BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20401_g1_i4 len=616 path=[594:0-108 4384:109-145 @740@!:146-523
1118:524-615]

Length=616
                                                                      Score     E

ref|XP_011084065.1|  PREDICTED: calcium uptake protein 1, mitocho...    113   6e-26   
gb|EYU38319.1|  hypothetical protein MIMGU_mgv1a005763mg                106   2e-23   
emb|CBI25571.3|  unnamed protein product                              99.4    3e-21   
ref|XP_002266120.1|  PREDICTED: calcium uptake protein 1, mitocho...  99.4    8e-21   Vitis vinifera
ref|XP_010244879.1|  PREDICTED: calcium uptake protein 1, mitocho...  99.0    1e-20   
ref|XP_010687823.1|  PREDICTED: calcium uptake protein 1 homolog,...  97.1    2e-20   
ref|XP_009415582.1|  PREDICTED: calcium uptake protein 1 homolog,...  97.8    3e-20   
gb|KDO59309.1|  hypothetical protein CISIN_1g042758mg                 94.0    3e-19   
ref|XP_006474603.1|  PREDICTED: calcium uptake protein 1, mitocho...  94.7    4e-19   
emb|CDP10495.1|  unnamed protein product                              92.8    6e-19   
ref|XP_004953089.1|  PREDICTED: calcium uptake protein 1 homolog,...  94.0    6e-19   
ref|XP_009405765.1|  PREDICTED: calcium uptake protein 1, mitocho...  93.6    9e-19   
tpg|DAA49669.1|  TPA: hypothetical protein ZEAMMB73_737328            91.7    1e-18   
ref|XP_006453731.1|  hypothetical protein CICLE_v10010671mg           93.6    1e-18   
ref|XP_009405764.1|  PREDICTED: calcium uptake protein 1, mitocho...  93.2    1e-18   
ref|XP_009626825.1|  PREDICTED: calcium uptake protein 1 homolog,...  92.0    3e-18   
ref|XP_002452439.1|  hypothetical protein SORBIDRAFT_04g025880        91.3    5e-18   Sorghum bicolor [broomcorn]
ref|XP_010907508.1|  PREDICTED: calcium uptake protein 1 homolog,...  90.9    6e-18   
ref|XP_010907507.1|  PREDICTED: calcium uptake protein 1 homolog,...  90.9    8e-18   
ref|NP_001147122.1|  calcium binding atopy-related autoantigen 1      90.9    8e-18   Zea mays [maize]
ref|XP_008645921.1|  PREDICTED: calcium uptake protein 1, mitocho...  90.5    1e-17   
ref|XP_003572710.2|  PREDICTED: calcium uptake protein 1 homolog,...  89.4    3e-17   
ref|XP_008456564.1|  PREDICTED: calcium uptake protein 1, mitocho...  89.7    3e-17   
ref|XP_006365836.1|  PREDICTED: calcium uptake protein 1, mitocho...  88.2    5e-17   
dbj|BAK07466.1|  predicted protein                                    89.0    5e-17   
ref|XP_009766649.1|  PREDICTED: calcium uptake protein 1, mitocho...  88.2    8e-17   
ref|XP_002324884.1|  hypothetical protein POPTR_0018s02130g           87.4    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009782522.1|  PREDICTED: calcium uptake protein 1 homolog,...  87.0    2e-16   
ref|XP_006648832.1|  PREDICTED: calcium uptake protein 1 homolog,...  85.5    2e-16   
ref|XP_004976137.1|  PREDICTED: calcium uptake protein 1 homolog,...  84.7    3e-16   
ref|NP_001053237.1|  Os04g0502900                                     86.3    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653576.1|  PREDICTED: calcium uptake protein 1 homolog,...  85.5    3e-16   
gb|EEC77583.1|  hypothetical protein OsI_16535                        86.3    3e-16   Oryza sativa Indica Group [Indian rice]
emb|CAH67586.1|  OSIGBa0112M24.3                                      86.3    3e-16   Oryza sativa [red rice]
gb|KHG19522.1|  Calcium uptake 1, mitochondrial                       85.9    4e-16   
gb|KEH39843.1|  calcium-binding EF hand protein                       85.9    5e-16   
ref|XP_006367412.1|  PREDICTED: calcium uptake protein 1, mitocho...  85.5    5e-16   
dbj|BAD19699.1|  putative calcium binding atopy-related autoantig...  83.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37068.1|  TPA: hypothetical protein ZEAMMB73_919529            82.8    1e-15   
ref|XP_010250313.1|  PREDICTED: calcium uptake protein 1, mitocho...  84.7    1e-15   
ref|XP_008668321.1|  PREDICTED: hypothetical protein isoform X2       84.0    2e-15   
gb|KCW81354.1|  hypothetical protein EUGRSUZ_C02735                   82.8    2e-15   
ref|XP_011036617.1|  PREDICTED: calcium uptake protein 1 homolog,...  84.0    2e-15   
ref|XP_010051173.1|  PREDICTED: calcium uptake protein 1, mitocho...  84.7    2e-15   
gb|AFW58785.1|  hypothetical protein ZEAMMB73_183509                  79.3    2e-15   
ref|XP_011081511.1|  PREDICTED: calcium uptake protein 1, mitocho...  84.0    2e-15   
ref|XP_004231518.1|  PREDICTED: calcium uptake protein 1, mitocho...  83.6    2e-15   
ref|XP_008775755.1|  PREDICTED: calcium uptake protein 1 homolog,...  82.4    2e-15   
ref|XP_004498756.1|  PREDICTED: calcium uptake protein 1, mitocho...  83.6    2e-15   
ref|XP_008668320.1|  PREDICTED: hypothetical protein isoform X1       83.6    2e-15   
gb|EEE57362.1|  hypothetical protein OsJ_07508                        83.6    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73584.1|  hypothetical protein OsI_08048                        83.6    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004498755.1|  PREDICTED: calcium uptake protein 1, mitocho...  83.6    3e-15   
ref|XP_004240684.1|  PREDICTED: calcium uptake protein 1, mitocho...  83.6    3e-15   
ref|NP_001047417.1|  Os02g0613000                                     83.6    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KDP33558.1|  hypothetical protein JCGZ_07129                       83.6    3e-15   
ref|XP_008456571.1|  PREDICTED: calcium uptake protein 1, mitocho...  83.2    4e-15   
gb|KCW81353.1|  hypothetical protein EUGRSUZ_C02735                   82.0    4e-15   
ref|XP_002970263.1|  hypothetical protein SELMODRAFT_231573           82.0    6e-15   
gb|KHN07054.1|  Calcium uptake protein 1, mitochondrial               82.4    6e-15   
ref|XP_006581342.1|  PREDICTED: calcium uptake protein 1, mitocho...  82.4    6e-15   
ref|XP_002515470.1|  calcium ion binding protein, putative            82.8    6e-15   Ricinus communis
ref|XP_008775754.1|  PREDICTED: calcium uptake protein 1 homolog,...  82.4    6e-15   
ref|NP_001142200.1|  uncharacterized protein LOC100274368             79.3    1e-14   Zea mays [maize]
ref|XP_010913361.1|  PREDICTED: calcium uptake protein 1, mitocho...  81.3    1e-14   
emb|CDP18812.1|  unnamed protein product                              81.6    1e-14   
ref|XP_009614691.1|  PREDICTED: calcium uptake protein 1, mitocho...  81.3    2e-14   
ref|XP_007011794.1|  Calcium ion binding protein, putative isoform 1  81.3    2e-14   
ref|XP_010913360.1|  PREDICTED: calcium uptake protein 1, mitocho...  80.9    2e-14   
ref|XP_006389396.1|  hypothetical protein POPTR_0025s00330g           79.7    2e-14   
ref|XP_010913359.1|  PREDICTED: calcium uptake protein 1, mitocho...  80.9    2e-14   
gb|AES73595.2|  calcium-binding EF hand protein                       80.9    2e-14   
ref|XP_003603344.1|  Calcium binding atopy-related autoantigen        80.9    2e-14   
ref|XP_010913358.1|  PREDICTED: calcium uptake protein 1, mitocho...  80.9    2e-14   
gb|KHN08156.1|  Calcium uptake protein 1, mitochondrial               80.1    3e-14   
ref|XP_002978421.1|  hypothetical protein SELMODRAFT_108925           79.7    3e-14   
ref|XP_007136990.1|  hypothetical protein PHAVU_009G091000g           80.1    4e-14   
ref|XP_010665654.1|  PREDICTED: calcium uptake protein 1 homolog,...  80.5    4e-14   
ref|XP_008661648.1|  PREDICTED: uncharacterized protein LOC100274...  80.1    4e-14   
ref|XP_010665651.1|  PREDICTED: calcium uptake protein 1 homolog,...  80.1    4e-14   
gb|KHG08195.1|  Calcium uptake 1, mitochondrial                       79.7    6e-14   
gb|KHN15019.1|  Calcium uptake protein 1, mitochondrial               79.0    7e-14   
ref|XP_004159433.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  79.3    8e-14   
ref|XP_004139397.1|  PREDICTED: calcium uptake protein 1, mitocho...  79.3    8e-14   
ref|XP_007155096.1|  hypothetical protein PHAVU_003G172800g           79.0    9e-14   
ref|XP_007013634.1|  Calcium-binding EF hand family protein           79.3    9e-14   
ref|XP_006450355.1|  hypothetical protein CICLE_v10008054mg           77.4    1e-13   
ref|XP_006389387.1|  hypothetical protein POPTR_0025s00230g           75.5    1e-13   
ref|XP_010099864.1|  Calcium uptake protein 1                         78.6    2e-13   
gb|KHN48538.1|  Calcium uptake protein 1, mitochondrial               77.8    2e-13   
ref|XP_003549296.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.8    2e-13   
gb|KFK29820.1|  hypothetical protein AALP_AA7G183100                  75.5    3e-13   
ref|XP_009626826.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.4    3e-13   
ref|XP_004145522.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.4    4e-13   
gb|KDO61821.1|  hypothetical protein CISIN_1g010530mg                 77.4    4e-13   
ref|XP_006450361.1|  hypothetical protein CICLE_v10008054mg           77.4    4e-13   
gb|KDO61820.1|  hypothetical protein CISIN_1g010530mg                 77.4    4e-13   
ref|XP_006594263.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.0    4e-13   
ref|XP_008452897.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.0    4e-13   
ref|XP_006594262.1|  PREDICTED: calcium uptake protein 1, mitocho...  77.0    5e-13   
gb|KHN47123.1|  Calcium uptake protein 1, mitochondrial               77.0    5e-13   
ref|XP_007201997.1|  hypothetical protein PRUPE_ppa024920mg           75.9    6e-13   
ref|XP_007161189.1|  hypothetical protein PHAVU_001G049500g           76.3    8e-13   
ref|XP_003609483.1|  Calcium binding atopy-related autoantigen        76.3    8e-13   
gb|AGV54724.1|  calcium uptake protein 1 mitochondrial-like protein   76.3    9e-13   
ref|XP_006578131.1|  PREDICTED: calcium uptake protein 1, mitocho...  75.5    1e-12   
ref|XP_010648727.1|  PREDICTED: calcium uptake protein 3, mitocho...  73.2    1e-12   
gb|AGV54279.1|  calcium ion binding protein                           75.9    1e-12   
gb|KFK29821.1|  hypothetical protein AALP_AA7G183100                  75.1    2e-12   
ref|XP_008242922.1|  PREDICTED: calcium uptake protein 1, mitocho...  75.1    2e-12   
ref|XP_001783961.1|  predicted protein                                74.3    3e-12   
gb|EYU20233.1|  hypothetical protein MIMGU_mgv1a005202mg              74.3    4e-12   
emb|CBI21113.3|  unnamed protein product                              74.7    5e-12   
ref|XP_010240086.1|  PREDICTED: calcium uptake protein 1 homolog,...  73.6    6e-12   
ref|NP_194934.1|  EF-hand, calcium binding motif-containing protein   73.2    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648725.1|  PREDICTED: calcium uptake protein 1, mitocho...  72.4    9e-12   
ref|XP_006283595.1|  hypothetical protein CARUB_v10004651mg           73.2    9e-12   
ref|XP_010437956.1|  PREDICTED: calcium uptake protein 1 homolog,...  73.2    1e-11   
ref|XP_010447444.1|  PREDICTED: calcium uptake protein 1 homolog,...  73.2    1e-11   
ref|XP_006412519.1|  hypothetical protein EUTSA_v10024993mg           72.8    1e-11   
ref|XP_006388376.1|  hypothetical protein POPTR_0204s00230g           68.6    1e-11   
ref|XP_003631765.1|  PREDICTED: calcium uptake protein 1, mitocho...  72.8    1e-11   
gb|KHN02022.1|  EF-hand domain-containing family member A2            70.1    1e-11   
ref|XP_009782530.1|  PREDICTED: calcium uptake protein 1, mitocho...  72.4    1e-11   
ref|XP_006596683.1|  PREDICTED: calcium uptake protein 1, mitocho...  70.1    2e-11   
ref|XP_002869294.1|  calcium-binding EF hand family protein           71.6    3e-11   
ref|XP_004508411.1|  PREDICTED: calcium uptake protein 1 homolog,...  71.2    4e-11   
ref|XP_010432776.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  71.2    4e-11   
emb|CAE02932.3|  OSJNBa0014K14.4                                      71.2    5e-11   Oryza sativa [red rice]
gb|EMS49497.1|  Calcium uptake protein 1, mitochondrial               70.5    6e-11   
gb|EMT14850.1|  Calcium-binding atopy-related autoantigen 1           70.1    6e-11   
ref|XP_004288762.1|  PREDICTED: calcium uptake protein 1, mitocho...  70.5    6e-11   
ref|XP_010526229.1|  PREDICTED: calcium uptake protein 1, mitocho...  70.5    7e-11   
gb|EMS64759.1|  Calcium uptake protein 1, mitochondrial               70.1    8e-11   
ref|XP_009363920.1|  PREDICTED: calcium uptake protein 1, mitocho...  70.1    9e-11   
ref|XP_009126406.1|  PREDICTED: calcium uptake protein 1 homolog,...  70.1    1e-10   
emb|CDX75217.1|  BnaA01g04850D                                        70.1    1e-10   
emb|CDX68814.1|  BnaC01g06390D                                        69.7    1e-10   
gb|EMT19411.1|  Calcium-binding atopy-related autoantigen 1           69.7    1e-10   
ref|XP_008384887.1|  PREDICTED: calcium uptake protein 1, mitocho...  69.3    2e-10   
gb|KCW79049.1|  hypothetical protein EUGRSUZ_C00479                   67.0    2e-10   
ref|XP_009355791.1|  PREDICTED: calcium uptake protein 1 homolog,...  68.6    3e-10   
ref|XP_011017911.1|  PREDICTED: calcium uptake protein 1 homolog,...  67.8    4e-10   
ref|XP_009362319.1|  PREDICTED: calcium uptake protein 1, mitocho...  67.8    6e-10   
ref|XP_010047215.1|  PREDICTED: calcium uptake protein 1, mitocho...  66.2    2e-09   
ref|XP_010227186.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  63.5    4e-09   
ref|XP_001763005.1|  predicted protein                                63.9    7e-09   
ref|XP_008394129.1|  PREDICTED: calcium uptake protein 1 homolog,...  63.9    1e-08   
ref|XP_002531446.1|  calcium ion binding protein, putative            60.5    1e-07   Ricinus communis
ref|XP_007225509.1|  hypothetical protein PRUPE_ppa000461mg           59.3    4e-07   
ref|XP_008219541.1|  PREDICTED: calcium uptake protein 1, mitocho...  58.5    5e-07   
ref|XP_004291429.1|  PREDICTED: calcium uptake protein 1, mitocho...  57.8    9e-07   
gb|EPS61781.1|  hypothetical protein M569_13012                       57.4    1e-06   
ref|XP_006852820.1|  hypothetical protein AMTR_s00033p00176330        54.3    2e-05   
gb|EKC29672.1|  Calcium-binding atopy-related autoantigen 1           54.3    2e-05   
ref|XP_002595985.1|  hypothetical protein BRAFLDRAFT_123729           53.9    2e-05   Branchiostoma floridae
ref|XP_009171887.1|  hypothetical protein T265_07952                  53.1    4e-05   
gb|EFX70917.1|  hypothetical protein DAPPUDRAFT_202030                51.6    2e-04   
ref|XP_005092984.1|  PREDICTED: calcium uptake protein 1 homolog,...  51.2    2e-04   
ref|XP_005092981.1|  PREDICTED: calcium uptake protein 1 homolog,...  51.2    2e-04   
tpg|DAA56200.1|  TPA: hypothetical protein ZEAMMB73_081691            51.2    2e-04   
ref|XP_005092983.1|  PREDICTED: calcium uptake protein 1 homolog,...  51.2    2e-04   
ref|XP_002003229.1|  GI23634                                          51.2    2e-04   Drosophila mojavensis
ref|XP_003740151.1|  PREDICTED: calcium uptake protein 1 homolog,...  50.8    2e-04   
ref|XP_001660641.1|  hypothetical protein AaeL_AAEL010116             50.4    3e-04   Aedes aegypti
ref|XP_002405421.1|  conserved hypothetical protein                   50.4    4e-04   Ixodes scapularis [blacklegged tick]
ref|XP_009045382.1|  hypothetical protein LOTGIDRAFT_110115           50.1    4e-04   
ref|XP_002132495.1|  GA27717                                          49.3    7e-04   Drosophila pseudoobscura pseudoobscura
ref|NP_001097110.1|  CG4495, isoform B                                49.3    8e-04   Drosophila melanogaster
ref|XP_002078478.1|  GD23455                                          49.3    9e-04   Drosophila simulans
ref|NP_609100.1|  CG4495, isoform A                                   49.3    9e-04   Drosophila melanogaster
ref|XP_002088070.1|  GE14428                                          49.3    9e-04   Drosophila yakuba
ref|XP_001970127.1|  GG10463                                          49.3    9e-04   Drosophila erecta
emb|CAX74039.1|  EF-hand domain-containing family member A2           48.1    9e-04   



>ref|XP_011084065.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Sesamum 
indicum]
Length=482

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            KVCG+SLT+ VVD++F++FD N DG LS+DEFLRVL+RRETDI  P E+G VGMISCWLD
Sbjct  412  KVCGVSLTDKVVDLVFYMFDANRDGSLSADEFLRVLERRETDILQPREEGLVGMISCWLD  471

Query  347  CTKGCPSKIL  318
            CT+ C SK L
Sbjct  472  CTRNCSSKKL  481



>gb|EYU38319.1| hypothetical protein MIMGU_mgv1a005763mg [Erythranthe guttata]
Length=471

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 57/69 (83%), Gaps = 1/69 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+ VVD++F++FD N DG LSS+EFLRVL+RRE DI+ P E GF G+I+CWLD
Sbjct  401  QVCGISLTDKVVDLVFYMFDANKDGSLSSEEFLRVLERREMDISQPREGGFAGLIACWLD  460

Query  347  CTKGC-PSK  324
            CTK C P K
Sbjct  461  CTKNCSPPK  469



>emb|CBI25571.3| unnamed protein product [Vitis vinifera]
Length=354

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+NVVD+IF +FD N DG LS DEF+RVLQRRE D + P E GF+G++SCWL 
Sbjct  282  QVCGISLTDNVVDIIFHIFDANRDGSLSLDEFVRVLQRRERDTSQPREPGFMGLLSCWLS  341

Query  347  CTKGCPS  327
            CT  C S
Sbjct  342  CTTNCSS  348



>ref|XP_002266120.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis 
vinifera]
Length=488

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+NVVD+IF +FD N DG LS DEF+RVLQRRE D + P E GF+G++SCWL 
Sbjct  416  QVCGISLTDNVVDIIFHIFDANRDGSLSLDEFVRVLQRRERDTSQPREPGFMGLLSCWLS  475

Query  347  CTKGCPS  327
            CT  C S
Sbjct  476  CTTNCSS  482



>ref|XP_010244879.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=496

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEK-GFVGMISCWL  351
            +VCGISL++NV+D+IF +FDTN DG LSSDEF+RVL RRE+D+A PTE+ G +G++SCW+
Sbjct  425  QVCGISLSDNVIDIIFHVFDTNRDGSLSSDEFVRVLHRRESDVAQPTEEVGLIGLLSCWM  484

Query  350  DCTKGC  333
            +C K C
Sbjct  485  NCAKNC  490



>ref|XP_010687823.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like, 
partial [Beta vulgaris subsp. vulgaris]
Length=373

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI L++NVVD+IF +FD N DG LSSDEFL+VLQRRE D++ P E GF G+ SCW+DC
Sbjct  304  VCGIKLSKNVVDIIFHIFDLNRDGSLSSDEFLKVLQRRERDVSLPREAGFKGLFSCWVDC  363

Query  344  TKGCPS  327
            T  C S
Sbjct  364  TTSCSS  369



>ref|XP_009415582.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SLTENVV++IF +FDTN DG LSS+EFLR +QRRETDI  P+  G +G++SCWL C
Sbjct  403  VCGVSLTENVVEIIFHIFDTNRDGSLSSEEFLRAVQRRETDIREPSSTGIMGLLSCWLHC  462

Query  344  TKGCPSKIL  318
             + C S  L
Sbjct  463  RRHCSSSQL  471



>gb|KDO59309.1| hypothetical protein CISIN_1g042758mg, partial [Citrus sinensis]
Length=364

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            KVCGIS+++NVVD+IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +
Sbjct  296  KVCGISISDNVVDVIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKN  355

Query  347  CT  342
            C 
Sbjct  356  CA  357



>ref|XP_006474603.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Citrus 
sinensis]
Length=527

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            KVCGIS+T+NVVD+IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +
Sbjct  456  KVCGISITDNVVDVIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKN  515

Query  347  CT  342
            C 
Sbjct  516  CA  517



>emb|CDP10495.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS+++N+VD++F++FDTN DG LSSDEFLRVLQRRE++ + P   G  G+ SCW +
Sbjct  305  QVCGISISDNLVDLVFYIFDTNRDGNLSSDEFLRVLQRRESNASQPRGAGDKGLFSCWFE  364

Query  347  CTKGCPS  327
            CTK   S
Sbjct  365  CTKKSSS  371



>ref|XP_004953089.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Setaria italica]
Length=476

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+NVVD+IF +FD + DG LSS+EFLR LQRRE+DI  PT  GF+G+++CWL+C
Sbjct  406  VCGVDLTDNVVDIIFHVFDADRDGNLSSEEFLRSLQRRESDIRQPTTSGFLGVVACWLNC  465

Query  344  TK  339
            TK
Sbjct  466  TK  467



>ref|XP_009405765.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=459

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEK--GFVGMISCWL  351
            VCGISLTEN+VD+IF +FDTN DG LSS+EFLR LQRRE+D   P+    G +G++SCWL
Sbjct  387  VCGISLTENMVDVIFHVFDTNRDGNLSSEEFLRALQRRESDACQPSAPGGGIMGLLSCWL  446

Query  350  DCTKGC  333
             CTK C
Sbjct  447  QCTKNC  452



>tpg|DAA49669.1| TPA: hypothetical protein ZEAMMB73_737328 [Zea mays]
Length=292

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+
Sbjct  221  QVCGVDLTDKVVDIIFHVFDANCDGKLSSEEFLRSLQRRENDIRQPATSGFLGVITCWLN  280

Query  347  CTK  339
            CTK
Sbjct  281  CTK  283



>ref|XP_006453731.1| hypothetical protein CICLE_v10010671mg [Citrus clementina]
 gb|ESR66971.1| hypothetical protein CICLE_v10010671mg [Citrus clementina]
Length=491

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            KVCGIS+++NVVD+IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +
Sbjct  423  KVCGISISDNVVDVIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKN  482

Query  347  CT  342
            C 
Sbjct  483  CA  484



>ref|XP_009405764.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=471

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 2/66 (3%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEK--GFVGMISCWL  351
            VCGISLTEN+VD+IF +FDTN DG LSS+EFLR LQRRE+D   P+    G +G++SCWL
Sbjct  399  VCGISLTENMVDVIFHVFDTNRDGNLSSEEFLRALQRRESDACQPSAPGGGIMGLLSCWL  458

Query  350  DCTKGC  333
             CTK C
Sbjct  459  QCTKNC  464



>ref|XP_009626825.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=455

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NV++++F +FDTNHDG LSSDEF+RVL++RE DIA PTE G +  +SC+ +
Sbjct  379  QVCGVSLTDNVIEIVFHVFDTNHDGNLSSDEFIRVLEKRERDIAEPTEAGILNFVSCYGN  438

Query  347  CTKGCPSKIL  318
             T+   S +L
Sbjct  439  STRNYKSYLL  448



>ref|XP_002452439.1| hypothetical protein SORBIDRAFT_04g025880 [Sorghum bicolor]
 gb|EES05415.1| hypothetical protein SORBIDRAFT_04g025880 [Sorghum bicolor]
Length=471

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+C
Sbjct  401  VCGVDLTDKVVDIIFHVFDANSDGNLSSEEFLRSLQRREGDIRQPATSGFLGVIACWLNC  460

Query  344  TK  339
            TK
Sbjct  461  TK  462



>ref|XP_010907508.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=438

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+S+T+NVVD+IF +FD N DG LSS+EFLR LQ+RE+ I  PT  G  G++SCWL+C
Sbjct  368  VCGVSVTDNVVDVIFHVFDANFDGKLSSEEFLRALQKRESAIRQPTATGLTGLLSCWLNC  427

Query  344  TKGC  333
             + C
Sbjct  428  KRSC  431



>ref|XP_010907507.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=466

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+S+T+NVVD+IF +FD N DG LSS+EFLR LQ+RE+ I  PT  G  G++SCWL+C
Sbjct  396  VCGVSVTDNVVDVIFHVFDANFDGKLSSEEFLRALQKRESAIRQPTATGLTGLLSCWLNC  455

Query  344  TKGC  333
             + C
Sbjct  456  KRSC  459



>ref|NP_001147122.1| calcium binding atopy-related autoantigen 1 [Zea mays]
 gb|ACG25549.1| calcium binding atopy-related autoantigen 1 [Zea mays]
 gb|ACR35585.1| unknown [Zea mays]
 gb|AFW62953.1| calcium binding atopy autoantigen 1 isoform 1 [Zea mays]
 gb|AFW62954.1| calcium binding atopy autoantigen 1 isoform 2 [Zea mays]
Length=472

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE+DI  P   GF+G+I+CWL+C
Sbjct  402  VCGVDLTDKVVDIIFHVFDANCDGNLSSEEFLRSLQRRESDIRQPATSGFLGVIACWLNC  461

Query  344  TK  339
            TK
Sbjct  462  TK  463



>ref|XP_008645921.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Zea mays]
 gb|AFW72315.1| hypothetical protein ZEAMMB73_328564 [Zea mays]
Length=463

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+C
Sbjct  393  VCGVDLTDKVVDIIFHVFDANCDGNLSSEEFLRSLQRRENDIRQPATSGFLGVIACWLNC  452

Query  344  TK  339
            TK
Sbjct  453  TK  454



>ref|XP_003572710.2| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Brachypodium distachyon]
Length=456

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+ SCWL+
Sbjct  385  QVCGVDLTDTVVDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGVFSCWLN  444

Query  347  CTK  339
            CTK
Sbjct  445  CTK  447



>ref|XP_008456564.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Cucumis melo]
Length=532

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -3

Query  536  YIYKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            ++YKVCG+S+T+NVVD+IF +FD N DG LSSDEF+RV+QRRE + + P   G  G++SC
Sbjct  457  FLYKVCGVSITKNVVDIIFHIFDANEDGDLSSDEFVRVIQRREVNSSQPA-VGVGGLLSC  515

Query  356  WLDCTKGCPSKIL  318
            W  C   C S  L
Sbjct  516  WFSCAAKCSSAKL  528



>ref|XP_006365836.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
tuberosum]
Length=438

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VC ISL++NVVD+IFF+FD + DG LSSDEFLRVLQRRE + + P E  FVG  S WLD
Sbjct  375  QVCSISLSDNVVDLIFFMFDLDCDGTLSSDEFLRVLQRREQESSQPRESSFVGFFSSWLD  434

Query  347  CT  342
             T
Sbjct  435  ST  436



>dbj|BAK07466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+ SCWL+C
Sbjct  438  VCGVDLTDKVVDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGVFSCWLNC  497

Query  344  TK  339
            TK
Sbjct  498  TK  499



>ref|XP_009766649.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=470

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+NVVD+IFF+FD + DG LSSDEFLRVLQRRE + +   E GFV   S WLD
Sbjct  399  QVCGISLTDNVVDLIFFMFDLDCDGSLSSDEFLRVLQRREPECSEQRESGFVSFFSGWLD  458

Query  347  CTK  339
             TK
Sbjct  459  STK  461



>ref|XP_002324884.1| hypothetical protein POPTR_0018s02130g [Populus trichocarpa]
 gb|EEF03449.1| hypothetical protein POPTR_0018s02130g [Populus trichocarpa]
Length=488

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV++IF LFD+NHDG LS+DEF+RVL RRE DIA P E G  G +SC  + 
Sbjct  418  VCGVSLSDNVVEIIFHLFDSNHDGSLSADEFVRVLHRRERDIAQPVESGLAGFLSCCFNR  477

Query  344  TKGCP  330
                P
Sbjct  478  AANSP  482



>ref|XP_009782522.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=453

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NV++++F +FDTN DG LSSDEF+RVL++RE DIA P E G +  +SC+ +
Sbjct  377  QVCGVSLTDNVIEIVFHVFDTNRDGNLSSDEFIRVLEKREKDIAEPIEAGILNFVSCYGN  436

Query  347  CTKGCPSKIL  318
             T+   S +L
Sbjct  437  STRNYKSYLL  446



>ref|XP_006648832.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Oryza brachyantha]
Length=389

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+C
Sbjct  320  VCGVDLTDKVVDVIFHVFDANQDGSLSADEFLRALQRRESDIRQPATSGLLGVFTCLLNC  379

Query  344  TK  339
            TK
Sbjct  380  TK  381



>ref|XP_004976137.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Setaria italica]
 ref|XP_004976138.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Setaria italica]
 ref|XP_004976139.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X3 [Setaria italica]
Length=328

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FDTN DG LSS+EFLR LQRRETDI  PT  G +G +SCW   
Sbjct  258  VCGVDLTDRVVDIIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLGFLSCWFGG  317

Query  344  TKGC  333
             K  
Sbjct  318  RKSS  321



>ref|NP_001053237.1| Os04g0502900 [Oryza sativa Japonica Group]
 dbj|BAF15151.1| Os04g0502900 [Oryza sativa Japonica Group]
Length=472

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL
Sbjct  399  HHVCGVDLTDRVVDIIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWL  458

Query  350  DCTK  339
            +  K
Sbjct  459  NFNK  462



>ref|XP_006653576.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Oryza brachyantha]
Length=396

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FDTNHDG LSS+EF+R LQRRETDI  P   G VG +S WL
Sbjct  323  HHVCGVDLTDRVVDIIFHVFDTNHDGNLSSEEFVRALQRRETDIRQPATPGSVGPLSSWL  382

Query  350  D  348
            +
Sbjct  383  N  383



>gb|EEC77583.1| hypothetical protein OsI_16535 [Oryza sativa Indica Group]
Length=471

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL
Sbjct  398  HHVCGVDLTDRVVDIIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWL  457

Query  350  DCTK  339
            +  K
Sbjct  458  NFNK  461



>emb|CAH67586.1| OSIGBa0112M24.3 [Oryza sativa Indica Group]
Length=471

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL
Sbjct  398  HHVCGVDLTDRVVDIIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWL  457

Query  350  DCTK  339
            +  K
Sbjct  458  NFNK  461



>gb|KHG19522.1| Calcium uptake 1, mitochondrial [Gossypium arboreum]
Length=489

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y VCGISLT+N+V++IF +FDTN DG LSSDEF+RVL +RE DIA P E G  G++SC  
Sbjct  417  YHVCGISLTDNIVEIIFHVFDTNRDGHLSSDEFVRVLLKRERDIAQPVESGIFGLLSCCW  476

Query  350  DCTKGC  333
             C+   
Sbjct  477  HCSNNS  482



>gb|KEH39843.1| calcium-binding EF hand protein [Medicago truncatula]
Length=464

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGISL++NVV+++F LFDTN DG LS+DEF+RVL +RE DI HP E G +G++SC  +C
Sbjct  394  VCGISLSDNVVEIVFHLFDTNRDGNLSTDEFVRVLHKRERDIGHPVETGMLGLLSCCWNC  453

Query  344  TKGCPS  327
             +   S
Sbjct  454  RENISS  459



>ref|XP_006367412.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
tuberosum]
Length=463

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+N+++++F +FDTN DG LSSDEF+RVL++R  DIA PTE G +  +SC  +
Sbjct  387  QVCGVSLTDNMIELVFHVFDTNRDGSLSSDEFIRVLEKRARDIAEPTEAGILNFMSCCGN  446

Query  347  CTKGCPSKIL  318
            CT+   S +L
Sbjct  447  CTRNYKSNLL  456



>dbj|BAD19699.1| putative calcium binding atopy-related autoantigen 1 [Oryza sativa 
Japonica Group]
Length=283

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC + LT+ VVD+IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+C
Sbjct  214  VCEVDLTDKVVDVIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNC  273

Query  344  TK  339
            TK
Sbjct  274  TK  275



>tpg|DAA37068.1| TPA: hypothetical protein ZEAMMB73_919529 [Zea mays]
Length=285

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FDTN DG LS +EFLR LQRRETDI  PT  G +G +SCW   
Sbjct  215  VCGVDLTDRVVDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSG  274

Query  344  TK  339
             K
Sbjct  275  RK  276



>ref|XP_010250313.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=509

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SL++NVVD+IF +FD+N DG LSSDEF+RVL RRE  +  P E G VG++S W+ 
Sbjct  434  QVCGVSLSDNVVDIIFHVFDSNRDGSLSSDEFVRVLHRRERYLGQPMEAGVVGLLSYWMR  493

Query  347  CTKGC  333
              + C
Sbjct  494  YARDC  498



>ref|XP_008668321.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=430

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FDTN DG LS +EFLR LQRRETDI  PT  G +G +SCW   
Sbjct  360  VCGVDLTDRVVDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSG  419

Query  344  TK  339
             K
Sbjct  420  RK  421



>gb|KCW81354.1| hypothetical protein EUGRSUZ_C02735 [Eucalyptus grandis]
Length=328

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NVV++IF +FD N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +
Sbjct  257  RVCGVSLTDNVVELIFHVFDLNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHN  316

Query  347  C  345
            C
Sbjct  317  C  317



>ref|XP_011036617.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Populus euphratica]
Length=488

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SL++NVV++IF +FD+NHDG LS++EF++VL RRE DIA P E G  G +SC  +
Sbjct  417  QVCGVSLSDNVVEIIFHVFDSNHDGSLSAEEFVKVLHRRERDIAQPVESGLAGFLSCCFN  476

Query  347  CTKGCP  330
                 P
Sbjct  477  RAANSP  482



>ref|XP_010051173.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Eucalyptus 
grandis]
Length=630

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NVV++IF +FD N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +
Sbjct  559  RVCGVSLTDNVVELIFHVFDLNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHN  618

Query  347  C  345
            C
Sbjct  619  C  619



>gb|AFW58785.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=118

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG++LT+ VVD+IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW   
Sbjct  49   VCGVNLTDRVVDIIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSG  108

Query  344  TK  339
             K
Sbjct  109  RK  110



>ref|XP_011081511.1| PREDICTED: calcium uptake protein 1, mitochondrial [Sesamum indicum]
Length=483

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+NV+D+IF +FD N DG LSSDEF+RVL +RE DIA PTE G +  +SC   
Sbjct  412  QVCGISLTDNVLDIIFHVFDANRDGSLSSDEFVRVLHKRERDIAQPTEAGVLSFLSCCWH  471

Query  347  CTKG  336
            C+  
Sbjct  472  CSSA  475



>ref|XP_004231518.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
lycopersicum]
Length=442

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VC ISL++NVVD+IFF+FD + DG LSSDEFLRVLQRRE + +   E  FVG  S WLD
Sbjct  379  QVCNISLSDNVVDLIFFMFDLDCDGTLSSDEFLRVLQRREQESSQTRESSFVGFFSGWLD  438

Query  347  CT  342
             T
Sbjct  439  ST  440



>ref|XP_008775755.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X2 [Phoenix dactylifera]
Length=350

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC +S+T+NVVD+IF +FD N DG LSS+EF+R LQ+RE+ I  PT  G  G++SCWL+C
Sbjct  281  VCNLSVTDNVVDVIFHVFDANCDGNLSSEEFVRALQKRESAIRQPTATGLAGLLSCWLNC  340

Query  344  TK  339
             +
Sbjct  341  KR  342



>ref|XP_004498756.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Cicer arietinum]
Length=473

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFDTN DG LS++EF+RVL +RE DI  P E G +G +SC  +C
Sbjct  402  VCGLSLSDNVVEIVFHLFDTNQDGNLSTNEFVRVLHKREKDIVQPVESGMLGFLSCCRNC  461

Query  344  TKG-CPSKIL  318
            T+   PS++ 
Sbjct  462  TENISPSRLF  471



>ref|XP_008668320.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=458

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ LT+ VVD+IF +FDTN DG LS +EFLR LQRRETDI  PT  G +G +SCW   
Sbjct  388  VCGVDLTDRVVDIIFHVFDTNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSG  447

Query  344  TK  339
             K
Sbjct  448  RK  449



>gb|EEE57362.1| hypothetical protein OsJ_07508 [Oryza sativa Japonica Group]
Length=461

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC + LT+ VVD+IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+C
Sbjct  392  VCEVDLTDKVVDVIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNC  451

Query  344  TK  339
            TK
Sbjct  452  TK  453



>gb|EEC73584.1| hypothetical protein OsI_08048 [Oryza sativa Indica Group]
Length=461

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC + LT+ VVD+IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+C
Sbjct  392  VCEVDLTDKVVDVIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNC  451

Query  344  TK  339
            TK
Sbjct  452  TK  453



>ref|XP_004498755.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Cicer arietinum]
Length=479

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFDTN DG LS++EF+RVL +RE DI  P E G +G +SC  +C
Sbjct  408  VCGLSLSDNVVEIVFHLFDTNQDGNLSTNEFVRVLHKREKDIVQPVESGMLGFLSCCRNC  467

Query  344  TKG-CPSKIL  318
            T+   PS++ 
Sbjct  468  TENISPSRLF  477



>ref|XP_004240684.1| PREDICTED: calcium uptake protein 1, mitochondrial [Solanum lycopersicum]
Length=457

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            + CG+S+T+N+++++F +FDTNHDG LSSDEF+RVL++R  DIA PTE G +  +SC  +
Sbjct  381  QACGVSITDNMIELVFHVFDTNHDGSLSSDEFIRVLEKRARDIAEPTEAGILNFMSCSGN  440

Query  347  CT  342
            CT
Sbjct  441  CT  442



>ref|NP_001047417.1| Os02g0613000 [Oryza sativa Japonica Group]
 dbj|BAF09331.1| Os02g0613000 [Oryza sativa Japonica Group]
Length=478

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC + LT+ VVD+IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+C
Sbjct  409  VCEVDLTDKVVDVIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNC  468

Query  344  TK  339
            TK
Sbjct  469  TK  470



>gb|KDP33558.1| hypothetical protein JCGZ_07129 [Jatropha curcas]
Length=503

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            +CGISLT+NVVD+IF +FD+N DG LS DEF+RVL +RE DIA P E G  G +SC  +C
Sbjct  433  ICGISLTQNVVDIIFHVFDSNQDGHLSPDEFVRVLYKRERDIAEPVESGIFGFLSCCYNC  492

Query  344  T  342
             
Sbjct  493  A  493



>ref|XP_008456571.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=505

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+S+T+NVVD+IF +FD N DG LSSDEF+RV+QRRE + + P   G  G++SCW  
Sbjct  433  QVCGVSITKNVVDIIFHIFDANEDGDLSSDEFVRVIQRREVNSSQPA-VGVGGLLSCWFS  491

Query  347  CTKGCPSKIL  318
            C   C S  L
Sbjct  492  CAAKCSSAKL  501



>gb|KCW81353.1| hypothetical protein EUGRSUZ_C02735 [Eucalyptus grandis]
Length=373

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NVV++IF +FD N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +
Sbjct  302  RVCGVSLTDNVVELIFHVFDLNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHN  361

Query  347  C  345
            C
Sbjct  362  C  362



>ref|XP_002970263.1| hypothetical protein SELMODRAFT_231573 [Selaginella moellendorffii]
 gb|EFJ28393.1| hypothetical protein SELMODRAFT_231573 [Selaginella moellendorffii]
Length=411

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VC + LTE V+D++F++FD N DG LS +EFL  LQRRE D  HP E G V ++ CW +
Sbjct  338  QVCSVPLTEAVIDVVFYIFDLNRDGNLSMEEFLGALQRREGDTGHPAEAGIVQVLKCWWN  397

Query  347  CTKGC  333
            C + C
Sbjct  398  CARNC  402



>gb|KHN07054.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=462

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   C
Sbjct  392  VCGVSLSDNVVEIVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKC  451

Query  344  TKGCPSKIL  318
            T   PS  L
Sbjct  452  TDTSPSSRL  460



>ref|XP_006581342.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=464

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   C
Sbjct  394  VCGVSLSDNVVEIVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKC  453

Query  344  TKGCPSKIL  318
            T   PS  L
Sbjct  454  TDTSPSSRL  462



>ref|XP_002515470.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF46919.1| calcium ion binding protein, putative [Ricinus communis]
Length=540

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SLT+ VVD+IF +FD+N DG LS +EF+RVL +RE DIA P E G +G +SC  +C
Sbjct  413  VCGVSLTDKVVDIIFHVFDSNRDGHLSLNEFIRVLHKRERDIAQPVESGIIGFLSCCFNC  472

Query  344  TKG  336
              G
Sbjct  473  ANG  475



>ref|XP_008775754.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Phoenix dactylifera]
Length=467

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC +S+T+NVVD+IF +FD N DG LSS+EF+R LQ+RE+ I  PT  G  G++SCWL+C
Sbjct  398  VCNLSVTDNVVDVIFHVFDANCDGNLSSEEFVRALQKRESAIRQPTATGLAGLLSCWLNC  457

Query  344  TK  339
             +
Sbjct  458  KR  459



>ref|NP_001142200.1| uncharacterized protein LOC100274368 [Zea mays]
 gb|ACF87871.1| unknown [Zea mays]
 gb|AFW58783.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58784.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=248

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG++LT+ VVD+IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW   
Sbjct  179  VCGVNLTDRVVDIIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSG  238

Query  344  TK  339
             K
Sbjct  239  RK  240



>ref|XP_010913361.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X4 [Elaeis guineensis]
Length=443

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI++++NVVD+IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL 
Sbjct  364  EVCGITVSDNVVDIIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLS  423

Query  347  CTK  339
            C K
Sbjct  424  CVK  426



>emb|CDP18812.1| unnamed protein product [Coffea canephora]
Length=498

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VC +SLT+NV+++IF +FD N DG LSSDEF+RVLQ+RE DIA PTE G    +SC  +
Sbjct  427  QVCDVSLTDNVIEIIFHVFDANRDGSLSSDEFIRVLQKREKDIAQPTEAGIFNFLSCCWN  486

Query  347  C  345
            C
Sbjct  487  C  487



>ref|XP_009614691.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=470

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISLT+NVVD+IFF+FD ++DG LSSDEFLRVLQRRE + +   E       S WLD
Sbjct  399  QVCGISLTDNVVDLIFFMFDLDYDGSLSSDEFLRVLQRREPESSEQRESVSGSFFSGWLD  458

Query  347  CTK  339
             TK
Sbjct  459  STK  461



>ref|XP_007011794.1| Calcium ion binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29413.1| Calcium ion binding protein, putative isoform 1 [Theobroma cacao]
Length=492

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI LT+NVV++IF +FD+N DG LS+DEF+RVL +RE DIA P E G +G++SC  +C
Sbjct  422  VCGIDLTDNVVEIIFHVFDSNRDGHLSADEFVRVLLKRERDIAQPVESGILGLLSCCWNC  481

Query  344  T  342
            +
Sbjct  482  S  482



>ref|XP_010913360.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X3 [Elaeis guineensis]
Length=455

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI++++NVVD+IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C
Sbjct  377  VCGITVSDNVVDIIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSC  436

Query  344  TK  339
             K
Sbjct  437  VK  438



>ref|XP_006389396.1| hypothetical protein POPTR_0025s00330g [Populus trichocarpa]
 gb|ERP48310.1| hypothetical protein POPTR_0025s00330g [Populus trichocarpa]
Length=336

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            K+CGIS+T N+VD+IF +FD N DG LSSDEF+RVLQ RET    P E G  G++SC  +
Sbjct  265  KLCGISITNNLVDIIFHVFDANRDGNLSSDEFVRVLQGRETASRIPREPGLKGLMSCCAN  324

Query  347  CTKG-CPSKIL  318
            C K   P+K L
Sbjct  325  CAKNYSPAKRL  335



>ref|XP_010913359.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Elaeis guineensis]
Length=464

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI++++NVVD+IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C
Sbjct  386  VCGITVSDNVVDIIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSC  445

Query  344  TK  339
             K
Sbjct  446  VK  447



>gb|AES73595.2| calcium-binding EF hand protein [Medicago truncatula]
Length=455

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFDT+ DG LSS+EF+RVLQRRE D+    E G +G +SC  +C
Sbjct  385  VCGLSLSDNVVEIVFHLFDTSGDGNLSSNEFVRVLQRRERDVGRSVETGIMGFLSCCWNC  444

Query  344  TKGCPSKIL  318
            T   P   L
Sbjct  445  TDNSPGSQL  453



>ref|XP_003603344.1| Calcium binding atopy-related autoantigen [Medicago truncatula]
Length=478

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFDT+ DG LSS+EF+RVLQRRE D+    E G +G +SC  +C
Sbjct  408  VCGLSLSDNVVEIVFHLFDTSGDGNLSSNEFVRVLQRRERDVGRSVETGIMGFLSCCWNC  467

Query  344  TKGCPSKIL  318
            T   P   L
Sbjct  468  TDNSPGSQL  476



>ref|XP_010913358.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Elaeis guineensis]
Length=483

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI++++NVVD+IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C
Sbjct  405  VCGITVSDNVVDIIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSC  464

Query  344  TK  339
             K
Sbjct  465  VK  466



>gb|KHN08156.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=395

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NVV+++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   C
Sbjct  325  VCGLSLSDNVVEIVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKC  384

Query  344  TKGCPSKIL  318
                PS  L
Sbjct  385  KDTSPSSRL  393



>ref|XP_002978421.1| hypothetical protein SELMODRAFT_108925, partial [Selaginella 
moellendorffii]
 gb|EFJ20407.1| hypothetical protein SELMODRAFT_108925, partial [Selaginella 
moellendorffii]
Length=373

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC + LT+ V+D++F++FD N DG LS +EFL  LQRRE D  HP E G V ++ CW +C
Sbjct  301  VCSVPLTDAVIDVVFYIFDLNRDGNLSMEEFLGALQRREGDTGHPAEAGIVQVLKCWWNC  360

Query  344  TKGC  333
             + C
Sbjct  361  ARNC  364



>ref|XP_007136990.1| hypothetical protein PHAVU_009G091000g [Phaseolus vulgaris]
 gb|ESW08984.1| hypothetical protein PHAVU_009G091000g [Phaseolus vulgaris]
Length=462

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SL++NV++++F LFD N DG LS++EF+RVLQ RE DIA  TE G +G +SC   C
Sbjct  392  VCGLSLSDNVIEIVFHLFDANGDGSLSTEEFVRVLQHRERDIAQTTETGIMGFLSCCWKC  451

Query  344  TKGCPSKIL  318
                PS  L
Sbjct  452  RNTSPSSRL  460



>ref|XP_010665654.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=505

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NVV++I+ +FD N DG L +DEF+RVLQ+R  DIA P E G  G +SC  +
Sbjct  434  QVCGVSLTDNVVEIIYHVFDANRDGNLCADEFVRVLQKRNRDIAQPLETGLFGFLSCCRN  493

Query  347  CTKGC  333
            C   C
Sbjct  494  CANRC  498



>ref|XP_008661648.1| PREDICTED: uncharacterized protein LOC100274368 isoform X1 [Zea 
mays]
 gb|ACL54137.1| unknown [Zea mays]
 gb|AFW58780.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58781.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58782.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=464

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG++LT+ VVD+IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW   
Sbjct  395  VCGVNLTDRVVDIIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSG  454

Query  344  TK  339
             K
Sbjct  455  RK  456



>ref|XP_010665651.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=509

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SLT+NVV++I+ +FD N DG L +DEF+RVLQ+R  DIA P E G  G +SC  +
Sbjct  438  QVCGVSLTDNVVEIIYHVFDANRDGNLCADEFVRVLQKRNRDIAQPLETGLFGFLSCCRN  497

Query  347  CTKGC  333
            C   C
Sbjct  498  CANRC  502



>gb|KHG08195.1| Calcium uptake 1, mitochondrial [Gossypium arboreum]
Length=484

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+SLT+N+V+++F +FD+N DG LS DEF+RVL++RE DIA P E G +G+ SC  +C
Sbjct  414  VCGVSLTDNIVEIVFHVFDSNKDGHLSWDEFVRVLRKRERDIAQPVESGIMGLKSCCWNC  473

Query  344  T  342
            +
Sbjct  474  S  474



>gb|KHN15019.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=424

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ +++ VVD+IF +FD N DG LS+ EF+RV+QRRE + +     GF G+ISCW +
Sbjct  354  QVCGVCISDEVVDIIFHVFDANRDGSLSASEFVRVVQRRENNNS-SRHGGFGGLISCWWN  412

Query  347  CTKGCPSKILHF  312
            C K C S  L F
Sbjct  413  CVKNCSSAKLQF  424



>ref|XP_004159433.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1, mitochondrial-like 
[Cucumis sativus]
Length=511

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+S+T+NVVD+IF +FD N DG LSSDEF+RV+QRRE +   P   G  G++SCW  C
Sbjct  440  VCGVSITKNVVDIIFHIFDANEDGDLSSDEFVRVIQRREVNSTQPA-VGAGGLLSCWFGC  498

Query  344  TKGC  333
               C
Sbjct  499  AAKC  502



>ref|XP_004139397.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN60757.1| Calcium ion binding protein [Cucumis sativus]
Length=511

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+S+T+NVVD+IF +FD N DG LSSDEF+RV+QRRE +   P   G  G++SCW  C
Sbjct  440  VCGVSITKNVVDIIFHIFDANEDGDLSSDEFVRVIQRREVNSTQPA-VGAGGLLSCWFGC  498

Query  344  TKGC  333
               C
Sbjct  499  AAKC  502



>ref|XP_007155096.1| hypothetical protein PHAVU_003G172800g [Phaseolus vulgaris]
 gb|ESW27090.1| hypothetical protein PHAVU_003G172800g [Phaseolus vulgaris]
Length=471

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 3/70 (4%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ +T+ VVD+IF +FD N DG LS  EF+RVLQRRE DI+  +  GF G+I+CWL C
Sbjct  404  VCGVCITDKVVDIIFHVFDANRDGNLSVSEFVRVLQRRE-DISSGS--GFKGLITCWLKC  460

Query  344  TKGCPSKILH  315
             K CP+  L 
Sbjct  461  VKNCPTTNLQ  470



>ref|XP_007013634.1| Calcium-binding EF hand family protein [Theobroma cacao]
 gb|EOY31253.1| Calcium-binding EF hand family protein [Theobroma cacao]
Length=505

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI++T++VVD+IF +FD N DG LSSDEF+RV+QRRE   + P      G+ISCWL 
Sbjct  435  QVCGIAITDSVVDIIFHVFDANRDGNLSSDEFVRVVQRRERSNSQPRADT-KGLISCWLS  493

Query  347  CTKGCP-SKIL  318
            C   C  SK+L
Sbjct  494  CATNCSTSKLL  504



>ref|XP_006450355.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450356.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450358.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450362.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63595.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63596.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63598.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63602.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
Length=328

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGI LT+NV+D+IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  
Sbjct  256  YRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCW  315

Query  350  DCT  342
            + T
Sbjct  316  NFT  318



>ref|XP_006389387.1| hypothetical protein POPTR_0025s00230g, partial [Populus trichocarpa]
 gb|ERP48301.1| hypothetical protein POPTR_0025s00230g, partial [Populus trichocarpa]
Length=167

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            ++CGIS+T N+VD+IF +FD N DG  SSD+F+RVLQ RET    P E G  G++SC  +
Sbjct  96   QLCGISITNNLVDIIFHVFDANRDGNSSSDDFVRVLQGRETASRIPREPGLKGLMSCCAN  155

Query  347  CTKG-CPSKIL  318
            C K   P+K L
Sbjct  156  CAKNYSPAKRL  166



>ref|XP_010099864.1| Calcium uptake protein 1 [Morus notabilis]
 gb|EXB80741.1| Calcium uptake protein 1 [Morus notabilis]
Length=490

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGI L+ NVV++IF LFD N DG LS DEF+RVL RRE DIA P E G +G + C  +C
Sbjct  419  VCGIDLSRNVVEIIFHLFDANRDGSLSLDEFVRVLHRRERDIAQPVESGLMGFLFCCGNC  478

Query  344  T  342
            +
Sbjct  479  S  479



>gb|KHN48538.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=481

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGISL++ VV+++F LFD N DG LS DEF+RVL +RE DIA P E G  G +SC  +C
Sbjct  415  VCGISLSDTVVEIVFHLFDANRDGNLSFDEFVRVLHKRERDIAQPVETGIRGWLSCGWNC  474

Query  344  TKGCPS  327
            T    S
Sbjct  475  THNFSS  480



>ref|XP_003549296.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=487

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCGISL++ VV+++F LFD N DG LS DEF+RVL +RE DIA P E G  G +SC  +C
Sbjct  421  VCGISLSDTVVEIVFHLFDANRDGNLSFDEFVRVLHKRERDIAQPVETGIRGWLSCGWNC  480

Query  344  TKGCPS  327
            T    S
Sbjct  481  THNFSS  486



>gb|KFK29820.1| hypothetical protein AALP_AA7G183100 [Arabis alpina]
Length=225

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGISL++NV+++ F +FD+N DG LS DEFLRVL RRE D++ P  KG    +S   
Sbjct  159  YQVCGISLSDNVIEIAFHVFDSNRDGNLSVDEFLRVLHRRERDMSPPIAKGLCQFLSNGW  218

Query  350  DCTKGC  333
            + +K C
Sbjct  219  NGSKNC  224



>ref|XP_009626826.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Nicotiana tomentosiformis]
Length=430

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKG  378
            +VCG+SLT+NV++++F +FDTNHDG LSSDEF+RVL++RE DIA PTE  
Sbjct  379  QVCGVSLTDNVIEIVFHVFDTNHDGNLSSDEFIRVLEKRERDIAEPTEAA  428



>ref|XP_004145522.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004157086.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN55467.1| hypothetical protein Csa_4G652790 [Cucumis sativus]
Length=476

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            +VCGI+L++ VVD+IF LFDTN DG LSS+EF+RVL  RE D+A P E G +G+ S CW
Sbjct  412  QVCGINLSDEVVDIIFHLFDTNLDGELSSEEFVRVLHNRERDVAQPVEAGMMGLFSRCW  470



>gb|KDO61821.1| hypothetical protein CISIN_1g010530mg [Citrus sinensis]
Length=499

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGI LT+NV+D+IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  
Sbjct  427  YRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCW  486

Query  350  DCT  342
            + T
Sbjct  487  NFT  489



>ref|XP_006450361.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006483416.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR63601.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
Length=508

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGI LT+NV+D+IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  
Sbjct  436  YRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCW  495

Query  350  DCT  342
            + T
Sbjct  496  NFT  498



>gb|KDO61820.1| hypothetical protein CISIN_1g010530mg [Citrus sinensis]
Length=508

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGI LT+NV+D+IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  
Sbjct  436  YRVCGILLTDNVIDIIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCW  495

Query  350  DCT  342
            + T
Sbjct  496  NFT  498



>ref|XP_006594263.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Glycine max]
Length=459

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ +T+ VVD+IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+
Sbjct  384  QVCGVCITDEVVDIIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLN  442

Query  347  CTKGCPSKILHF  312
            C K C S   +F
Sbjct  443  CVKNCSSAQFNF  454



>ref|XP_008452897.1| PREDICTED: calcium uptake protein 1, mitochondrial [Cucumis melo]
 gb|ADN34123.1| calcium ion binding protein [Cucumis melo subsp. melo]
Length=476

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            +VCGI+L++ VVD+IF LFDTN DG LSS+EF+RVL  RE D+A P E G +G+ S CW
Sbjct  412  QVCGINLSDEVVDIIFHLFDTNLDGELSSEEFVRVLHNRERDVAQPVEAGMMGLFSRCW  470



>ref|XP_006594262.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Glycine max]
Length=487

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ +T+ VVD+IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+
Sbjct  412  QVCGVCITDEVVDIIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLN  470

Query  347  CTKGCPSKILHF  312
            C K C S   +F
Sbjct  471  CVKNCSSAQFNF  482



>gb|KHN47123.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=481

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ +T+ VVD+IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+
Sbjct  406  QVCGVCITDEVVDIIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLN  464

Query  347  CTKGCPSKILHF  312
            C K C S   +F
Sbjct  465  CVKNCSSAQFNF  476



>ref|XP_007201997.1| hypothetical protein PRUPE_ppa024920mg [Prunus persica]
 gb|EMJ03196.1| hypothetical protein PRUPE_ppa024920mg [Prunus persica]
Length=371

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS+  NV+D+IF +FD N DG LS++EF+RVLQRR  ++   +E GF G++SCWL+
Sbjct  301  QVCGISVPNNVIDIIFHVFDANGDGDLSANEFVRVLQRRGGEV---SETGFRGLLSCWLN  357

Query  347  CT  342
            C 
Sbjct  358  CA  359



>ref|XP_007161189.1| hypothetical protein PHAVU_001G049500g [Phaseolus vulgaris]
 gb|ESW33183.1| hypothetical protein PHAVU_001G049500g [Phaseolus vulgaris]
Length=487

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISL +NVVD++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +
Sbjct  417  QVCGISLPDNVVDIVFHVFDTNRDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWN  476

Query  347  CTKGCPSKIL  318
            C+    S + 
Sbjct  477  CSNNKSSGLF  486



>ref|XP_003609483.1| Calcium binding atopy-related autoantigen [Medicago truncatula]
 gb|AES91680.1| calcium-binding EF hand protein [Medicago truncatula]
Length=468

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+ +TENV+D+IF +FD N DG LS+ EF+RV+QRRE DI+  +  GF  +I+CWL+
Sbjct  406  QVCGVHVTENVLDIIFHVFDANRDGSLSASEFVRVIQRRE-DIS--SRFGFGNLITCWLN  462

Query  347  CTKG  336
            C KG
Sbjct  463  CVKG  466



>gb|AGV54724.1| calcium uptake protein 1 mitochondrial-like protein [Phaseolus 
vulgaris]
Length=482

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISL +NVVD++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +
Sbjct  412  QVCGISLPDNVVDIVFHVFDTNRDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWN  471

Query  347  CTKGCPSKIL  318
            C+    S + 
Sbjct  472  CSNNKSSGLF  481



>ref|XP_006578131.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=391

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            VCG+SL++NVV+++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +S CW
Sbjct  303  VCGLSLSDNVVEIVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCW  360



>ref|XP_010648727.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Vitis 
vinifera]
Length=231

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            VCGISL++ VV++IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC
Sbjct  161  VCGISLSKCVVEIIFHVFDMNDDGKLSSEELVRVLQKRERDIAQPMESGIMGFFSC  216



>gb|AGV54279.1| calcium ion binding protein [Phaseolus vulgaris]
Length=550

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISL +NVVD++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +
Sbjct  362  QVCGISLPDNVVDIVFHVFDTNGDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWN  421

Query  347  CTKGCPSKIL  318
            C+    S + 
Sbjct  422  CSNNKSSGLF  431



>gb|KFK29821.1| hypothetical protein AALP_AA7G183100 [Arabis alpina]
Length=494

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            Y+VCGISL++NV+++ F +FD+N DG LS DEFLRVL RRE D++ P  KG    +S   
Sbjct  428  YQVCGISLSDNVIEIAFHVFDSNRDGNLSVDEFLRVLHRRERDMSPPIAKGLCQFLSNGW  487

Query  350  DCTKGC  333
            + +K C
Sbjct  488  NGSKNC  493



>ref|XP_008242922.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Prunus 
mume]
Length=500

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 48/62 (77%), Gaps = 3/62 (5%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS+  NV+D+IF +FD N DG LS++EF+RVLQRR  ++   ++ GF G++SCWL+
Sbjct  429  QVCGISVPNNVIDIIFHVFDANGDGDLSANEFVRVLQRRGGEV---SQTGFRGLLSCWLN  485

Query  347  CT  342
            C 
Sbjct  486  CA  487



>ref|XP_001783961.1| predicted protein [Physcomitrella patens]
 gb|EDQ51239.1| predicted protein [Physcomitrella patens]
Length=379

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            K+C + LT+ V+D+IF +FDT+ DG+L+ +EFL VLQRRE+DIA PTE G +  + C   
Sbjct  310  KLCDVQLTDVVMDIIFHIFDTDADGLLTMEEFLGVLQRRESDIADPTETGVIQFLKCLWR  369

Query  347  CTKGC  333
            C++ C
Sbjct  370  CSRHC  374



>gb|EYU20233.1| hypothetical protein MIMGU_mgv1a005202mg [Erythranthe guttata]
Length=493

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCW  354
            +VCG+SLT+ ++++IF +FD N DG LS+DEF+RVL +RE DIA PTE GF   +S +
Sbjct  407  QVCGVSLTDKMLEIIFHVFDANKDGRLSADEFVRVLHKRERDIAEPTEAGFFSFLSFF  464



>emb|CBI21113.3| unnamed protein product [Vitis vinifera]
Length=975

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            VCGISL++ VV++IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC
Sbjct  905  VCGISLSKCVVEIIFHVFDMNDDGKLSSEELVRVLQKRERDIAQPMESGIMGFFSC  960



>ref|XP_010240086.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Brachypodium distachyon]
Length=463

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VCG+ L++ VVD+IF +FDTN DG LSS+EFLR LQRRE DI  PT +G VG    W + 
Sbjct  400  VCGVELSDRVVDIIFHVFDTNEDGNLSSEEFLRALQRRENDIHQPTTRGPVG----WPNS  455

Query  344  TK  339
             +
Sbjct  456  KR  457



>ref|NP_194934.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 emb|CAA16584.1| putative protein [Arabidopsis thaliana]
 emb|CAB79924.1| putative protein [Arabidopsis thaliana]
 gb|AAL59985.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67515.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85999.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=498

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI+L++NV+++ F +FD+N DG LS DEFLRVL RRE D+A P  KG     S    
Sbjct  431  QVCGITLSDNVIEIAFHVFDSNQDGNLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWK  490

Query  347  CTKGCPS  327
             +K C S
Sbjct  491  GSKNCSS  497



>ref|XP_010648725.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Vitis vinifera]
Length=368

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            VCGISL++ VV++IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC
Sbjct  298  VCGISLSKCVVEIIFHVFDMNDDGNLSSEELVRVLQKRERDIAQPMESGIMGFFSC  353



>ref|XP_006283595.1| hypothetical protein CARUB_v10004651mg [Capsella rubella]
 gb|EOA16493.1| hypothetical protein CARUB_v10004651mg [Capsella rubella]
Length=496

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI+L++NV+++ F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   +
Sbjct  431  QVCGITLSDNVIEIAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWN  490

Query  347  CTKGC  333
             +K C
Sbjct  491  GSKNC  495



>ref|XP_010437956.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=488

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI+L++NV+++ F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   +
Sbjct  423  QVCGITLSDNVIEIAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWN  482

Query  347  CTKGC  333
             +K C
Sbjct  483  GSKNC  487



>ref|XP_010447444.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Camelina sativa]
Length=497

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI+L++NV+++ F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   +
Sbjct  432  QVCGITLSDNVIEIAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWN  491

Query  347  CTKGC  333
             +K C
Sbjct  492  GSKNC  496



>ref|XP_006412519.1| hypothetical protein EUTSA_v10024993mg [Eutrema salsugineum]
 gb|ESQ53972.1| hypothetical protein EUTSA_v10024993mg [Eutrema salsugineum]
Length=496

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGISL++NV+++ F +FD+N DG LS +EFLRVL RRE D++ P  KG     S   +
Sbjct  429  QVCGISLSDNVIEIAFHVFDSNRDGTLSVEEFLRVLHRRERDMSQPIAKGLCQYFSDRWN  488

Query  347  CTKGCPSK  324
             +K C S+
Sbjct  489  GSKNCSSR  496



>ref|XP_006388376.1| hypothetical protein POPTR_0204s00230g [Populus trichocarpa]
 gb|ERP47290.1| hypothetical protein POPTR_0204s00230g [Populus trichocarpa]
Length=95

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = -3

Query  533  IYKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCW  354
            ++ +CGIS+  N+VD+IF +FD N DG LSSDEF+RV Q RET    P E G   ++SC 
Sbjct  23   LFPLCGISIL-NLVDIIFHVFDANRDGNLSSDEFVRVRQGRETASPIPREPGLKRLMSCC  81

Query  353  LDCTKG-CPSKIL  318
             +C K   P+K L
Sbjct  82   ANCAKNYSPAKRL  94



>ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X1 
[Vitis vinifera]
 emb|CBI21112.3| unnamed protein product [Vitis vinifera]
Length=474

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            VCGISL++ VV++IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC
Sbjct  404  VCGISLSKCVVEIIFHVFDMNDDGNLSSEELVRVLQKRERDIAQPMESGIMGFFSC  459



>gb|KHN02022.1| EF-hand domain-containing family member A2 [Glycine soja]
Length=182

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            V GISL+  VV+++F LFD N DG LS DEF+RVL +RE D+A P E G +G +SC
Sbjct  112  VYGISLSNIVVEIVFHLFDANRDGNLSFDEFVRVLHKREKDVAQPMETGIMGWLSC  167



>ref|XP_009782530.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Nicotiana sylvestris]
Length=428

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKG  378
            +VCG+SLT+NV++++F +FDTN DG LSSDEF+RVL++RE DIA P E  
Sbjct  377  QVCGVSLTDNVIEIVFHVFDTNRDGNLSSDEFIRVLEKREKDIAEPIEAA  426



>ref|XP_006596683.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=246

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            V GISL+  VV+++F LFD N DG LS DEF+RVL +RE D+A P E G +G +SC
Sbjct  176  VYGISLSNIVVEIVFHLFDANRDGNLSFDEFVRVLHKREKDVAQPVETGIMGWLSC  231



>ref|XP_002869294.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45553.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG++L++NV+++ F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   +
Sbjct  431  QVCGVTLSDNVIEIAFHVFDSNRDGNLSVDEFLRVLHRRERDMAQPIAKGLSRYFSDGWN  490

Query  347  CTKGC  333
             +K C
Sbjct  491  GSKNC  495



>ref|XP_004508411.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Cicer arietinum]
Length=461

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI++T+ V+D+IF +FD N DG LS+ EF+RV+QRRE      +  GF  ++SCWL+
Sbjct  392  QVCGINVTDEVLDIIFHVFDANRDGSLSASEFIRVIQRRENS---ASRFGFGSVMSCWLN  448

Query  347  C-TKGCPSKILH  315
            C T  C S  L 
Sbjct  449  CVTSNCSSAKLQ  460



>ref|XP_010432776.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1 homolog, 
mitochondrial-like [Camelina sativa]
Length=495

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGI+L++NV+++ F +FD+N DG LS +EFLRVL RRE D+A P  KG     S   +
Sbjct  430  QVCGITLSDNVIEIAFHVFDSNRDGSLSVEEFLRVLHRRERDVAQPIAKGLSRYFSDGWN  489

Query  347  CTKGC  333
             +K C
Sbjct  490  GSKNC  494



>emb|CAE02932.3| OSJNBa0014K14.4 [Oryza sativa Japonica Group]
Length=611

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 11/65 (17%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FDTNHDG LSS+EF+R LQRRETD+            S WL
Sbjct  399  HHVCGVDLTDRVVDIIFHVFDTNHDGNLSSEEFVRALQRRETDVH-----------SSWL  447

Query  350  DCTKG  336
            D   G
Sbjct  448  DFRHG  452



>gb|EMS49497.1| Calcium uptake protein 1, mitochondrial [Triticum urartu]
Length=403

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWL  351
            + VCG+ LT+ VVD+IF +FD N+DG LSS+EFLR LQRRE DI  P  +G  G +  WL
Sbjct  334  HHVCGVELTDRVVDIIFHVFDMNNDGHLSSEEFLRALQRREADIHQPAARG--GPMG-WL  390

Query  350  D  348
            +
Sbjct  391  N  391



>gb|EMT14850.1| Calcium-binding atopy-related autoantigen 1 [Aegilops tauschii]
Length=387

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGM  366
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+
Sbjct  331  VCGVDLTDKVVDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGV  383



>ref|XP_004288762.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=474

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 4/66 (6%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            KVCGI++T+NV+D+IF +FD N DG LS+ EF++VLQ R      P E G  G+++C+L+
Sbjct  411  KVCGINVTDNVIDIIFHVFDANGDGDLSASEFVKVLQNRG---GEPVESGLRGLLTCFLN  467

Query  347  C-TKGC  333
            C TK C
Sbjct  468  CATKSC  473



>ref|XP_010526229.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=507

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            VC ISL++NV+++ F++FD+N DG LS DEFLRVL +RE DI+ P  +G    +S   + 
Sbjct  437  VCDISLSDNVIEIAFYVFDSNRDGNLSVDEFLRVLHQRERDISQPVTRGLFQFMSGGPNG  496

Query  344  TKGC  333
            +K C
Sbjct  497  SKNC  500



>gb|EMS64759.1| Calcium uptake protein 1, mitochondrial [Triticum urartu]
Length=391

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVG  369
            VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G
Sbjct  331  VCGVDLTDKVVDVIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG  382



>ref|XP_009363920.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=495

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 3/62 (5%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS++ NV+D+IF +FD N DG LS++EF+RVLQRR  +     E G  G++SCW +
Sbjct  424  QVCGISVSTNVLDIIFHVFDANGDGDLSANEFVRVLQRRGGET---QETGIRGLLSCWFN  480

Query  347  CT  342
            C 
Sbjct  481  CA  482



>ref|XP_009126406.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Brassica 
rapa]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SL++NV+++ F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   +
Sbjct  427  QVCGVSLSDNVIEIAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWN  486

Query  347  CTKGCPS  327
             +  C S
Sbjct  487  GSNKCSS  493



>emb|CDX75217.1| BnaA01g04850D [Brassica napus]
Length=495

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SL++NV+++ F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   +
Sbjct  428  QVCGVSLSDNVIEIAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWN  487

Query  347  CTKGCPS  327
             +  C S
Sbjct  488  GSNKCSS  494



>emb|CDX68814.1| BnaC01g06390D [Brassica napus]
Length=494

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCG+SL++NV+++ F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   +
Sbjct  427  QVCGVSLSDNVIEIAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWN  486

Query  347  CTKGCPS  327
             +  C S
Sbjct  487  GSNKCSS  493



>gb|EMT19411.1| Calcium-binding atopy-related autoantigen 1 [Aegilops tauschii]
Length=514

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 3/59 (5%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            VCG+ LT+ VVD+IF +FD N+DG LSS+EFLR LQRRE DI  P  +G  G +  WL+
Sbjct  447  VCGVELTDRVVDIIFHVFDMNNDGHLSSEEFLRALQRREADIHQPAARG--GPMG-WLN  502



>ref|XP_008384887.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Malus 
domestica]
Length=495

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 3/62 (5%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS++ NV+D+IF LFD N DG LS++EF+RVLQ R  +     E G  G++SCW +
Sbjct  424  RVCGISVSTNVLDIIFHLFDANGDGDLSANEFVRVLQSRGGET---QETGIRGLLSCWFN  480

Query  347  CT  342
            C 
Sbjct  481  CA  482



>gb|KCW79049.1| hypothetical protein EUGRSUZ_C00479 [Eucalyptus grandis]
Length=231

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMI  363
            +VCGIS+T NVVD+IF LFD N DG LSS EF+R +QR E++ A   E G  G+I
Sbjct  160  QVCGISITSNVVDIIFHLFDANRDGNLSSKEFIRAVQRCESNGAQAREAGVKGLI  214



>ref|XP_009355791.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Pyrus 
x bretschneideri]
Length=472

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            VCG+SLT+NVV+++F LFD N DG LS DEF+RVLQ+R  DIA P E G +
Sbjct  418  VCGVSLTDNVVEIVFQLFDFNQDGNLSLDEFVRVLQQRGRDIAQPVETGIM  468



>ref|XP_011017911.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017912.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017913.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017914.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
Length=384

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +VCGIS+T ++VD+ F +F+ N DG LSSD+F+RVLQ RET      E G  G++SC  +
Sbjct  313  QVCGISITNDLVDITFHVFNANRDGNLSSDQFVRVLQGRETASWIAREPGLKGLMSCCAN  372

Query  347  CTKGCPS  327
            C K   S
Sbjct  373  CAKNYSS  379



>ref|XP_009362319.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=474

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            VCG+SLT+NVVD++F LFD N DG LS DEF+RVLQRR  D+A   E G +
Sbjct  420  VCGVSLTDNVVDIVFQLFDFNQDGSLSLDEFVRVLQRRGMDVAQQVETGIM  470



>ref|XP_010047215.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Eucalyptus 
grandis]
Length=492

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMI  363
            +VCGIS+T NVVD+IF LFD N DG LSS EF+R +QR E++ A   E G  G+I
Sbjct  421  QVCGISITSNVVDIIFHLFDANRDGNLSSKEFIRAVQRCESNGAQAREAGVKGLI  475



>ref|XP_010227186.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1 homolog, 
mitochondrial-like [Brachypodium distachyon]
Length=240

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPT  387
            VCG+ L++ VV++IF +FDTN DG LSS+EFLR +QRRE +I  PT
Sbjct  179  VCGVELSDRVVEVIFHVFDTNEDGNLSSEEFLRAVQRRENNIHQPT  224



>ref|XP_001763005.1| predicted protein [Physcomitrella patens]
 gb|EDQ72210.1| predicted protein [Physcomitrella patens]
Length=366

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            K+C   +++ VVD+IF +FDT+ DG+LS +EFL VLQ+RE ++  P++ G +  I C   
Sbjct  296  KICHTPISDAVVDVIFHIFDTDGDGVLSMEEFLSVLQQRERELIDPSDTGIIQFIKCLGK  355

Query  347  CTKGC  333
            C   C
Sbjct  356  CAGNC  360



>ref|XP_008394129.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Malus 
domestica]
Length=472

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            VCG+SLT+NVV+++F LFD N DG LS DEF+RVLQ+R  DIA   E G +
Sbjct  418  VCGVSLTDNVVEIVFQLFDFNQDGNLSLDEFVRVLQQRGRDIAQHVETGIM  468



>ref|XP_002531446.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF30933.1| calcium ion binding protein, putative [Ricinus communis]
Length=496

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETD  402
            +VCG+S+T N+VD+IF +FD + DG LSSDEF+ VLQRRE D
Sbjct  427  QVCGVSITNNLVDIIFHVFDDDRDGSLSSDEFISVLQRREKD  468



>ref|XP_007225509.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica]
 gb|EMJ26708.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica]
Length=1155

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            VCG+ LT+NVV++IF +FD+N DG LS  EF+RVL +R  DIA   + G +
Sbjct  408  VCGVCLTDNVVEIIFHVFDSNRDGNLSLAEFVRVLHQRGRDIAQHVDTGIM  458



>ref|XP_008219541.1| PREDICTED: calcium uptake protein 1, mitochondrial [Prunus mume]
Length=469

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            VCG+SLT+NVV++IF +FD+N DG LS  EF+RVL +R  DIA   + G +
Sbjct  416  VCGVSLTDNVVEIIFHVFDSNRDGNLSLAEFVRVLHQRGRDIAQHVDTGIM  466



>ref|XP_004291429.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=472

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  530  YKVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            + VC I+L++NVV++IF +FD+N DG LS DEF+ VL +R+ DIA   E G +
Sbjct  417  FHVCDIALSDNVVEIIFHVFDSNRDGHLSLDEFVTVLHQRQKDIAQHVETGIM  469



>gb|EPS61781.1| hypothetical protein M569_13012, partial [Genlisea aurea]
Length=349

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRE  408
            +VCGI +++ +VD++F++FD N DG LS DEF+RV+QRRE
Sbjct  309  QVCGIRVSDGLVDLVFYVFDENRDGSLSWDEFVRVMQRRE  348



>ref|XP_006852820.1| hypothetical protein AMTR_s00033p00176330 [Amborella trichopoda]
 gb|ERN14287.1| hypothetical protein AMTR_s00033p00176330 [Amborella trichopoda]
Length=391

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDI-AH  393
            VC + +TEN+VD++F +FD N DG LS DEFL  +QRRE DI AH
Sbjct  300  VCDVVVTENMVDVVFHVFDANRDGNLSIDEFLGAVQRRERDIVAH  344



>gb|EKC29672.1| Calcium-binding atopy-related autoantigen 1 [Crassostrea gigas]
Length=571

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V G+ L+++VV+++F LFD N DG LS+ EF+ V+++R    +  P + GF+ +I+    
Sbjct  501  VAGVKLSDHVVELVFTLFDENADGQLSNKEFVSVMKQRVMRGLEKPKDTGFIKLINSVFK  560

Query  347  CTKGCPSKIL  318
            C K   +  L
Sbjct  561  CAKNTTTAFL  570



>ref|XP_002595985.1| hypothetical protein BRAFLDRAFT_123729 [Branchiostoma floridae]
 gb|EEN51997.1| hypothetical protein BRAFLDRAFT_123729 [Branchiostoma floridae]
Length=488

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVL-QRRETDIAHPTEKGFVGMISCWLD  348
            V G+ L ++VV+++F LFD N DG LS+ EF+ ++ QR    +  P + GF  ++S  + 
Sbjct  421  VAGVELNDHVVEIVFKLFDENDDGELSNKEFVSIMKQRMMRGLEKPKDTGFTRLLSAMMK  480

Query  347  CTK  339
            CTK
Sbjct  481  CTK  483



>ref|XP_009171887.1| hypothetical protein T265_07952 [Opisthorchis viverrini]
 gb|KER24347.1| hypothetical protein T265_07952 [Opisthorchis viverrini]
Length=888

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  I L+ +VVD++F LFD N+DG LS  EF+ V++RR    +  P + GFV  +S    
Sbjct  371  VANIELSPHVVDVVFTLFDENNDGQLSYREFVGVMRRRLLRGLDKPMDTGFVRFVSALFK  430

Query  347  CTK  339
            CTK
Sbjct  431  CTK  433



>gb|EFX70917.1| hypothetical protein DAPPUDRAFT_202030 [Daphnia pulex]
Length=518

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 41/72 (57%), Gaps = 1/72 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L ++VV+++F +FD N DG LS+ EF+ V++ R    +  P + GF+ +I   L 
Sbjct  447  VAHVELVDHVVEVVFTIFDENQDGQLSNREFIAVMKNRMMRGLEKPKDTGFIKLIESSLK  506

Query  347  CTKGCPSKILHF  312
            C K     +L F
Sbjct  507  CAKQTRPALLDF  518



>ref|XP_005092984.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X4 [Aplysia californica]
Length=529

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L+++++D+IF LFD N+DG LS+ EF+ V++RR    +  P + GFV +I+  + 
Sbjct  460  VAFVDLSDHIIDVIFTLFDENNDGELSNKEFVSVMKRRVMRGLEKPKDTGFVKLINAMVK  519

Query  347  CT  342
            C 
Sbjct  520  CA  521



>ref|XP_005092981.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Aplysia californica]
 ref|XP_005092982.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Aplysia californica]
Length=536

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L+++++D+IF LFD N+DG LS+ EF+ V++RR    +  P + GFV +I+  + 
Sbjct  467  VAFVDLSDHIIDVIFTLFDENNDGELSNKEFVSVMKRRVMRGLEKPKDTGFVKLINAMVK  526

Query  347  CT  342
            C 
Sbjct  527  CA  528



>tpg|DAA56200.1| TPA: hypothetical protein ZEAMMB73_081691 [Zea mays]
Length=434

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  527  KVCGISLTENVVDMIFFLFDTNHDGILSSDEFLR  426
            KVCG+ LT+ VVD+IF +FD N DG LSS+EFLR
Sbjct  318  KVCGVDLTDKVVDIIFHVFDANCDGNLSSEEFLR  351



>ref|XP_005092983.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X3 [Aplysia californica]
Length=533

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L+++++D+IF LFD N+DG LS+ EF+ V++RR    +  P + GFV +I+  + 
Sbjct  464  VAFVDLSDHIIDVIFTLFDENNDGELSNKEFVSVMKRRVMRGLEKPKDTGFVKLINAMVK  523

Query  347  CT  342
            C 
Sbjct  524  CA  525



>ref|XP_002003229.1| GI23634 [Drosophila mojavensis]
 gb|EDW12671.1| GI23634 [Drosophila mojavensis]
Length=560

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++LT++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  489  VAMVNLTDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMVRSVFK  548

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  549  CAKETKPVLL  558



>ref|XP_003740151.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Metaseiulus occidentalis]
Length=463

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L ++VVD++F LFD N DG LS+ EF+ V++ R    +  P + GFV ++S +  
Sbjct  388  VAHVELRDHVVDVLFALFDENMDGQLSNKEFVSVMKERLHRGLEKPKDTGFVKLLSSFAK  447

Query  347  CTKGCPSK  324
            C    P K
Sbjct  448  C--AIPKK  453



>ref|XP_001660641.1| hypothetical protein AaeL_AAEL010116 [Aedes aegypti]
 gb|EAT37944.1| AAEL010116-PA [Aedes aegypti]
Length=536

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + LT++V+D++F +FD N DG LS+ EF+ V++ R    +  P + GFV ++   L 
Sbjct  457  VAMVELTDHVIDVVFTIFDENMDGQLSNREFVAVMKNRLLRGLEKPKDTGFVKLMHSILK  516

Query  347  CTKGCPSKILHF  312
            C K     +L F
Sbjct  517  CAKDTKPVLLDF  528



>ref|XP_002405421.1| conserved hypothetical protein [Ixodes scapularis]
 gb|EEC15270.1| conserved hypothetical protein [Ixodes scapularis]
Length=439

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  + L + V+D+IF LFD N DG LS+ EF+ V++ R    +  P + GFV +I+  + 
Sbjct  368  VAHVDLRDYVIDVIFTLFDENMDGQLSNKEFVSVMKERLHRGLEKPKDTGFVKLINSAVK  427

Query  347  CTK  339
            C K
Sbjct  428  CAK  430



>ref|XP_009045382.1| hypothetical protein LOTGIDRAFT_110115, partial [Lottia gigantea]
 gb|ESP03900.1| hypothetical protein LOTGIDRAFT_110115, partial [Lottia gigantea]
Length=403

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVL-QRRETDIAHPTEKGFVGMISCWLD  348
            V  + L++ V+D++F LFD N+DG LS  EF+ V+ QR    +  P + GF+ +I+    
Sbjct  333  VAQVELSDYVIDIVFTLFDENNDGELSDKEFVSVMKQRLLRGLEKPKDTGFIKLINAIGK  392

Query  347  CTKGCPSKILH  315
            C K   S  L 
Sbjct  393  CAKNQTSLFLE  403



>ref|XP_002132495.1| GA27717 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY69897.1| GA27717 [Drosophila pseudoobscura pseudoobscura]
Length=331

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  260  VALVNLSDHVVDVVFIIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  319

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  320  CAKETKPVLL  329



>ref|NP_001097110.1| CG4495, isoform B [Drosophila melanogaster]
 sp|A2VEI2.1|MICU1_DROME RecName: Full=Calcium uptake protein 1 homolog, mitochondrial 
[Drosophila melanogaster]
 gb|ABN49290.1| IP17639p [Drosophila melanogaster]
 gb|ABV53641.1| CG4495, isoform B [Drosophila melanogaster]
Length=525

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  454  VAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  513

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  514  CAKETKPVLL  523



>ref|XP_002078478.1| GD23455 [Drosophila simulans]
 gb|EDX04063.1| GD23455 [Drosophila simulans]
Length=510

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  439  VAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  498

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  499  CAKETKPVLL  508



>ref|NP_609100.1| CG4495, isoform A [Drosophila melanogaster]
 gb|AAF52489.1| CG4495, isoform A [Drosophila melanogaster]
 gb|AAK93419.1| LD46238p [Drosophila melanogaster]
Length=524

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  453  VAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  512

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  513  CAKETKPVLL  522



>ref|XP_002088070.1| GE14428 [Drosophila yakuba]
 gb|EDW87782.1| GE14428 [Drosophila yakuba]
Length=525

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  454  VAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  513

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  514  CAKETKPVLL  523



>ref|XP_001970127.1| GG10463 [Drosophila erecta]
 gb|EDV59186.1| GG10463 [Drosophila erecta]
Length=522

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  ++L+++VVD++F +FD N+D  LS+ EF+ V++ R +  +  P + GF+ M+     
Sbjct  451  VAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK  510

Query  347  CTKGCPSKIL  318
            C K     +L
Sbjct  511  CAKETKPVLL  520



>emb|CAX74039.1| EF-hand domain-containing family member A2 [Schistosoma japonicum]
Length=186

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 1/63 (2%)
 Frame = -3

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLD  348
            V  I L+ +V+D++F LFD N+DG LS  EF+ V++ R    +  P + GF+ ++S    
Sbjct  110  VANIHLSPHVLDVVFTLFDENNDGQLSYREFVGVMRHRLLRGLDKPMDTGFIRLLSALFH  169

Query  347  CTK  339
            C K
Sbjct  170  CAK  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 789084978192