39%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP+G Q Q+ +++ Y GN  LCG PL  +CH++   I     + +++E+ D      F+
Sbjct  812  KIPTGNQFQTFDSSIYQGNLALCGFPLTTECHDNNGTIPTGKGEDKDDEEGDDSELPWFF  871

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            +SM LGF + FWG   TL +K+SWRYAY+RF+   KD + + + ++  R  RK
Sbjct  872  VSMGLGFIIGFWGVCGTLIIKNSWRYAYFRFVEKMKDRLLLAVALNVARRTRK  924



>ref|XP_009376584.1| PREDICTED: receptor-like protein 2 [Pyrus x bretschneideri]
Length=731

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 74/133 (56%), Gaps = 16/133 (12%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P + + +LHF       +  L  ++P GTQ+Q  +AT++ GN GLCG P
Sbjct  601  DLSRNHLSGGIPDSLS-SLHFLASLSVAYNNLQGQVPLGTQIQGFDATAFEGNPGLCGSP  659

Query  593  LP-KCHEDVP--AIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
            LP KC ++    A K   D +    +        FYIS+ LGF V FWG   +L L  SW
Sbjct  660  LPNKCQQNTSDNATKNMEDVHGNGNEIPW-----FYISVALGFIVGFWGVCGSLALITSW  714

Query  422  RYAYYRFLSDSKD  384
            RYAY++FLSD KD
Sbjct  715  RYAYFQFLSDVKD  727



>ref|XP_009766484.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana sylvestris]
Length=1023

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  671   KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAI----KekgddyeeeeddDRLLTL  504
             +IPS TQLQ+   +SY+ N+ LCG PL +C    P           + +E  +D    + 
Sbjct  905   RIPSSTQLQTFERSSYSSNAQLCGPPLQECPGYAPPSPHIDHSSNMNPQEHGEDVEFPSR  964

Query  503   EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             EFYISMV GF ++FWG +  L +  SWR AY+ FL+D   W+ +  +V   RL+RK 
Sbjct  965   EFYISMVFGFFLAFWGILGCLIVNPSWRNAYFTFLADMMSWLDMISRVCCSRLKRKL  1021



>ref|XP_008384515.1| PREDICTED: receptor-like protein 2, partial [Malus domestica]
Length=522

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 11/131 (8%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHF-------FFILH*KIPSGTQLQSINATSYAGNSGLCGDP  594
            +L R   +  +P++ + +LHF       +  L  ++PSGTQLQ  +AT+Y GN GLCG P
Sbjct  391  DLSRNHLSGGIPASLS-SLHFLASLSVAYNNLQGRVPSGTQLQGFDATAYEGNXGLCGSP  449

Query  593  LP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWRY  417
            LP KC +   +     +  ++ ++   +  L  +IS+ LGF V FWG    L    SWRY
Sbjct  450  LPNKCQQMNTSDNATKNMEDKHDNGXEIPWL--HISVALGFIVGFWGVCGPLVFSTSWRY  507

Query  416  AYYRFLSDSKD  384
            AY++FLS+ KD
Sbjct  508  AYFQFLSNVKD  518



>ref|XP_009367863.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=936

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 3/112 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ+ ++ ++ GN  LCG PL + C  +  + +E+    ++ E++D L+T  FY
Sbjct  823  KIPIGTQLQTYDSYAFVGNPLLCGIPLQQLCSPEETSPEEQPMFGDQVEENDGLITTGFY  882

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            +S+ LGF V FWG   +L    SWRY YY+FL+   DW+YV  +V+ +R QR
Sbjct  883  LSLALGFVVGFWGVCGSLIFIRSWRYTYYKFLNYVYDWLYV--RVTLIRQQR  932



>ref|XP_010111049.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
 gb|EXC29911.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
Length=952

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 4/111 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            +IP GTQL  ++A  YAGN GLCG PL +C    P         E+ +++D  +T  FY 
Sbjct  842  RIPKGTQL-GLDAAFYAGNPGLCGFPLEECEAPEPE---GSTRNEQGDEEDSFITQGFYF  897

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            S  LG++V  W  + TL   DSWR+ Y +FLSD  DW+YV + ++  +L+R
Sbjct  898  STGLGYAVGIWVVIGTLIFSDSWRFKYLKFLSDIYDWLYVMILLNKAKLER  948



>ref|XP_009342503.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X2 [Pyrus x bretschneideri]
Length=970

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + ++YAGN  LCG PL    +D    +++      EE++D L+T  FY+
Sbjct  865  KIPTGTQLQSFDPSNYAGNPQLCGPPLQNMCDD----QQETVISSNEEENDELITWGFYV  920

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            SM +GF V FWG   +L     WRY+Y RFL+   DW+Y+
Sbjct  921  SMAIGFIVGFWGVCGSLIFIRQWRYSYIRFLNVLNDWLYL  960



>ref|XP_010646953.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=667

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (60%), Gaps = 4/117 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPL-PKCHED--VPAIKekgddyeeeeddDRLLTL  504
            +IP+G QLQ+++  S Y  N  LCG P   KC  D   P  +   +  +E E+ D     
Sbjct  546  RIPTGNQLQTLDDPSIYENNPALCGPPTTAKCPGDDQRPKTRSGDNVEDENENGDGFEMK  605

Query  503  EFYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
             FY+SM  GF+V FWG  VTL +K+SWR+AY+R + D K+W+ + + ++  RL+RK 
Sbjct  606  WFYVSMGPGFAVGFWGVCVTLIVKNSWRHAYFRLVYDVKEWLLMVISLNVARLRRKL  662



>ref|XP_008233039.1| PREDICTED: systemin receptor SR160-like [Prunus mume]
Length=828

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 67/113 (59%), Gaps = 4/113 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            KIP GTQLQ+ ++ +Y GN  LCG PLP+ C E+             E+D D L+T  FY
Sbjct  719  KIPIGTQLQTFDS-AYGGNPLLCGKPLPRTCPEEEKG--SGQSVLVNEDDKDGLITQGFY  775

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            ISM LGF+V FWG   TL L  S RY Y+ FL+   DW+YV +++   R+  K
Sbjct  776  ISMGLGFAVGFWGVCGTLLLNRSCRYTYFNFLTFLNDWLYVNVEIIKQRILNK  828



>ref|XP_009342502.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X1 [Pyrus x bretschneideri]
Length=994

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 4/100 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            KIP+GTQLQS + ++YAGN  LCG PL    +D    +++      EE++D L+T  FY+
Sbjct  889  KIPTGTQLQSFDPSNYAGNPQLCGPPLQNMCDD----QQETVISSNEEENDELITWGFYV  944

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYV  372
            SM +GF V FWG   +L     WRY+Y RFL+   DW+Y+
Sbjct  945  SMAIGFIVGFWGVCGSLIFIRQWRYSYIRFLNVLNDWLYL  984



>ref|XP_008365880.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=740

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = -3

Query  668  IPSGTQLQSINATSYAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEFYI  492
            IP+GTQLQS  A+++ GN  LCG PLP KC  D    + + D  +            FYI
Sbjct  633  IPTGTQLQSFEASAFEGNPKLCGAPLPNKCRIDEHDKRNRDDMDDGHRHPW------FYI  686

Query  491  SMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQR  339
            S  LGF   FWG   +L +K +WRYAY+RF  +  D +YV + V   R++R
Sbjct  687  STALGFIFGFWGVCGSLIVKKTWRYAYFRFTDNVHDRLYVMLAVRMNRMKR  737



>emb|CAN67736.1| hypothetical protein VITISV_022720 [Vitis vinifera]
Length=1680

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPL-PKCHEDVPAIKekgddyeeeeddDR--LLTLE  501
            KIP GTQLQS +A++Y GN GLCG PL  +C ED             +++D +     + 
Sbjct  567  KIPLGTQLQSFDASTYEGNPGLCGPPLLIRCPEDELGGVSFTSGLSSKKEDIQDDANNIW  626

Query  500  FYISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVT  369
            FY ++VLGF + FWG   TL    SWRYAY++ LS  KDW+Y+T
Sbjct  627  FYGNIVLGFIIGFWGVCGTLLFNSSWRYAYFQLLSKIKDWLYMT  670



>ref|XP_010105709.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
 gb|EXC05929.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Morus 
notabilis]
Length=846

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 68/121 (56%), Gaps = 5/121 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IP  TQLQS +A++Y GN  LCG P+ K C  D        ++  E ++D   +T  FY
Sbjct  725  RIPLSTQLQSFDASAYEGNHQLCGPPVTKYCPGDPGVTDGHENENMEGDEDVGYVTFGFY  784

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSD----SKDWVYVTMKVSFVRLQRKFWP  327
            +S  +GF V FWG   TL LK SWR AY++F S     +KD+ YVT KV   RL R    
Sbjct  785  VSTAIGFIVGFWGVCGTLVLKSSWRRAYFQFWSHNSQMTKDYFYVTTKVFKARLLRILTS  844

Query  326  H  324
            H
Sbjct  845  H  845



>ref|XP_009365374.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Pyrus x bretschneideri]
Length=1081

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -3

Query  671   KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
             +IP+G QLQ++N +S Y GN  LCG PL  KC ED P I +   +  E+  D     L  
Sbjct  970   RIPTGNQLQTLNFSSIYVGNQWLCGVPLSTKCPEDDPFIAKDAKEENEDGKD----KLWL  1025

Query  497   YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQ  342
             Y+S+VLGF V FWG   TL LK SWRYAY++F  D K+ V + + +  VR +
Sbjct  1026  YVSVVLGFIVGFWGVCGTLTLKTSWRYAYFQFFEDIKNKVALAIALKVVRFK  1077



>ref|XP_007021418.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12943.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=960

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 81/150 (54%), Gaps = 10/150 (7%)
 Frame = -3

Query  761  QNEELIRKPSTAPLPSA-----FTNTLHFFF-ILH*KIPSGTQLQSINATSYAGNSGLCG  600
            Q  +L R   +  +PS+     F +TL   +  L  KIP+GTQ+Q  + ++++ N GLCG
Sbjct  812  QALDLSRNNFSGGIPSSLSELTFLSTLDLSYNYLSGKIPTGTQIQLFDPSTFSHNHGLCG  871

Query  599  DPL-PKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSW  423
             P+ P C       + +    +++ D+ R     FY  M +GF V FWG    L  K SW
Sbjct  872  PPVTPNCSGSAETPQGQPRRGQDDFDEFRKW---FYAGMGIGFIVGFWGICGALLFKRSW  928

Query  422  RYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            R++Y+RFL + KDW+YV   +   RL+R+ 
Sbjct  929  RHSYFRFLDNMKDWLYVRFVLQKARLERRI  958



>ref|XP_009389817.1| PREDICTED: receptor-like protein 12 [Musa acuminata subsp. malaccensis]
Length=1098

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 15/160 (9%)
 Frame = -3

Query  782   TGVECVRQNE--ELIRKPSTAPLPSA-----FTNTLHFFFI-LH*KIPSGTQLQSINATS  627
             + ++ ++Q E  +L R   +  +PS      F N L+  +  L  KIP+G+QLQ++N  S
Sbjct  944   SNIDGMQQLEILDLSRNNLSGTIPSTLAALNFLNDLNLSYNNLSGKIPTGSQLQTLNDPS  1003

Query  626   -YAGNSGLCGDPLPK-CHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGF  453
              Y GN  LCG PLPK C       K   ++  E+  + R+ TL  Y S+ LGF + FW  
Sbjct  1004  VYNGNPNLCGPPLPKNC-----TAKANEEEQNEDSSNSRMETLWLYTSITLGFIIGFWAI  1058

Query  452   VVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
               +L L+ +WR AY+R + +  D +YV M V+  + +RK 
Sbjct  1059  YGSLLLRRTWRIAYFRAIDNMFDKLYVMMVVTVAKYKRKL  1098



>ref|XP_008349105.1| PREDICTED: receptor-like protein 2 [Malus domestica]
Length=225

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 61/115 (53%), Gaps = 6/115 (5%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLP-KCHEDVPAIKekgddyeeeeddDRLLTLEF  498
            +IPSG QLQ +   S Y GN  LCG P   KC  D            ++ ++D    L F
Sbjct  115  RIPSGNQLQXLEDPSIYEGNLLLCGVPXSTKCXGD----DTFTATDAKDSNEDGNXKLWF  170

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            Y+SM LGF+V FWG   TL +K SWRYAY+R   D KD V + + V     QRK 
Sbjct  171  YVSMXLGFTVGFWGVCGTLLVKKSWRYAYFRLFDDIKDKVMLAIAVKVAHFQRKL  225



>ref|XP_004295501.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Fragaria vesca subsp. vesca]
Length=789

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 44/114 (39%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = -3

Query  671  KIPSGTQLQSINATS-YAGNSGLCGDPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFY  495
            +IPSG QLQ+++  S Y GN  LCG PL KC E+      + D+ +  +  +RL     Y
Sbjct  679  RIPSGNQLQALDDPSIYKGNPSLCGFPLSKCSEERDDRPHEEDNKDHVDVGERL---GLY  735

Query  494  ISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +S+V+GF + FWG   TL +  SWRYAY++F  + K+ V + + +   R+QR++
Sbjct  736  VSVVIGFVIGFWGVCGTLIMNKSWRYAYFQFFDNVKEKVVLAIALKVARVQRRW  789



>ref|XP_009388360.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=704

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 81/149 (54%), Gaps = 16/149 (11%)
 Frame = -3

Query  752  ELIRKPSTAPLPSAFTNTLHFFFILH*---------KIPSGTQLQSINATSYAGNSGLCG  600
            +L     T  +PS+F+     +F+ H          KIP+  QL + ++++Y GN  LCG
Sbjct  559  DLSENSLTGEIPSSFS---AMYFLAHLNLSYNNLSGKIPTSGQLSTFDSSTYVGNKDLCG  615

Query  599  DPLPKCHEDVPAIKekgddyeeeeddDRLLTLEFYISMVLGFSVSFWGFVVTLFLKDSWR  420
             PL  C    P  +   D   + EDD++L  L  Y S+V+GF V FW F+ TL +K + R
Sbjct  616  TPLADC----PVYQTPPDARVKHEDDEKLDKLLEYTSIVIGFVVGFWLFIGTLVMKQAIR  671

Query  419  YAYYRFLSDSKDWVYVTMKVSFVRLQRKF  333
            +A++R++  + DWVYV   V   +L+ K+
Sbjct  672  FAFFRWIDKASDWVYVQFAVKLAKLKSKW  700



>gb|KEH33796.1| LRR receptor-like kinase [Medicago truncatula]
Length=511

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = -3

Query  671  KIPSGTQLQSINATSYAGNSGLCGDPLPKC--HEDVPAIKekgddyeeeeddDRLLTLEF  498
            KIP  TQLQS NA+SY GN  LCG PL  C   E+ P           E +DD  +    
Sbjct  406  KIPIATQLQSFNASSYIGNPKLCGAPLNNCTTEEENPG--------NTENEDDESIRESL  457

Query  497  YISMVLGFSVSFWGFVVTLFLKDSWRYAYYRFLSDSKDWVYVTMKVSFVRLQRK  336
            Y+ M +GF+V FWG   +LFL   WR+AY+R +    D++YVT+ V     +R 
Sbjct  458  YLGMGVGFAVGFWGICGSLFLIRKWRHAYFRLVDRVGDFLYVTLTVKLNSFRRN  511



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1447202328740