BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20401_g1_i3 len=848 path=[594:0-108 4384:109-145 @740@!:146-523
2961:524-823 4254:824-847]

Length=848
                                                                      Score     E

gb|EYU38319.1|  hypothetical protein MIMGU_mgv1a005763mg                255   1e-77   
ref|XP_011084065.1|  PREDICTED: calcium uptake protein 1, mitocho...    254   3e-77   
emb|CBI25571.3|  unnamed protein product                                241   8e-74   
ref|XP_009415582.1|  PREDICTED: calcium uptake protein 1 homolog,...    244   2e-73   
emb|CDP10495.1|  unnamed protein product                                239   8e-73   
ref|XP_002266120.1|  PREDICTED: calcium uptake protein 1, mitocho...    242   2e-72   Vitis vinifera
ref|XP_010687823.1|  PREDICTED: calcium uptake protein 1 homolog,...    238   4e-72   
ref|XP_010244879.1|  PREDICTED: calcium uptake protein 1, mitocho...    240   1e-71   
ref|XP_007011794.1|  Calcium ion binding protein, putative isoform 1    238   5e-71   
ref|XP_010907508.1|  PREDICTED: calcium uptake protein 1 homolog,...    236   1e-70   
ref|XP_010907507.1|  PREDICTED: calcium uptake protein 1 homolog,...    236   3e-70   
ref|XP_008775755.1|  PREDICTED: calcium uptake protein 1 homolog,...    231   1e-69   
gb|KHG19522.1|  Calcium uptake 1, mitochondrial                         234   1e-69   
gb|KHG08195.1|  Calcium uptake 1, mitochondrial                         233   4e-69   
ref|XP_008775754.1|  PREDICTED: calcium uptake protein 1 homolog,...    231   2e-68   
gb|KEH39843.1|  calcium-binding EF hand protein                         229   7e-68   
ref|XP_002324884.1|  hypothetical protein POPTR_0018s02130g             228   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006367412.1|  PREDICTED: calcium uptake protein 1, mitocho...    227   6e-67   
ref|XP_009626825.1|  PREDICTED: calcium uptake protein 1 homolog,...    226   6e-67   
ref|XP_010913360.1|  PREDICTED: calcium uptake protein 1, mitocho...    225   2e-66   
ref|XP_010913359.1|  PREDICTED: calcium uptake protein 1, mitocho...    225   3e-66   
ref|XP_006450355.1|  hypothetical protein CICLE_v10008054mg             221   3e-66   
ref|XP_010913358.1|  PREDICTED: calcium uptake protein 1, mitocho...    225   3e-66   
dbj|BAD19699.1|  putative calcium binding atopy-related autoantig...    219   4e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099864.1|  Calcium uptake protein 1                           225   6e-66   
gb|KCW81354.1|  hypothetical protein EUGRSUZ_C02735                     219   1e-65   
gb|KDO59309.1|  hypothetical protein CISIN_1g042758mg                   220   2e-65   
ref|XP_003549296.1|  PREDICTED: calcium uptake protein 1, mitocho...    223   3e-65   
gb|KHN48538.1|  Calcium uptake protein 1, mitochondrial                 223   3e-65   
gb|KDP33558.1|  hypothetical protein JCGZ_07129                         223   4e-65   
ref|XP_011036617.1|  PREDICTED: calcium uptake protein 1 homolog,...    223   4e-65   
ref|XP_009766649.1|  PREDICTED: calcium uptake protein 1, mitocho...    222   5e-65   
gb|KHN02022.1|  EF-hand domain-containing family member A2              213   7e-65   
dbj|BAK07466.1|  predicted protein                                      222   9e-65   
gb|KCW81353.1|  hypothetical protein EUGRSUZ_C02735                     218   1e-64   
ref|XP_004498756.1|  PREDICTED: calcium uptake protein 1, mitocho...    221   1e-64   
ref|XP_004498755.1|  PREDICTED: calcium uptake protein 1, mitocho...    221   1e-64   
ref|XP_002515470.1|  calcium ion binding protein, putative              222   2e-64   Ricinus communis
ref|XP_010250313.1|  PREDICTED: calcium uptake protein 1, mitocho...    222   2e-64   
ref|XP_006474603.1|  PREDICTED: calcium uptake protein 1, mitocho...    222   2e-64   
ref|XP_009782522.1|  PREDICTED: calcium uptake protein 1 homolog,...    220   2e-64   
ref|XP_009405764.1|  PREDICTED: calcium uptake protein 1, mitocho...    220   2e-64   
gb|KDO61821.1|  hypothetical protein CISIN_1g010530mg                   221   2e-64   
ref|XP_007155096.1|  hypothetical protein PHAVU_003G172800g             220   2e-64   
gb|KDO61820.1|  hypothetical protein CISIN_1g010530mg                   221   2e-64   
ref|XP_006450361.1|  hypothetical protein CICLE_v10008054mg             221   3e-64   
ref|XP_006648832.1|  PREDICTED: calcium uptake protein 1 homolog,...    218   3e-64   
emb|CDP18812.1|  unnamed protein product                                220   4e-64   
ref|XP_006596683.1|  PREDICTED: calcium uptake protein 1, mitocho...    213   4e-64   
tpg|DAA37068.1|  TPA: hypothetical protein ZEAMMB73_919529              214   4e-64   
ref|XP_006453731.1|  hypothetical protein CICLE_v10010671mg             220   5e-64   
ref|XP_004240684.1|  PREDICTED: calcium uptake protein 1, mitocho...    219   5e-64   
ref|XP_011081511.1|  PREDICTED: calcium uptake protein 1, mitocho...    219   6e-64   
ref|XP_003572710.2|  PREDICTED: calcium uptake protein 1 homolog,...    219   6e-64   
ref|XP_009355791.1|  PREDICTED: calcium uptake protein 1 homolog,...    219   9e-64   
ref|XP_004159433.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...    219   1e-63   
ref|XP_004139397.1|  PREDICTED: calcium uptake protein 1, mitocho...    219   1e-63   
gb|EEE57362.1|  hypothetical protein OsJ_07508                          218   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KHN08156.1|  Calcium uptake protein 1, mitochondrial                 216   1e-63   
gb|EEC73584.1|  hypothetical protein OsI_08048                          218   1e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001047417.1|  Os02g0613000                                       218   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77583.1|  hypothetical protein OsI_16535                          217   3e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001053237.1|  Os04g0502900                                       217   3e-63   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67586.1|  OSIGBa0112M24.3                                        217   3e-63   Oryza sativa [red rice]
ref|XP_004976137.1|  PREDICTED: calcium uptake protein 1 homolog,...    213   4e-63   
ref|XP_006653576.1|  PREDICTED: calcium uptake protein 1 homolog,...    215   4e-63   
ref|XP_007161189.1|  hypothetical protein PHAVU_001G049500g             216   8e-63   
gb|KHN15019.1|  Calcium uptake protein 1, mitochondrial                 215   1e-62   
ref|XP_006365836.1|  PREDICTED: calcium uptake protein 1, mitocho...    215   1e-62   
ref|XP_008456571.1|  PREDICTED: calcium uptake protein 1, mitocho...    216   1e-62   
ref|XP_008668321.1|  PREDICTED: hypothetical protein isoform X2         214   2e-62   
ref|XP_008394129.1|  PREDICTED: calcium uptake protein 1 homolog,...    215   2e-62   
gb|KFK29820.1|  hypothetical protein AALP_AA7G183100                    208   2e-62   
ref|XP_003609483.1|  Calcium binding atopy-related autoantigen          215   3e-62   
ref|XP_010051173.1|  PREDICTED: calcium uptake protein 1, mitocho...    218   3e-62   
ref|XP_006594263.1|  PREDICTED: calcium uptake protein 1, mitocho...    214   3e-62   
gb|KHN07054.1|  Calcium uptake protein 1, mitochondrial                 214   4e-62   
ref|XP_008668320.1|  PREDICTED: hypothetical protein isoform X1         214   4e-62   
ref|XP_006581342.1|  PREDICTED: calcium uptake protein 1, mitocho...    214   4e-62   
gb|KHN47123.1|  Calcium uptake protein 1, mitochondrial                 214   5e-62   
ref|NP_001142200.1|  uncharacterized protein LOC100274368               207   5e-62   Zea mays [maize]
ref|XP_006594262.1|  PREDICTED: calcium uptake protein 1, mitocho...    214   6e-62   
ref|XP_009362319.1|  PREDICTED: calcium uptake protein 1, mitocho...    214   6e-62   
ref|XP_007013634.1|  Calcium-binding EF hand family protein             214   8e-62   
ref|XP_009626826.1|  PREDICTED: calcium uptake protein 1, mitocho...    212   1e-61   
ref|XP_009614691.1|  PREDICTED: calcium uptake protein 1, mitocho...    213   1e-61   
ref|XP_007136990.1|  hypothetical protein PHAVU_009G091000g             213   1e-61   
ref|XP_006578131.1|  PREDICTED: calcium uptake protein 1, mitocho...    211   2e-61   
ref|XP_010665654.1|  PREDICTED: calcium uptake protein 1 homolog,...    213   2e-61   
ref|XP_010665651.1|  PREDICTED: calcium uptake protein 1 homolog,...    213   2e-61   
ref|XP_010648727.1|  PREDICTED: calcium uptake protein 3, mitocho...    204   4e-61   
ref|XP_004508411.1|  PREDICTED: calcium uptake protein 1 homolog,...    211   6e-61   
ref|XP_007201997.1|  hypothetical protein PRUPE_ppa024920mg             208   9e-61   
ref|XP_006412519.1|  hypothetical protein EUTSA_v10024993mg             211   2e-60   
gb|KCW79049.1|  hypothetical protein EUGRSUZ_C00479                     203   2e-60   
ref|XP_004953089.1|  PREDICTED: calcium uptake protein 1 homolog,...    209   4e-60   
ref|XP_010526229.1|  PREDICTED: calcium uptake protein 1, mitocho...    209   7e-60   
ref|NP_194934.1|  EF-hand, calcium binding motif-containing protein     209   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219541.1|  PREDICTED: calcium uptake protein 1, mitocho...    208   8e-60   
ref|XP_003603344.1|  Calcium binding atopy-related autoantigen          208   1e-59   
ref|XP_008661648.1|  PREDICTED: uncharacterized protein LOC100274...    207   1e-59   
ref|XP_008452897.1|  PREDICTED: calcium uptake protein 1, mitocho...    207   1e-59   
ref|NP_001147122.1|  calcium binding atopy-related autoantigen 1        207   2e-59   Zea mays [maize]
ref|XP_010437956.1|  PREDICTED: calcium uptake protein 1 homolog,...    207   2e-59   
gb|AES73595.2|  calcium-binding EF hand protein                         207   2e-59   
ref|XP_010447444.1|  PREDICTED: calcium uptake protein 1 homolog,...    207   2e-59   
ref|XP_006283595.1|  hypothetical protein CARUB_v10004651mg             207   3e-59   
ref|XP_009126406.1|  PREDICTED: calcium uptake protein 1 homolog,...    207   3e-59   
ref|XP_006852820.1|  hypothetical protein AMTR_s00033p00176330          205   3e-59   
emb|CDX75217.1|  BnaA01g04850D                                          207   3e-59   
ref|XP_009782530.1|  PREDICTED: calcium uptake protein 1, mitocho...    206   4e-59   
emb|CDX68814.1|  BnaC01g06390D                                          207   4e-59   
ref|XP_011017911.1|  PREDICTED: calcium uptake protein 1 homolog,...    204   4e-59   
gb|KFK29821.1|  hypothetical protein AALP_AA7G183100                    207   4e-59   
gb|EMT14850.1|  Calcium-binding atopy-related autoantigen 1             204   7e-59   
ref|XP_002531446.1|  calcium ion binding protein, putative              206   7e-59   Ricinus communis
ref|XP_010432776.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...    206   7e-59   
gb|EMS64759.1|  Calcium uptake protein 1, mitochondrial                 203   1e-58   
ref|XP_004145522.1|  PREDICTED: calcium uptake protein 1, mitocho...    205   1e-58   
ref|XP_002869294.1|  calcium-binding EF hand family protein             206   1e-58   
ref|XP_010648725.1|  PREDICTED: calcium uptake protein 1, mitocho...    202   2e-58   
ref|XP_004231518.1|  PREDICTED: calcium uptake protein 1, mitocho...    202   6e-58   
ref|XP_007225509.1|  hypothetical protein PRUPE_ppa000461mg             210   1e-57   
ref|XP_003631765.1|  PREDICTED: calcium uptake protein 1, mitocho...    202   2e-57   
ref|XP_008456564.1|  PREDICTED: calcium uptake protein 1, mitocho...    202   5e-57   
gb|EYU20233.1|  hypothetical protein MIMGU_mgv1a005202mg                201   5e-57   
ref|XP_009405765.1|  PREDICTED: calcium uptake protein 1, mitocho...    201   6e-57   
emb|CBI21113.3|  unnamed protein product                                206   1e-56   
ref|XP_010047215.1|  PREDICTED: calcium uptake protein 1, mitocho...    200   1e-56   
ref|XP_008242922.1|  PREDICTED: calcium uptake protein 1, mitocho...    201   1e-56   
emb|CAE02932.3|  OSJNBa0014K14.4                                        202   2e-56   Oryza sativa [red rice]
gb|EMS49497.1|  Calcium uptake protein 1, mitochondrial                 197   4e-56   
ref|XP_010240086.1|  PREDICTED: calcium uptake protein 1 homolog,...    198   5e-56   
ref|XP_008645921.1|  PREDICTED: calcium uptake protein 1, mitocho...    197   8e-56   
ref|XP_004288762.1|  PREDICTED: calcium uptake protein 1, mitocho...    197   1e-55   
ref|XP_004291429.1|  PREDICTED: calcium uptake protein 1, mitocho...    197   1e-55   
ref|XP_006389387.1|  hypothetical protein POPTR_0025s00230g             187   2e-55   
ref|XP_006389396.1|  hypothetical protein POPTR_0025s00330g             191   1e-54   
ref|XP_002970263.1|  hypothetical protein SELMODRAFT_231573             192   3e-54   
ref|XP_002452439.1|  hypothetical protein SORBIDRAFT_04g025880          193   5e-54   Sorghum bicolor [broomcorn]
ref|XP_009363920.1|  PREDICTED: calcium uptake protein 1, mitocho...    191   3e-53   
gb|EPS61781.1|  hypothetical protein M569_13012                         188   3e-53   
ref|XP_008384887.1|  PREDICTED: calcium uptake protein 1, mitocho...    189   3e-52   
ref|XP_010227186.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...    182   4e-52   
gb|EMT19411.1|  Calcium-binding atopy-related autoantigen 1             188   6e-52   
ref|XP_002978421.1|  hypothetical protein SELMODRAFT_108925             176   1e-48   
ref|XP_001783961.1|  predicted protein                                  174   1e-47   
ref|XP_001763005.1|  predicted protein                                  166   1e-44   
ref|XP_007011795.1|  Calcium ion binding protein, putative isoform 2    157   5e-41   
ref|XP_010913361.1|  PREDICTED: calcium uptake protein 1, mitocho...    150   2e-38   
ref|XP_006450363.1|  hypothetical protein CICLE_v10008054mg             149   5e-38   
gb|AGV54724.1|  calcium uptake protein 1 mitochondrial-like protein     149   8e-38   
dbj|BAH56953.1|  AT4G32060                                              141   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54279.1|  calcium ion binding protein                             147   1e-36   
ref|XP_011036618.1|  PREDICTED: calcium uptake protein 1, mitocho...    142   1e-35   
ref|XP_010527118.1|  PREDICTED: calcium uptake protein 1, mitocho...    141   5e-35   
gb|AFW58785.1|  hypothetical protein ZEAMMB73_183509                    133   5e-35   
ref|NP_001078476.1|  EF-hand, calcium binding motif-containing pr...    139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437957.1|  PREDICTED: calcium uptake protein 1, mitocho...    139   3e-34   
ref|XP_010447445.1|  PREDICTED: calcium uptake protein 1, mitocho...    139   4e-34   
gb|KEH35912.1|  calcium-binding EF hand protein                         129   1e-30   
ref|XP_001702338.1|  hypothetical protein CHLREDRAFT_194638             100   9e-21   Chlamydomonas reinhardtii
ref|XP_005642848.1|  putative calcium binding atopy-related autoa...  95.1    2e-19   
ref|XP_005643147.1|  hypothetical protein COCSUDRAFT_20509            95.1    4e-19   
tpg|DAA49669.1|  TPA: hypothetical protein ZEAMMB73_737328            93.6    8e-19   
ref|XP_002947888.1|  hypothetical protein VOLCADRAFT_103668           92.0    1e-17   
ref|XP_010913362.1|  PREDICTED: calcium uptake protein 1, mitocho...  90.5    1e-17   
ref|XP_004341831.1|  Calciumbinding atopy-related autoantigen 1, ...  87.0    2e-16   
ref|XP_637081.1|  hypothetical protein DDB_G0287825                   85.9    1e-15   Dictyostelium discoideum AX4
ref|XP_005847618.1|  hypothetical protein CHLNCDRAFT_133931           83.6    5e-15   
dbj|BAJ95051.1|  predicted protein                                    79.0    6e-14   
dbj|GAM19553.1|  hypothetical protein SAMD00019534_027280             80.9    6e-14   
ref|XP_003056146.1|  predicted protein                                80.9    7e-14   
ref|XP_004351464.1|  putative protein serine/threonine kinase         81.6    7e-14   
ref|XP_001415872.1|  predicted protein                                78.2    9e-14   Ostreococcus lucimarinus CCE9901
gb|EFA81158.1|  hypothetical protein PPL_05995                        80.1    1e-13   Polysphondylium pallidum PN500
gb|EKC29672.1|  Calcium-binding atopy-related autoantigen 1           79.3    3e-13   
ref|XP_003074381.1|  Ca2+ binding protein, contains EF-hand motif...  78.2    6e-13   
ref|XP_002507300.1|  predicted protein                                77.0    7e-13   Micromonas commoda
ref|XP_003293670.1|  hypothetical protein DICPUDRAFT_158565           74.7    7e-12   
ref|XP_002595985.1|  hypothetical protein BRAFLDRAFT_123729           74.3    1e-11   Branchiostoma floridae
ref|XP_006000149.1|  PREDICTED: calcium uptake protein 3, mitocho...  73.6    2e-11   
ref|XP_008302681.1|  PREDICTED: calcium uptake protein 3, mitocho...  72.4    4e-11   
ref|XP_010886756.1|  PREDICTED: calcium uptake protein 3, mitocho...  72.0    6e-11   
gb|ERL87561.1|  hypothetical protein D910_04952                       70.1    6e-11   
gb|ENN74748.1|  hypothetical protein YQE_08686                        70.1    6e-11   
ref|XP_009822342.1|  hypothetical protein, variant 2                  71.6    8e-11   
ref|XP_004364554.1|  Cbara1 protein                                   71.6    8e-11   
ref|XP_006388376.1|  hypothetical protein POPTR_0204s00230g           66.6    1e-10   
ref|XP_008315732.1|  PREDICTED: calcium uptake protein 3, mitocho...  70.9    2e-10   
ref|XP_008315733.1|  PREDICTED: calcium uptake protein 3, mitocho...  70.9    2e-10   
ref|XP_002157845.2|  PREDICTED: calcium uptake protein 1, mitocho...  70.5    2e-10   
ref|XP_009028818.1|  hypothetical protein HELRODRAFT_69384            69.7    3e-10   
gb|EFA10933.1|  hypothetical protein TcasGA2_TC001761                 69.7    4e-10   
ref|XP_003219318.2|  PREDICTED: calcium uptake protein 2, mitocho...  69.7    4e-10   
gb|KDO31970.1|  hypothetical protein SPRG_03186                       69.3    4e-10   
ref|XP_008106201.1|  PREDICTED: calcium uptake protein 2, mitocho...  69.3    4e-10   
ref|XP_008606834.1|  hypothetical protein SDRG_02998                  69.3    5e-10   
ref|XP_008199062.1|  PREDICTED: calcium uptake protein 3, mitocho...  69.3    6e-10   
ref|XP_006630179.1|  PREDICTED: calcium uptake protein 3, mitocho...  69.3    6e-10   
ref|XP_970272.2|  PREDICTED: calcium uptake protein 3, mitochondr...  68.9    6e-10   Tribolium castaneum [rust-red flour beetle]
gb|ETE64089.1|  EF-hand domain-containing family member A1            67.0    6e-10   
ref|XP_005931336.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.9    7e-10   
ref|XP_005931335.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.9    7e-10   
ref|XP_005931333.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.9    7e-10   
ref|XP_004911250.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    9e-10   
ref|XP_008412314.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    9e-10   
ref|XP_008412060.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_008411976.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_007567712.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_008411808.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_007567709.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_007567715.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_008411723.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.6    1e-09   
ref|XP_009840494.1|  hypothetical protein H257_14397                  68.2    1e-09   
ref|XP_008412562.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_005066565.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
gb|EMP36426.1|  EF-hand domain-containing family member A1            65.5    1e-09   
gb|ELT97656.1|  hypothetical protein CAPTEDRAFT_174710                68.2    1e-09   
ref|XP_010896340.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.8    1e-09   
ref|XP_007898850.1|  PREDICTED: calcium uptake protein 2, mitocho...  68.2    1e-09   
ref|XP_010896332.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_010896324.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_008412475.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_010896318.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_010896309.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_008059398.1|  PREDICTED: calcium uptake protein 3, mitocho...  68.2    1e-09   
ref|XP_008475222.1|  PREDICTED: uncharacterized protein LOC103512249  68.2    1e-09   
gb|AAH91318.1|  Efha2 protein                                         66.6    2e-09   Rattus norvegicus [brown rat]
gb|EGV99934.1|  EF-hand domain-containing family member A2            67.0    2e-09   
ref|XP_003972622.1|  PREDICTED: EF-hand domain-containing family ...  67.8    2e-09   
ref|XP_007554802.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.8    2e-09   
ref|XP_006790880.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.8    2e-09   
ref|XP_007554803.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.8    2e-09   
ref|XP_007554804.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_004539228.1|  PREDICTED: EF-hand domain-containing family ...  67.4    2e-09   
ref|XP_006790878.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_004539227.1|  PREDICTED: EF-hand domain-containing family ...  67.4    2e-09   
ref|XP_004539229.1|  PREDICTED: EF-hand domain-containing family ...  67.4    2e-09   
ref|XP_006790879.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_006790877.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_005454830.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_005931334.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
ref|XP_003772875.1|  PREDICTED: EF-hand domain-containing family ...  67.4    2e-09   
ref|XP_004539226.1|  PREDICTED: EF-hand domain-containing family ...  67.4    2e-09   
ref|XP_005743667.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    2e-09   
gb|ELK08864.1|  EF-hand domain-containing family member A2            67.0    2e-09   
ref|XP_006744914.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    3e-09   
ref|XP_007258737.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.4    3e-09   
ref|XP_006509586.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_010727412.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.1    3e-09   
ref|XP_009822339.1|  hypothetical protein, variant 3                  67.0    3e-09   
ref|XP_007567713.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_004672651.1|  PREDICTED: EF-hand domain-containing family ...  67.0    3e-09   
ref|XP_008411894.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_005806572.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_008412393.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_007567711.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_007953145.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    3e-09   
ref|XP_009305682.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_007567710.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_005330851.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
ref|XP_009305683.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
gb|AAI45174.1|  Efha2 protein                                         66.6    3e-09   Mus musculus [mouse]
ref|XP_009305663.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    3e-09   
gb|AAI25420.1|  Efha2 protein                                         66.6    3e-09   Mus musculus [mouse]
ref|XP_006820556.1|  PREDICTED: calcium uptake protein 1, mitocho...  66.6    3e-09   
ref|XP_009305673.1|  PREDICTED: calcium uptake protein 3, mitocho...  67.0    4e-09   
ref|XP_010733364.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_008412228.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_009305679.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_008412145.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_009305672.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_009305681.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_009305665.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
gb|EDL78811.1|  EF hand domain family, member A2                      66.6    4e-09   
ref|XP_010168578.1|  PREDICTED: calcium uptake protein 2, mitocho...  66.2    4e-09   
gb|KFZ60459.1|  hypothetical protein N321_14328                       65.9    4e-09   
ref|XP_004452144.1|  PREDICTED: EF-hand domain-containing family ...  66.6    4e-09   
gb|EHB05560.1|  EF-hand domain-containing family member A2            66.6    4e-09   
ref|XP_010733380.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_006563213.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  66.6    4e-09   
gb|EFB28585.1|  hypothetical protein PANDA_013067                     66.6    4e-09   
ref|XP_005969128.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_010764883.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_010764882.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_006138989.1|  PREDICTED: calcium uptake protein 2, mitocho...  66.2    4e-09   
ref|XP_001655235.1|  hypothetical protein AaeL_AAEL011306             66.2    4e-09   
gb|EHH28301.1|  EF-hand domain-containing family member A2            66.2    4e-09   
ref|XP_005887466.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_010733372.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
gb|ERE89145.1|  EF-hand domain-containing family member A2            66.6    4e-09   
ref|XP_007612543.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
gb|KFO14873.1|  hypothetical protein N312_13292                       64.7    4e-09   
ref|XP_008181329.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_005698908.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_010308839.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    4e-09   
ref|XP_003243357.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    4e-09   
ref|XP_008181330.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    5e-09   
ref|XP_004073627.1|  PREDICTED: EF-hand domain-containing family ...  66.6    5e-09   
ref|XP_001950061.2|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    5e-09   
ref|XP_007516340.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.6    5e-09   
ref|XP_002923844.1|  PREDICTED: EF-hand domain-containing family ...  66.2    5e-09   
ref|XP_010620106.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_004021901.1|  PREDICTED: EF-hand domain-containing family ...  66.2    5e-09   
ref|XP_007890982.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_005460537.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
gb|ELR62476.1|  EF-hand domain-containing family member A2            66.2    5e-09   
ref|XP_010372788.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_009045382.1|  hypothetical protein LOTGIDRAFT_110115           66.2    5e-09   
ref|XP_007890985.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_005460535.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_009210831.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_007099081.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_004318851.1|  PREDICTED: EF-hand domain-containing family ...  66.2    5e-09   
gb|EHH64006.1|  EF-hand domain-containing family member A2            66.2    5e-09   
ref|XP_007890983.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_003704684.1|  PREDICTED: EF-hand domain-containing family ...  66.2    5e-09   
ref|XP_005092981.1|  PREDICTED: calcium uptake protein 1 homolog,...  66.2    5e-09   
ref|XP_006753863.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_007890984.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    5e-09   
ref|XP_005092983.1|  PREDICTED: calcium uptake protein 1 homolog,...  66.2    5e-09   
ref|XP_009811603.1|  PREDICTED: calcium uptake protein 2, mitocho...  66.2    6e-09   
ref|XP_005810991.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    6e-09   
gb|EHJ75402.1|  hypothetical protein KGM_03597                        65.9    6e-09   
ref|XP_005460536.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    6e-09   
ref|XP_005092984.1|  PREDICTED: calcium uptake protein 1 homolog,...  66.2    6e-09   
ref|XP_005864159.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    6e-09   
ref|XP_010856700.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    6e-09   
gb|KFV54458.1|  hypothetical protein N328_08797                       65.9    6e-09   
ref|XP_003455846.1|  PREDICTED: calcium uptake protein 3, mitocho...  66.2    6e-09   
ref|XP_008417920.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    6e-09   
ref|XP_005516815.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.9    6e-09   
gb|KFB35411.1|  AGAP004179-PA-like protein                            66.2    6e-09   
ref|XP_417140.4|  PREDICTED: EF-hand domain-containing family mem...  66.2    6e-09   
ref|XP_009693819.1|  PREDICTED: calcium uptake protein 2, mitocho...  63.9    6e-09   
gb|EMC80457.1|  EF-hand domain-containing family member A1            65.9    6e-09   
gb|KFP62709.1|  hypothetical protein N322_10382                       63.9    6e-09   
ref|XP_313067.5|  AGAP004179-PA                                       66.2    6e-09   
ref|XP_007062757.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    6e-09   
ref|XP_004794315.1|  PREDICTED: EF-hand domain-containing family ...  65.9    7e-09   
ref|XP_008877050.1|  hypothetical protein, variant 1                  65.9    7e-09   
ref|XP_005175455.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    7e-09   
ref|XP_010708438.1|  PREDICTED: calcium uptake protein 3, mitocho...  63.9    7e-09   
ref|XP_008877052.1|  hypothetical protein, variant 2                  65.9    7e-09   
ref|XP_005501566.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.9    7e-09   
ref|XP_008877053.1|  hypothetical protein H310_11947                  65.9    7e-09   
ref|XP_003436734.1|  AGAP004179-PC                                    65.9    7e-09   
ref|XP_006916548.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    7e-09   
ref|XP_007430667.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.9    7e-09   
ref|XP_006192949.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    7e-09   
gb|KFV16390.1|  hypothetical protein N340_04616                       63.9    8e-09   
gb|KFO99378.1|  hypothetical protein N300_04148                       65.9    8e-09   
ref|XP_005398522.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
ref|XP_008877051.1|  hypothetical protein, variant 3                  65.9    8e-09   
ref|XP_009982603.1|  PREDICTED: calcium uptake protein 2, mitocho...  63.9    8e-09   
ref|XP_005362595.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
ref|XP_004888834.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
gb|KDO33285.1|  hypothetical protein SPRG_02094                       65.9    8e-09   
ref|XP_003399648.1|  PREDICTED: EF-hand domain-containing family ...  65.9    8e-09   
ref|XP_008417919.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
ref|XP_007109970.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
gb|KFZ67394.1|  hypothetical protein N338_00760                       65.5    8e-09   
ref|XP_008417917.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
ref|XP_008417918.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    8e-09   
ref|XP_004610382.1|  PREDICTED: EF-hand domain-containing family ...  65.9    9e-09   
ref|XP_006930657.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    9e-09   
ref|XP_004633112.1|  PREDICTED: EF-hand domain-containing family ...  65.9    9e-09   
ref|XP_008527379.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    9e-09   
ref|XP_003399649.1|  PREDICTED: EF-hand domain-containing family ...  65.5    9e-09   
ref|XP_002709559.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.9    9e-09   
ref|XP_009275713.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    9e-09   
ref|XP_007059178.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.5    9e-09   
ref|XP_009241830.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    9e-09   
ref|XP_008109921.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_003469192.2|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_004597901.1|  PREDICTED: EF-hand domain-containing family ...  65.5    1e-08   
ref|XP_008842742.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_008568762.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_008109922.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005916638.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_003902508.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_004911251.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005304432.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.5    1e-08   
ref|XP_006198093.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005562711.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005562710.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005916636.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_004853146.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_009210826.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_008249419.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005304433.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.1    1e-08   
ref|XP_004409577.1|  PREDICTED: EF-hand domain-containing family ...  65.5    1e-08   
ref|XP_006509585.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_001094797.1|  PREDICTED: EF-hand domain-containing family ...  65.5    1e-08   
ref|XP_006253264.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|NP_084386.1|  calcium uptake protein 3, mitochondrial             65.5    1e-08   
ref|NP_001193026.1|  calcium uptake protein 3, mitochondrial          65.5    1e-08   
ref|XP_006149772.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_001843108.1|  conserved hypothetical protein                   65.1    1e-08   
ref|XP_006974032.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_002756950.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_003399647.1|  PREDICTED: EF-hand domain-containing family ...  65.5    1e-08   
ref|XP_006253262.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005226046.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_008769515.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_004428849.1|  PREDICTED: EF-hand domain-containing family ...  65.5    1e-08   
ref|XP_009664173.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_010708437.1|  PREDICTED: calcium uptake protein 3, mitocho...  63.9    1e-08   
ref|NP_001178821.1|  calcium uptake protein 3, mitochondrial          65.5    1e-08   
ref|XP_009210830.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
gb|KFW74170.1|  hypothetical protein N305_14569                       64.7    1e-08   
ref|XP_008977485.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_009478196.1|  PREDICTED: calcium uptake protein 3, mitocho...  63.9    1e-08   
ref|XP_006893617.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005562712.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005562713.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_008977483.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_009289442.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_010708436.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.3    1e-08   
ref|XP_008938045.1|  PREDICTED: calcium uptake protein 3, mitocho...  62.8    1e-08   
ref|XP_007959917.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_007959914.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_010994044.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_007959915.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_005226048.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_006974033.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_009210829.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_007607013.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.5    1e-08   
ref|XP_006610814.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  65.1    1e-08   
ref|XP_006781871.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_009210828.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_010344392.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_004563277.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
ref|XP_006097487.1|  PREDICTED: LOW QUALITY PROTEIN: calcium upta...  65.1    1e-08   
ref|XP_005273535.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_005157308.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_009289441.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_007959918.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_003797701.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
gb|KFW94785.1|  hypothetical protein N336_04930                       64.3    1e-08   
ref|XP_005719553.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_006781870.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_009664171.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_008977484.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_010344391.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_004277219.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
ref|XP_007459973.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_010951654.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_005175456.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_009586079.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    1e-08   
ref|XP_848512.2|  PREDICTED: calcium uptake protein 3, mitochondrial  65.1    1e-08   
gb|KFV99151.1|  hypothetical protein N327_11601                       64.7    1e-08   
ref|XP_005012203.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    1e-08   
ref|XP_004563275.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
ref|XP_007959916.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
gb|KFP97290.1|  hypothetical protein N329_05236                       64.7    1e-08   
ref|XP_009643190.1|  PREDICTED: calcium uptake protein 2, mitocho...  65.1    1e-08   
ref|XP_005837175.1|  hypothetical protein GUITHDRAFT_104007           64.7    1e-08   
ref|XP_003935605.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_004382843.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
gb|ETN62282.1|  hypothetical protein AND_006028                       65.1    1e-08   
gb|KFV87308.1|  hypothetical protein N308_01884                       64.7    1e-08   
ref|XP_006080220.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
gb|KFV06016.1|  hypothetical protein N339_12703                       64.3    1e-08   
ref|XP_004682546.1|  PREDICTED: EF-hand domain-containing family ...  65.1    1e-08   
ref|XP_005012202.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    1e-08   
gb|KFQ87554.1|  hypothetical protein N337_11076                       64.7    1e-08   
gb|KFQ57742.1|  hypothetical protein N334_08947                       64.3    1e-08   
ref|XP_008144445.1|  PREDICTED: calcium uptake protein 3, mitocho...  65.1    1e-08   
ref|XP_001638682.1|  predicted protein                                64.7    1e-08   
ref|XP_003412365.2|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    1e-08   
ref|XP_008931524.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_009684867.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
gb|KFQ39172.1|  hypothetical protein N332_01773                       64.7    2e-08   
ref|XP_010196377.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
gb|KFV98569.1|  hypothetical protein N326_12645                       64.3    2e-08   
gb|KFP30153.1|  hypothetical protein N325_00381                       63.5    2e-08   
gb|KFP20999.1|  hypothetical protein Z169_16493                       64.7    2e-08   
ref|XP_009490311.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.3    2e-08   
ref|XP_003199954.2|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
gb|KFP44384.1|  hypothetical protein N324_12680                       64.7    2e-08   
ref|XP_008490159.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
ref|XP_010196304.1|  PREDICTED: calcium uptake protein 2, mitocho...  63.2    2e-08   
ref|XP_009927632.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_005175454.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
ref|XP_010187870.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_010217235.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_006015956.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
ref|XP_002940795.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_009941532.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
gb|KFV56832.1|  hypothetical protein N341_03716                       64.3    2e-08   
ref|XP_009333472.1|  PREDICTED: calcium uptake protein 3, mitocho...  64.7    2e-08   
ref|XP_003690116.1|  PREDICTED: EF-hand domain-containing family ...  64.7    2e-08   
gb|ELU03948.1|  hypothetical protein CAPTEDRAFT_173112                64.7    2e-08   
ref|XP_010158514.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.3    2e-08   
ref|XP_005229780.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
ref|XP_009969596.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.3    2e-08   
ref|XP_005417839.1|  PREDICTED: calcium uptake protein 2, mitocho...  64.7    2e-08   
gb|KFP51634.1|  hypothetical protein N323_12883                       64.3    2e-08   



>gb|EYU38319.1| hypothetical protein MIMGU_mgv1a005763mg [Erythranthe guttata]
Length=471

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYDY+S+GTI++KDF LSMVA+ADM +I KFLD+VEELN+EP LR
Sbjct  295  FLRDLHDEMLRLEFAHYDYKSQGTITAKDFVLSMVASADMRYINKFLDQVEELNNEPLLR  354

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            + R++F+EFK+FAELRK+L+PF++A+FS+GK +NG+LSK DFKRAA  VCGISLT+ VVD
Sbjct  355  NERVTFEEFKNFAELRKRLEPFSMALFSYGK-VNGLLSKQDFKRAADQVCGISLTDKVVD  413

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC-PSK  324
            ++F++FD N DG LSS+EFLRVL+RRE DI+ P E GF G+I+CWLDCTK C P K
Sbjct  414  LVFYMFDANKDGSLSSEEFLRVLERREMDISQPREGGFAGLIACWLDCTKNCSPPK  469



>ref|XP_011084065.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Sesamum 
indicum]
Length=482

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 152/177 (86%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYD++S+GTIS+KDF LSMVA+ADM +I KFLD V++LN+E  LR
Sbjct  306  FLRDLHDEMLRLEFAHYDFKSQGTISAKDFILSMVASADMRYINKFLDLVDKLNNEESLR  365

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELRK+L+PF++A+FS+GK +NG+LSK DFKRAA  VCG+SLT+ VVD
Sbjct  366  DLRITFEEFKNFAELRKRLEPFSIALFSYGK-VNGLLSKPDFKRAADKVCGVSLTDKVVD  424

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F++FD N DG LS+DEFLRVL+RRETDI  P E+G VGMISCWLDCT+ C SK L
Sbjct  425  LVFYMFDANRDGSLSADEFLRVLERRETDILQPREEGLVGMISCWLDCTRNCSSKKL  481



>emb|CBI25571.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYD +SRGTIS+ DFALSMVA+ADM HI KFL RV++LNDEP+LR
Sbjct  176  FLRDLHDEILQLEFAHYDCKSRGTISANDFALSMVASADMRHINKFLRRVDDLNDEPQLR  235

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+ +EFK+FAELRK+LQP + AIFS+GK +NG L+K DF+RAA  VCGISLT+NVVD
Sbjct  236  DIRITLEEFKNFAELRKRLQPLSWAIFSYGK-VNGQLTKGDFQRAACQVCGISLTDNVVD  294

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FD N DG LS DEF+RVLQRRE D + P E GF+G++SCWL CT  C S
Sbjct  295  IIFHIFDANRDGSLSLDEFVRVLQRRERDTSQPREPGFMGLLSCWLSCTTNCSS  348



>ref|XP_009415582.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++ LEFAHYD++SRGTIS+KDFALSMVA+ADM HI K LD+V+EL++ P +R
Sbjct  296  FLRDLHDEIVHLEFAHYDFKSRGTISAKDFALSMVASADMNHINKLLDQVDELDNNPSVR  355

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELRK+L+P TLAIFS+GK +NG+L+K DF RAA HVCG+SLTENVV+
Sbjct  356  DIRITFEEFKAFAELRKRLKPLTLAIFSYGK-VNGLLTKQDFIRAASHVCGVSLTENVVE  414

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FDTN DG LSS+EFLR +QRRETDI  P+  G +G++SCWL C + C S  L
Sbjct  415  IIFHIFDTNRDGSLSSEEFLRAVQRRETDIREPSSTGIMGLLSCWLHCRRHCSSSQL  471



>emb|CDP10495.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +   +LRLEFAHYD++S+GTIS+KDFALSMVA+AD+ HI KFLDRV+ELN EP L+
Sbjct  199  FLRDLHNDILRLEFAHYDWKSQGTISAKDFALSMVASADINHINKFLDRVDELNKEPNLK  258

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV I+F+EFK+FAELRK+L+PF+LAIFS+GK +NG+L+K DF+RAA  VCGIS+++N+VD
Sbjct  259  DVCITFEEFKNFAELRKRLRPFSLAIFSYGK-VNGLLTKQDFQRAATQVCGISISDNLVD  317

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            ++F++FDTN DG LSSDEFLRVLQRRE++ + P   G  G+ SCW +CTK   S
Sbjct  318  LVFYIFDTNRDGNLSSDEFLRVLQRRESNASQPRGAGDKGLFSCWFECTKKSSS  371



>ref|XP_002266120.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Vitis 
vinifera]
Length=488

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYD +SRGTIS+ DFALSMVA+ADM HI KFL RV++LNDEP+LR
Sbjct  310  FLRDLHDEILQLEFAHYDCKSRGTISANDFALSMVASADMRHINKFLRRVDDLNDEPQLR  369

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+ +EFK+FAELRK+LQP + AIFS+GK +NG L+K DF+RAA  VCGISLT+NVVD
Sbjct  370  DIRITLEEFKNFAELRKRLQPLSWAIFSYGK-VNGQLTKGDFQRAACQVCGISLTDNVVD  428

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FD N DG LS DEF+RVLQRRE D + P E GF+G++SCWL CT  C S
Sbjct  429  IIFHIFDANRDGSLSLDEFVRVLQRRERDTSQPREPGFMGLLSCWLSCTTNCSS  482



>ref|XP_010687823.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like, 
partial [Beta vulgaris subsp. vulgaris]
Length=373

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYD++SRGTIS++DFALSMVA+ADM H T+FLDRV+EL+++  L 
Sbjct  196  FLRDLHDEILRLEFAHYDHKSRGTISARDFALSMVASADMSHTTRFLDRVDELSNDSLLN  255

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +VR +F+EFK FA+LRK L+P +LAIFS GK+ +G+L+K+DF+RAA HVCGI L++NVVD
Sbjct  256  NVRFTFEEFKGFADLRKSLRPLSLAIFSHGKANDGLLTKEDFRRAASHVCGIKLSKNVVD  315

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FD N DG LSSDEFL+VLQRRE D++ P E GF G+ SCW+DCT  C S
Sbjct  316  IIFHIFDLNRDGSLSSDEFLKVLQRRERDVSLPREAGFKGLFSCWVDCTTSCSS  369



>ref|XP_010244879.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=496

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 146/173 (84%), Gaps = 2/173 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEFAHYD  S+GTIS+KDFALSMVA+ADM HI KFLDRV+ELN+EP+LR
Sbjct  319  FLRDLHYEILLLEFAHYDCMSQGTISAKDFALSMVASADMSHINKFLDRVDELNNEPQLR  378

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D R++ +EF SFAELRK+LQP +LAIFS+GK +NG+L+K D +RAA  VCGISL++NV+D
Sbjct  379  DNRVTLEEFMSFAELRKQLQPLSLAIFSYGK-VNGLLTKKDLQRAASQVCGISLSDNVID  437

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEK-GFVGMISCWLDCTKGC  333
            +IF +FDTN DG LSSDEF+RVL RRE+D+A PTE+ G +G++SCW++C K C
Sbjct  438  IIFHVFDTNRDGSLSSDEFVRVLHRRESDVAQPTEEVGLIGLLSCWMNCAKNC  490



>ref|XP_007011794.1| Calcium ion binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY29413.1| Calcium ion binding protein, putative isoform 1 [Theobroma cacao]
Length=492

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEF HYDY+ RGTIS+KDFALSMVA+ADM H+ + L++V+ELNDEP+LR
Sbjct  315  FLQKLQDEMLRLEFDHYDYKGRGTISAKDFALSMVASADMSHLGRLLEQVDELNDEPQLR  374

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+ DEFK FAELR+KLQPF+LA+FS+GK +NG+L+KDDFKRAA HVCGI LT+NVV+
Sbjct  375  EIRINLDEFKHFAELRRKLQPFSLALFSYGK-INGLLTKDDFKRAASHVCGIDLTDNVVE  433

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD+N DG LS+DEF+RVL +RE DIA P E G +G++SC  +C+ 
Sbjct  434  IIFHVFDSNRDGHLSADEFVRVLLKRERDIAQPVESGILGLLSCCWNCSN  483



>ref|XP_010907508.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=438

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYD++SRGTIS+KDFALSMVA AD+ HI KFLDRV+ELN  P LR
Sbjct  261  FLRELHDEIVRLEFAHYDFKSRGTISAKDFALSMVACADVNHINKFLDRVDELNGNPHLR  320

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+F EL  +LQ  TLAIF FGK +NG+L+K DFKRAA HVCG+S+T+NVVD
Sbjct  321  DMRITFEEFKTFVELCNRLQALTLAIFGFGK-VNGLLTKQDFKRAASHVCGVSVTDNVVD  379

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FD N DG LSS+EFLR LQ+RE+ I  PT  G  G++SCWL+C + C
Sbjct  380  VIFHVFDANFDGKLSSEEFLRALQKRESAIRQPTATGLTGLLSCWLNCKRSC  431



>ref|XP_010907507.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=466

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYD++SRGTIS+KDFALSMVA AD+ HI KFLDRV+ELN  P LR
Sbjct  289  FLRELHDEIVRLEFAHYDFKSRGTISAKDFALSMVACADVNHINKFLDRVDELNGNPHLR  348

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+F EL  +LQ  TLAIF FGK +NG+L+K DFKRAA HVCG+S+T+NVVD
Sbjct  349  DMRITFEEFKTFVELCNRLQALTLAIFGFGK-VNGLLTKQDFKRAASHVCGVSVTDNVVD  407

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FD N DG LSS+EFLR LQ+RE+ I  PT  G  G++SCWL+C + C
Sbjct  408  VIFHVFDANFDGKLSSEEFLRALQKRESAIRQPTATGLTGLLSCWLNCKRSC  459



>ref|XP_008775755.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X2 [Phoenix dactylifera]
Length=350

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYD++SRGTIS+KDFALSMVA AD+ HI  FLDRV+ELN+ P LR
Sbjct  174  FLRDLHDEIVRLEFAHYDFKSRGTISAKDFALSMVACADLNHINMFLDRVDELNNNPHLR  233

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR +LQ  TLAIF +GK +NG+L+K DFKRAA HVC +S+T+NVVD
Sbjct  234  DMRITFEEFKTFAELRDRLQALTLAIFGYGK-VNGLLTKQDFKRAASHVCNLSVTDNVVD  292

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKI  321
            +IF +FD N DG LSS+EF+R LQ+RE+ I  PT  G  G++SCWL+C +    +I
Sbjct  293  VIFHVFDANCDGNLSSEEFVRALQKRESAIRQPTATGLAGLLSCWLNCKRCSVPQI  348



>gb|KHG19522.1| Calcium uptake 1, mitochondrial [Gossypium arboreum]
Length=489

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEF HYDY+ RG+IS+KDFALSMVA+ADM H+ + L+RV+ELN+EP LR
Sbjct  312  FMRKLQDEILRLEFDHYDYKVRGSISAKDFALSMVASADMSHLDRLLERVDELNNEPHLR  371

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+ DEFK FAELR+KLQPF+LA+FS+GK +NG+L+KDDFKRAA HVCGISLT+N+V+
Sbjct  372  EIRINLDEFKHFAELRRKLQPFSLALFSYGK-INGLLTKDDFKRAAYHVCGISLTDNIVE  430

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FDTN DG LSSDEF+RVL +RE DIA P E G  G++SC   C+  
Sbjct  431  IIFHVFDTNRDGHLSSDEFVRVLLKRERDIAQPVESGIFGLLSCCWHCSNN  481



>gb|KHG08195.1| Calcium uptake 1, mitochondrial [Gossypium arboreum]
Length=484

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 142/169 (84%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEF HYDY+ RGTIS+KDFALSMVAAADM H+ + L+RV+ LND+P+LR
Sbjct  307  FMRKLQDEILRLEFDHYDYKGRGTISAKDFALSMVAAADMSHLDRLLERVDALNDKPQLR  366

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +VRIS DEFK FAELR+KLQPF+LA+FS+GK +NG L+KDDFKRAA HVCG+SLT+N+V+
Sbjct  367  EVRISLDEFKHFAELRRKLQPFSLALFSYGK-VNGQLTKDDFKRAASHVCGVSLTDNIVE  425

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            ++F +FD+N DG LS DEF+RVL++RE DIA P E G +G+ SC  +C+
Sbjct  426  IVFHVFDSNKDGHLSWDEFVRVLRKRERDIAQPVESGIMGLKSCCWNCS  474



>ref|XP_008775754.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Phoenix dactylifera]
Length=467

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYD++SRGTIS+KDFALSMVA AD+ HI  FLDRV+ELN+ P LR
Sbjct  291  FLRDLHDEIVRLEFAHYDFKSRGTISAKDFALSMVACADLNHINMFLDRVDELNNNPHLR  350

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR +LQ  TLAIF +GK +NG+L+K DFKRAA HVC +S+T+NVVD
Sbjct  351  DMRITFEEFKTFAELRDRLQALTLAIFGYGK-VNGLLTKQDFKRAASHVCNLSVTDNVVD  409

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKI  321
            +IF +FD N DG LSS+EF+R LQ+RE+ I  PT  G  G++SCWL+C +    +I
Sbjct  410  VIFHVFDANCDGNLSSEEFVRALQKRESAIRQPTATGLAGLLSCWLNCKRCSVPQI  465



>gb|KEH39843.1| calcium-binding EF hand protein [Medicago truncatula]
Length=464

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF HYDY+SR  IS+KDFALSMVA+ADM H+ K L+RV+ELN+EP  +
Sbjct  287  FLQDLHDEILRLEFDHYDYKSRKAISAKDFALSMVASADMSHLGKLLERVDELNNEPCFK  346

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI F++FK+FAELRKKL P +LA+FSFGK +NG+L++DDF+RAA HVCGISL++NVV+
Sbjct  347  DVRIRFEDFKNFAELRKKLLPLSLALFSFGK-VNGLLTRDDFQRAASHVCGISLSDNVVE  405

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            ++F LFDTN DG LS+DEF+RVL +RE DI HP E G +G++SC  +C +   S
Sbjct  406  IVFHLFDTNRDGNLSTDEFVRVLHKRERDIGHPVETGMLGLLSCCWNCRENISS  459



>ref|XP_002324884.1| hypothetical protein POPTR_0018s02130g [Populus trichocarpa]
 gb|EEF03449.1| hypothetical protein POPTR_0018s02130g [Populus trichocarpa]
Length=488

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEFAHYDY+ RGTIS+KDFALSMVA+ADM H+ K LDRV+ELND+  L  +RI+ +
Sbjct  318  EILRLEFAHYDYKLRGTISAKDFALSMVASADMSHLGKLLDRVDELNDQANLGGLRITLE  377

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFKSFAELRKKL PF+LA+FS+GK +NG+L ++DF+RAA HVCG+SL++NVV++IF LFD
Sbjct  378  EFKSFAELRKKLLPFSLALFSYGK-VNGLLMREDFQRAASHVCGVSLSDNVVEIIFHLFD  436

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCP  330
            +NHDG LS+DEF+RVL RRE DIA P E G  G +SC  +     P
Sbjct  437  SNHDGSLSADEFVRVLHRRERDIAQPVESGLAGFLSCCFNRAANSP  482



>ref|XP_006367412.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
tuberosum]
Length=463

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 146/177 (82%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +ML+LEFAHYDY+ RGTIS+KDFALSMVA+AD+ ++ K LDRV++L++EP+L 
Sbjct  281  FLRDLHEEMLKLEFAHYDYKFRGTISAKDFALSMVASADLKYLNKLLDRVDDLDNEPQLS  340

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RISF+EFK+FAELRKKLQPF+LA+F FG+ +NG+L++ DFKRAA  VCG+SLT+N+++
Sbjct  341  HIRISFEEFKTFAELRKKLQPFSLALFCFGQ-VNGLLTRSDFKRAASQVCGVSLTDNMIE  399

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F +FDTN DG LSSDEF+RVL++R  DIA PTE G +  +SC  +CT+   S +L
Sbjct  400  LVFHVFDTNRDGSLSSDEFIRVLEKRARDIAEPTEAGILNFMSCCGNCTRNYKSNLL  456



>ref|XP_009626825.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=455

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +ML+LEFAHYDY+ RGTIS+KDFALSMVAAAD+ ++ K LDRV++L++E  L 
Sbjct  273  FLRDLHEEMLKLEFAHYDYKFRGTISAKDFALSMVAAADLKYLNKLLDRVDDLDNESPLS  332

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             ++ISF+EFKSFAELRKKLQPF+LA+F FG+ +NG L++ DFKRAA  VCG+SLT+NV++
Sbjct  333  RIKISFEEFKSFAELRKKLQPFSLALFCFGQ-VNGRLTRIDFKRAASQVCGVSLTDNVIE  391

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F +FDTNHDG LSSDEF+RVL++RE DIA PTE G +  +SC+ + T+   S +L
Sbjct  392  IVFHVFDTNHDGNLSSDEFIRVLEKRERDIAEPTEAGILNFVSCYGNSTRNYKSYLL  448



>ref|XP_010913360.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X3 [Elaeis guineensis]
Length=455

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+ LEFAHYDY+SRGTIS+KDFALSMVA+AD+ ++ KFLDR +EL+  P L+
Sbjct  270  FLRDLHDEMVNLEFAHYDYKSRGTISAKDFALSMVASADISNVNKFLDRADELDSHPHLK  329

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+ +EFKSFAELRK LQP  LAIFS+G+ +NG+L+K DF+RAA HVCGI++++NVVD
Sbjct  330  DARITLEEFKSFAELRKTLQPLALAIFSYGR-VNGLLTKQDFQRAASHVCGITVSDNVVD  388

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C K
Sbjct  389  IIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSCVK  438



>ref|XP_010913359.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Elaeis guineensis]
Length=464

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+ LEFAHYDY+SRGTIS+KDFALSMVA+AD+ ++ KFLDR +EL+  P L+
Sbjct  279  FLRDLHDEMVNLEFAHYDYKSRGTISAKDFALSMVASADISNVNKFLDRADELDSHPHLK  338

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+ +EFKSFAELRK LQP  LAIFS+G+ +NG+L+K DF+RAA HVCGI++++NVVD
Sbjct  339  DARITLEEFKSFAELRKTLQPLALAIFSYGR-VNGLLTKQDFQRAASHVCGITVSDNVVD  397

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C K
Sbjct  398  IIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSCVK  447



>ref|XP_006450355.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450356.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450358.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006450362.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63595.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63596.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63598.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63602.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
Length=328

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ +++ +MLRLEFAHYDY+ RGTIS++DFALSMVA+ADMGH+ K L+RV++L +E  L 
Sbjct  151  FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLC  210

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR+KLQPF LA+FS+GK +NG+L++DDF+RAA  VCGI LT+NV+D
Sbjct  211  DLRITFEEFKNFAELRRKLQPFCLALFSYGK-VNGLLTRDDFQRAAYRVCGILLTDNVID  269

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  + T 
Sbjct  270  IIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTN  319



>ref|XP_010913358.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Elaeis guineensis]
Length=483

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+ LEFAHYDY+SRGTIS+KDFALSMVA+AD+ ++ KFLDR +EL+  P L+
Sbjct  298  FLRDLHDEMVNLEFAHYDYKSRGTISAKDFALSMVASADISNVNKFLDRADELDSHPHLK  357

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+ +EFKSFAELRK LQP  LAIFS+G+ +NG+L+K DF+RAA HVCGI++++NVVD
Sbjct  358  DARITLEEFKSFAELRKTLQPLALAIFSYGR-VNGLLTKQDFQRAASHVCGITVSDNVVD  416

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C K
Sbjct  417  IIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSCVK  466



>dbj|BAD19699.1| putative calcium binding atopy-related autoantigen 1 [Oryza sativa 
Japonica Group]
Length=283

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS KDFALSMVA+ADM HI K LDRV++ +D P L+
Sbjct  107  FLKQLHDEIVRLEFSHYDVKSSKTISVKDFALSMVASADMNHINKLLDRVDDFDDYPDLK  166

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR+KL+PF +AIFS+GK +NG+L+K D KRAA HVC + LT+ VVD
Sbjct  167  DLRITFEEFKAFADLRRKLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCEVDLTDKVVD  225

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+CTK
Sbjct  226  VIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNCTK  275



>ref|XP_010099864.1| Calcium uptake protein 1 [Morus notabilis]
 gb|EXB80741.1| Calcium uptake protein 1 [Morus notabilis]
Length=490

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEFAHYDY+ RGTI +KDFALSMVA+ADM H++K LDRVE++N EP L+
Sbjct  312  FMRDLHDEILRLEFAHYDYKLRGTILAKDFALSMVASADMSHLSKLLDRVEKMNSEPHLK  371

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+ +EFKSFAELRKKLQPF+LA+FS+G+ +NG+L+++D +RAA HVCGI L+ NVV+
Sbjct  372  DLRITLEEFKSFAELRKKLQPFSLALFSYGE-VNGLLTREDLQRAASHVCGIDLSRNVVE  430

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            +IF LFD N DG LS DEF+RVL RRE DIA P E G +G + C  +C+
Sbjct  431  IIFHLFDANRDGSLSLDEFVRVLHRRERDIAQPVESGLMGFLFCCGNCS  479



>gb|KCW81354.1| hypothetical protein EUGRSUZ_C02735 [Eucalyptus grandis]
Length=328

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +ML LEF+HYDY+  GTIS+KDFALSMVA+ADM H+ + LDRV++L+ EP L +VRIS +
Sbjct  158  EMLNLEFSHYDYKQNGTISAKDFALSMVASADMNHLHRLLDRVDQLDKEPHLTNVRISLE  217

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FAELRKKLQPF+LA+FS+G+ +NG+L++ DF+RAA  VCG+SLT+NVV++IF +FD
Sbjct  218  EFKNFAELRKKLQPFSLALFSYGR-VNGLLTRKDFQRAASRVCGVSLTDNVVELIFHVFD  276

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
             N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +C
Sbjct  277  LNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHNC  317



>gb|KDO59309.1| hypothetical protein CISIN_1g042758mg, partial [Citrus sinensis]
Length=364

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYD + RGTIS+KDFALS+VA+AD+  + K LDRV+E+ +EP+LR
Sbjct  190  FLRDLHEEILQLEFAHYDCKLRGTISAKDFALSLVASADLSQVNKLLDRVDEIGNEPKLR  249

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI++ EFK FAELRK+LQ  +LAIF++GK +NG+L+K DF+RAA  VCGIS+++NVVD
Sbjct  250  PIRITYKEFKDFAELRKQLQFLSLAIFTYGK-VNGVLTKRDFQRAASKVCGISISDNVVD  308

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            +IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +C 
Sbjct  309  VIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKNCA  357



>ref|XP_003549296.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=487

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+S  TIS+KDFALSMVA+ADM H+ + L+RV+ LND+PRL+
Sbjct  314  FLRGLHDEILRLEFAHYDYQSCQTISAKDFALSMVASADMSHLGRLLERVDGLNDDPRLK  373

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+F++FK+FAELRKKL PF+LA+FSFG+ +NG+L++DDF+RAA HVCGISL++ VV+
Sbjct  374  DARITFEDFKNFAELRKKLLPFSLALFSFGE-VNGLLTRDDFQRAASHVCGISLSDTVVE  432

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            ++F LFD N DG LS DEF+RVL +RE DIA P E G  G +SC  +CT
Sbjct  433  IVFHLFDANRDGNLSFDEFVRVLHKRERDIAQPVETGIRGWLSCGWNCT  481



>gb|KHN48538.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=481

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+S  TIS+KDFALSMVA+ADM H+ + L+RV+ LND+PRL+
Sbjct  308  FLRGLHDEILRLEFAHYDYQSCQTISAKDFALSMVASADMSHLGRLLERVDGLNDDPRLK  367

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+F++FK+FAELRKKL PF+LA+FSFG+ +NG+L++DDF+RAA HVCGISL++ VV+
Sbjct  368  DARITFEDFKNFAELRKKLLPFSLALFSFGE-VNGLLTRDDFQRAASHVCGISLSDTVVE  426

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            ++F LFD N DG LS DEF+RVL +RE DIA P E G  G +SC  +CT
Sbjct  427  IVFHLFDANRDGNLSFDEFVRVLHKRERDIAQPVETGIRGWLSCGWNCT  475



>gb|KDP33558.1| hypothetical protein JCGZ_07129 [Jatropha curcas]
Length=503

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYDY+S+ +I +KDFALSMVA+AD+ H+ K L RV+ELN++ RL+
Sbjct  326  FLRELHDEMLRLEFAHYDYKSQESILAKDFALSMVASADLSHLDKLLCRVDELNNDARLK  385

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV+I+FDEFKSFA+LRKKL PF+LA+FS+GK +NG+L+++DF+RAA ++CGISLT+NVVD
Sbjct  386  DVQITFDEFKSFADLRKKLVPFSLAVFSYGK-VNGLLTREDFQRAASYICGISLTQNVVD  444

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD+N DG LS DEF+RVL +RE DIA P E G  G +SC  +C  
Sbjct  445  IIFHVFDSNQDGHLSPDEFVRVLYKRERDIAEPVESGIFGFLSCCYNCAN  494



>ref|XP_011036617.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Populus euphratica]
Length=488

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEFAHYDY+ RGTIS+KDFALSMVA+ADM H+ K LDRV+ELND+  L  +RI+ +
Sbjct  318  EILRLEFAHYDYKLRGTISAKDFALSMVASADMSHLGKLLDRVDELNDQANLGGIRITLE  377

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFKSFAELRKKL PF+LA+FS+GK +NG+L ++DF+RAA  VCG+SL++NVV++IF +FD
Sbjct  378  EFKSFAELRKKLLPFSLALFSYGK-VNGLLMREDFQRAASQVCGVSLSDNVVEIIFHVFD  436

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCP  330
            +NHDG LS++EF++VL RRE DIA P E G  G +SC  +     P
Sbjct  437  SNHDGSLSAEEFVKVLHRRERDIAQPVESGLAGFLSCCFNRAANSP  482



>ref|XP_009766649.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=470

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+S+G+IS+KDFALSMVA+AD+ HI KFLDRVE+L+DEP LR
Sbjct  293  FLRDLHDEILRLEFAHYDYKSQGSISAKDFALSMVASADISHINKFLDRVEDLDDEPHLR  352

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+++EF S   LRK+LQ F+  I S+GK +NG+LSK + K AAK VCGISLT+NVVD
Sbjct  353  DLRITYEEFMSLTNLRKELQSFSQVILSYGK-VNGLLSKQELKGAAKQVCGISLTDNVVD  411

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IFF+FD + DG LSSDEFLRVLQRRE + +   E GFV   S WLD TK
Sbjct  412  LIFFMFDLDCDGSLSSDEFLRVLQRREPECSEQRESGFVSFFSGWLDSTK  461



>gb|KHN02022.1| EF-hand domain-containing family member A2 [Glycine soja]
Length=182

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  839  SVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVR  660
            +V P +LRLEFAHYDY+SR TIS+KDFALSMVA+ADM H+ + L+RV+ LND+PRL+D R
Sbjct  9    AVVP-ILRLEFAHYDYQSRQTISAKDFALSMVASADMSHLGRLLERVDGLNDDPRLKDAR  67

Query  659  ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIF  480
            ++F++ K+FAELRKKL PF+LA+FSFG+ +NG+L++DDF+RAA HV GISL+  VV+++F
Sbjct  68   LTFEDLKNFAELRKKLLPFSLALFSFGE-VNGLLTRDDFQRAASHVYGISLSNIVVEIVF  126

Query  479  FLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
             LFD N DG LS DEF+RVL +RE D+A P E G +G +SC
Sbjct  127  HLFDANRDGNLSFDEFVRVLHKREKDVAQPMETGIMGWLSC  167



>dbj|BAK07466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF HYD +S  TIS+KDFALSMVA+ADM HI K LDRV++ ++ P ++
Sbjct  331  FLKQLHDEIVRLEFNHYDIKSSKTISAKDFALSMVASADMNHINKLLDRVDDFDESPDVK  390

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  391  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCGVDLTDKVVD  449

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+ SCWL+CTK
Sbjct  450  VIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGVFSCWLNCTK  499



>gb|KCW81353.1| hypothetical protein EUGRSUZ_C02735 [Eucalyptus grandis]
Length=373

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +ML LEF+HYDY+  GTIS+KDFALSMVA+ADM H+ + LDRV++L+ EP L +VRIS +
Sbjct  203  EMLNLEFSHYDYKQNGTISAKDFALSMVASADMNHLHRLLDRVDQLDKEPHLTNVRISLE  262

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FAELRKKLQPF+LA+FS+G+ +NG+L++ DF+RAA  VCG+SLT+NVV++IF +FD
Sbjct  263  EFKNFAELRKKLQPFSLALFSYGR-VNGLLTRKDFQRAASRVCGVSLTDNVVELIFHVFD  321

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
             N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +C
Sbjct  322  LNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHNC  362



>ref|XP_004498756.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Cicer arietinum]
Length=473

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEF HYDY+SR +IS+KDFALSMVA+AD+ H+ K L+RV+ELN++ R +
Sbjct  295  FMRDLHDEVLRLEFDHYDYKSRKSISAKDFALSMVASADISHLGKLLERVDELNNDSRFK  354

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV+I+F++FK+FAELRKKL P +LA+FSFGK +NG+L++DDF+RAA HVCG+SL++NVV+
Sbjct  355  DVQITFEDFKNFAELRKKLFPLSLALFSFGK-VNGLLTRDDFQRAASHVCGLSLSDNVVE  413

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG-CPSKIL  318
            ++F LFDTN DG LS++EF+RVL +RE DI  P E G +G +SC  +CT+   PS++ 
Sbjct  414  IVFHLFDTNQDGNLSTNEFVRVLHKREKDIVQPVESGMLGFLSCCRNCTENISPSRLF  471



>ref|XP_004498755.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Cicer arietinum]
Length=479

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEF HYDY+SR +IS+KDFALSMVA+AD+ H+ K L+RV+ELN++ R +
Sbjct  301  FMRDLHDEVLRLEFDHYDYKSRKSISAKDFALSMVASADISHLGKLLERVDELNNDSRFK  360

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV+I+F++FK+FAELRKKL P +LA+FSFGK +NG+L++DDF+RAA HVCG+SL++NVV+
Sbjct  361  DVQITFEDFKNFAELRKKLFPLSLALFSFGK-VNGLLTRDDFQRAASHVCGLSLSDNVVE  419

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG-CPSKIL  318
            ++F LFDTN DG LS++EF+RVL +RE DI  P E G +G +SC  +CT+   PS++ 
Sbjct  420  IVFHLFDTNQDGNLSTNEFVRVLHKREKDIVQPVESGMLGFLSCCRNCTENISPSRLF  477



>ref|XP_002515470.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF46919.1| calcium ion binding protein, putative [Ricinus communis]
Length=540

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+ R TIS+KDFALSMVA+AD+ H+ K L RV+ELN+E  L 
Sbjct  306  FLRDLHDEILRLEFAHYDYKLRKTISAKDFALSMVASADLSHLDKLLVRVDELNNEADLS  365

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D++I+F+EFK+FAELRKKL PF+LA+FS+GK +NG+L+K+DF+RAA HVCG+SLT+ VVD
Sbjct  366  DIQITFEEFKNFAELRKKLLPFSLALFSYGK-VNGLLTKEDFQRAASHVCGVSLTDKVVD  424

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD+N DG LS +EF+RVL +RE DIA P E G +G +SC  +C  G
Sbjct  425  IIFHVFDSNRDGHLSLNEFIRVLHKRERDIAQPVESGIIGFLSCCFNCANG  475



>ref|XP_010250313.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nelumbo 
nucifera]
Length=509

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEFAHYDY+ RGTIS+ DFALSMVA+ADM +I KFL+RV++LN EP+LR
Sbjct  328  FLRDLHDEILLLEFAHYDYKLRGTISAMDFALSMVASADMNYINKFLNRVDKLNHEPQLR  387

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+ +EFK+FAELRK+LQP +LAIFS+G ++NG+L++ DF+RAA  VCG+SL++NVVD
Sbjct  388  DTRITLEEFKNFAELRKQLQPLSLAIFSYG-NVNGLLTRKDFQRAASQVCGVSLSDNVVD  446

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FD+N DG LSSDEF+RVL RRE  +  P E G VG++S W+   + C
Sbjct  447  IIFHVFDSNRDGSLSSDEFVRVLHRRERYLGQPMEAGVVGLLSYWMRYARDC  498



>ref|XP_006474603.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Citrus 
sinensis]
Length=527

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYD + RGTIS+KDFALS+VA+AD+  + K LDRV+E+ +EP+LR
Sbjct  350  FLRDLHEEILQLEFAHYDCKLRGTISAKDFALSLVASADLSQVNKLLDRVDEIGNEPKLR  409

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI++ EFK FAELRK+LQ  +LAIF++GK +NG+L+K DF+RAA  VCGIS+T+NVVD
Sbjct  410  PIRITYKEFKDFAELRKQLQFLSLAIFTYGK-VNGVLTKRDFQRAASKVCGISITDNVVD  468

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +C        L
Sbjct  469  VIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKNCATATKCSFL  525



>ref|XP_009782522.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=453

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 142/177 (80%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYDY+ RGTIS+KDFALSMVAAAD+ ++ K LDRV++L++E  L 
Sbjct  271  FLRDLHEEILKLEFAHYDYKFRGTISAKDFALSMVAAADLKYLNKLLDRVDDLDNESPLS  330

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
              +ISF+EFKSFAELRKKLQPF+LA+F FG+ +NG L++ DFKRAA  VCG+SLT+NV++
Sbjct  331  RTKISFEEFKSFAELRKKLQPFSLALFCFGQ-VNGHLTRSDFKRAASQVCGVSLTDNVIE  389

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F +FDTN DG LSSDEF+RVL++RE DIA P E G +  +SC+ + T+   S +L
Sbjct  390  IVFHVFDTNRDGNLSSDEFIRVLEKREKDIAEPIEAGILNFVSCYGNSTRNYKSYLL  446



>ref|XP_009405764.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=471

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +SRGTIS+KDFALSMVA+ADM H+ K LDRV+EL+D P LR
Sbjct  292  FLRDLHDEIVRLEFSHYDLKSRGTISAKDFALSMVASADMNHVDKLLDRVDELDDSPSLR  351

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+  +F+EFK+FAELR++L+P TLAIFS+GK MNG+L+K DF RAA HVCGISLTEN+VD
Sbjct  352  DLHFTFEEFKAFAELRRRLRPLTLAIFSYGK-MNGLLTKQDFIRAASHVCGISLTENMVD  410

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEK--GFVGMISCWLDCTKGC  333
            +IF +FDTN DG LSS+EFLR LQRRE+D   P+    G +G++SCWL CTK C
Sbjct  411  VIFHVFDTNRDGNLSSEEFLRALQRRESDACQPSAPGGGIMGLLSCWLQCTKNC  464



>gb|KDO61821.1| hypothetical protein CISIN_1g010530mg [Citrus sinensis]
Length=499

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ +++ +MLRLEFAHYDY+ RGTIS++DFALSMVA+ADMGH+ K L+RV++L +E  L 
Sbjct  322  FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLC  381

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR+KLQPF LA+FS+GK +NG+L++DDF+RAA  VCGI LT+NV+D
Sbjct  382  DLRITFEEFKNFAELRRKLQPFCLALFSYGK-VNGLLTRDDFQRAAYRVCGILLTDNVID  440

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  + T  
Sbjct  441  IIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNN  491



>ref|XP_007155096.1| hypothetical protein PHAVU_003G172800g [Phaseolus vulgaris]
 gb|ESW27090.1| hypothetical protein PHAVU_003G172800g [Phaseolus vulgaris]
Length=471

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYDY  RG+IS+KDFALS+VA+AD+ HI+K LDRVEELN + +LR
Sbjct  297  FLRQLHDEILRLEFSHYDYNKRGSISAKDFALSLVASADVNHISKLLDRVEELNRDQQLR  356

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+R+++ EF+ FAELRKKLQ F+LAIFS+GK +NG+L+K DF+RAA +VCG+ +T+ VVD
Sbjct  357  DLRLTYREFQDFAELRKKLQSFSLAIFSYGK-VNGVLTKTDFQRAASNVCGVCITDKVVD  415

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKILH  315
            +IF +FD N DG LS  EF+RVLQRRE DI+  +  GF G+I+CWL C K CP+  L 
Sbjct  416  IIFHVFDANRDGNLSVSEFVRVLQRRE-DIS--SGSGFKGLITCWLKCVKNCPTTNLQ  470



>gb|KDO61820.1| hypothetical protein CISIN_1g010530mg [Citrus sinensis]
Length=508

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ +++ +MLRLEFAHYDY+ RGTIS++DFALSMVA+ADMGH+ K L+RV++L +E  L 
Sbjct  331  FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLC  390

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR+KLQPF LA+FS+GK +NG+L++DDF+RAA  VCGI LT+NV+D
Sbjct  391  DLRITFEEFKNFAELRRKLQPFCLALFSYGK-VNGLLTRDDFQRAAYRVCGILLTDNVID  449

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  + T  
Sbjct  450  IIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNN  500



>ref|XP_006450361.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 ref|XP_006483416.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR63601.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
Length=508

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ +++ +MLRLEFAHYDY+ RGTIS++DFALSMVA+ADMGH+ K L+RV++L +E  L 
Sbjct  331  FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLC  390

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR+KLQPF LA+FS+GK +NG+L++DDF+RAA  VCGI LT+NV+D
Sbjct  391  DLRITFEEFKNFAELRRKLQPFCLALFSYGK-VNGLLTRDDFQRAAYRVCGILLTDNVID  449

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD+N DG LS +EF+RVL  RE DIA P E G +G ++C  + T  
Sbjct  450  IIFQVFDSNRDGNLSLEEFVRVLHNRERDIAQPVETGILGFLNCCWNFTNN  500



>ref|XP_006648832.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Oryza brachyantha]
Length=389

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS KDFALSMVA+ADM HI K +DRV++ + +P L+
Sbjct  213  FLKQLHDEIVRLEFSHYDVKSSKTISVKDFALSMVASADMNHINKLIDRVDDFDVDPDLK  272

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+R++F+EFK+FA+LR+KL+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  273  DLRVTFEEFKAFADLRRKLEPFAMAIFSYGK-INGLLTKQDLKRAANHVCGVDLTDKVVD  331

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+CTK
Sbjct  332  VIFHVFDANQDGSLSADEFLRALQRRESDIRQPATSGLLGVFTCLLNCTK  381



>emb|CDP18812.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +ML+LEF+HYDY+ RGTIS+KDFALSMVAAAD+ H+ K  DRV++L+  P + 
Sbjct  321  FLRDLHDEMLKLEFSHYDYKCRGTISAKDFALSMVAAADLKHLGKLHDRVDDLDKMPHIS  380

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +VRI+ +EFKSFAELRKKLQPF+LAIFSFG+ +NG+L+K DF+RAA  VC +SLT+NV++
Sbjct  381  NVRITLEEFKSFAELRKKLQPFSLAIFSFGE-VNGLLTKGDFRRAASQVCDVSLTDNVIE  439

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            +IF +FD N DG LSSDEF+RVLQ+RE DIA PTE G    +SC  +C
Sbjct  440  IIFHVFDANRDGSLSSDEFIRVLQKREKDIAQPTEAGIFNFLSCCWNC  487



>ref|XP_006596683.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=246

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -1

Query  842  LSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDV  663
            L +  ++LRLEFAHYDY+SR TIS+KDFALSMVA+ADM H+ + L+RV+ LND+PRL+D 
Sbjct  71   LRIGLKILRLEFAHYDYQSRQTISAKDFALSMVASADMSHLGRLLERVDGLNDDPRLKDA  130

Query  662  RISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMI  483
            R++F++ K+FAELRKKL PF+LA+FSFG+ +NG+L++DDF+RAA HV GISL+  VV+++
Sbjct  131  RLTFEDLKNFAELRKKLLPFSLALFSFGE-VNGLLTRDDFQRAASHVYGISLSNIVVEIV  189

Query  482  FFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            F LFD N DG LS DEF+RVL +RE D+A P E G +G +SC
Sbjct  190  FHLFDANRDGNLSFDEFVRVLHKREKDVAQPVETGIMGWLSC  231



>tpg|DAA37068.1| TPA: hypothetical protein ZEAMMB73_919529 [Zea mays]
Length=285

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++++LEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L  EP L+D+RI+F+
Sbjct  115  EIIQLEFSHYDVKSSKTIPAKDFALSMVASADMNHINKLLDRVDSLVKEPDLKDIRITFE  174

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FA+LR++L+P ++AIF++GK +NG+L+K+D KRAA+HVCG+ LT+ VVD+IF +FD
Sbjct  175  EFKAFADLRRRLEPLSMAIFAYGK-LNGLLTKEDLKRAAQHVCGVDLTDRVVDIIFHVFD  233

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            TN DG LS +EFLR LQRRETDI  PT  G +G +SCW    K C S
Sbjct  234  TNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSGRK-CSS  279



>ref|XP_006453731.1| hypothetical protein CICLE_v10010671mg [Citrus clementina]
 gb|ESR66971.1| hypothetical protein CICLE_v10010671mg [Citrus clementina]
Length=491

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 137/169 (81%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYD + RGTIS+KDFALS+VA+AD+  + K LDRV+E+ +EP+LR
Sbjct  317  FLRDLHEEILQLEFAHYDCKLRGTISAKDFALSLVASADLSQVNKLLDRVDEIGNEPKLR  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI++ EFK FAELRK+LQ  +LAIF++GK +NG+L+K DF+RAA  VCGIS+++NVVD
Sbjct  377  PIRITYKEFKDFAELRKQLQFLSLAIFTYGK-VNGVLTKRDFQRAASKVCGISISDNVVD  435

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            +IF +FDTN DG +S DEF+RVLQRRE D A P E GF G+I+CW +C 
Sbjct  436  VIFHVFDTNRDGSISPDEFVRVLQRRERDTARPREPGFKGLITCWKNCA  484



>ref|XP_004240684.1| PREDICTED: calcium uptake protein 1, mitochondrial [Solanum lycopersicum]
Length=457

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEF HYDY+ RGTIS+KDFALSMVA+AD+ ++ K L RV++L++EP+L 
Sbjct  275  FLRDLHEEILKLEFVHYDYKFRGTISAKDFALSMVASADLKYLHKLLARVDDLDNEPQLS  334

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RISF+EFKSFAELRKKLQPF+LA+F FG+ +NG+L++ DFKRAA   CG+S+T+N+++
Sbjct  335  HIRISFEEFKSFAELRKKLQPFSLALFCFGQ-VNGLLTRSDFKRAASQACGVSITDNMIE  393

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            ++F +FDTNHDG LSSDEF+RVL++R  DIA PTE G +  +SC  +CT
Sbjct  394  LVFHVFDTNHDGSLSSDEFIRVLEKRARDIAEPTEAGILNFMSCSGNCT  442



>ref|XP_011081511.1| PREDICTED: calcium uptake protein 1, mitochondrial [Sesamum indicum]
Length=483

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEFAHYDY  RGTIS+KDFALSMVA+AD+ H+ K LDRV++L+++P L 
Sbjct  306  FLRDLHDEMVRLEFAHYDYMLRGTISAKDFALSMVASADLKHLNKLLDRVDDLDNQPHLH  365

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+ +EFK+FAELR+KLQPF+LA+FSFG+ +NG+L++ D +RAA  VCGISLT+NV+D
Sbjct  366  NIRITPEEFKNFAELRRKLQPFSLALFSFGQ-INGLLTRKDLQRAADQVCGISLTDNVLD  424

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD N DG LSSDEF+RVL +RE DIA PTE G +  +SC   C+  
Sbjct  425  IIFHVFDANRDGSLSSDEFVRVLHKRERDIAQPTEAGVLSFLSCCWHCSSA  475



>ref|XP_003572710.2| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Brachypodium distachyon]
Length=456

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS+KDFALSMVA+ADM HI K LD+V++ ++ P ++
Sbjct  279  FLKQLHDEIVRLEFSHYDIKSSKTISAKDFALSMVASADMNHINKLLDKVDDFDESPDVK  338

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA  VCG+ LT+ VVD
Sbjct  339  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAATQVCGVDLTDTVVD  397

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+ SCWL+CTK
Sbjct  398  VIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGVFSCWLNCTK  447



>ref|XP_009355791.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Pyrus 
x bretschneideri]
Length=472

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M++LEF+HYDY+ RGTI +KDFALSMVA+ADM H++  LDRVEEL+++P LR
Sbjct  311  FLRDLQDEMVKLEFSHYDYKLRGTILAKDFALSMVASADMSHLSNLLDRVEELSNKPHLR  370

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFK+FAELRKKLQPF+LA+FS+GK+ NGML+++DF+RAA HVCG+SLT+NVV+
Sbjct  371  DVRITFEEFKNFAELRKKLQPFSLALFSYGKA-NGMLTREDFQRAASHVCGVSLTDNVVE  429

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            ++F LFD N DG LS DEF+RVLQ+R  DIA P E G +
Sbjct  430  IVFQLFDFNQDGNLSLDEFVRVLQQRGRDIAQPVETGIM  468



>ref|XP_004159433.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1, mitochondrial-like 
[Cucumis sativus]
Length=511

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEF+HYD++S+G+IS+KDFALS+VA+AD+ HI K LDRVE LN EP  +
Sbjct  333  FLRQLHDEILLLEFSHYDFKSQGSISAKDFALSIVASADINHIDKLLDRVEALNKEPHFK  392

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+FDEFK FAELRKKL+ F+LAIFS+GK +NG L+K DF+RAA HVCG+S+T+NVVD
Sbjct  393  NIRITFDEFKDFAELRKKLESFSLAIFSYGK-VNGELTKQDFQRAASHVCGVSITKNVVD  451

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FD N DG LSSDEF+RV+QRRE +   P   G  G++SCW  C   C
Sbjct  452  IIFHIFDANEDGDLSSDEFVRVIQRREVNSTQPA-VGAGGLLSCWFGCAAKC  502



>ref|XP_004139397.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN60757.1| Calcium ion binding protein [Cucumis sativus]
Length=511

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEF+HYD++S+G+IS+KDFALS+VA+AD+ HI K LDRVE LN EP  +
Sbjct  333  FLRQLHDEILLLEFSHYDFKSQGSISAKDFALSIVASADINHIDKLLDRVEALNKEPHFK  392

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+FDEFK FAELRKKL+ F+LAIFS+GK +NG L+K DF+RAA HVCG+S+T+NVVD
Sbjct  393  NIRITFDEFKDFAELRKKLESFSLAIFSYGK-VNGELTKQDFQRAASHVCGVSITKNVVD  451

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FD N DG LSSDEF+RV+QRRE +   P   G  G++SCW  C   C
Sbjct  452  IIFHIFDANEDGDLSSDEFVRVIQRREVNSTQPA-VGAGGLLSCWFGCAAKC  502



>gb|EEE57362.1| hypothetical protein OsJ_07508 [Oryza sativa Japonica Group]
Length=461

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS KDFALSMVA+ADM HI K LDRV++ +D P L+
Sbjct  285  FLKQLHDEIVRLEFSHYDVKSSKTISVKDFALSMVASADMNHINKLLDRVDDFDDYPDLK  344

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR+KL+PF +AIFS+GK +NG+L+K D KRAA HVC + LT+ VVD
Sbjct  345  DLRITFEEFKAFADLRRKLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCEVDLTDKVVD  403

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+CTK
Sbjct  404  VIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNCTK  453



>gb|KHN08156.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=395

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +++RLEFAHYDY+SR TI +KDFA S+VA+AD+ H+ + L+RV+EL+++PR R
Sbjct  218  FIRDLHDEIVRLEFAHYDYKSRKTIPAKDFAHSIVASADLSHLGRLLERVDELSNDPRFR  277

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+FDEFK+FAELRKKL PF+  IFSF + + G+L++DDF+RAA HVCG+SL++NVV+
Sbjct  278  DVRITFDEFKNFAELRKKLSPFSSGIFSFAE-VQGLLTRDDFQRAASHVCGLSLSDNVVE  336

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   C    PS  L
Sbjct  337  IVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKCKDTSPSSRL  393



>gb|EEC73584.1| hypothetical protein OsI_08048 [Oryza sativa Indica Group]
Length=461

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS KDFALSM+A+ADM HI K LDRV++ +D P L+
Sbjct  285  FLKQLHDEIVRLEFSHYDVKSSKTISVKDFALSMIASADMNHINKLLDRVDDFDDYPDLK  344

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR+KL+PF +AIFS+GK +NG+L+K D KRAA HVC + LT+ VVD
Sbjct  345  DLRITFEEFKAFADLRRKLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCEVDLTDKVVD  403

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+CTK
Sbjct  404  VIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNCTK  453



>ref|NP_001047417.1| Os02g0613000 [Oryza sativa Japonica Group]
 dbj|BAF09331.1| Os02g0613000 [Oryza sativa Japonica Group]
Length=478

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS KDFALSMVA+ADM HI K LDRV++ +D P L+
Sbjct  302  FLKQLHDEIVRLEFSHYDVKSSKTISVKDFALSMVASADMNHINKLLDRVDDFDDYPDLK  361

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR+KL+PF +AIFS+GK +NG+L+K D KRAA HVC + LT+ VVD
Sbjct  362  DLRITFEEFKAFADLRRKLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCEVDLTDKVVD  420

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LS+DEFLR LQRRE+DI  P   G +G+ +C L+CTK
Sbjct  421  VIFLVFDANRDGSLSADEFLRALQRRESDIRQPASSGLMGVFTCLLNCTK  470



>gb|EEC77583.1| hypothetical protein OsI_16535 [Oryza sativa Indica Group]
Length=471

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L ++P L+
Sbjct  293  FLKGLHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMNHINKLLDRVDNLGNDPDLK  352

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFKSFA+LR++L+P  +AIF++GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  353  GVRITFEEFKSFADLRRRLEPLAMAIFTYGK-VNGLLTKQDLKRAAHHVCGVDLTDRVVD  411

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL+  K C S
Sbjct  412  IIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWLNFNK-CSS  464



>ref|NP_001053237.1| Os04g0502900 [Oryza sativa Japonica Group]
 dbj|BAF15151.1| Os04g0502900 [Oryza sativa Japonica Group]
Length=472

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L ++P L+
Sbjct  294  FLKGLHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMNHINKLLDRVDNLGNDPDLK  353

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFKSFA+LR++L+P  +AIF++GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  354  GVRITFEEFKSFADLRRRLEPLAMAIFTYGK-VNGLLTKQDLKRAAHHVCGVDLTDRVVD  412

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL+  K C S
Sbjct  413  IIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWLNFNK-CSS  465



>emb|CAH67586.1| OSIGBa0112M24.3 [Oryza sativa Indica Group]
Length=471

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L ++P L+
Sbjct  293  FLKGLHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMNHINKLLDRVDNLGNDPDLK  352

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFKSFA+LR++L+P  +AIF++GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  353  GVRITFEEFKSFADLRRRLEPLAMAIFTYGK-VNGLLTKQDLKRAAHHVCGVDLTDRVVD  411

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            +IF +FDTNHDG LSS+EF+R LQRRETD+  P   G +G++S WL+  K C S
Sbjct  412  IIFHVFDTNHDGNLSSEEFVRALQRRETDVRQPATPGSMGLLSYWLNFNK-CSS  464



>ref|XP_004976137.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Setaria italica]
 ref|XP_004976138.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Setaria italica]
 ref|XP_004976139.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X3 [Setaria italica]
Length=328

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI   LDRV++L ++P L+
Sbjct  151  FLKELHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMNHINMLLDRVDDLVNDPDLK  210

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RISF+EFK+FA+LR++L+P ++AIF++GK +NG+L+K D K AA+HVCG+ LT+ VVD
Sbjct  211  DMRISFEEFKAFADLRRRLEPLSMAIFAYGK-VNGLLTKQDLKHAAQHVCGVDLTDRVVD  269

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FDTN DG LSS+EFLR LQRRETDI  PT  G +G +SCW    K
Sbjct  270  IIFHVFDTNQDGNLSSEEFLRALQRRETDIRQPTIPGPLGFLSCWFGGRK  319



>ref|XP_006653576.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Oryza brachyantha]
Length=396

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDR + L ++P L+
Sbjct  218  FLKGLHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMSHINKLLDRADNLGNDPDLK  277

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFKSFA+LR++L+P  +AIF++GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  278  GVRITFEEFKSFADLRRRLEPLAMAIFTYGK-VNGLLTKQDLKRAAHHVCGVDLTDRVVD  336

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +IF +FDTNHDG LSS+EF+R LQRRETDI  P   G VG +S WL+
Sbjct  337  IIFHVFDTNHDGNLSSEEFVRALQRRETDIRQPATPGSVGPLSSWLN  383



>ref|XP_007161189.1| hypothetical protein PHAVU_001G049500g [Phaseolus vulgaris]
 gb|ESW33183.1| hypothetical protein PHAVU_001G049500g [Phaseolus vulgaris]
Length=487

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+S+ TIS+KDFALSMVA+AD+ H++K L RV+ LND+P L+
Sbjct  311  FLRDLHDEILRLEFAHYDYKSQETISAKDFALSMVASADISHLSKLLKRVDVLNDDPCLK  370

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+F++FKSFAELRKKL PF++AIFSFG+ +NG+L++DDF+RAA  VCGISL +NVVD
Sbjct  371  DARITFEDFKSFAELRKKLVPFSMAIFSFGE-VNGLLTRDDFQRAASQVCGISLPDNVVD  429

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +C+    S + 
Sbjct  430  IVFHVFDTNRDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWNCSNNKSSGLF  486



>gb|KHN15019.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=424

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  824  MLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDE  645
            +LRLEF+HYDY  +GTIS+KDFALS+VA+AD+ HI K LDRVEELN    LRD RI+F E
Sbjct  256  ILRLEFSHYDYNKKGTISAKDFALSLVASADINHINKLLDRVEELNSVQNLRDKRITFKE  315

Query  644  FKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDT  465
            F+ FAELRKKL  F+LAIFS+GK +NG+L+K DF+RAA  VCG+ +++ VVD+IF +FD 
Sbjct  316  FQDFAELRKKLHSFSLAIFSYGK-VNGVLTKSDFQRAASQVCGVCISDEVVDIIFHVFDA  374

Query  464  NHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKILHF  312
            N DG LS+ EF+RV+QRRE + +     GF G+ISCW +C K C S  L F
Sbjct  375  NRDGSLSASEFVRVVQRRENNNS-SRHGGFGGLISCWWNCVKNCSSAKLQF  424



>ref|XP_006365836.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
tuberosum]
Length=438

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++ RLEFAHYDY+S+G+IS+KDFALSMVA+AD+ HI KFLDRVE+L+DE +LR
Sbjct  270  FLRDLHNEISRLEFAHYDYKSQGSISAKDFALSMVASADISHIDKFLDRVEDLDDEKQLR  329

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F EF + AELRK+L  F+ +I S+ K  NG+LSK + KRAA  VC ISL++NVVD
Sbjct  330  DVRITFKEFMNLAELRKELPSFSQSILSYAK--NGLLSKQELKRAANQVCSISLSDNVVD  387

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IFF+FD + DG LSSDEFLRVLQRRE + + P E  FVG  S WLD T 
Sbjct  388  LIFFMFDLDCDGTLSSDEFLRVLQRREQESSQPRESSFVGFFSSWLDSTN  437



>ref|XP_008456571.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=505

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 2/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEF+HYD++S+G+IS KDFALS+VA+AD+ HI K LDRVE LN EP  +
Sbjct  327  FLRQLHEEILILEFSHYDFKSQGSISVKDFALSIVASADINHIDKLLDRVEALNKEPHFK  386

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+++EFK FAELRKKL+ F+LAIFS+GK +NG L+K DF+RAA  VCG+S+T+NVVD
Sbjct  387  NIRITYEEFKDFAELRKKLESFSLAIFSYGK-VNGELTKQDFQRAASQVCGVSITKNVVD  445

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FD N DG LSSDEF+RV+QRRE + + P   G  G++SCW  C   C S  L
Sbjct  446  IIFHIFDANEDGDLSSDEFVRVIQRREVNSSQPA-VGVGGLLSCWFSCAAKCSSAKL  501



>ref|XP_008668321.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=430

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++++LEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L  EP L+D+RI+F+
Sbjct  260  EIIQLEFSHYDVKSSKTIPAKDFALSMVASADMNHINKLLDRVDSLVKEPDLKDIRITFE  319

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FA+LR++L+P ++AIF++GK +NG+L+K+D KRAA+HVCG+ LT+ VVD+IF +FD
Sbjct  320  EFKAFADLRRRLEPLSMAIFAYGK-LNGLLTKEDLKRAAQHVCGVDLTDRVVDIIFHVFD  378

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            TN DG LS +EFLR LQRRETDI  PT  G +G +SCW    K
Sbjct  379  TNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSGRK  421



>ref|XP_008394129.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Malus 
domestica]
Length=472

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEF+HYDY+ RGTI ++DFALSMV++ADM H++  LDRVEEL+++P LR
Sbjct  311  FLRDLQDEMVRLEFSHYDYKLRGTILARDFALSMVSSADMSHLSNLLDRVEELSNKPHLR  370

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFKSFAELRKKLQPF+LA+FSFGK +NGML+++DF+RAA HVCG+SLT+NVV+
Sbjct  371  DVRITFEEFKSFAELRKKLQPFSLALFSFGK-VNGMLTREDFQRAASHVCGVSLTDNVVE  429

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            ++F LFD N DG LS DEF+RVLQ+R  DIA   E G +
Sbjct  430  IVFQLFDFNQDGNLSLDEFVRVLQQRGRDIAQHVETGIM  468



>gb|KFK29820.1| hypothetical protein AALP_AA7G183100 [Arabis alpina]
Length=225

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RGTIS++DFALSMVAAAD  H++K LDR ++L++ P LR
Sbjct  54   FMKELREEMLRLEFAHYDYKKRGTISARDFALSMVAAADANHLSKLLDRADDLSEHPHLR  113

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGISL++NV++
Sbjct  114  DVRISLKEFKRFDELRNKLGPFSLALFAYGKA-NGLLTMKDFKRAAYQVCGISLSDNVIE  172

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D++ P  KG    +S   + +K C
Sbjct  173  IAFHVFDSNRDGNLSVDEFLRVLHRRERDMSPPIAKGLCQFLSNGWNGSKNC  224



>ref|XP_003609483.1| Calcium binding atopy-related autoantigen [Medicago truncatula]
 gb|AES91680.1| calcium-binding EF hand protein [Medicago truncatula]
Length=468

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 141/171 (82%), Gaps = 4/171 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYD+  RGTIS+KDFALS+VA+AD+ HI K LDRV+EL+++P +R
Sbjct  300  FLRQLHDEILRLEFSHYDHNKRGTISAKDFALSLVASADINHINKLLDRVDELDNDPHIR  359

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+F+EFK+FAELR+KL+ F+LAIFS+GK +NG+L+K DF+RAA  VCG+ +TENV+D
Sbjct  360  DKRITFEEFKAFAELRRKLESFSLAIFSYGK-VNGVLAKTDFQRAASQVCGVHVTENVLD  418

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FD N DG LS+ EF+RV+QRRE DI+  +  GF  +I+CWL+C KG
Sbjct  419  IIFHVFDANRDGSLSASEFVRVIQRRE-DIS--SRFGFGNLITCWLNCVKG  466



>ref|XP_010051173.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Eucalyptus 
grandis]
Length=630

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +ML LEF+HYDY+  GTIS+KDFALSMVA+ADM H+ + LDRV++L+ EP L +VRIS +
Sbjct  460  EMLNLEFSHYDYKQNGTISAKDFALSMVASADMNHLHRLLDRVDQLDKEPHLTNVRISLE  519

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FAELRKKLQPF+LA+FS+G+ +NG+L++ DF+RAA  VCG+SLT+NVV++IF +FD
Sbjct  520  EFKNFAELRKKLQPFSLALFSYGR-VNGLLTRKDFQRAASRVCGVSLTDNVVELIFHVFD  578

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
             N DG LS++EF+RVL+RRE DIA P   G +G++SC+ +C
Sbjct  579  LNQDGNLSAEEFVRVLRRREKDIAMPEGDGLMGLLSCYHNC  619



>ref|XP_006594263.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Glycine max]
Length=459

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYDY  +GTIS++DFALS+VA+AD+ HI K LDRVEELN +  LR
Sbjct  278  FLRQLHDEILRLEFSHYDYNKKGTISARDFALSLVASADINHINKLLDRVEELNSDQNLR  337

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+F EF+ FAELRKKL+ F+LAIFS+GK +NG+L+K DF+RAA  VCG+ +T+ VVD
Sbjct  338  HIRITFKEFQDFAELRKKLKSFSLAIFSYGK-VNGVLTKSDFQRAASQVCGVCITDEVVD  396

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKILHF  312
            +IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+C K C S   +F
Sbjct  397  IIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLNCVKNCSSAQFNF  454



>gb|KHN07054.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=462

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +++ LEFAHYDY+SR TIS+KDFA S+VA+AD+ H+ + L+RV+EL+++PR +
Sbjct  285  FIRDLHDEIVGLEFAHYDYKSRKTISAKDFAHSIVASADLSHLGRLLERVDELSNDPRFK  344

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV I+F+EFK+FAELRKKL PF+LAIFSF + + G+L++DDF+RAA HVCG+SL++NVV+
Sbjct  345  DVCITFEEFKNFAELRKKLLPFSLAIFSFAE-VQGLLTRDDFQRAASHVCGVSLSDNVVE  403

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   CT   PS  L
Sbjct  404  IVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKCTDTSPSSRL  460



>ref|XP_008668320.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=458

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++++LEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L  EP L+D+RI+F+
Sbjct  288  EIIQLEFSHYDVKSSKTIPAKDFALSMVASADMNHINKLLDRVDSLVKEPDLKDIRITFE  347

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FA+LR++L+P ++AIF++GK +NG+L+K+D KRAA+HVCG+ LT+ VVD+IF +FD
Sbjct  348  EFKAFADLRRRLEPLSMAIFAYGK-LNGLLTKEDLKRAAQHVCGVDLTDRVVDIIFHVFD  406

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            TN DG LS +EFLR LQRRETDI  PT  G +G +SCW    K C S
Sbjct  407  TNQDGNLSPEEFLRALQRRETDIREPTIPGPLGFLSCWFSGRK-CSS  452



>ref|XP_006581342.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=464

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +++ LEFAHYDY+SR TIS+KDFA S+VA+AD+ H+ + L+RV+EL+++PR +
Sbjct  287  FIRDLHDEIVGLEFAHYDYKSRKTISAKDFAHSIVASADLSHLGRLLERVDELSNDPRFK  346

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV I+F+EFK+FAELRKKL PF+LAIFSF + + G+L++DDF+RAA HVCG+SL++NVV+
Sbjct  347  DVCITFEEFKNFAELRKKLLPFSLAIFSFAE-VQGLLTRDDFQRAASHVCGVSLSDNVVE  405

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +SC   CT   PS  L
Sbjct  406  IVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCWKCTDTSPSSRL  462



>gb|KHN47123.1| Calcium uptake protein 1, mitochondrial [Glycine soja]
Length=481

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYDY  +GTIS++DFALS+VA+AD+ HI K LDRVEELN +  LR
Sbjct  300  FLRQLHDEILRLEFSHYDYNKKGTISARDFALSLVASADINHINKLLDRVEELNSDQNLR  359

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+F EF+ FAELRKKL+ F+LAIFS+GK +NG+L+K DF+RAA  VCG+ +T+ VVD
Sbjct  360  HIRITFKEFQDFAELRKKLKSFSLAIFSYGK-VNGVLTKSDFQRAASQVCGVCITDEVVD  418

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKILHF  312
            +IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+C K C S   +F
Sbjct  419  IIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLNCVKNCSSAQFNF  476



>ref|NP_001142200.1| uncharacterized protein LOC100274368 [Zea mays]
 gb|ACF87871.1| unknown [Zea mays]
 gb|AFW58783.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58784.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=248

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDR + L  EP L+
Sbjct  72   FLKELHDEIIRLEFSHYDVKSSKTIPAKDFALSMVASADMNHINKLLDRADGLVKEPDLK  131

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+P ++AIF+ GK +NG+L+K+D KRA +HVCG++LT+ VVD
Sbjct  132  DIRITFEEFKAFADLRQRLEPLSMAIFAHGK-VNGLLTKEDLKRATQHVCGVNLTDRVVD  190

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW    K
Sbjct  191  IIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSGRK  240



>ref|XP_006594262.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Glycine max]
Length=487

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 137/179 (77%), Gaps = 2/179 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYDY  +GTIS++DFALS+VA+AD+ HI K LDRVEELN +  LR
Sbjct  306  FLRQLHDEILRLEFSHYDYNKKGTISARDFALSLVASADINHINKLLDRVEELNSDQNLR  365

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+F EF+ FAELRKKL+ F+LAIFS+GK +NG+L+K DF+RAA  VCG+ +T+ VVD
Sbjct  366  HIRITFKEFQDFAELRKKLKSFSLAIFSYGK-VNGVLTKSDFQRAASQVCGVCITDEVVD  424

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKILHF  312
            +IF +FD N DG LS+ EF+RV+QRRE++ +      F G+ SCWL+C K C S   +F
Sbjct  425  IIFHVFDANRDGSLSAAEFVRVVQRRESNNS-SRHDSFGGLTSCWLNCVKNCSSAQFNF  482



>ref|XP_009362319.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=474

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEF+HYDY+ RGTI +KDFALSMVA+ADM H++  LDRVEEL+++P LR
Sbjct  313  FLRDLQDEMVRLEFSHYDYKLRGTILAKDFALSMVASADMCHLSNLLDRVEELSNKPHLR  372

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFK+FAELRKKLQPF+LA+FS+GK+ NGML++++F+ AA HVCG+SLT+NVVD
Sbjct  373  DVRITFEEFKNFAELRKKLQPFSLALFSYGKA-NGMLTRENFQLAASHVCGVSLTDNVVD  431

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            ++F LFD N DG LS DEF+RVLQRR  D+A   E G +
Sbjct  432  IVFQLFDFNQDGSLSLDEFVRVLQRRGMDVAQQVETGIM  470



>ref|XP_007013634.1| Calcium-binding EF hand family protein [Theobroma cacao]
 gb|EOY31253.1| Calcium-binding EF hand family protein [Theobroma cacao]
Length=505

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYDY+  GTIS+KDFALS+VA+A++ HI + LDRV++L++E  LR
Sbjct  329  FLRGLHDEILKLEFAHYDYKIHGTISAKDFALSLVASAEISHINELLDRVDKLDNESHLR  388

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELRK+LQ F+LAIFS+GK +NG+L+K DF+RAA  VCGI++T++VVD
Sbjct  389  DLRITFEEFKNFAELRKRLQSFSLAIFSYGK-VNGVLTKKDFQRAASQVCGIAITDSVVD  447

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FD N DG LSSDEF+RV+QRRE   + P      G+ISCWL C   C +  L
Sbjct  448  IIFHVFDANRDGNLSSDEFVRVVQRRERSNSQPRADT-KGLISCWLSCATNCSTSKL  503



>ref|XP_009626826.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Nicotiana tomentosiformis]
Length=430

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +ML+LEFAHYDY+ RGTIS+KDFALSMVAAAD+ ++ K LDRV++L++E  L 
Sbjct  273  FLRDLHEEMLKLEFAHYDYKFRGTISAKDFALSMVAAADLKYLNKLLDRVDDLDNESPLS  332

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             ++ISF+EFKSFAELRKKLQPF+LA+F FG+ +NG L++ DFKRAA  VCG+SLT+NV++
Sbjct  333  RIKISFEEFKSFAELRKKLQPFSLALFCFGQ-VNGRLTRIDFKRAASQVCGVSLTDNVIE  391

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTE  384
            ++F +FDTNHDG LSSDEF+RVL++RE DIA PTE
Sbjct  392  IVFHVFDTNHDGNLSSDEFIRVLEKRERDIAEPTE  426



>ref|XP_009614691.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDY+S+G+IS+KDFALSMVA+AD+ HI KFLDRVE+L+D+P  R
Sbjct  293  FLRDLHDEILRLEFAHYDYKSQGSISAKDFALSMVASADISHINKFLDRVEDLDDKPHFR  352

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EF S A+LRK+LQ F+  I S+GK +NG+LSK + K AAK VCGISLT+NVVD
Sbjct  353  DLRITFEEFMSLAKLRKELQSFSQVILSYGK-VNGLLSKQELKGAAKQVCGISLTDNVVD  411

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IFF+FD ++DG LSSDEFLRVLQRRE + +   E       S WLD TK
Sbjct  412  LIFFMFDLDYDGSLSSDEFLRVLQRREPESSEQRESVSGSFFSGWLDSTK  461



>ref|XP_007136990.1| hypothetical protein PHAVU_009G091000g [Phaseolus vulgaris]
 gb|ESW08984.1| hypothetical protein PHAVU_009G091000g [Phaseolus vulgaris]
Length=462

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +++RLEFAHYDY+SR TIS+KDFA S+VA+AD+ H+ + L  V+EL+++PR +
Sbjct  285  FIRDLHDEIVRLEFAHYDYKSRKTISAKDFAHSIVASADLSHLGRLLKLVDELSNDPRFK  344

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFK+F+ELRKKL PF+LAIFSF + + G+L++DDF+RAA HVCG+SL++NV++
Sbjct  345  DVRITFEEFKNFSELRKKLLPFSLAIFSFAE-VQGLLTRDDFQRAASHVCGLSLSDNVIE  403

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F LFD N DG LS++EF+RVLQ RE DIA  TE G +G +SC   C    PS  L
Sbjct  404  IVFHLFDANGDGSLSTEEFVRVLQHRERDIAQTTETGIMGFLSCCWKCRNTSPSSRL  460



>ref|XP_006578131.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Glycine 
max]
Length=391

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +++RLEFAHYDY+SR TI +KDFA S+VA+AD+ H+ + L+RV+EL+++PR R
Sbjct  196  FIRDLHDEIVRLEFAHYDYKSRKTIPAKDFAHSIVASADLSHLGRLLERVDELSNDPRFR  255

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+FDEFK+FAELRKKL PF+  IFSF + + G+L++DDF+RAA HVCG+SL++NVV+
Sbjct  256  DVRITFDEFKNFAELRKKLSPFSSGIFSFAE-VQGLLTRDDFQRAASHVCGLSLSDNVVE  314

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            ++F LFD N DG LS++EF+ VLQ RE DIA P E G +G +S CW
Sbjct  315  IVFHLFDANEDGNLSTEEFVSVLQHRERDIAQPVETGIMGFLSCCW  360



>ref|XP_010665654.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=505

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 136/172 (79%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYDYRS+GTI +KDFALSMVA+AD+ H+ K L+RV+EL+++P+  
Sbjct  328  FLRKLHDEIVRLEFSHYDYRSQGTILAKDFALSMVASADIRHVNKLLERVDELDNDPQFS  387

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+ DEF+ FAELR KL+PF LA+F++GK +NG++++DDF+RAA  VCG+SLT+NVV+
Sbjct  388  SIRITEDEFRKFAELRTKLEPFALALFAYGK-VNGLMTRDDFQRAASQVCGVSLTDNVVE  446

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +I+ +FD N DG L +DEF+RVLQ+R  DIA P E G  G +SC  +C   C
Sbjct  447  IIYHVFDANRDGNLCADEFVRVLQKRNRDIAQPLETGLFGFLSCCRNCANRC  498



>ref|XP_010665651.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=509

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 136/172 (79%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYDYRS+GTI +KDFALSMVA+AD+ H+ K L+RV+EL+++P+  
Sbjct  332  FLRKLHDEIVRLEFSHYDYRSQGTILAKDFALSMVASADIRHVNKLLERVDELDNDPQFS  391

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+ DEF+ FAELR KL+PF LA+F++GK +NG++++DDF+RAA  VCG+SLT+NVV+
Sbjct  392  SIRITEDEFRKFAELRTKLEPFALALFAYGK-VNGLMTRDDFQRAASQVCGVSLTDNVVE  450

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +I+ +FD N DG L +DEF+RVLQ+R  DIA P E G  G +SC  +C   C
Sbjct  451  IIYHVFDANRDGNLCADEFVRVLQKRNRDIAQPLETGLFGFLSCCRNCANRC  502



>ref|XP_010648727.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Vitis 
vinifera]
Length=231

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++L LEFAHYDY+ RG+IS+KDFALSMVA+AD+ H+ + LDRV+ LN +  L 
Sbjct  54   FMRDLHDELLILEFAHYDYKLRGSISAKDFALSMVASADLSHLNRLLDRVDGLNKQSSLS  113

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFKSFAELR++L+PF LA+ S+GK +NG+L+K DF+RAA +VCGISL++ VV+
Sbjct  114  DIRITFEEFKSFAELRRRLRPFALALSSYGK-VNGLLTKTDFQRAASNVCGISLSKCVVE  172

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC  +
Sbjct  173  IIFHVFDMNDDGKLSSEELVRVLQKRERDIAQPMESGIMGFFSCCCN  219



>ref|XP_004508411.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Cicer arietinum]
Length=461

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLE++HYDY  RGTIS+KDFALS+VA+AD+ HI K LDRV+EL+++P + 
Sbjct  286  FLRQLHDEILRLEYSHYDYNKRGTISAKDFALSLVASADINHINKLLDRVDELDNDPHIT  345

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+F+EFK+FAELR+KLQ F+LAIFS+GK +NG+L+K+DF+RAA  VCGI++T+ V+D
Sbjct  346  GIRITFEEFKAFAELRRKLQSFSLAIFSYGK-VNGVLTKNDFQRAASQVCGINVTDEVLD  404

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC-TKGCPSKILH  315
            +IF +FD N DG LS+ EF+RV+QRRE      +  GF  ++SCWL+C T  C S  L 
Sbjct  405  IIFHVFDANRDGSLSASEFIRVIQRRENS---ASRFGFGSVMSCWLNCVTSNCSSAKLQ  460



>ref|XP_007201997.1| hypothetical protein PRUPE_ppa024920mg [Prunus persica]
 gb|EMJ03196.1| hypothetical protein PRUPE_ppa024920mg [Prunus persica]
Length=371

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 133/162 (82%), Gaps = 4/162 (2%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +MLRLEF+HYDY+ +GTIS+KDFALS+VA+AD+    K LDRV+EL+++PRL+D++I++ 
Sbjct  202  EMLRLEFSHYDYKEQGTISAKDFALSLVASADISDTNKLLDRVDELDNDPRLKDIKITYK  261

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK FAELRK LQ F+LAIFS+G+ +NG+L+K D +RAA  VCGIS+  NV+D+IF +FD
Sbjct  262  EFKDFAELRKNLQSFSLAIFSYGE-VNGVLTKKDLQRAASQVCGISVPNNVIDIIFHVFD  320

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
             N DG LS++EF+RVLQRR  ++   +E GF G++SCWL+C 
Sbjct  321  ANGDGDLSANEFVRVLQRRGGEV---SETGFRGLLSCWLNCA  359



>ref|XP_006412519.1| hypothetical protein EUTSA_v10024993mg [Eutrema salsugineum]
 gb|ESQ53972.1| hypothetical protein EUTSA_v10024993mg [Eutrema salsugineum]
Length=496

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RGTIS+KDFALSMVAAAD  H++K LDRVE+L++ P LR
Sbjct  323  FMKDLTEEMLRLEFAHYDYKRRGTISAKDFALSMVAAADASHLSKLLDRVEDLSEHPHLR  382

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS +EFK F ELR KL PF+LA+F++G++ NG+L+  DFKRAA  VCGISL++NV++
Sbjct  383  DIRISLEEFKQFDELRNKLGPFSLALFAYGQA-NGLLTMTDFKRAASQVCGISLSDNVIE  441

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSK  324
            + F +FD+N DG LS +EFLRVL RRE D++ P  KG     S   + +K C S+
Sbjct  442  IAFHVFDSNRDGTLSVEEFLRVLHRRERDMSQPIAKGLCQYFSDRWNGSKNCSSR  496



>gb|KCW79049.1| hypothetical protein EUGRSUZ_C00479 [Eucalyptus grandis]
Length=231

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYD RS GTIS KDFALS+VA+ADM H+ K LDRV+E++ EP LR
Sbjct  54   FLKDLHDEILRLEFSHYDTRSVGTISVKDFALSLVASADMCHLNKLLDRVDEIDGEPSLR  113

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RISF EFK FAELRK LQ F+LAIFS+GK + G+L+K DF+RAA  VCGIS+T NVVD
Sbjct  114  DLRISFQEFKDFAELRKMLQSFSLAIFSYGK-VKGLLTKRDFQRAASQVCGISITSNVVD  172

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMI  363
            +IF LFD N DG LSS EF+R +QR E++ A   E G  G+I
Sbjct  173  IIFHLFDANRDGNLSSKEFIRAVQRCESNGAQAREAGVKGLI  214



>ref|XP_004953089.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Setaria italica]
Length=476

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 143/177 (81%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI  KDFALSMVA+ADM HI K LDRV++L+D   L+
Sbjct  299  FLKQLHDEIVRLEFSHYDVKSSQTIPVKDFALSMVASADMNHINKLLDRVDDLDDNADLK  358

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+NVVD
Sbjct  359  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-INGLLTKQDLKRAASHVCGVDLTDNVVD  417

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FD + DG LSS+EFLR LQRRE+DI  PT  GF+G+++CWL+CTK    ++L
Sbjct  418  IIFHVFDADRDGNLSSEEFLRSLQRRESDIRQPTTSGFLGVVACWLNCTKCSLQQML  474



>ref|XP_010526229.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=507

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 134/172 (78%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RGTIS+KDFALSMVAAAD  H++K LDRV+EL+  P LR
Sbjct  330  FMRDLTDEMLRLEFAHYDYKGRGTISAKDFALSMVAAADASHLSKLLDRVDELHVHPHLR  389

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS ++FK FAELR+KL PF+LA+F+ G++ NG+L+  DFKRAA HVC ISL++NV++
Sbjct  390  DIRISLEDFKQFAELRRKLGPFSLALFACGQA-NGLLTMKDFKRAASHVCDISLSDNVIE  448

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F++FD+N DG LS DEFLRVL +RE DI+ P  +G    +S   + +K C
Sbjct  449  IAFYVFDSNRDGNLSVDEFLRVLHQRERDISQPVTRGLFQFMSGGPNGSKNC  500



>ref|NP_194934.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 emb|CAA16584.1| putative protein [Arabidopsis thaliana]
 emb|CAB79924.1| putative protein [Arabidopsis thaliana]
 gb|AAL59985.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67515.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85999.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=498

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H++K LDRVE L++ P LR
Sbjct  325  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLR  384

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGI+L++NV++
Sbjct  385  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGITLSDNVIE  443

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            + F +FD+N DG LS DEFLRVL RRE D+A P  KG     S     +K C S
Sbjct  444  IAFHVFDSNQDGNLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWKGSKNCSS  497



>ref|XP_008219541.1| PREDICTED: calcium uptake protein 1, mitochondrial [Prunus mume]
Length=469

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 133/159 (84%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEFAHYDY+ RGTI +KDFALSMVA+ADM H++  L+RV+ELN++P L+
Sbjct  309  FLRDLQDEMVRLEFAHYDYKLRGTILAKDFALSMVASADMTHLSNLLNRVDELNNKPHLK  368

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFKSFAELRKKLQP +LA+FS+GK+ NGML+++DF+RAA HVCG+SLT+NVV+
Sbjct  369  DVRITFEEFKSFAELRKKLQPLSLALFSYGKA-NGMLTQEDFQRAASHVCGVSLTDNVVE  427

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            +IF +FD+N DG LS  EF+RVL +R  DIA   + G +
Sbjct  428  IIFHVFDSNRDGNLSLAEFVRVLHQRGRDIAQHVDTGIM  466



>ref|XP_003603344.1| Calcium binding atopy-related autoantigen [Medicago truncatula]
Length=478

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            Q+LRLEF HYD++ + TI +KDFA S+VA+AD+ H++K L+RV+ELN++P+   VRI+F+
Sbjct  308  QILRLEFVHYDFKFQKTILAKDFAHSIVASADVNHLSKLLERVDELNNDPQFNSVRITFE  367

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK+FAELRKKL P +LA+FSF K +NG+L++DDF+RAA  VCG+SL++NVV+++F LFD
Sbjct  368  EFKNFAELRKKLVPLSLALFSFAK-VNGLLTRDDFQRAASSVCGLSLSDNVVEIVFHLFD  426

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            T+ DG LSS+EF+RVLQRRE D+    E G +G +SC  +CT   P   L
Sbjct  427  TSGDGNLSSNEFVRVLQRRERDVGRSVETGIMGFLSCCWNCTDNSPGSQL  476



>ref|XP_008661648.1| PREDICTED: uncharacterized protein LOC100274368 isoform X1 [Zea 
mays]
 gb|ACL54137.1| unknown [Zea mays]
 gb|AFW58780.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58781.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
 gb|AFW58782.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=464

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDR + L  EP L+
Sbjct  288  FLKELHDEIIRLEFSHYDVKSSKTIPAKDFALSMVASADMNHINKLLDRADGLVKEPDLK  347

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+P ++AIF+ GK +NG+L+K+D KRA +HVCG++LT+ VVD
Sbjct  348  DIRITFEEFKAFADLRQRLEPLSMAIFAHGK-VNGLLTKEDLKRATQHVCGVNLTDRVVD  406

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW    K
Sbjct  407  IIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSGRK  456



>ref|XP_008452897.1| PREDICTED: calcium uptake protein 1, mitochondrial [Cucumis melo]
 gb|ADN34123.1| calcium ion binding protein [Cucumis melo subsp. melo]
Length=476

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 130/159 (82%), Gaps = 2/159 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +ML+LEFAHYDY+ RGTIS+KDFALSMVA+AD   + + LDRV  ++D+P  +D+RIS++
Sbjct  313  EMLKLEFAHYDYKLRGTISAKDFALSMVASADSSRLRELLDRVSRMDDKPHFKDIRISWE  372

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK F  LR+KLQPF+LA+FS+GK +NG+L+K+DF+RAA  VCGI+L++ VVD+IF LFD
Sbjct  373  EFKDFDTLRRKLQPFSLALFSYGK-VNGLLTKNDFQRAASQVCGINLSDEVVDIIFHLFD  431

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            TN DG LSS+EF+RVL  RE D+A P E G +G+ S CW
Sbjct  432  TNLDGELSSEEFVRVLHNRERDVAQPVEAGMMGLFSRCW  470



>ref|NP_001147122.1| calcium binding atopy-related autoantigen 1 [Zea mays]
 gb|ACG25549.1| calcium binding atopy-related autoantigen 1 [Zea mays]
 gb|ACR35585.1| unknown [Zea mays]
 gb|AFW62953.1| calcium binding atopy autoantigen 1 isoform 1 [Zea mays]
 gb|AFW62954.1| calcium binding atopy autoantigen 1 isoform 2 [Zea mays]
Length=472

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI  KDFALSMVA+ADM +I K LDRVE+L+D   L+
Sbjct  295  FLKKLHDEIVRLEFSHYDVKSSNTIPVKDFALSMVASADMIYIDKLLDRVEDLDDNLDLK  354

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  355  DLRITFEEFKAFADLRRRLEPFRMAIFSYGK-VNGLLTKQDLKRAASHVCGVDLTDKVVD  413

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FD N DG LSS+EFLR LQRRE+DI  P   GF+G+I+CWL+CTK    ++L
Sbjct  414  IIFHVFDANCDGNLSSEEFLRSLQRRESDIRQPATSGFLGVIACWLNCTKCSLQQML  470



>ref|XP_010437956.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=488

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H+ K LDRV+ L++ PRLR
Sbjct  317  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLGKLLDRVDGLSEHPRLR  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGI+L++NV++
Sbjct  377  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGITLSDNVIE  435

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   + +K C
Sbjct  436  IAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWNGSKNC  487



>gb|AES73595.2| calcium-binding EF hand protein [Medicago truncatula]
Length=455

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++LRLEF HYD++ + TI +KDFA S+VA+AD+ H++K L+RV+ELN++P+  
Sbjct  278  FIRDLHDEILRLEFVHYDFKFQKTILAKDFAHSIVASADVNHLSKLLERVDELNNDPQFN  337

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFK+FAELRKKL P +LA+FSF K +NG+L++DDF+RAA  VCG+SL++NVV+
Sbjct  338  SVRITFEEFKNFAELRKKLVPLSLALFSFAK-VNGLLTRDDFQRAASSVCGLSLSDNVVE  396

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            ++F LFDT+ DG LSS+EF+RVLQRRE D+    E G +G +SC  +CT   P   L
Sbjct  397  IVFHLFDTSGDGNLSSNEFVRVLQRRERDVGRSVETGIMGFLSCCWNCTDNSPGSQL  453



>ref|XP_010447444.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial isoform 
X1 [Camelina sativa]
Length=497

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H+ K LDRV+ L++ PRLR
Sbjct  326  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLGKLLDRVDGLSEHPRLR  385

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGI+L++NV++
Sbjct  386  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGITLSDNVIE  444

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   + +K C
Sbjct  445  IAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWNGSKNC  496



>ref|XP_006283595.1| hypothetical protein CARUB_v10004651mg [Capsella rubella]
 gb|EOA16493.1| hypothetical protein CARUB_v10004651mg [Capsella rubella]
Length=496

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H++K LDRV+ L++ P LR
Sbjct  325  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLSKLLDRVDGLSEHPHLR  384

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGI+L++NV++
Sbjct  385  DIRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGITLSDNVIE  443

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   + +K C
Sbjct  444  IAFHVFDSNRDGSLSVDEFLRVLHRRERDVAQPIAKGLSRYFSDGWNGSKNC  495



>ref|XP_009126406.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial [Brassica 
rapa]
Length=494

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYDY+ RGTIS+KDFALSMVAAAD  H+ K LDRVE+L++   L+
Sbjct  321  FLKDLTEEMLRLEFAHYDYKRRGTISAKDFALSMVAAADASHLGKLLDRVEDLSEHAHLQ  380

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRIS  EFK FAELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCG+SL++NV++
Sbjct  381  DVRISLKEFKQFAELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGVSLSDNVIE  439

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            + F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   + +  C S
Sbjct  440  IAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWNGSNKCSS  493



>ref|XP_006852820.1| hypothetical protein AMTR_s00033p00176330 [Amborella trichopoda]
 gb|ERN14287.1| hypothetical protein AMTR_s00033p00176330 [Amborella trichopoda]
Length=391

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYDY+S GTIS++DFALSMVAAADMG I+KFLDRV+EL+D P LR
Sbjct  193  FLKDLHHEIIRLEFAHYDYKSCGTISARDFALSMVAAADMGLISKFLDRVDELSDNPHLR  252

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D++I+F+EFK+FAELRKKL P  LAIFS+GK +NG+L+KDDF+RAA HVC + +TEN+VD
Sbjct  253  DMQITFEEFKAFAELRKKLYPLALAIFSYGK-VNGLLTKDDFQRAASHVCDVVVTENMVD  311

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDI-AH  393
            ++F +FD N DG LS DEFL  +QRRE DI AH
Sbjct  312  VVFHVFDANRDGNLSIDEFLGAVQRRERDIVAH  344



>emb|CDX75217.1| BnaA01g04850D [Brassica napus]
Length=495

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYDY+ RGTIS+KDFALSMVAAAD  H+ K LDRVE+L++   L+
Sbjct  322  FLKDLTEEMLRLEFAHYDYKRRGTISAKDFALSMVAAADASHLGKLLDRVEDLSEHAHLQ  381

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRIS  EFK FAELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCG+SL++NV++
Sbjct  382  DVRISLKEFKQFAELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGVSLSDNVIE  440

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            + F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   + +  C S
Sbjct  441  IAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWNGSNKCSS  494



>ref|XP_009782530.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Nicotiana sylvestris]
Length=428

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYDY+ RGTIS+KDFALSMVAAAD+ ++ K LDRV++L++E  L 
Sbjct  271  FLRDLHEEILKLEFAHYDYKFRGTISAKDFALSMVAAADLKYLNKLLDRVDDLDNESPLS  330

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
              +ISF+EFKSFAELRKKLQPF+LA+F FG+ +NG L++ DFKRAA  VCG+SLT+NV++
Sbjct  331  RTKISFEEFKSFAELRKKLQPFSLALFCFGQ-VNGHLTRSDFKRAASQVCGVSLTDNVIE  389

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTE  384
            ++F +FDTN DG LSSDEF+RVL++RE DIA P E
Sbjct  390  IVFHVFDTNRDGNLSSDEFIRVLEKREKDIAEPIE  424



>emb|CDX68814.1| BnaC01g06390D [Brassica napus]
Length=494

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEFAHYDY+ RGTIS+KDFALSMVAAAD  H+ K LDRVE+L++   L+
Sbjct  321  FLKDLTEEMLRLEFAHYDYKRRGTISAKDFALSMVAAADASHLGKLLDRVEDLSEHAHLQ  380

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRIS  EFK FAELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCG+SL++NV++
Sbjct  381  DVRISLKEFKQFAELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGVSLSDNVIE  439

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            + F +FD+N DG LS +EFLRVL RRE DI+ P  KG     S   + +  C S
Sbjct  440  IAFHVFDSNRDGNLSVEEFLRVLHRREKDISQPIAKGLCQYFSDGWNGSNKCSS  493



>ref|XP_011017911.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017912.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017913.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
 ref|XP_011017914.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Populus euphratica]
Length=384

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYDYRS GTIS+KDFALS+VA+AD+ HI+K LDRV+E ++EP++R
Sbjct  207  FLRDLHDEILRLEFAHYDYRSCGTISAKDFALSLVASADIRHISKLLDRVDEASNEPQIR  266

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+ +EFKSFAELR++LQ  +LAIFS GK +NG+L++ DF+RA+  VCGIS+T ++VD
Sbjct  267  DIRITLEEFKSFAELRRQLQYLSLAIFSHGK-VNGVLTRKDFQRASSQVCGISITNDLVD  325

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
            + F +F+ N DG LSSD+F+RVLQ RET      E G  G++SC  +C K   S
Sbjct  326  ITFHVFNANRDGNLSSDQFVRVLQGRETASWIAREPGLKGLMSCCANCAKNYSS  379



>gb|KFK29821.1| hypothetical protein AALP_AA7G183100 [Arabis alpina]
Length=494

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RGTIS++DFALSMVAAAD  H++K LDR ++L++ P LR
Sbjct  323  FMKELREEMLRLEFAHYDYKKRGTISARDFALSMVAAADANHLSKLLDRADDLSEHPHLR  382

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGISL++NV++
Sbjct  383  DVRISLKEFKRFDELRNKLGPFSLALFAYGKA-NGLLTMKDFKRAAYQVCGISLSDNVIE  441

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D++ P  KG    +S   + +K C
Sbjct  442  IAFHVFDSNRDGNLSVDEFLRVLHRRERDMSPPIAKGLCQFLSNGWNGSKNC  493



>gb|EMT14850.1| Calcium-binding atopy-related autoantigen 1 [Aegilops tauschii]
Length=387

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 131/161 (81%), Gaps = 1/161 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS+KDFALSMVA+ADM HI K LDRV++ ++ P ++
Sbjct  224  FLKQLHDEIVRLEFSHYDVKSSKTISAKDFALSMVASADMNHINKLLDRVDDFDESPDVK  283

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  284  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCGVDLTDKVVD  342

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGM  366
            +IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G+
Sbjct  343  VIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMGV  383



>ref|XP_002531446.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF30933.1| calcium ion binding protein, putative [Ricinus communis]
Length=496

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEFAHYD+R+RGTIS+KDFALSMVA+AD+ HI K LDRV+ELN+EP LR
Sbjct  321  FLRDLHDEILRLEFAHYDFRTRGTISAKDFALSMVASADISHINKLLDRVDELNNEPHLR  380

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EF++FAELRK+LQ  +LAIFS+GK +NG L+K DF+RAA  VCG+S+T N+VD
Sbjct  381  DIRITFEEFRAFAELRKQLQSLSLAIFSYGK-VNGTLTKYDFQRAASQVCGVSITNNLVD  439

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHP  390
            +IF +FD + DG LSSDEF+ VLQRRE D   P
Sbjct  440  IIFHVFDDDRDGSLSSDEFISVLQRREKDNLVP  472



>ref|XP_010432776.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1 homolog, 
mitochondrial-like [Camelina sativa]
Length=495

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 130/172 (76%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H+ K LDRV+ L++ PRLR
Sbjct  324  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLGKLLDRVDGLSEHPRLR  383

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCGI+L++NV++
Sbjct  384  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQVCGITLSDNVIE  442

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS +EFLRVL RRE D+A P  KG     S   + +K C
Sbjct  443  IAFHVFDSNRDGSLSVEEFLRVLHRRERDVAQPIAKGLSRYFSDGWNGSKNC  494



>gb|EMS64759.1| Calcium uptake protein 1, mitochondrial [Triticum urartu]
Length=391

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS+KDFALSMVA+ADM HI K LDRV++ ++ P ++
Sbjct  224  FLKQLHDEIVRLEFSHYDVKSSKTISAKDFALSMVASADMNHINKLLDRVDDFDESPDVK  283

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  284  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAATHVCGVDLTDKVVD  342

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVG  369
            +IF +FD N DG LSS+EFLR LQRRE++I  PT  G +G
Sbjct  343  VIFHVFDANCDGNLSSEEFLRALQRRESNIRQPTTPGLMG  382



>ref|XP_004145522.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004157086.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN55467.1| hypothetical protein Csa_4G652790 [Cucumis sativus]
Length=476

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 129/159 (81%), Gaps = 2/159 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +ML+LEFAHYDY+ RGTIS+KDFALSMVA+AD   + + LDRV  ++++P   D+RIS++
Sbjct  313  EMLKLEFAHYDYKLRGTISAKDFALSMVASADSSRLRELLDRVSRMDNKPHFMDIRISWE  372

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK F  LR+KLQPF+LA+FS+GK +NG+L+K+DF+RAA  VCGI+L++ VVD+IF LFD
Sbjct  373  EFKDFDTLRRKLQPFSLALFSYGK-VNGLLTKNDFQRAASQVCGINLSDEVVDIIFHLFD  431

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMIS-CW  354
            TN DG LSS+EF+RVL  RE D+A P E G +G+ S CW
Sbjct  432  TNLDGELSSEEFVRVLHNRERDVAQPVEAGMMGLFSRCW  470



>ref|XP_002869294.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45553.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEF HYDY+ RG+IS+KDFALSMVAAAD  H++K LDRVE L + P LR
Sbjct  325  FMKDLTEEMLRLEFGHYDYKQRGSISAKDFALSMVAAADASHLSKLLDRVESLTEHPHLR  384

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  VCG++L++NV++
Sbjct  385  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMRDFKRAASQVCGVTLSDNVIE  443

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            + F +FD+N DG LS DEFLRVL RRE D+A P  KG     S   + +K C
Sbjct  444  IAFHVFDSNRDGNLSVDEFLRVLHRRERDMAQPIAKGLSRYFSDGWNGSKNC  495



>ref|XP_010648725.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Vitis vinifera]
Length=368

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++L+LEFAHYDY+ RG+IS+KDFALSMVA+AD+ ++ + LDRV+ LN +  L 
Sbjct  191  FMRDLHDELLKLEFAHYDYKLRGSISAKDFALSMVASADLSNLNRLLDRVDGLNKQSSLS  250

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFKSFAELR++L+PF LA+ S+GK +NG+L+K DF+RAA +VCGISL++ VV+
Sbjct  251  DIRITFEEFKSFAELRRRLRPFALALSSYGK-VNGLLTKTDFQRAASNVCGISLSKCVVE  309

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC  +
Sbjct  310  IIFHVFDMNDDGNLSSEELVRVLQKRERDIAQPMESGIMGFFSCCCN  356



>ref|XP_004231518.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Solanum 
lycopersicum]
Length=442

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 2/169 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++ RLEFAHYDY+S+G+IS+KDFALSMVA+AD+ HI KFLDRVE+L+DE +LR
Sbjct  274  FLRDLHNEISRLEFAHYDYKSQGSISAKDFALSMVASADISHIDKFLDRVEDLDDEKQLR  333

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DV I+F EF + AELRK+L  F+ +I S+ KS  G+LSK + K AA  VC ISL++NVVD
Sbjct  334  DVCITFKEFMNLAELRKELPSFSQSILSYAKS--GVLSKQELKLAANQVCNISLSDNVVD  391

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
            +IFF+FD + DG LSSDEFLRVLQRRE + +   E  FVG  S WLD T
Sbjct  392  LIFFMFDLDCDGTLSSDEFLRVLQRREQESSQTRESSFVGFFSGWLDST  440



>ref|XP_007225509.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica]
 gb|EMJ26708.1| hypothetical protein PRUPE_ppa000461mg [Prunus persica]
Length=1155

 Score =   210 bits (534),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEFAHYDY+ RGTI +KDFALSMVA+ADM H++  L+RV+ELN++P L+
Sbjct  301  FLRDLQDEMVRLEFAHYDYKLRGTILAKDFALSMVASADMTHLSNLLNRVDELNNKPHLK  360

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            DVRI+F+EFKSFAELRKKLQP +LA+FS+GK+ NGML+++DF+RAA HVCG+ LT+NVV+
Sbjct  361  DVRITFEEFKSFAELRKKLQPLSLALFSYGKA-NGMLTREDFQRAASHVCGVCLTDNVVE  419

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            +IF +FD+N DG LS  EF+RVL +R  DIA   + G +
Sbjct  420  IIFHVFDSNRDGNLSLAEFVRVLHQRGRDIAQHVDTGIM  458



>ref|XP_003631765.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X1 
[Vitis vinifera]
 emb|CBI21112.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++L+LEFAHYDY+ RG+IS+KDFALSMVA+AD+ ++ + LDRV+ LN +  L 
Sbjct  297  FMRDLHDELLKLEFAHYDYKLRGSISAKDFALSMVASADLSNLNRLLDRVDGLNKQSSLS  356

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFKSFAELR++L+PF LA+ S+GK +NG+L+K DF+RAA +VCGISL++ VV+
Sbjct  357  DIRITFEEFKSFAELRRRLRPFALALSSYGK-VNGLLTKTDFQRAASNVCGISLSKCVVE  415

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC  +
Sbjct  416  IIFHVFDMNDDGNLSSEELVRVLQKRERDIAQPMESGIMGFFSCCCN  462



>ref|XP_008456564.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Cucumis melo]
Length=532

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 137/204 (67%), Gaps = 29/204 (14%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L LEF+HYD++S+G+IS KDFALS+VA+AD+ HI K LDRVE LN EP  +
Sbjct  327  FLRQLHEEILILEFSHYDFKSQGSISVKDFALSIVASADINHIDKLLDRVEALNKEPHFK  386

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKH------------  525
            ++RI+++EFK FAELRKKL+ F+LAIFS+GK +NG L+K DF+RAA              
Sbjct  387  NIRITYEEFKDFAELRKKLESFSLAIFSYGK-VNGELTKQDFQRAASQVSTHQTFQVNKL  445

Query  524  ---------------VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHP  390
                           VCG+S+T+NVVD+IF +FD N DG LSSDEF+RV+QRRE + + P
Sbjct  446  KINLIHNVGFVFLYKVCGVSITKNVVDIIFHIFDANEDGDLSSDEFVRVIQRREVNSSQP  505

Query  389  TEKGFVGMISCWLDCTKGCPSKIL  318
               G  G++SCW  C   C S  L
Sbjct  506  A-VGVGGLLSCWFSCAAKCSSAKL  528



>gb|EYU20233.1| hypothetical protein MIMGU_mgv1a005202mg [Erythranthe guttata]
Length=493

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++ LEFAHYDY+ RGTIS+KDFALSMVA+AD+ H++K L RV+EL++ P L 
Sbjct  301  FLRHLHDELVELEFAHYDYKLRGTISAKDFALSMVASADLKHLSKLLRRVDELDNHPGLG  360

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            ++RI+ +EFKSFA+LRKKLQPF+LA+FSFG+ +NG+L++ D +RAA  VCG+SLT+ +++
Sbjct  361  NIRITREEFKSFAKLRKKLQPFSLALFSFGQ-VNGLLTRKDLQRAANQVCGVSLTDKMLE  419

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCW  354
            +IF +FD N DG LS+DEF+RVL +RE DIA PTE GF   +S +
Sbjct  420  IIFHVFDANKDGRLSADEFVRVLHKRERDIAEPTEAGFFSFLSFF  464



>ref|XP_009405765.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=459

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = -1

Query  788  SRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDEFKSFAELRKKLQ  609
            SRGTIS+KDFALSMVA+ADM H+ K LDRV+EL+D P LRD+  +F+EFK+FAELR++L+
Sbjct  300  SRGTISAKDFALSMVASADMNHVDKLLDRVDELDDSPSLRDLHFTFEEFKAFAELRRRLR  359

Query  608  PFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSSDEFL  429
            P TLAIFS+GK MNG+L+K DF RAA HVCGISLTEN+VD+IF +FDTN DG LSS+EFL
Sbjct  360  PLTLAIFSYGK-MNGLLTKQDFIRAASHVCGISLTENMVDVIFHVFDTNRDGNLSSEEFL  418

Query  428  RVLQRRETDIAHPTEK--GFVGMISCWLDCTKGC  333
            R LQRRE+D   P+    G +G++SCWL CTK C
Sbjct  419  RALQRRESDACQPSAPGGGIMGLLSCWLQCTKNC  452



>emb|CBI21113.3| unnamed protein product [Vitis vinifera]
Length=975

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++L LEFAHYDY+ RG+IS+KDFALSMVA+AD+ H+ + LDRV+ LN +  L 
Sbjct  798  FMRDLHDELLILEFAHYDYKLRGSISAKDFALSMVASADLSHLNRLLDRVDGLNKQSSLS  857

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFKSFAELR++L+PF LA+ S+GK +NG+L+K DF+RAA +VCGISL++ VV+
Sbjct  858  DIRITFEEFKSFAELRRRLRPFALALSSYGK-VNGLLTKTDFQRAASNVCGISLSKCVVE  916

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISC  357
            +IF +FD N DG LSS+E +RVLQ+RE DIA P E G +G  SC
Sbjct  917  IIFHVFDMNDDGKLSSEELVRVLQKRERDIAQPMESGIMGFFSC  960



>ref|XP_010047215.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Eucalyptus 
grandis]
Length=492

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++LRLEF+HYD RS GTIS KDFALS+VA+ADM H+ K LDRV+E++ EP LR
Sbjct  315  FLKDLHDEILRLEFSHYDTRSVGTISVKDFALSLVASADMCHLNKLLDRVDEIDGEPSLR  374

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RISF EFK FAELRK LQ F+LAIFS+GK + G+L+K DF+RAA  VCGIS+T NVVD
Sbjct  375  DLRISFQEFKDFAELRKMLQSFSLAIFSYGK-VKGLLTKRDFQRAASQVCGISITSNVVD  433

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMI  363
            +IF LFD N DG LSS EF+R +QR E++ A   E G  G+I
Sbjct  434  IIFHLFDANRDGNLSSKEFIRAVQRCESNGAQAREAGVKGLI  475



>ref|XP_008242922.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Prunus 
mume]
Length=500

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 131/162 (81%), Gaps = 4/162 (2%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEF+HYDY+ + TIS+KDFALS+VA+AD+    K LDRV+EL+++PR +D++I++ 
Sbjct  330  EILRLEFSHYDYKEQRTISAKDFALSLVASADISDTNKLLDRVDELDNDPRFKDIKITYK  389

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK FAELRK LQ F+LAIFS+G+ +NG+L+K D +RAA  VCGIS+  NV+D+IF +FD
Sbjct  390  EFKDFAELRKNLQSFSLAIFSYGE-VNGVLTKKDLQRAASQVCGISVPNNVIDIIFHVFD  448

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
             N DG LS++EF+RVLQRR  ++   ++ GF G++SCWL+C 
Sbjct  449  ANGDGDLSANEFVRVLQRRGGEV---SQTGFRGLLSCWLNCA  487



>emb|CAE02932.3| OSJNBa0014K14.4 [Oryza sativa Japonica Group]
Length=611

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 129/171 (75%), Gaps = 12/171 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI K LDRV+ L ++P L+
Sbjct  294  FLKGLHDEIIRLEFSHYDVKSSNTIPAKDFALSMVASADMNHINKLLDRVDNLGNDPDLK  353

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             VRI+F+EFKSFA+LR++L+P  +AIF++GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  354  GVRITFEEFKSFADLRRRLEPLAMAIFTYGK-VNGLLTKQDLKRAAHHVCGVDLTDRVVD  412

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
            +IF +FDTNHDG LSS+EF+R LQRRETD+            S WLD   G
Sbjct  413  IIFHVFDTNHDGNLSSEEFVRALQRRETDVH-----------SSWLDFRHG  452



>gb|EMS49497.1| Calcium uptake protein 1, mitochondrial [Triticum urartu]
Length=403

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI+K LDR + L ++P L+
Sbjct  229  FLKELHEEIIRLEFSHYDVKSTNTIPAKDFALSMVASADMNHISKLLDRADTLGNDPYLK  288

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+  T+AIF++G+ +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  289  DLRITFEEFKAFADLRRRLESLTMAIFAYGQ-VNGLLTKQDLKRAAHHVCGVELTDRVVD  347

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            +IF +FD N+DG LSS+EFLR LQRRE DI  P  +G  G +  WL+
Sbjct  348  IIFHVFDMNNDGHLSSEEFLRALQRREADIHQPAARG--GPMG-WLN  391



>ref|XP_010240086.1| PREDICTED: calcium uptake protein 1 homolog, mitochondrial-like 
[Brachypodium distachyon]
Length=463

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI+K LD+V+ L+++P L+
Sbjct  293  FLKELHDEIIRLEFSHYDVKSMETIPAKDFALSMVASADMNHISKLLDKVDMLDNDPYLK  352

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+F+EFK+FA+LR++L+P TLAIF++G+ +NG+L K D  RAA+HVCG+ L++ VVD
Sbjct  353  HLRITFEEFKAFADLRRRLEPLTLAIFAYGE-VNGLLKKHDLMRAAQHVCGVELSDRVVD  411

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FDTN DG LSS+EFLR LQRRE DI  PT +G VG    W + +K C
Sbjct  412  IIFHVFDTNEDGNLSSEEFLRALQRRENDIHQPTTRGPVG----WPN-SKRC  458



>ref|XP_008645921.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X1 [Zea mays]
 gb|AFW72315.1| hypothetical protein ZEAMMB73_328564 [Zea mays]
Length=463

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TIS+KDFALSMVA+ADM HI K LDRV++L+D   L+
Sbjct  286  FLKQLHDEIVRLEFSHYDLKSSNTISAKDFALSMVASADMNHIDKLLDRVDDLDDNLDLK  345

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  346  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAASHVCGVDLTDKVVD  404

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+CTK
Sbjct  405  IIFHVFDANCDGNLSSEEFLRSLQRRENDIRQPATSGFLGVIACWLNCTK  454



>ref|XP_004288762.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=474

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 133/173 (77%), Gaps = 5/173 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F   +  +MLRLEFAHYDY++ G I++KDFALS+VA+AD+  + K LDRV+++N+ PRL 
Sbjct  305  FFRDLHEEMLRLEFAHYDYKAEGAITAKDFALSLVASADLSDLYKLLDRVDDINNAPRLN  364

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +++I++ EFK FAELRK LQ F+LAIFS+G+ +NG+L+K D +RAA  VCGI++T+NV+D
Sbjct  365  NIQITYKEFKDFAELRKNLQSFSLAIFSYGE-VNGVLTKSDLQRAASKVCGINVTDNVID  423

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC-TKGC  333
            +IF +FD N DG LS+ EF++VLQ R      P E G  G+++C+L+C TK C
Sbjct  424  IIFHVFDANGDGDLSASEFVKVLQNRG---GEPVESGLRGLLTCFLNCATKSC  473



>ref|XP_004291429.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=472

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+RLEF+HYDY+ RGT+ +KDFALSMVA+ADM H++  LDRV+EL+  P L+
Sbjct  312  FLRDLQNEMVRLEFSHYDYKMRGTMIAKDFALSMVASADMHHLSSLLDRVDELDHNPDLK  371

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D  ISF+EFK+FAELRK+LQPF+LA+FS+GK+ NGML+++DFKRAA HVC I+L++NVV+
Sbjct  372  DTCISFEEFKNFAELRKQLQPFSLALFSYGKA-NGMLTREDFKRAAFHVCDIALSDNVVE  430

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFV  372
            +IF +FD+N DG LS DEF+ VL +R+ DIA   E G +
Sbjct  431  IIFHVFDSNRDGHLSLDEFVTVLHQRQKDIAQHVETGIM  469



>ref|XP_006389387.1| hypothetical protein POPTR_0025s00230g, partial [Populus trichocarpa]
 gb|ERP48301.1| hypothetical protein POPTR_0025s00230g, partial [Populus trichocarpa]
Length=167

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -1

Query  782  GTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDEFKSFAELRKKLQPF  603
            G IS+KDFALS+VA+AD+ HI+K LDRV+E+++EP++RD+RI+F+EFK+FAELR++LQ  
Sbjct  12   GIISAKDFALSLVASADIRHISKLLDRVDEVSNEPQIRDIRITFEEFKNFAELRRQLQYL  71

Query  602  TLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRV  423
            +LAIFS+GK +NG+L+K DF+RA+  +CGIS+T N+VD+IF +FD N DG  SSD+F+RV
Sbjct  72   SLAIFSYGK-VNGVLTKKDFQRASSQLCGISITNNLVDIIFHVFDANRDGNSSSDDFVRV  130

Query  422  LQRRETDIAHPTEKGFVGMISCWLDCTKG-CPSKIL  318
            LQ RET    P E G  G++SC  +C K   P+K L
Sbjct  131  LQGRETASRIPREPGLKGLMSCCANCAKNYSPAKRL  166



>ref|XP_006389396.1| hypothetical protein POPTR_0025s00330g [Populus trichocarpa]
 gb|ERP48310.1| hypothetical protein POPTR_0025s00330g [Populus trichocarpa]
Length=336

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 131/178 (74%), Gaps = 18/178 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEFAHYDYRS GTIS+KDFALS+VA+AD+ HI+K LDRV+E+++EP++R
Sbjct  175  FLRDLHDEILQLEFAHYDYRSCGTISAKDFALSLVASADIRHISKLLDRVDEVSNEPQIR  234

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FAELR++LQ  +LAIFS+GK                 +CGIS+T N+VD
Sbjct  235  DIRITFEEFKNFAELRRQLQYLSLAIFSYGK-----------------LCGISITNNLVD  277

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKG-CPSKIL  318
            +IF +FD N DG LSSDEF+RVLQ RET    P E G  G++SC  +C K   P+K L
Sbjct  278  IIFHVFDANRDGNLSSDEFVRVLQGRETASRIPREPGLKGLMSCCANCAKNYSPAKRL  335



>ref|XP_002970263.1| hypothetical protein SELMODRAFT_231573 [Selaginella moellendorffii]
 gb|EFJ28393.1| hypothetical protein SELMODRAFT_231573 [Selaginella moellendorffii]
Length=411

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEF+HYD++ +G IS++DFALS+V+AA++  I ++LD  + + D+P+ +
Sbjct  232  FLRDLHEEILKLEFSHYDFKRKGHISARDFALSLVSAANLSKINQYLDLADAIEDDPKFK  291

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+++EF+ FA+LRKKL    LAI SFGK+ +G+L+K DF+RAA  VC + LTE V+D
Sbjct  292  SLRITYEEFRCFAQLRKKLPTLALAISSFGKT-SGLLTKSDFQRAAAQVCSVPLTEAVID  350

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            ++F++FD N DG LS +EFL  LQRRE D  HP E G V ++ CW +C + C
Sbjct  351  VVFYIFDLNRDGNLSMEEFLGALQRREGDTGHPAEAGIVQVLKCWWNCARNC  402



>ref|XP_002452439.1| hypothetical protein SORBIDRAFT_04g025880 [Sorghum bicolor]
 gb|EES05415.1| hypothetical protein SORBIDRAFT_04g025880 [Sorghum bicolor]
Length=471

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI  KDFALSMVA+ADM +I K LDRV++L+D   L+
Sbjct  294  FLKQLHDEIVRLEFSHYDVKSSNTIPVKDFALSMVASADMNYIDKLLDRVDDLDDNLDLK  353

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+RI+F+EFK+FA+LR++L+PF +AIFS+GK +NG+L+K D KRAA HVCG+ LT+ VVD
Sbjct  354  DLRITFEEFKAFADLRRRLEPFAMAIFSYGK-VNGLLTKQDLKRAASHVCGVDLTDKVVD  412

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+CTK
Sbjct  413  IIFHVFDANSDGNLSSEEFLRSLQRREGDIRQPATSGFLGVIACWLNCTK  462



>ref|XP_009363920.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=495

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEFAHYD+ ++GTI +KDFA S+VA+AD   I K LDRV+E++++ RL++VRI++ 
Sbjct  325  EILRLEFAHYDFGAKGTILAKDFAFSLVASADSSDINKLLDRVDEIDNDTRLKNVRITYK  384

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK FAELRK LQ F+LA+FS+G+ +NG+L+K D +RAA  VCGIS++ NV+D+IF +FD
Sbjct  385  EFKDFAELRKNLQSFSLALFSYGE-VNGVLTKSDLQRAASQVCGISVSTNVLDIIFHVFD  443

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
             N DG LS++EF+RVLQRR        E G  G++SCW +C 
Sbjct  444  ANGDGDLSANEFVRVLQRRG---GETQETGIRGLLSCWFNCA  482



>gb|EPS61781.1| hypothetical protein M569_13012, partial [Genlisea aurea]
Length=349

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEF HYD++S G+IS+KDF LSMVAAAD  +I KFLD  +E+ +E  LR
Sbjct  202  FLRELHDEMLRLEFEHYDFKSEGSISAKDFILSMVAAADARYIDKFLDLADEVTNEASLR  261

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D+R++F+EF++FAELR+KL+PF++A+FS+G+  NG+LSK DFKR A+ VCGI +++ +VD
Sbjct  262  DLRVTFEEFRNFAELRRKLEPFSVALFSYGRVNNGLLSKQDFKRGAEQVCGIRVSDGLVD  321

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRE  408
            ++F++FD N DG LS DEF+RV+QRRE
Sbjct  322  LVFYVFDENRDGSLSWDEFVRVMQRRE  348



>ref|XP_008384887.1| PREDICTED: calcium uptake protein 1, mitochondrial-like [Malus 
domestica]
Length=495

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEFAHYD+R++GTI +KDFA S+VA+AD   I K LDRV+ ++++ RL+++RI++ 
Sbjct  325  EILRLEFAHYDFRAQGTILAKDFAFSLVASADSXEINKLLDRVDXIDNDXRLKNIRITYK  384

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            EFK FAELRK LQ F+LA+FS+G+ +NG+L+K D +RAA  VCGIS++ NV+D+IF LFD
Sbjct  385  EFKDFAELRKNLQSFSLALFSYGE-VNGVLTKSDLQRAASRVCGISVSTNVLDIIFHLFD  443

Query  467  TNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT  342
             N DG LS++EF+RVLQ R  +     E G  G++SCW +C 
Sbjct  444  ANGDGDLSANEFVRVLQSRGGET---QETGIRGLLSCWFNCA  482



>ref|XP_010227186.1| PREDICTED: LOW QUALITY PROTEIN: calcium uptake protein 1 homolog, 
mitochondrial-like [Brachypodium distachyon]
Length=240

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RL+F+HYD +S  TI +KDFALSMVA+ADM HI+K LD+V+ L++ P L+
Sbjct  72   FLKELHDEIIRLDFSHYDVKSTETILAKDFALSMVASADMNHISKLLDKVDMLDNNPYLK  131

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             + I+F++FK+FA LR++L+P T+AIF++GK +NGML+K D   AA+HVCG+ L++ VV+
Sbjct  132  XLAITFEDFKAFAGLRRRLEPLTMAIFAYGK-VNGMLTKHDLTPAAQHVCGVELSDRVVE  190

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPT  387
            +IF +FDTN DG LSS+EFLR +QRRE +I  PT
Sbjct  191  VIFHVFDTNEDGNLSSEEFLRAVQRRENNIHQPT  224



>gb|EMT19411.1| Calcium-binding atopy-related autoantigen 1 [Aegilops tauschii]
Length=514

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 11/174 (6%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD +S  TI +KDFALSMVA+ADM HI+K LDR + L ++P L+
Sbjct  333  FLKELHEEIIRLEFSHYDVKSTNTIPAKDFALSMVASADMNHISKLLDRADTLENDPYLK  392

Query  668  DVRISFD-------EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGIS  510
             +RI+F+       EFK+FA+LR++L+  T+AIF++G+ +NG+L+K D KRAA+HVCG+ 
Sbjct  393  HLRITFEMYFLGLQEFKAFADLRRRLESLTMAIFAYGQ-VNGLLTKQDLKRAAQHVCGVE  451

Query  509  LTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
            LT+ VVD+IF +FD N+DG LSS+EFLR LQRRE DI  P  +G  G +  WL+
Sbjct  452  LTDRVVDIIFHVFDMNNDGHLSSEEFLRALQRREADIHQPAARG--GPMG-WLN  502



>ref|XP_002978421.1| hypothetical protein SELMODRAFT_108925, partial [Selaginella 
moellendorffii]
 gb|EFJ20407.1| hypothetical protein SELMODRAFT_108925, partial [Selaginella 
moellendorffii]
Length=373

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++L+LEF+HYD++ +G IS++DFALS+V+AA++  I ++LD  + ++D+P+ +
Sbjct  193  FLCDLHEEILKLEFSHYDFKQKGHISARDFALSLVSAANLSKINQYLDLADAIDDDPKFK  252

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKH-VCGISLTENVV  492
             +RI+++EF+ FA+LRKKL    LAI SFGK+ +G+L+K DF+RAA   VC + LT+ V+
Sbjct  253  SLRITYEEFRCFAQLRKKLPTLALAISSFGKT-SGLLTKSDFQRAAAQVVCSVPLTDAVI  311

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            D++F++FD N DG LS +EFL  LQRRE D  HP E G V ++ CW +C + C
Sbjct  312  DVVFYIFDLNRDGNLSMEEFLGALQRREGDTGHPAEAGIVQVLKCWWNCARNC  364



>ref|XP_001783961.1| predicted protein [Physcomitrella patens]
 gb|EDQ51239.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 123/177 (69%), Gaps = 1/177 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYDY +RGTIS+ DF LSM A+AD+  +  +LDRV +L+ + +  
Sbjct  204  FLKELHEEIIRLEFAHYDYDNRGTISATDFGLSMAASADLSKLHHYLDRVHDLSTDAQFS  263

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
              RI+ +EF  FA+LRKK+    +AI SFGK + G L+K+D +RAA  +C + LT+ V+D
Sbjct  264  TTRITLEEFLEFAQLRKKIPVLAMAISSFGK-IQGKLTKNDVQRAAVKLCDVQLTDVVMD  322

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +IF +FDT+ DG+L+ +EFL VLQRRE+DIA PTE G +  + C   C++ C    L
Sbjct  323  IIFHIFDTDADGLLTMEEFLGVLQRRESDIADPTETGVIQFLKCLWRCSRHCQKPWL  379



>ref|XP_001763005.1| predicted protein [Physcomitrella patens]
 gb|EDQ72210.1| predicted protein [Physcomitrella patens]
Length=366

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEFAHYD+ +RG+IS+ DF LSM A+AD+  +  +LDRV++L  +P   
Sbjct  190  FLKDLHDEIIRLEFAHYDFENRGSISAMDFGLSMTASADLSKMNHYLDRVQDLAHDPHFS  249

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +RI+ +EF  FA+LRKK+    LAI SFG+ + G LSK D +RAA  +C   +++ VVD
Sbjct  250  SIRITLEEFIQFAQLRKKIPVMALAISSFGR-IQGTLSKSDVQRAAAKICHTPISDAVVD  308

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGC  333
            +IF +FDT+ DG+LS +EFL VLQ+RE ++  P++ G +  I C   C   C
Sbjct  309  VIFHIFDTDGDGVLSMEEFLSVLQQRERELIDPSDTGIIQFIKCLGKCAGNC  360



>ref|XP_007011795.1| Calcium ion binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY29414.1| Calcium ion binding protein, putative isoform 2 [Theobroma cacao]
Length=429

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +MLRLEF HYDY+ RGTIS+KDFALSMVA+ADM H+ + L++V+ELNDEP+LR
Sbjct  315  FLQKLQDEMLRLEFDHYDYKGRGTISAKDFALSMVASADMSHLGRLLEQVDELNDEPQLR  374

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKH  525
            ++RI+ DEFK FAELR+KLQPF+LA+FS+GK +NG+L+KDDFKRAA H
Sbjct  375  EIRINLDEFKHFAELRRKLQPFSLALFSYGK-INGLLTKDDFKRAASH  421



>ref|XP_010913361.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X4 [Elaeis guineensis]
Length=443

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 100/170 (59%), Gaps = 41/170 (24%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+ LEFAHYDY+SRGTIS+KDFALSMVA+AD+ ++ KFLDR +EL+  P L+
Sbjct  298  FLRDLHDEMVNLEFAHYDYKSRGTISAKDFALSMVASADISNVNKFLDRADELDSHPHLK  357

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            D RI+ +                                         VCGI++++NVVD
Sbjct  358  DARITLE-----------------------------------------VCGITVSDNVVD  376

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FD N DG LSS+EFLRVLQR E DI  PT     G+ SCWL C K
Sbjct  377  IIFHVFDANRDGNLSSEEFLRVLQRWECDICPPTAMNKRGLFSCWLSCVK  426



>ref|XP_006450363.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
 gb|ESR63603.1| hypothetical protein CICLE_v10008054mg [Citrus clementina]
Length=443

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ +++ +MLRLEFAHYDY+ RGTIS++DFALSMVA+ADMGH+ K L+RV++L +E  L 
Sbjct  331  FMRNLYEEMLRLEFAHYDYKQRGTISAEDFALSMVASADMGHLNKLLNRVDQLKNERHLC  390

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAA  531
            D+RI+F+EFK+FAELR+KLQPF LA+FS+GK +NG+L++DDF+RAA
Sbjct  391  DLRITFEEFKNFAELRRKLQPFCLALFSYGK-VNGLLTRDDFQRAA  435



>gb|AGV54724.1| calcium uptake protein 1 mitochondrial-like protein [Phaseolus 
vulgaris]
Length=482

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = -1

Query  686  DEPRLRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISL  507
            D+P L+D RI+F++FKSFAELRKKL PF++AIFSFG+ +NG+L++DDF+RAA  VCGISL
Sbjct  360  DDPCLKDARITFEDFKSFAELRKKLVPFSMAIFSFGE-VNGLLTRDDFQRAASQVCGISL  418

Query  506  TENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
             +NVVD++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +C+ 
Sbjct  419  PDNVVDIVFHVFDTNRDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWNCSN  474



>dbj|BAH56953.1| AT4G32060 [Arabidopsis thaliana]
Length=183

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H++K LDRVE L++ P LR
Sbjct  54   FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLR  113

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCG  516
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA    G
Sbjct  114  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQREG  163



>gb|AGV54279.1| calcium ion binding protein [Phaseolus vulgaris]
Length=550

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -1

Query  686  DEPRLRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISL  507
            D+P LRD RI F +FKSFAELRKKL PF++AIF F + +NG+L++DDF+RAA  VCGISL
Sbjct  310  DDPSLRDARIPFGDFKSFAELRKKLVPFSMAIFQFWR-INGLLTRDDFQRAASQVCGISL  368

Query  506  TENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPS  327
             +NVVD++F +FDTN DG L+ +EF RVL +RE D+A P   G +G +SC+ +C+    S
Sbjct  369  PDNVVDIVFHVFDTNGDGNLNFEEFTRVLHKRERDMAQPVGTGIMGWLSCFWNCSNNKSS  428

Query  326  KILHF*TCNHLM-KH  285
             +  F +C  ++ KH
Sbjct  429  GL--FSSCGKVIHKH  441



>ref|XP_011036618.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Populus euphratica]
Length=423

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 87/101 (86%), Gaps = 1/101 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEFAHYDY+ RGTIS+KDFALSMVA+ADM H+ K LDRV+ELND+  L  +RI+ +
Sbjct  318  EILRLEFAHYDYKLRGTISAKDFALSMVASADMSHLGKLLDRVDELNDQANLGGIRITLE  377

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKH  525
            EFKSFAELRKKL PF+LA+FS+GK +NG+L ++DF+RAA  
Sbjct  378  EFKSFAELRKKLLPFSLALFSYGK-VNGLLMREDFQRAASQ  417



>ref|XP_010527118.1| PREDICTED: calcium uptake protein 1, mitochondrial [Tarenaya 
hassleriana]
Length=444

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RGTIS KDFALSMVAAAD+ H+ K LDRV+EL D P L 
Sbjct  328  FMRDLTDEMLRLEFAHYDYKGRGTISGKDFALSMVAAADLNHLGKLLDRVDELGDHPHLH  387

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHV  522
            D+RIS DEFK FA+LR KL  F++A+F+ G++ NG+L+ +DFKRAA HV
Sbjct  388  DIRISLDEFKQFAKLRIKLGQFSMALFTCGEA-NGLLTMEDFKRAAAHV  435



>gb|AFW58785.1| hypothetical protein ZEAMMB73_183509 [Zea mays]
Length=118

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = -1

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +V +   EFK+FA+LR++L+P ++AIF+ GK +NG+L+K+D KRA +HVCG++LT+ VVD
Sbjct  2    NVYLQLQEFKAFADLRQRLEPLSMAIFAHGK-VNGLLTKEDLKRATQHVCGVNLTDRVVD  60

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTK  339
            +IF +FDTN DG LSS+EFLR L+RRET I  PT  G  G +SCW    K
Sbjct  61   IIFHVFDTNQDGNLSSEEFLRALERRETAIRQPTIPGPWGFLSCWFSGRK  110



>ref|NP_001078476.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 gb|AEE86000.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=454

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H++K LDRVE L++ P LR
Sbjct  325  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADASHLSKLLDRVESLSEHPHLR  384

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCG  516
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA    G
Sbjct  385  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQREG  434



>ref|XP_010437957.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=446

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 87/111 (78%), Gaps = 1/111 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H+ K LDRV+ L++ PRLR
Sbjct  317  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLGKLLDRVDGLSEHPRLR  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCG  516
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA    G
Sbjct  377  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQREG  426



>ref|XP_010447445.1| PREDICTED: calcium uptake protein 1, mitochondrial isoform X2 
[Camelina sativa]
Length=449

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 1/108 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  +MLRLEFAHYDY+ RG+IS+KDFALSMVAAAD  H+ K LDRV+ L++ PRLR
Sbjct  326  FMKDLTEEMLRLEFAHYDYKRRGSISAKDFALSMVAAADANHLGKLLDRVDGLSEHPRLR  385

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKH  525
            D+RIS  EFK F ELR KL PF+LA+F++GK+ NG+L+  DFKRAA  
Sbjct  386  DMRISLKEFKQFDELRSKLGPFSLALFAYGKA-NGLLTMKDFKRAASQ  432



>gb|KEH35912.1| calcium-binding EF hand protein [Medicago truncatula]
Length=402

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 88/106 (83%), Gaps = 1/106 (1%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            ++LRLEF HYD++ + TI +KDFA S+VA+AD+ H++K L+RV+ELN++P+   VRI+F+
Sbjct  285  EILRLEFVHYDFKFQKTILAKDFAHSIVASADVNHLSKLLERVDELNNDPQFNSVRITFE  344

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGIS  510
            EFK+FAELRKKL P +LA+FSF K +NG+L++DDF+RAA  V  +S
Sbjct  345  EFKNFAELRKKLVPLSLALFSFAK-VNGLLTRDDFQRAASSVRHVS  389



>ref|XP_001702338.1| hypothetical protein CHLREDRAFT_194638 [Chlamydomonas reinhardtii]
 gb|EDO96958.1| predicted protein [Chlamydomonas reinhardtii]
Length=451

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 8/176 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++++LEFAHYD   RG+++  DFA S+VA AD+  + K LDRV+ L  EP L 
Sbjct  276  FLKKLHEEVVKLEFAHYDNMGRGSMAPVDFARSLVATADVRQVDKLLDRVDAL--EPELL  333

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
              RISFDEF    ++ +KL    +A+  F + +   ++K DF +  K +  ++L  +VVD
Sbjct  334  RKRISFDEFLKVHQVERKLHTLQVALDFFAQ-VGRAVTKPDFVKLLKKLLNVTLPPHVVD  392

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAH----PTEKGFVGMISCWLDCTKGC  333
            +IF +F T+  G L +  FL V+QRRE          T+    G +S  + C + C
Sbjct  393  IIFAVF-TDDKGNLDTATFLEVMQRREIMWGRRKNSDTDGYPPGTLSRAMVCMRRC  447



>ref|XP_005642848.1| putative calcium binding atopy-related autoantigen 1 [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18304.1| putative calcium binding atopy-related autoantigen 1 [Coccomyxa 
subellipsoidea C-169]
Length=286

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 92/155 (59%), Gaps = 3/155 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F   +  +++RLEF HYD + +G IS   FA S+V+  +M ++  FL R++ L D  +++
Sbjct  111  FCTELHAELVRLEFLHYDIKGQGYISGTSFAHSLVSHCNMRNVDHFLSRIDNLPD--KIK  168

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +++++ EF+ FA+LR+ +    +A+  F  S    + + DF+RA   + G +L E++VD
Sbjct  169  ALKVTWAEFQQFAQLRQNVHKLAVAL-DFFYSTTDRIGRADFQRAVAKILGDTLAEDLVD  227

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTE  384
            +IF ++D      L+  E L  L++RE ++ +  +
Sbjct  228  VIFAIYDPKEQDNLAYKELLYALEKREGNMIYAKQ  262



>ref|XP_005643147.1| hypothetical protein COCSUDRAFT_20509, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18603.1| hypothetical protein COCSUDRAFT_20509, partial [Coccomyxa subellipsoidea 
C-169]
Length=359

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 92/155 (59%), Gaps = 3/155 (2%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F   +  +++RLEF HYD + +G IS   FA S+V+  +M ++  FL R++ L D  +++
Sbjct  184  FCTELHAELVRLEFLHYDIKGQGYISGTSFAHSLVSHCNMRNVDHFLSRIDNLPD--KIK  241

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             +++++ EF+ FA+LR+ +    +A+  F  S    + + DF+RA   + G +L E++VD
Sbjct  242  ALKVTWAEFQQFAQLRQNVHKLAVAL-DFFYSTTDRIGRADFQRAVAKILGDTLAEDLVD  300

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTE  384
            +IF ++D      L+  E L  L++RE ++ +  +
Sbjct  301  VIFAIYDPKEQDNLAYKELLYALEKREGNMIYAKQ  335



>tpg|DAA49669.1| TPA: hypothetical protein ZEAMMB73_737328 [Zea mays]
Length=292

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  527  HVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLD  348
             VCG+ LT+ VVD+IF +FD N DG LSS+EFLR LQRRE DI  P   GF+G+I+CWL+
Sbjct  221  QVCGVDLTDKVVDIIFHVFDANCDGKLSSEEFLRSLQRRENDIRQPATSGFLGVITCWLN  280

Query  347  CTK  339
            CTK
Sbjct  281  CTK  283



>ref|XP_002947888.1| hypothetical protein VOLCADRAFT_103668 [Volvox carteri f. nagariensis]
 gb|EFJ50876.1| hypothetical protein VOLCADRAFT_103668 [Volvox carteri f. nagariensis]
Length=447

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 90/167 (54%), Gaps = 13/167 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++ LEF HYDY   G+I + DF  S+VA AD+  + + LD+V+ +   P L 
Sbjct  278  FLDKLHAELVTLEFKHYDYSGSGSIPAVDFGRSLVATADIRRVDQLLDKVDAMG--PELT  335

Query  668  DVRISFDEFKSFA-ELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
              RIS +EF++   ++R+ L    +A+  F + +   L KDDF +    + G+SL+  V+
Sbjct  336  RQRISLEEFQTVHFDMRRNLHTLVVAL-DFYRQLGRPLLKDDFTKLLTKLMGVSLSSRVM  394

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRRETDIAH--------PTEKGF  375
            ++IF +FD    G L    FL  +QRRE   A         PT  GF
Sbjct  395  EIIFAVFDDGQGG-LDVQAFLETMQRREVMYARRRNIEPDGPTPAGF  440



>ref|XP_010913362.1| PREDICTED: calcium uptake protein 1, mitochondrial-like isoform 
X5 [Elaeis guineensis]
Length=367

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +M+ LEFAHYDY+SRGTIS+KDFALSMVA+AD+ ++ KFLDR +EL+  P L+
Sbjct  298  FLRDLHDEMVNLEFAHYDYKSRGTISAKDFALSMVASADISNVNKFLDRADELDSHPHLK  357

Query  668  DVRISFDEFK  639
            D RI+ + F+
Sbjct  358  DARITLEAFR  367



>ref|XP_004341831.1| Calciumbinding atopy-related autoantigen 1, putative [Acanthamoeba 
castellanii str. Neff]
 ref|XP_004341834.1| calcium binding atopyrelated autoantigen 1, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19739.1| Calciumbinding atopy-related autoantigen 1, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR19742.1| calcium binding atopyrelated autoantigen 1, putative [Acanthamoeba 
castellanii str. Neff]
Length=368

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 92/178 (52%), Gaps = 16/178 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ S+   +L+LEF  YD +  G I+++ F +S++   D   +  FL RVE L++    R
Sbjct  206  FIKSLHQGVLQLEFDRYDSKGEGKITARAFGMSVIGYVDPKDLPSFLTRVESLDN----R  261

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
               +SF++F +F    KKL    LA+         + ++ DF RA K + G+ L    +D
Sbjct  262  KGELSFEDFVNFNRALKKLPEIGLAV--------KLYAQGDFGRAVKAISGVDLKPVQID  313

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +I+ + D + +G L  +E + V+ +R E  +AH  + G    ++C + C   C  K L
Sbjct  314  VIYHVLDKDGNGKLDHNELVEVMAKRVEKGMAHHRDVGVARFVNCLVTC---CSRKAL  368



>ref|XP_637081.1| hypothetical protein DDB_G0287825 [Dictyostelium discoideum AX4]
 gb|EAL63559.1| hypothetical protein DDB_G0287825 [Dictyostelium discoideum AX4]
Length=461

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 82/147 (56%), Gaps = 1/147 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +   +L+LEF  YD   RG IS +DF L +++ + +G +   +  +  L ++    
Sbjct  289  FLSQLRRDVLQLEFNFYDPSGRGQISQRDFGLLLISYSKLGQLEHHIKALSSLPNKIDAN  348

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
            +  ISFD+F SF  L  KL    L++    K +N   +K  FK  +K +C +     VV+
Sbjct  349  NKGISFDQFVSFNTLLDKLHDVELSM-DLYKGINQPFTKSQFKYVSKIICNVDPQPEVVN  407

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRE  408
             ++ +FDT+ +G L+ DEF+ V++RR+
Sbjct  408  TVYQVFDTDKNGDLAKDEFVEVMERRK  434



>ref|XP_005847618.1| hypothetical protein CHLNCDRAFT_133931 [Chlorella variabilis]
 gb|EFN55516.1| hypothetical protein CHLNCDRAFT_133931 [Chlorella variabilis]
Length=373

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 74/116 (64%), Gaps = 4/116 (3%)
 Frame = -1

Query  794  YRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDEFKSFAELRKK  615
            +R+ G+IS +DFA S+V+ A + H+ ++LD+V+ +   P+L  +R++  EF+ F  +  K
Sbjct  252  FRTFGSISGRDFACSVVSCARLKHVDEYLDKVQAM--PPQLAAIRVTLPEFQEFRRMWSK  309

Query  614  LQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLF-DTNHDGI  450
            L+  ++A+  F  + NG + ++DF    +HV GI L   +VD++F+LF D  HD +
Sbjct  310  LRLLSVAL-EFRHNTNGKVGREDFAWVVQHVMGIQLRAELVDLLFYLFSDQAHDSL  364



>dbj|BAJ95051.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=267

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  +++RLEF+HYD  S  TI +KDFALSMVA+ADM HI+K LDR + L ++P L+
Sbjct  200  FLKELHEEIIRLEFSHYDVNSTNTIPAKDFALSMVASADMNHISKLLDRADTLGNDPYLK  259

Query  668  DVRISFD  648
             +RI+F+
Sbjct  260  HLRITFE  266



>dbj|GAM19553.1| hypothetical protein SAMD00019534_027280 [Acytostelium subglobosum 
LB1]
Length=424

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query  824  MLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDE  645
            +L+LEF  YD    G IS +DF   + + ++ G   ++L  +  L      ++  ISFD+
Sbjct  260  VLQLEFNMYDTTGSGFISQRDFGRLIASYSNFGQRDQYLKAITSLPATVTTQNKGISFDQ  319

Query  644  FKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDT  465
            F SF ++  KL    L+I    K +N   +K++FK  +K +     ++ +VD I+ +FD+
Sbjct  320  FVSFNKILNKLDEVGLSI-DLYKGINQPFTKNEFKYVSKVIASFEPSKEMVDTIYTIFDS  378

Query  464  NHDGILSSDEFLRVLQRRE-TDIAHPTEKGFVG  369
            +++G LS DEF+ V++RR+   + +  + GF+ 
Sbjct  379  DNNGDLSKDEFVEVMKRRKYRGLENNRDSGFIA  411



>ref|XP_003056146.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59522.1| predicted protein [Micromonas pusilla CCMP1545]
Length=443

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 83/150 (55%), Gaps = 10/150 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL  +  ++ +LEF HYD  + G+IS +DF  S+VA AD+  +  F++R  +L       
Sbjct  297  FLHQLRSEIDKLEFTHYDNTNTGSISLQDFGFSVVAGADVLKLQYFIERASKLASRGIYS  356

Query  668  -DVRISFDEFKSFAELRK----KLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
             D R+S ++F +F  L K    K Q    A    G  ++    K +F R AK  CG  L+
Sbjct  357  LDERVSREQFLAFCRLLKHGGTKFQEMIKAHVRAGSQLD----KVNFMRFAKD-CGEHLS  411

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQR  414
            E  +D+IFF+FDT+ DG+LS +E L V  R
Sbjct  412  EAQIDVIFFIFDTDGDGLLSPEELLHVTCR  441



>ref|XP_004351464.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
 gb|EGG14948.1| putative protein serine/threonine kinase [Dictyostelium fasciculatum]
Length=934

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 75/139 (54%), Gaps = 1/139 (1%)
 Frame = -1

Query  824  MLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDE  645
            +L+LEFA YD  + G IS +DF   +   AD   +  +L +V+ L      ++  ISF +
Sbjct  770  VLQLEFAIYDPNNTGYISQRDFGNIIARYADGKKLDTYLSQVQSLPSTIDSKNKGISFGQ  829

Query  644  FKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDT  465
            F  F EL  KL    L+I    K +N   +K  FK  +K VC     + +VD I+ +FDT
Sbjct  830  FVQFNELLNKLDDVALSI-DLYKGINQSFTKSKFKYVSKMVCKFDPPQEIVDSIYTIFDT  888

Query  464  NHDGILSSDEFLRVLQRRE  408
            + +G L   EF+ +++RR+
Sbjct  889  DKNGDLEKQEFVDLMERRK  907



>ref|XP_001415872.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94164.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=256

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 77/143 (54%), Gaps = 2/143 (1%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL ++  +M  LEF HYDY + G+I+ +DF  ++VA + + H+  FL +V+EL    R  
Sbjct  112  FLQTLRWEMDDLEFKHYDYHNVGSITPRDFGYALVAGSKVDHLATFLQKVKEL--PGREA  169

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
              R+S  EF +FA + K       A           ++++ F++ AK   G++L+  V  
Sbjct  170  KNRVSRAEFLAFARIAKHGDGAFQAEMKEISDSGAPITREKFRKIAKRTAGVNLSREVAK  229

Query  488  MIFFLFDTNHDGILSSDEFLRVL  420
            ++F +FD + D  LS DEF   +
Sbjct  230  IVFDIFDVDGDDSLSYDEFFNAI  252



>gb|EFA81158.1| hypothetical protein PPL_05995 [Polysphondylium pallidum PN500]
Length=435

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 83/156 (53%), Gaps = 3/156 (2%)
 Frame = -1

Query  824  MLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVR-ISFD  648
            +L+LEF  YD +S G IS +DF L + + A++     +L  VE L         + ++F+
Sbjct  270  VLQLEFHIYDPKSTGQISQRDFGLLISSYANVNMRNSYLKSVESLPTTVNNTGSKGVTFE  329

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFD  468
            +F  F  L  KL    L+I    K +N   +K +FK  AK +C    +  VVD ++ +FD
Sbjct  330  QFVGFNRLLNKLDEVGLSI-DLYKGINQPFTKSEFKYIAKVICQFEPSNEVVDTVYAIFD  388

Query  467  TNHDGILSSDEFLRVLQRRE-TDIAHPTEKGFVGMI  363
             + +G LS DEF+ V++RR+   +    + GFV  +
Sbjct  389  ADKNGDLSKDEFVSVMRRRKYRGLEESRDTGFVARL  424



>gb|EKC29672.1| Calcium-binding atopy-related autoantigen 1 [Crassostrea gigas]
Length=571

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 92/177 (52%), Gaps = 13/177 (7%)
 Frame = -1

Query  827  QMLRLEFAHYD--YRSRGTISSKDFA---LSMVAAADMGHITKFLDRVEE-LNDEPRLRD  666
            ++LR+EF  YD  Y  +G IS KDF    L+     D    ++ L RV++   ++P+   
Sbjct  400  EVLRIEFDRYDPLYEEKGKISEKDFGRILLTYAGYPDQKK-SRMLKRVKKKYKEDPK---  455

Query  665  VRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDM  486
              I+FDE+ +F    K +     A+ SF       + ++  K  A  V G+ L+++VV++
Sbjct  456  -GITFDEYLNFWMFLKSINDVDTAL-SFYHLAGVSIDEETLKHVAATVAGVKLSDHVVEL  513

Query  485  IFFLFDTNHDGILSSDEFLRVL-QRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +F LFD N DG LS+ EF+ V+ QR    +  P + GF+ +I+    C K   +  L
Sbjct  514  VFTLFDENADGQLSNKEFVSVMKQRVMRGLEKPKDTGFIKLINSVFKCAKNTTTAFL  570



>ref|XP_003074381.1| Ca2+ binding protein, contains EF-hand motifs (ISS) [Ostreococcus 
tauri]
 emb|CAL50232.1| EF-Hand 1, calcium-binding site [Ostreococcus tauri]
Length=458

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 81/146 (55%), Gaps = 4/146 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            FL ++  +M  LEFAHYD    G I+ +DF  S+V+   + H+ +F+D V+ L       
Sbjct  314  FLRTLRNEMDALEFAHYDVNKDGLITMRDFGYSLVSGCKVDHLQRFMDEVKRLPGYE--S  371

Query  668  DVRISFDEFKSFAELRKKLQ-PFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
             VRI+  EF +FA + K     F   I S   S   ++++  FK  A+   G+ L++++V
Sbjct  372  KVRINRAEFLAFARISKHGDGSFQREIKSISDSGE-VITRQKFKDIARRTAGVKLSDDIV  430

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQR  414
             +IF +FD ++D  LS DEF   +++
Sbjct  431  HVIFHVFDVDNDDSLSYDEFFNAIKK  456



>ref|XP_002507300.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68558.1| predicted protein [Micromonas sp. RCC299]
Length=349

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 3/135 (2%)
 Frame = -1

Query  815  LEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDEFKS  636
            LEF HYD  + GTIS++DFA S+VA A++  +  F+ R  ++     +   RI+ ++F S
Sbjct  217  LEFRHYDLTNSGTISTQDFAYSVVAGANVKVMQHFITRAAKIASSDVIAMERINEEQFMS  276

Query  635  FAE-LRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDTNH  459
            F   L+++   F   I S  + +   L+K  F+  AK + G SL++  +D+I+F+FD N 
Sbjct  277  FCRILKREGTEFQSKIKSHVQ-LGNKLTKTVFQDIAKEL-GASLSQTQIDIIYFIFDVNC  334

Query  458  DGILSSDEFLRVLQR  414
            DG LS  E L V+ R
Sbjct  335  DGELSPKELLGVICR  349



>ref|XP_003293670.1| hypothetical protein DICPUDRAFT_158565 [Dictyostelium purpureum]
 gb|EGC29805.1| hypothetical protein DICPUDRAFT_158565 [Dictyostelium purpureum]
Length=431

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 76/139 (55%), Gaps = 1/139 (1%)
 Frame = -1

Query  824  MLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFDE  645
            +L LEF  YD +S G IS +DF L +++   +G + + +  +  L      ++  I+F++
Sbjct  267  VLHLEFNFYDPKSTGVISQRDFGLLLISYCKLGQMKQHMGALSSLPSTVDSQNKGITFEQ  326

Query  644  FKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDT  465
            F SF +L  KL    L++    K  N   +K  FK  +K +        VV+ ++ +FDT
Sbjct  327  FVSFNKLLDKLPDVELSM-DLYKGSNQPFNKSQFKYVSKIITNEEPAPQVVNTVYTIFDT  385

Query  464  NHDGILSSDEFLRVLQRRE  408
            + +G L+ DEF+ +++RR+
Sbjct  386  DKNGDLAKDEFVELMERRK  404



>ref|XP_002595985.1| hypothetical protein BRAFLDRAFT_123729 [Branchiostoma floridae]
 gb|EEN51997.1| hypothetical protein BRAFLDRAFT_123729 [Branchiostoma floridae]
Length=488

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 88/167 (53%), Gaps = 6/167 (4%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADM--GHITKFLDRVEELNDEPRLRDVR-I  657
            ++LR+EF  YD    G IS +DF   M+  A +      K + RV++   E    +V  +
Sbjct  319  EILRIEFERYD-PDDGKISVRDFCDVMLTYAGLSDNRKKKMMARVKKYFKEKEDEEVPGV  377

Query  656  SFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFF  477
            +F+++K+F ++ K +     A+ +F       +     K  A  V G+ L ++VV+++F 
Sbjct  378  TFEDYKNFFQVLKNINDVDTAL-TFYHVAGASIDPATLKHVALTVAGVELNDHVVEIVFK  436

Query  476  LFDTNHDGILSSDEFLRVL-QRRETDIAHPTEKGFVGMISCWLDCTK  339
            LFD N DG LS+ EF+ ++ QR    +  P + GF  ++S  + CTK
Sbjct  437  LFDENDDGELSNKEFVSIMKQRMMRGLEKPKDTGFTRLLSAMMKCTK  483



>ref|XP_006000149.1| PREDICTED: calcium uptake protein 3, mitochondrial [Latimeria 
chalumnae]
Length=450

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 96/181 (53%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  R   +IS +DFA +++   ++ + + +L+ V +   E +  
Sbjct  283  FMDNLQTEILEIEFLSYS-RGLNSISEEDFACALLRYTNVENTSSYLENVRQRISEEK--  339

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               ISFDEF+SF +    L+ F +A+  ++F    N  + +D+FKRA     G+ L+ +V
Sbjct  340  --GISFDEFRSFFQFLNNLEDFAIAMRMYNFA---NRSIGQDEFKRAVYVATGLKLSPHV  394

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            VD +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  395  VDTVFKIFDVDRDDQLSYKEFMGIMKDR-------LHRGFRGHKTVQRYTTFKACLKKEL  447

Query  317  H  315
            +
Sbjct  448  Y  448



>ref|XP_008302681.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Stegastes 
partitus]
Length=441

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 95/170 (56%), Gaps = 16/170 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRVEELNDEPR  675
            F+ ++  ++L +EF  Y   S+G  TIS +DFA  ++   ++  ++ +L+ V   ++ P 
Sbjct  274  FMDNLQTEVLEIEFLSY---SKGMPTISEEDFARILLRYTNVDDVSGYLENVR--HNIPD  328

Query  674  LRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTE  501
              D  I+F+EF+SF +    L+ F +A+  ++F    N  + +D+F RA     GI LT 
Sbjct  329  --DKGITFEEFRSFFQFLNNLEDFAIAMQMYNFA---NRSIGQDEFTRAVYVATGIKLTR  383

Query  500  NVVDMIFFLFDTNHDGILSSDEFLRVLQRR--ETDIAHPTEKGFVGMISC  357
            ++V+ +F +FD +HDG LS  EF+ V++ R    +     E+ F+   SC
Sbjct  384  HLVNTVFRIFDEDHDGKLSHKEFIGVMKDRLHRGEGGMRVEEKFISFKSC  433



>ref|XP_010886756.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Esox 
lucius]
Length=502

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 87/149 (58%), Gaps = 9/149 (6%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +LD V + + D+ R 
Sbjct  322  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFARILLRYTNVENISSYLDNVRQSIPDDKRQ  380

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
            +   I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  381  KG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  435

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ IF +FD +HD  LS  EF+ +++ R
Sbjct  436  LVNTIFKIFDVDHDDQLSYKEFIGIMKDR  464



>gb|ERL87561.1| hypothetical protein D910_04952 [Dendroctonus ponderosae]
Length=228

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 84/149 (56%), Gaps = 10/149 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFA--LSMVAAADMGHITKFLDRVEELNDEPR  675
            F+L +  ++L LEF+ +  R   TIS  DFA  L      D      +LDR+ +     R
Sbjct  72   FMLHLQTEVLELEFSEF-ARGLPTISELDFAKILLRYTYLDTDEYDMYLDRLLD-----R  125

Query  674  LRDVR-ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
            ++D + I+F+EF  F +    L+ F++A+  +  + +  +SKD+F RA K   G SLT +
Sbjct  126  IKDSQGITFEEFNVFCQFLNNLEDFSIAMRMYTLA-DHPISKDEFHRAVKICTGTSLTPH  184

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V  +F +FD + DG+LS  EF+ +++ R
Sbjct  185  LVHTVFAIFDADGDGLLSYREFIAIMKDR  213



>gb|ENN74748.1| hypothetical protein YQE_08686, partial [Dendroctonus ponderosae]
Length=233

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 84/149 (56%), Gaps = 10/149 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFA--LSMVAAADMGHITKFLDRVEELNDEPR  675
            F+L +  ++L LEF+ +  R   TIS  DFA  L      D      +LDR+ +     R
Sbjct  77   FMLHLQTEVLELEFSEF-ARGLPTISELDFAKILLRYTYLDTDEYDMYLDRLLD-----R  130

Query  674  LRDVR-ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
            ++D + I+F+EF  F +    L+ F++A+  +  + +  +SKD+F RA K   G SLT +
Sbjct  131  IKDSQGITFEEFNVFCQFLNNLEDFSIAMRMYTLA-DHPISKDEFHRAVKICTGTSLTPH  189

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V  +F +FD + DG+LS  EF+ +++ R
Sbjct  190  LVHTVFAIFDADGDGLLSYREFIAIMKDR  218



>ref|XP_009822342.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV87473.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=484

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 90/174 (52%), Gaps = 14/174 (8%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVRISFD  648
            +++ L FAHYD      +S+++F + MV+  +   + +++++V++L+      ++ I+  
Sbjct  317  EIMHLHFAHYDVDGSKELSAREFGMFMVSHVNQTELDQWVEKVDKLHG----VEMSITEQ  372

Query  647  EFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGIS---LTENVVDMIFF  477
            EF  F    + L    +A+       +G L KD F RA +  C      ++  +VD+IF 
Sbjct  373  EFMDFYSFLENLDAMKVAM-ELVMEKHG-LDKDQFYRATRAACNGGRPLVSRQIVDIIFA  430

Query  476  LFDTNHDGILSSDEFLRVLQ-RRETDIAHPTEKG----FVGMISCWLDCTKGCP  330
            LFD + DG +S DEFL V++ RR   +    + G    F  + SC+L+C    P
Sbjct  431  LFDESGDGAVSPDEFLGVMETRRSAGLRERRDLGAVEFFKRIKSCFLECVADAP  484



>ref|XP_004364554.1| Cbara1 protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW43642.1| Cbara1 protein [Capsaspora owczarzaki ATCC 30864]
Length=476

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 92/177 (52%), Gaps = 16/177 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+  +  ++ ++EF  Y  R+  TIS   FA  +++ AD+     F+     L  + R  
Sbjct  306  FVHDLQSEINKIEFQSYS-RNEQTISEVAFAELLLSYADLKDEEDFV-----LRAKSREG  359

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
               ++F +F++F    K +    +A+  +  +    ++KDDFKRAAK V  + L  ++VD
Sbjct  360  QKPVTFKQFQAFNNFLKNIDDVEMALGMY-TAAGASITKDDFKRAAKAVANVDLDNHIVD  418

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRET-------DIAHPTEKGFVGMISCWLDCTK  339
             +F LFD + DG LS+ EF+ V+++R +       D+     +GF G++ C  D  K
Sbjct  419  TVFNLFDKDGDGKLSNREFVAVMKKRASRGLDQHRDLG--VVRGFKGLLICAKDKMK  473



>ref|XP_006388376.1| hypothetical protein POPTR_0204s00230g [Populus trichocarpa]
 gb|ERP47290.1| hypothetical protein POPTR_0204s00230g [Populus trichocarpa]
Length=95

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = -1

Query  524  VCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDC  345
            +CGIS+  N+VD+IF +FD N DG LSSDEF+RV Q RET    P E G   ++SC  +C
Sbjct  26   LCGISIL-NLVDIIFHVFDANRDGNLSSDEFVRVRQGRETASPIPREPGLKRLMSCCANC  84

Query  344  TKG  336
             K 
Sbjct  85   AKN  87



>ref|XP_008315732.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X1 
[Cynoglossus semilaevis]
Length=507

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 89/162 (55%), Gaps = 12/162 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVE-ELNDEPRL  672
            F+ ++  +ML +EF  Y  +   TIS +DFA  ++   ++ +I  +L+ V+  + DE   
Sbjct  339  FMDNLQTEMLEIEFLTYS-KGMTTISEEDFAKILLRFTNVDNINSYLENVKHSIPDEKG-  396

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RAA    G+ LT ++V
Sbjct  397  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAAYVATGLKLTRHLV  451

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGM  366
            + IF +FD +HD  LS  EF+ +++    D  H   +G+  M
Sbjct  452  NTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKTM  489



>ref|XP_008315733.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X2 
[Cynoglossus semilaevis]
Length=506

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 89/162 (55%), Gaps = 12/162 (7%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVE-ELNDEPRL  672
            F+ ++  +ML +EF  Y  +   TIS +DFA  ++   ++ +I  +L+ V+  + DE   
Sbjct  339  FMDNLQTEMLEIEFLTYS-KGMTTISEEDFAKILLRFTNVDNINSYLENVKHSIPDEKG-  396

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RAA    G+ LT ++V
Sbjct  397  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAAYVATGLKLTRHLV  451

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGM  366
            + IF +FD +HD  LS  EF+ +++    D  H   +G+  M
Sbjct  452  NTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKTM  489



>ref|XP_002157845.2| PREDICTED: calcium uptake protein 1, mitochondrial-like [Hydra 
vulgaris]
Length=410

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 94/180 (52%), Gaps = 5/180 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAA--DMGHITKFLDRVEELNDEPR  675
            F + +  +++ LEF  +  +  G IS   F   ++  A  D    +K L +++++  E  
Sbjct  230  FKMKLQKEVMLLEFQMFGSKD-GVISENKFTEMLLTYAYFDKAKHSKILKKIKKMYGEGS  288

Query  674  LRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
             ++  + F+++  F +    L+   +A+ SF       + K+ FK+ AK V G++L +++
Sbjct  289  GKNEGLLFEDYLDFYQFLLNLRDVEMAL-SFHTVSGQTIDKETFKQVAKSVAGVNLRDHL  347

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRE-TDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            VD++F +FD N DG LS+ EF+ V++ +    +  P + GF  ++S    CTK   S  L
Sbjct  348  VDVVFSIFDENGDGHLSNKEFVAVMKDKMFRGLNKPKDTGFTRLLSAIWKCTKISVSDTL  407



>ref|XP_009028818.1| hypothetical protein HELRODRAFT_69384 [Helobdella robusta]
 gb|ESN92596.1| hypothetical protein HELRODRAFT_69384 [Helobdella robusta]
Length=414

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 9/173 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPR--  675
            F   +  ++L+LEF  Y+  + G IS +DFA S++  A  GH   F  R + L    R  
Sbjct  241  FQKQLMTEVLQLEFNRYE-PTNGKISERDFADSIIIYA--GH--NFNKRSKMLKKVKRNF  295

Query  674  LRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
                 ISF ++  F ++ K +    +A+  F       + K   K  AK V  ++L++++
Sbjct  296  AGGTGISFQDYYDFFQVLKYINDIDVALV-FYNVAGASIDKQTLKHVAKTVAHVNLSDHL  354

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLDCTK  339
            +D++F LFD N DG LS  EF+ V++RR    +  P + G + +++    C K
Sbjct  355  IDVVFILFDENDDGELSHREFISVMKRRLMRGLEKPKDTGLLRVLAAMWKCAK  407



>gb|EFA10933.1| hypothetical protein TcasGA2_TC001761 [Tribolium castaneum]
Length=386

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 87/151 (58%), Gaps = 14/151 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMV--AAADMGHITKFLDRVEELNDE  681
            F+L +  ++L LEF+ +   S+G  TIS  DFA  M+     D      +LDR+ +    
Sbjct  216  FMLHLQTEVLELEFSEF---SKGLPTISEVDFAKIMLRYTYLDTDEYDMYLDRLLD----  268

Query  680  PRLRDVR-ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
             R+++ + I+F+EF  F +    L+ FT+A+  +  + +  +SKD+F RA K   G SL+
Sbjct  269  -RIKETKGITFEEFNVFCQFLNNLEDFTIAMRMYTLA-DHPISKDEFHRAVKICTGTSLS  326

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
             ++V  +F +FD + DG+LS  EF+ +++ R
Sbjct  327  PHLVHTVFAIFDVDGDGLLSYREFIAIMKDR  357



>ref|XP_003219318.2| PREDICTED: calcium uptake protein 2, mitochondrial isoform X1 
[Anolis carolinensis]
Length=452

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 10/124 (8%)
 Frame = -1

Query  701  VEELNDEPRLRDVR--------ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDD  546
             EE N+E   ++V+        IS +EFK+F +   +L+ F++A+  F  +    + + +
Sbjct  309  TEEENNEIYWQNVKERIQAGESISMEEFKTFCQFTNRLEDFSIALKMFTIASR-PVKQAE  367

Query  545  FKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVG  369
            FKRA K V G+ L+EN++D IF +FD + D  LS  EFL VL+ R    +  P ++G  G
Sbjct  368  FKRAVKVVTGLELSENILDTIFKIFDLDGDNCLSHTEFLGVLKNRMHRGLRVPQQQGVEG  427

Query  368  MISC  357
               C
Sbjct  428  YWKC  431



>gb|KDO31970.1| hypothetical protein SPRG_03186 [Saprolegnia parasitica CBS 223.65]
Length=408

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 81/156 (52%), Gaps = 10/156 (6%)
 Frame = -1

Query  845  LLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRVEELNDEPRL  672
            + S+   +LR EF  Y     G  +IS  DFA+++++  D  H+   L R++ L      
Sbjct  244  ITSLKEHLLRAEFDLYAAERNGVKSISVHDFAVTLISCLDPKHLPSLLPRLQLLA----A  299

Query  671  RDVRISFDEFKSF-AELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
             D R+S+ EF  F + ++  L+   LA   F       ++++DF +AA  V G+ L E++
Sbjct  300  SDERVSWHEFVLFHSVIQNHLEGIKLA---FELRPEDEVNEEDFIKAAYIVSGVRLPEHI  356

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPT  387
            + M+F +FD N +G L  DE L++L  R     H T
Sbjct  357  MAMVFRIFDANGNGTLDEDELLKILATRNQAALHKT  392



>ref|XP_008106201.1| PREDICTED: calcium uptake protein 2, mitochondrial isoform X2 
[Anolis carolinensis]
Length=430

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 10/124 (8%)
 Frame = -1

Query  701  VEELNDEPRLRDVR--------ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDD  546
             EE N+E   ++V+        IS +EFK+F +   +L+ F++A+  F  +    + + +
Sbjct  287  TEEENNEIYWQNVKERIQAGESISMEEFKTFCQFTNRLEDFSIALKMFTIASR-PVKQAE  345

Query  545  FKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVG  369
            FKRA K V G+ L+EN++D IF +FD + D  LS  EFL VL+ R    +  P ++G  G
Sbjct  346  FKRAVKVVTGLELSENILDTIFKIFDLDGDNCLSHTEFLGVLKNRMHRGLRVPQQQGVEG  405

Query  368  MISC  357
               C
Sbjct  406  YWKC  409



>ref|XP_008606834.1| hypothetical protein SDRG_02998 [Saprolegnia diclina VS20]
 gb|EQC39562.1| hypothetical protein SDRG_02998 [Saprolegnia diclina VS20]
Length=408

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 80/154 (52%), Gaps = 10/154 (6%)
 Frame = -1

Query  839  SVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRD  666
            S+   +LR EF  Y     G  +IS  DFA+++++  D  H+   L R++ L       D
Sbjct  246  SLKEHLLRAEFDLYATERNGVKSISVHDFAVTLISCLDPKHLPSLLPRLQLLA----ASD  301

Query  665  VRISFDEFKSF-AELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
             R+S+ EF  F + ++  L+   LA   F       ++++DF +AA  V G+ L E+++ 
Sbjct  302  ERVSWQEFVLFHSVIQNHLEGIKLA---FELRPEDEVNEEDFIKAAYIVSGVRLPEHIMA  358

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPT  387
            M+F +FD N +G L  DE L++L  R     H T
Sbjct  359  MVFRVFDANGNGTLDEDELLKILATRNQAALHKT  392



>ref|XP_008199062.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X1 
[Tribolium castaneum]
Length=446

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 86/155 (55%), Gaps = 22/155 (14%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAA-------DMGHITKFLDRVE  696
            F+L +  ++L LEF+ +   S+G  TIS  DFA  M+          DM ++ + LDR++
Sbjct  276  FMLHLQTEVLELEFSEF---SKGLPTISEVDFAKIMLRYTYLDTDEYDM-YLDRLLDRIK  331

Query  695  ELNDEPRLRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCG  516
            E           I+F+EF  F +    L+ FT+A+  +  + +  +SKD+F RA K   G
Sbjct  332  ETKG--------ITFEEFNVFCQFLNNLEDFTIAMRMYTLA-DHPISKDEFHRAVKICTG  382

Query  515  ISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
             SL+ ++V  +F +FD + DG+LS  EF+ +++ R
Sbjct  383  TSLSPHLVHTVFAIFDVDGDGLLSYREFIAIMKDR  417



>ref|XP_006630179.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Lepisosteus 
oculatus]
Length=490

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 86/149 (58%), Gaps = 12/149 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ + + +LD V +     R+ 
Sbjct  323  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFARILLRYTNVENTSSYLDNVRQ-----RIP  376

Query  668  DVR-ISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
            D + I+FDEF+SF +    L+ F +A+  ++F    N  + +D+FKRA     G+ LT +
Sbjct  377  DEKGITFDEFRSFFQFLNNLEDFAIAMQMYNFA---NRSIGQDEFKRAVYVATGLKLTHH  433

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ +F +FD + D  LS  EF+ +++ R
Sbjct  434  LVNTVFKIFDVDRDDQLSYKEFIGIMKDR  462



>ref|XP_970272.2| PREDICTED: calcium uptake protein 3, mitochondrial isoform X2 
[Tribolium castaneum]
Length=431

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 86/155 (55%), Gaps = 22/155 (14%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAA-------DMGHITKFLDRVE  696
            F+L +  ++L LEF+ +   S+G  TIS  DFA  M+          DM ++ + LDR++
Sbjct  261  FMLHLQTEVLELEFSEF---SKGLPTISEVDFAKIMLRYTYLDTDEYDM-YLDRLLDRIK  316

Query  695  ELNDEPRLRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCG  516
            E           I+F+EF  F +    L+ FT+A+  +  + +  +SKD+F RA K   G
Sbjct  317  ETKG--------ITFEEFNVFCQFLNNLEDFTIAMRMYTLA-DHPISKDEFHRAVKICTG  367

Query  515  ISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
             SL+ ++V  +F +FD + DG+LS  EF+ +++ R
Sbjct  368  TSLSPHLVHTVFAIFDVDGDGLLSYREFIAIMKDR  402



>gb|ETE64089.1| EF-hand domain-containing family member A1 [Ophiophagus hannah]
Length=208

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -1

Query  680  PRLRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTE  501
            P    V IS DEFK+F +   +L+ F++A+  F  +    + + +FKRA K   G  L++
Sbjct  80   PEHGGVSISMDEFKTFCQFTNRLEDFSIALKMFTVASR-PVKRAEFKRAVKVATGQELSD  138

Query  500  NVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISC  357
            NV+D IF +FD + D  LS  EFL VL+ R    +  P ++G  G   C
Sbjct  139  NVLDTIFKIFDLDGDNCLSHAEFLGVLKNRMHRGLRVPQQQGVQGYWKC  187



>ref|XP_005931336.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X4 [Haplochromis burtoni]
Length=444

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 83/146 (57%), Gaps = 4/146 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V +    P  +
Sbjct  274  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCI--PDEK  330

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
               I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V+
Sbjct  331  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLVN  389

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRR  411
             IF +FD +HD  LS  EF+ +++ R
Sbjct  390  TIFKIFDVDHDDQLSYKEFIGIMKDR  415



>ref|XP_005931335.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X3 [Haplochromis burtoni]
Length=458

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 83/146 (57%), Gaps = 4/146 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V +    P  +
Sbjct  288  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCI--PDEK  344

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
               I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V+
Sbjct  345  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLVN  403

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRR  411
             IF +FD +HD  LS  EF+ +++ R
Sbjct  404  TIFKIFDVDHDDQLSYKEFIGIMKDR  429



>ref|XP_005931333.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X1 [Haplochromis burtoni]
Length=490

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 83/146 (57%), Gaps = 4/146 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V +    P  +
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCI--PDEK  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVD  489
               I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V+
Sbjct  377  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLVN  435

Query  488  MIFFLFDTNHDGILSSDEFLRVLQRR  411
             IF +FD +HD  LS  EF+ +++ R
Sbjct  436  TIFKIFDVDHDDQLSYKEFIGIMKDR  461



>ref|XP_004911250.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X1 
[Xenopus (Silurana) tropicalis]
Length=565

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 17/176 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ + + +L+ V       RLR
Sbjct  384  FMDNLQTEVLEIEFLTYS-KGMSTISEEDFAHILLRYTNVENTSSYLENV-------RLR  435

Query  668  ---DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
               +  ISFDEF+SF +    L+ F +A+  ++F    N  + +D+FKRA     G+ L+
Sbjct  436  IPEEKGISFDEFRSFFQFLNNLEDFAIAMQMYNFA---NRSIGQDEFKRAVYVATGLKLS  492

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVGMISCWLDCTK  339
             ++V+ +F +FD + D  LS  EF+ +++ R       P ++G      C    T+
Sbjct  493  PHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFREPPKRGLKDYYVCVTSVTR  548



>ref|XP_008412314.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X8 [Poecilia reticulata]
Length=482

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  311  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  369

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  370  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  424

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  425  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  475



>ref|XP_008412060.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X5 [Poecilia reticulata]
Length=490

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V +    P  +
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCI--PDEK  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT ++
Sbjct  377  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRHL  433

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  434  VNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  483



>ref|XP_008411976.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X4 [Poecilia reticulata]
Length=491

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  378

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  379  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  433

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  434  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  484



>ref|XP_007567712.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X4 [Poecilia formosa]
Length=477

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  306  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  364

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  365  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  419

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  420  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  470



>ref|XP_008411808.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X2 [Poecilia reticulata]
Length=495

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V +    P  +
Sbjct  325  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCI--PDEK  381

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT ++
Sbjct  382  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRHL  438

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  439  VNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  488



>ref|XP_007567709.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X1 [Poecilia formosa]
Length=490

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V +    P  +
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCI--PDEK  376

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT ++
Sbjct  377  QEGITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRHL  433

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  434  VNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  483



>ref|XP_007567715.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X6 [Poecilia formosa]
Length=445

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  274  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  332

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  333  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  387

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  388  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  438



>ref|XP_008411723.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X1 [Poecilia reticulata]
Length=496

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  325  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  383

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  384  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  438

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  439  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  489



>ref|XP_009840494.1| hypothetical protein H257_14397 [Aphanomyces astaci]
 gb|ETV70051.1| hypothetical protein H257_14397 [Aphanomyces astaci]
Length=424

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 12/149 (8%)
 Frame = -1

Query  824  MLRLEFAHYDYR-----SRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVR  660
            +LR EF  Y           TIS  DFA++M++  D  H+ + LDR+  L    R  D R
Sbjct  261  LLRAEFDMYATSPSATTKESTISVHDFAVTMISCFDPKHLPRMLDRLHLL----RATDER  316

Query  659  ISFDEFKSF-AELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMI  483
            +S+ EF+ F + ++  L    LA F   +  +  +++DDF +AA  V G+ L  ++V M 
Sbjct  317  VSWTEFREFHSVIQNHLADIRLA-FELQRGGDE-ITEDDFIKAAYIVSGVRLPAHIVSMA  374

Query  482  FFLFDTNHDGILSSDEFLRVLQRRETDIA  396
            F +FD + +G L  +E LRVL  R    A
Sbjct  375  FRVFDLDGNGSLDHEEVLRVLSARNNQAA  403



>ref|XP_008412562.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X11 [Poecilia reticulata]
Length=445

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  274  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  332

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  333  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  387

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  388  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  438



>ref|XP_005066565.1| PREDICTED: calcium uptake protein 3, mitochondrial [Mesocricetus 
auratus]
Length=410

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + T FL+ V     E +  
Sbjct  243  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENTTVFLENVRYSIPEEK--  299

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  300  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  354

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ IF +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  355  VNTIFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  407

Query  317  H  315
            H
Sbjct  408  H  408



>gb|EMP36426.1| EF-hand domain-containing family member A1 [Chelonia mydas]
Length=169

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 67/124 (54%), Gaps = 10/124 (8%)
 Frame = -1

Query  701  VEELNDEPRLRDVR--------ISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDD  546
             +E N+E   ++VR        IS DEFK+F +   +L+ F++A+  F  + N  +   +
Sbjct  26   TDEENNEIYWQNVRERIQAGENISLDEFKTFCQFTNRLEDFSIAMQMFTVA-NRPVKLAE  84

Query  545  FKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSSDEFLRVLQRR-ETDIAHPTEKGFVG  369
            FKRA K   G  L++NV+D +F +FD + D  LS  EF+ VL+ R    +  P ++G  G
Sbjct  85   FKRAVKVATGQELSDNVLDTVFKIFDLDGDNCLSHGEFVGVLKNRMYRGLRVPQQQGVQG  144

Query  368  MISC  357
               C
Sbjct  145  YWKC  148



>gb|ELT97656.1| hypothetical protein CAPTEDRAFT_174710 [Capitella teleta]
Length=414

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 86/173 (50%), Gaps = 8/173 (5%)
 Frame = -1

Query  827  QMLRLEFAHYDYRSRGTISSKDFA--LSMVAAADMGHITKFLDRVEELNDEPRLRDVRIS  654
            ++L LEF  Y+   +  I+ +DFA  L M A  +     K + RV+++  E       ++
Sbjct  246  EILWLEFQRYEPEDK-KITERDFADILLMYAGLNETKRIKMMKRVKKVYKE---EAKGVT  301

Query  653  FDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFL  474
            F+EF  F E+ K +     A+  F       + K   K  A+ V  + L+++VV+++F L
Sbjct  302  FEEFAGFFEVLKYINDVDTALM-FYHVAGASIDKPTLKHVARTVAHVELSDHVVNIVFTL  360

Query  473  FDTNHDGILSSDEFLRVLQRRET-DIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            FD N DG LS+ EF+ V++RR    +    + G V +IS    C K     +L
Sbjct  361  FDENDDGELSNREFVSVMKRRMMRGLEKSKDMGVVKIISAMWKCAKSQTPSML  413



>ref|XP_010896340.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X5 
[Esox lucius]
Length=336

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRV-EELNDEP  678
            F+ ++  ++L +EF  Y   S+G   IS +DFA  ++   ++  I  +LD V + + DE 
Sbjct  167  FMDNLQTEVLEIEFLSY---SKGLPIISEEDFARILLRFTNVDDIAGYLDNVRKSITDEK  223

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  I+FDEF+SF +    L+ F +A+  ++F    N  + +D+F RA     G+ LT
Sbjct  224  G-----ITFDEFRSFFQFMNNLEDFAIAMQMYNFA---NRSIGQDEFARAVYVATGLKLT  275

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +++V  +F +FD + DG LS  EF+ V++ R
Sbjct  276  DHLVHTVFHIFDEDRDGQLSYKEFIGVMKDR  306



>ref|XP_007898850.1| PREDICTED: calcium uptake protein 2, mitochondrial [Callorhinchus 
milii]
Length=368

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 73/156 (47%), Gaps = 10/156 (6%)
 Frame = -1

Query  776  ISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLRDVR--------ISFDEFKSFAELR  621
            I  K+F+  M            L   EE N +    +VR        ISF+EF++F    
Sbjct  200  IEFKEFSRGMKTMRREEFAAWLLHFTEEENHKTYWENVRLRIPAGESISFEEFRAFCRFM  259

Query  620  KKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVVDMIFFLFDTNHDGILSS  441
              L+ F   +  F KS N  +   DFKRA K V G  L++NV+D +F +FD + DG LS 
Sbjct  260  NHLEDFAFTMNMFTKS-NRPVGIADFKRAVKVVTGQELSDNVLDTVFKIFDLDGDGCLSH  318

Query  440  DEFL-RVLQRRETDIAHPTEKGFVGMISCWLDCTKG  336
             EFL  ++ R    +  P + G  G + C  + T G
Sbjct  319  QEFLGAIMTRLHRGLKAPPQIGLNGYLKCVKNETIG  354



>ref|XP_010896332.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X4 
[Esox lucius]
Length=413

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRV-EELNDEP  678
            F+ ++  ++L +EF  Y   S+G   IS +DFA  ++   ++  I  +LD V + + DE 
Sbjct  244  FMDNLQTEVLEIEFLSY---SKGLPIISEEDFARILLRFTNVDDIAGYLDNVRKSITDEK  300

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  I+FDEF+SF +    L+ F +A+  ++F    N  + +D+F RA     G+ LT
Sbjct  301  G-----ITFDEFRSFFQFMNNLEDFAIAMQMYNFA---NRSIGQDEFARAVYVATGLKLT  352

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +++V  +F +FD + DG LS  EF+ V++ R
Sbjct  353  DHLVHTVFHIFDEDRDGQLSYKEFIGVMKDR  383



>ref|XP_010896324.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X3 
[Esox lucius]
Length=427

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRV-EELNDEP  678
            F+ ++  ++L +EF  Y   S+G   IS +DFA  ++   ++  I  +LD V + + DE 
Sbjct  258  FMDNLQTEVLEIEFLSY---SKGLPIISEEDFARILLRFTNVDDIAGYLDNVRKSITDEK  314

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  I+FDEF+SF +    L+ F +A+  ++F    N  + +D+F RA     G+ LT
Sbjct  315  G-----ITFDEFRSFFQFMNNLEDFAIAMQMYNFA---NRSIGQDEFARAVYVATGLKLT  366

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +++V  +F +FD + DG LS  EF+ V++ R
Sbjct  367  DHLVHTVFHIFDEDRDGQLSYKEFIGVMKDR  397



>ref|XP_008412475.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X10 [Poecilia reticulata]
Length=459

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 95/175 (54%), Gaps = 15/175 (9%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +++ V + + DE + 
Sbjct  288  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYMENVRQCIPDEKKQ  346

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  347  EG--ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  401

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGF--VGMISCWLDCTK  339
            +V+ IF +FD +HD  LS  EF+ +++    D  H   +G+  V   S +  C K
Sbjct  402  LVNTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSVERASSFRSCLK  452



>ref|XP_010896318.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X2 
[Esox lucius]
Length=444

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRV-EELNDEP  678
            F+ ++  ++L +EF  Y   S+G   IS +DFA  ++   ++  I  +LD V + + DE 
Sbjct  275  FMDNLQTEVLEIEFLSY---SKGLPIISEEDFARILLRFTNVDDIAGYLDNVRKSITDEK  331

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  I+FDEF+SF +    L+ F +A+  ++F    N  + +D+F RA     G+ LT
Sbjct  332  G-----ITFDEFRSFFQFMNNLEDFAIAMQMYNFA---NRSIGQDEFARAVYVATGLKLT  383

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +++V  +F +FD + DG LS  EF+ V++ R
Sbjct  384  DHLVHTVFHIFDEDRDGQLSYKEFIGVMKDR  414



>ref|XP_010896309.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X1 
[Esox lucius]
Length=458

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 85/151 (56%), Gaps = 16/151 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRG--TISSKDFALSMVAAADMGHITKFLDRV-EELNDEP  678
            F+ ++  ++L +EF  Y   S+G   IS +DFA  ++   ++  I  +LD V + + DE 
Sbjct  289  FMDNLQTEVLEIEFLSY---SKGLPIISEEDFARILLRFTNVDDIAGYLDNVRKSITDEK  345

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  I+FDEF+SF +    L+ F +A+  ++F    N  + +D+F RA     G+ LT
Sbjct  346  G-----ITFDEFRSFFQFMNNLEDFAIAMQMYNFA---NRSIGQDEFARAVYVATGLKLT  397

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +++V  +F +FD + DG LS  EF+ V++ R
Sbjct  398  DHLVHTVFHIFDEDRDGQLSYKEFIGVMKDR  428



>ref|XP_008059398.1| PREDICTED: calcium uptake protein 3, mitochondrial [Tarsius syrichta]
Length=447

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 93/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ +I+ FL+ V     E +  
Sbjct  280  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENISVFLENVRYSIPEEK--  336

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  337  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  391

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  392  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  444

Query  317  H  315
            H
Sbjct  445  H  445



>ref|XP_008475222.1| PREDICTED: uncharacterized protein LOC103512249 [Diaphorina citri]
Length=913

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 83/148 (56%), Gaps = 4/148 (3%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMV--AAADMGHITKFLDRVEELNDEPR  675
            F+ ++  ++L +EF  +  +    IS  DFA  M+     D+    ++LDR+ E   E  
Sbjct  739  FMENLQTEVLEMEFQEFA-KGADVISELDFARIMLRYTYLDIRVYDRYLDRLLERIKEME  797

Query  674  LRDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
                 ISFDEFK F +    ++ FT+A+  +  + +  +SKD+F RA K   G SL++++
Sbjct  798  GIPPGISFDEFKIFCQFLNNIEDFTIAMRMYTLA-DHPISKDEFHRAVKICTGTSLSQHL  856

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            V  +F +FD + DG+LS  EF+ +++ R
Sbjct  857  VHTVFAIFDEDGDGLLSYREFIAIMKDR  884



>gb|AAH91318.1| Efha2 protein, partial [Rattus norvegicus]
Length=262

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + + FL+ V     E +  
Sbjct  95   FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEK--  151

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  152  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  206

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  207  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  259

Query  317  H  315
            H
Sbjct  260  H  260



>gb|EGV99934.1| EF-hand domain-containing family member A2 [Cricetulus griseus]
Length=280

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + + FL+ V     E +  
Sbjct  113  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEK--  169

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  170  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  224

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  225  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFQGYKTVQKYPTFKSCLKKEL  277

Query  317  H  315
            H
Sbjct  278  H  278



>ref|XP_003972622.1| PREDICTED: EF-hand domain-containing family member A2-like [Takifugu 
rubripes]
Length=480

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 92/175 (53%), Gaps = 18/175 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V   + DE   
Sbjct  313  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISSYLENVRHCIPDEKG-  370

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G  LT +
Sbjct  371  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGQQLTRH  423

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGM--ISCWLDCTK  339
            +V  IF +FD +HD  LS  EF+ +++    D  H   +G+  M  I+ +  C K
Sbjct  424  LVHTIFKIFDVDHDDQLSYKEFIGIMK----DRLHRGARGYKSMERITSFRSCLK  474



>ref|XP_007554802.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X1 [Poecilia formosa]
Length=476

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 92/171 (54%), Gaps = 18/171 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGT--ISSKDFALSMVAAADMGHITKFLDRVEE-LNDEP  678
            F+ ++  ++L +EF      S+G   IS +DFA  ++   ++  ++ +++ V   + DE 
Sbjct  309  FMDNLQTEVLEIEFLS---SSKGMPFISEEDFARILLRYTNVDDVSGYMENVRHSIPDEK  365

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  ISF+EF+SF +    L+ FT+A+  ++F     G   +D+F RA     GI L+
Sbjct  366  G-----ISFEEFRSFFQFLNNLEDFTIAMQMYNFAHRSVG---QDEFTRAVYVATGIKLS  417

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR--ETDIAHPTEKGFVGMISC  357
             ++V+ +F +FD +HDG LS  EF+ V++ R    D     E+ F+   SC
Sbjct  418  HHLVNTVFKIFDEDHDGKLSHKEFIGVMKDRLHRGDRGAKAEEKFISFKSC  468



>ref|XP_006790880.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X4 [Neolamprologus brichardi]
Length=442

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  274  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  331

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  332  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  384

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ IF +FD +HD  LS  EF+ +++ R
Sbjct  385  LVNTIFKIFDVDHDDQLSYKEFIGIMKDR  413



>ref|XP_007554803.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X2 [Poecilia formosa]
Length=462

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 92/171 (54%), Gaps = 18/171 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGT--ISSKDFALSMVAAADMGHITKFLDRVEE-LNDEP  678
            F+ ++  ++L +EF      S+G   IS +DFA  ++   ++  ++ +++ V   + DE 
Sbjct  295  FMDNLQTEVLEIEFLS---SSKGMPFISEEDFARILLRYTNVDDVSGYMENVRHSIPDEK  351

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  ISF+EF+SF +    L+ FT+A+  ++F     G   +D+F RA     GI L+
Sbjct  352  G-----ISFEEFRSFFQFLNNLEDFTIAMQMYNFAHRSVG---QDEFTRAVYVATGIKLS  403

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR--ETDIAHPTEKGFVGMISC  357
             ++V+ +F +FD +HDG LS  EF+ V++ R    D     E+ F+   SC
Sbjct  404  HHLVNTVFKIFDEDHDGKLSHKEFIGVMKDRLHRGDRGAKAEEKFISFKSC  454



>ref|XP_007554804.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X3 [Poecilia formosa]
Length=444

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 92/171 (54%), Gaps = 18/171 (11%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGT--ISSKDFALSMVAAADMGHITKFLDRVEE-LNDEP  678
            F+ ++  ++L +EF      S+G   IS +DFA  ++   ++  ++ +++ V   + DE 
Sbjct  277  FMDNLQTEVLEIEFLS---SSKGMPFISEEDFARILLRYTNVDDVSGYMENVRHSIPDEK  333

Query  677  RLRDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLT  504
                  ISF+EF+SF +    L+ FT+A+  ++F     G   +D+F RA     GI L+
Sbjct  334  G-----ISFEEFRSFFQFLNNLEDFTIAMQMYNFAHRSVG---QDEFTRAVYVATGIKLS  385

Query  503  ENVVDMIFFLFDTNHDGILSSDEFLRVLQRR--ETDIAHPTEKGFVGMISC  357
             ++V+ +F +FD +HDG LS  EF+ V++ R    D     E+ F+   SC
Sbjct  386  HHLVNTVFKIFDEDHDGKLSHKEFIGVMKDRLHRGDRGAKAEEKFISFKSC  436



>ref|XP_004539228.1| PREDICTED: EF-hand domain-containing family member A2-like isoform 
X3 [Maylandia zebra]
Length=455

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  288  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  345

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  346  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  400

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  401  NTIFKIFDVDHDDQLSYKEFIGIMKDR  427



>ref|XP_006790878.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X2 [Neolamprologus brichardi]
Length=487

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  430

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ IF +FD +HD  LS  EF+ +++ R
Sbjct  431  LVNTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>ref|XP_004539227.1| PREDICTED: EF-hand domain-containing family member A2-like isoform 
X2 [Maylandia zebra]
Length=473

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  306  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  363

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  364  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  418

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  419  NTIFKIFDVDHDDQLSYKEFIGIMKDR  445



>ref|XP_004539229.1| PREDICTED: EF-hand domain-containing family member A2-like isoform 
X4 [Maylandia zebra]
Length=441

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  274  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  331

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  332  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  386

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  387  NTIFKIFDVDHDDQLSYKEFIGIMKDR  413



>ref|XP_006790879.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X3 [Neolamprologus brichardi]
Length=456

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  288  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  345

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  346  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  398

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ IF +FD +HD  LS  EF+ +++ R
Sbjct  399  LVNTIFKIFDVDHDDQLSYKEFIGIMKDR  427



>ref|XP_006790877.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X1 [Neolamprologus brichardi]
Length=488

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 85/149 (57%), Gaps = 12/149 (8%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                I+FDEF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ LT +
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFARAVYVATGLKLTRH  430

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRR  411
            +V+ IF +FD +HD  LS  EF+ +++ R
Sbjct  431  LVNTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>ref|XP_005454830.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Oreochromis 
niloticus]
Length=496

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  432

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  433  NTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>ref|XP_005931334.1| PREDICTED: calcium uptake protein 3, mitochondrial-like isoform 
X2 [Haplochromis burtoni]
Length=488

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  432

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  433  NTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>ref|XP_003772875.1| PREDICTED: EF-hand domain-containing family member A2 [Sarcophilus 
harrisii]
Length=447

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 91/181 (50%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ +   FLD V        + 
Sbjct  280  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNIENTAVFLDNVRY----NIME  334

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
            +  I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  335  EKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  391

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V  IF +FD + D  LS  EF+ +++ R        ++GF G  +     T K C  K L
Sbjct  392  VSTIFKIFDVDKDDQLSYKEFIGIMKDR-------LQRGFRGYKTLQRYPTFKSCLKKEL  444

Query  317  H  315
            H
Sbjct  445  H  445



>ref|XP_004539226.1| PREDICTED: EF-hand domain-containing family member A2-like isoform 
X1 [Maylandia zebra]
Length=487

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  432

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  433  NTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>ref|XP_005743667.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Pundamilia 
nyererei]
Length=496

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++   ++ +I+ +L+ V + + DE   
Sbjct  320  FMDNLQTEVLEIEFLTYS-KGMTTISEEDFAKILLRFTNVENISAYLENVRQCIPDEKG-  377

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAIFSFGKSMNGMLSKDDFKRAAKHVCGISLTENVV  492
                I+FDEF+SF +    L+ F +A+  +  +    + +D+F RA     G+ LT ++V
Sbjct  378  ----ITFDEFRSFFQFLNNLEDFAIAMQMYNFAARS-IGQDEFARAVYVATGLKLTRHLV  432

Query  491  DMIFFLFDTNHDGILSSDEFLRVLQRR  411
            + IF +FD +HD  LS  EF+ +++ R
Sbjct  433  NTIFKIFDVDHDDQLSYKEFIGIMKDR  459



>gb|ELK08864.1| EF-hand domain-containing family member A2 [Pteropus alecto]
Length=355

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + + FL+ V     E +  
Sbjct  188  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEK--  244

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  245  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  299

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  300  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  352

Query  317  H  315
            H
Sbjct  353  H  353



>ref|XP_006744914.1| PREDICTED: calcium uptake protein 3, mitochondrial, partial [Leptonychotes 
weddellii]
Length=296

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + + FL+ V     E +  
Sbjct  129  FMDNLQTEVLEIEFLSYS-NGMSTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEK--  185

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  186  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  240

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  241  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  293

Query  317  H  315
            H
Sbjct  294  H  294



>ref|XP_007258737.1| PREDICTED: calcium uptake protein 3, mitochondrial-like [Astyanax 
mexicanus]
Length=479

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 93/180 (52%), Gaps = 18/180 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEE-LNDEPRL  672
            F+ ++  ++L +EF  Y  +   TIS +DFA  ++    + +I  +L+ V + + DE   
Sbjct  312  FMDNLQTEVLEIEFLSYS-KGMTTISEEDFARILLRYTTVDNIGSYLENVRQSIPDEKG-  369

Query  671  RDVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTEN  498
                ISF+EF+SF +    L+ F +A+  ++F     G   +D+F RA     G+ L+ +
Sbjct  370  ----ISFEEFRSFFQFLNNLEDFAIAMQMYNFASRSIG---QDEFGRAVYVATGLKLSAH  422

Query  497  VVDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCTKGCPSKIL  318
            +V++IF +FD +HD  LS  EF+ +++ R     H    G+ G         KGC  K L
Sbjct  423  LVNIIFKIFDVDHDDQLSYKEFIGIMKDR----LHRGSSGYRG--EERFTSFKGCMKKEL  476



>ref|XP_006509586.1| PREDICTED: calcium uptake protein 3, mitochondrial isoform X2 
[Mus musculus]
Length=354

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 92/181 (51%), Gaps = 18/181 (10%)
 Frame = -1

Query  848  FLLSVFPQMLRLEFAHYDYRSRGTISSKDFALSMVAAADMGHITKFLDRVEELNDEPRLR  669
            F+ ++  ++L +EF  Y      TIS +DFA  ++   ++ + + FL+ V     E +  
Sbjct  187  FMDNLQTEVLEIEFLSYS-NGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEK--  243

Query  668  DVRISFDEFKSFAELRKKLQPFTLAI--FSFGKSMNGMLSKDDFKRAAKHVCGISLTENV  495
               I+FDEF+SF +    L+ F +A+  ++F     G   +D+FKRA     G+ L+ ++
Sbjct  244  --GITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIG---QDEFKRAVYVATGLKLSPHL  298

Query  494  VDMIFFLFDTNHDGILSSDEFLRVLQRRETDIAHPTEKGFVGMISCWLDCT-KGCPSKIL  318
            V+ +F +FD + D  LS  EF+ +++ R         +GF G  +     T K C  K L
Sbjct  299  VNTVFKIFDVDKDDQLSYKEFIGIMKDR-------LHRGFRGYKTVQKYPTFKSCLKKEL  351

Query  317  H  315
            H
Sbjct  352  H  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1651846923090