BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c20382_g1_i1 len=1259 path=[79:0-639 2574:640-640 718:641-641
78:642-804 40:805-1258]

Length=1259
                                                                      Score     E

ref|XP_009613232.1|  PREDICTED: B3 domain-containing protein At5g...    143   3e-35   
ref|XP_009769341.1|  PREDICTED: B3 domain-containing protein REM2...    143   3e-35   
ref|XP_009613231.1|  PREDICTED: B3 domain-containing protein At5g...    144   5e-35   
ref|XP_009769340.1|  PREDICTED: B3 domain-containing protein At4g...    143   8e-35   
emb|CDP12499.1|  unnamed protein product                                134   4e-32   
ref|XP_006351837.1|  PREDICTED: B3 domain-containing protein At5g...    135   4e-32   
ref|XP_004231373.1|  PREDICTED: B3 domain-containing protein At5g...    133   1e-31   
ref|XP_006346538.1|  PREDICTED: B3 domain-containing protein At5g...    129   4e-31   
ref|XP_006350438.1|  PREDICTED: B3 domain-containing protein REM5...    125   9e-30   
ref|XP_010315502.1|  PREDICTED: putative B3 domain-containing pro...    131   1e-29   
emb|CDP12500.1|  unnamed protein product                                125   2e-28   
ref|XP_010315503.1|  PREDICTED: B3 domain-containing protein At5g...    116   2e-27   
ref|XP_004231660.1|  PREDICTED: B3 domain-containing protein At5g...    121   3e-27   
ref|XP_011100052.1|  PREDICTED: putative B3 domain-containing pro...    119   7e-27   
ref|XP_011084088.1|  PREDICTED: putative B3 domain-containing pro...    118   1e-26   
ref|XP_002284808.2|  PREDICTED: putative B3 domain-containing pro...    118   4e-26   Vitis vinifera
ref|XP_010647774.1|  PREDICTED: B3 domain-containing protein At5g...    109   2e-25   
emb|CBI32504.3|  unnamed protein product                                118   4e-25   
gb|EYU36190.1|  hypothetical protein MIMGU_mgv1a014702mg                108   4e-24   
emb|CAN82365.1|  hypothetical protein VITISV_027616                     113   2e-23   Vitis vinifera
ref|XP_010647813.1|  PREDICTED: B3 domain-containing protein REM2...    101   2e-20   
ref|XP_010647775.1|  PREDICTED: B3 domain-containing protein REM2...  92.8    8e-19   
ref|XP_010255054.1|  PREDICTED: B3 domain-containing protein Os03...  90.9    2e-17   
ref|XP_010030660.1|  PREDICTED: B3 domain-containing protein REM2...  91.3    2e-17   
gb|KCW89692.1|  hypothetical protein EUGRSUZ_A01956                   89.7    2e-17   
ref|XP_010255053.1|  PREDICTED: putative B3 domain-containing pro...  89.7    9e-17   
ref|XP_010255057.1|  PREDICTED: B3 domain-containing protein At1g...  88.2    1e-16   
ref|XP_010255056.1|  PREDICTED: putative B3 domain-containing pro...  88.2    5e-16   
gb|EYU40140.1|  hypothetical protein MIMGU_mgv1a026121mg              87.0    1e-15   
ref|XP_006342294.1|  PREDICTED: B3 domain-containing protein At5g...  84.7    3e-15   
ref|XP_010647819.1|  PREDICTED: putative B3 domain-containing pro...  85.1    5e-15   
ref|XP_006423126.1|  hypothetical protein CICLE_v10028843mg           84.0    1e-14   
gb|KDO52155.1|  hypothetical protein CISIN_1g020807mg                 84.0    1e-14   
ref|XP_010691759.1|  PREDICTED: B3 domain-containing protein At4g...  84.7    3e-14   
ref|XP_010657897.1|  PREDICTED: uncharacterized protein LOC104881...  80.9    4e-13   
ref|XP_008787670.1|  PREDICTED: B3 domain-containing protein Os11...  79.0    1e-12   
ref|XP_010647820.1|  PREDICTED: B3 domain-containing protein REM2...  77.8    2e-12   
ref|XP_008787667.1|  PREDICTED: B3 domain-containing protein Os11...  78.6    2e-12   
ref|XP_008787669.1|  PREDICTED: B3 domain-containing protein Os11...  78.2    2e-12   
ref|XP_008787668.1|  PREDICTED: B3 domain-containing protein Os11...  78.2    3e-12   
ref|XP_007041353.1|  Uncharacterized protein isoform 2                76.6    5e-12   
ref|XP_010255064.1|  PREDICTED: B3 domain-containing protein REM1...  76.6    8e-12   
ref|XP_010255062.1|  PREDICTED: B3 domain-containing protein REM1...  76.6    8e-12   
ref|XP_010924500.1|  PREDICTED: B3 domain-containing protein Os11...  75.5    1e-11   
ref|XP_010924491.1|  PREDICTED: B3 domain-containing protein Os11...  75.5    1e-11   
ref|XP_009365669.1|  PREDICTED: B3 domain-containing protein REM5...  73.9    2e-11   
ref|XP_008440206.1|  PREDICTED: putative B3 domain-containing pro...  73.2    2e-11   
ref|XP_010486112.1|  PREDICTED: B3 domain-containing protein REM2...  72.8    2e-11   
ref|XP_010924483.1|  PREDICTED: B3 domain-containing protein Os11...  75.5    2e-11   
ref|XP_006403705.1|  hypothetical protein EUTSA_v10010633mg           73.6    2e-11   
ref|XP_010426969.1|  PREDICTED: B3 domain-containing protein REM2...  73.6    3e-11   
ref|XP_009138285.1|  PREDICTED: B3 domain-containing protein At4g...  72.0    3e-11   
ref|XP_010924476.1|  PREDICTED: B3 domain-containing protein Os11...  74.7    3e-11   
ref|XP_010924468.1|  PREDICTED: B3 domain-containing protein Os11...  75.1    3e-11   
ref|XP_010924451.1|  PREDICTED: B3 domain-containing protein Os11...  74.7    3e-11   
ref|XP_010924459.1|  PREDICTED: B3 domain-containing protein Os11...  74.7    3e-11   
ref|XP_010924436.1|  PREDICTED: B3 domain-containing protein Os11...  74.7    4e-11   
ref|XP_010924443.1|  PREDICTED: B3 domain-containing protein Os11...  74.7    4e-11   
ref|XP_006293000.1|  hypothetical protein CARUB_v10019277mg           72.8    4e-11   
ref|XP_008440203.1|  PREDICTED: putative B3 domain-containing pro...  73.2    5e-11   
emb|CAN76392.1|  hypothetical protein VITISV_011465                   74.7    6e-11   Vitis vinifera
ref|XP_006577282.1|  PREDICTED: putative B3 domain-containing pro...  72.8    6e-11   
ref|XP_010504088.1|  PREDICTED: B3 domain-containing protein REM2...  72.4    7e-11   
ref|XP_011030811.1|  PREDICTED: B3 domain-containing protein Os01...  73.6    1e-10   
ref|XP_011030803.1|  PREDICTED: B3 domain-containing protein Os01...  73.6    1e-10   
ref|XP_004141939.1|  PREDICTED: putative B3 domain-containing pro...  72.0    1e-10   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                  73.9    1e-10   Vitis vinifera
ref|XP_011030796.1|  PREDICTED: B3 domain-containing protein Os01...  73.6    1e-10   
ref|XP_011030771.1|  PREDICTED: B3 domain-containing protein Os01...  73.6    1e-10   
ref|XP_007147158.1|  hypothetical protein PHAVU_006G100700g           71.6    2e-10   
gb|KGN48478.1|  hypothetical protein Csa_6G489940                     71.6    2e-10   
ref|XP_010414513.1|  PREDICTED: B3 domain-containing protein At3g...  69.7    2e-10   
ref|XP_006354941.1|  PREDICTED: B3 domain-containing protein Os01...  68.2    2e-10   
emb|CDP04824.1|  unnamed protein product                              70.1    2e-10   
ref|XP_010470071.1|  PREDICTED: B3 domain-containing protein At3g...  68.9    2e-10   
ref|XP_007017394.1|  AP2/B3-like transcriptional factor family pr...  72.4    2e-10   
ref|XP_002877911.1|  hypothetical protein ARALYDRAFT_906718           70.5    3e-10   
ref|XP_006650312.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...  71.6    3e-10   
ref|XP_004167398.1|  PREDICTED: putative B3 domain-containing pro...  70.9    3e-10   
emb|CAN82366.1|  hypothetical protein VITISV_027617                   70.9    3e-10   Vitis vinifera
emb|CDP07598.1|  unnamed protein product                              72.0    4e-10   
ref|XP_006396490.1|  hypothetical protein EUTSA_v10028696mg           71.2    4e-10   
ref|XP_010515820.1|  PREDICTED: B3 domain-containing protein REM2...  69.7    5e-10   
ref|XP_002466799.1|  hypothetical protein SORBIDRAFT_01g014370        70.5    6e-10   Sorghum bicolor [broomcorn]
gb|KFK30878.1|  hypothetical protein AALP_AA6G037600                  70.9    6e-10   
ref|XP_010263797.1|  PREDICTED: putative B3 domain-containing pro...  70.5    6e-10   
ref|XP_006398097.1|  hypothetical protein EUTSA_v10000999mg           68.9    8e-10   
ref|XP_006375016.1|  hypothetical protein POPTR_0014s03610g           70.9    8e-10   
ref|XP_006393897.1|  hypothetical protein EUTSA_v10004496mg           69.7    1e-09   
ref|XP_010683976.1|  PREDICTED: B3 domain-containing protein Os01...  70.5    1e-09   
ref|XP_010469086.1|  PREDICTED: B3 domain-containing protein REM2...  68.6    1e-09   
ref|XP_009112350.1|  PREDICTED: putative B3 domain-containing pro...  68.9    1e-09   
ref|XP_010683984.1|  PREDICTED: B3 domain-containing protein Os01...  70.5    1e-09   
ref|XP_008440214.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    1e-09   
ref|XP_010518203.1|  PREDICTED: B3 domain-containing protein REM2...  68.2    1e-09   
emb|CDP08404.1|  unnamed protein product                              68.6    1e-09   
ref|XP_008440211.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    1e-09   
ref|XP_008440215.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    1e-09   
ref|XP_008440213.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    1e-09   
ref|XP_008440210.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    2e-09   
ref|XP_008440207.1|  PREDICTED: uncharacterized protein LOC103484...  70.5    2e-09   
ref|XP_008440208.1|  PREDICTED: uncharacterized protein LOC103484...  70.1    2e-09   
ref|XP_010512501.1|  PREDICTED: B3 domain-containing protein REM2...  68.2    2e-09   
ref|XP_008440209.1|  PREDICTED: uncharacterized protein LOC103484...  70.1    2e-09   
ref|XP_010518202.1|  PREDICTED: B3 domain-containing protein REM2...  68.2    2e-09   
ref|XP_009781396.1|  PREDICTED: B3 domain-containing protein Os01...  69.7    2e-09   
ref|XP_009781397.1|  PREDICTED: B3 domain-containing protein Os01...  69.7    2e-09   
ref|XP_009781392.1|  PREDICTED: B3 domain-containing protein Os01...  69.7    2e-09   
ref|XP_010414512.1|  PREDICTED: B3 domain-containing protein At3g...  66.6    2e-09   
ref|XP_010908022.1|  PREDICTED: B3 domain-containing protein Os01...  69.3    2e-09   
ref|XP_009389534.1|  PREDICTED: B3 domain-containing protein Os11...  69.3    2e-09   
ref|XP_007047112.1|  Cytochrome P450                                  69.7    2e-09   
ref|XP_010518200.1|  PREDICTED: B3 domain-containing protein REM2...  68.2    2e-09   
ref|XP_008226600.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    3e-09   
ref|XP_009116025.1|  PREDICTED: B3 domain-containing protein REM20    67.0    4e-09   
ref|XP_007224954.1|  hypothetical protein PRUPE_ppa021314mg           65.9    4e-09   
ref|XP_008226602.1|  PREDICTED: putative B3 domain-containing pro...  67.0    4e-09   
ref|XP_010447089.1|  PREDICTED: B3 domain-containing protein At4g...  68.2    4e-09   
ref|XP_010436894.1|  PREDICTED: B3 domain-containing protein At3g...  65.5    5e-09   
ref|XP_008220725.1|  PREDICTED: B3 domain-containing protein REM5...  66.6    5e-09   
ref|XP_010255061.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    5e-09   
ref|XP_006425800.1|  hypothetical protein CICLE_v10026137mg           67.0    6e-09   
gb|KFK34581.1|  hypothetical protein AALP_AA5G164400                  66.2    7e-09   
ref|XP_009588432.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    7e-09   
ref|XP_008226826.1|  PREDICTED: putative B3 domain-containing pro...  66.6    7e-09   
ref|XP_009588431.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    7e-09   
gb|KHG05520.1|  hypothetical protein F383_30454                       67.8    7e-09   
ref|XP_009588428.1|  PREDICTED: B3 domain-containing protein Os01...  67.8    7e-09   
gb|KEH41174.1|  plant-specific B3-DNA-binding domain protein          66.6    9e-09   
ref|XP_002522368.1|  DNA binding protein, putative                    65.9    9e-09   Ricinus communis
ref|NP_001050682.1|  Os03g0622200                                     66.6    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010413386.1|  PREDICTED: B3 domain-containing protein REM2...  67.0    1e-08   
emb|CDY67388.1|  BnaAnng24200D                                        65.9    1e-08   
ref|XP_010413387.1|  PREDICTED: B3 domain-containing protein REM2...  67.0    1e-08   
ref|XP_009103858.1|  PREDICTED: B3 domain-containing protein REM2...  65.9    1e-08   
ref|XP_009341411.1|  PREDICTED: uncharacterized protein LOC103933435  66.2    1e-08   
ref|XP_010255211.1|  PREDICTED: putative B3 domain-containing pro...  64.3    2e-08   
gb|KGN48479.1|  hypothetical protein Csa_6G489950                     67.0    2e-08   
ref|XP_010460626.1|  PREDICTED: B3 domain-containing protein At4g...  66.2    2e-08   
emb|CDY13301.1|  BnaC06g14560D                                        65.1    2e-08   
ref|XP_010501632.1|  PREDICTED: B3 domain-containing protein At4g...  63.5    2e-08   
emb|CDY45798.1|  BnaC03g16210D                                        63.9    2e-08   
emb|CDY33105.1|  BnaC09g22010D                                        66.2    2e-08   
ref|XP_006290106.1|  hypothetical protein CARUB_v10003750mg           62.4    3e-08   
ref|XP_010492301.1|  PREDICTED: B3 domain-containing protein At3g...  62.4    3e-08   
ref|XP_009364120.1|  PREDICTED: B3 domain-containing protein Os01...  65.9    3e-08   
ref|XP_006595849.1|  PREDICTED: B3 domain-containing protein REM2...  64.7    3e-08   
ref|XP_008792612.1|  PREDICTED: putative B3 domain-containing pro...  65.5    3e-08   
emb|CDX81347.1|  BnaC09g07580D                                        64.7    3e-08   
ref|XP_010070479.1|  PREDICTED: putative B3 domain-containing pro...  64.7    3e-08   
ref|XP_010263796.1|  PREDICTED: B3 domain-containing protein REM1...  65.5    3e-08   
ref|XP_007017395.1|  AP2/B3-like transcriptional factor family pr...  65.5    4e-08   
gb|KHN48598.1|  B3 domain-containing protein REM21                    65.1    4e-08   
ref|XP_008240883.1|  PREDICTED: putative B3 domain-containing pro...  64.3    4e-08   
ref|XP_010026398.1|  PREDICTED: putative B3 domain-containing pro...  62.4    4e-08   
emb|CDY70353.1|  BnaCnng67970D                                        64.7    4e-08   
gb|EEC75758.1|  hypothetical protein OsI_12653                        65.1    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004238198.1|  PREDICTED: B3 domain-containing protein Os01...  65.5    4e-08   
ref|XP_010245897.1|  PREDICTED: putative B3 domain-containing pro...  64.3    5e-08   
gb|AAO34502.1|  putative auxin response factor                        65.5    5e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75759.1|  hypothetical protein OsI_12654                        64.7    5e-08   Oryza sativa Indica Group [Indian rice]
gb|KFK30080.1|  hypothetical protein AALP_AA7G214000                  64.3    6e-08   
emb|CAB67638.1|  putative protein                                     63.5    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006840809.1|  hypothetical protein AMTR_s00214p00019140        62.4    6e-08   
ref|XP_007214527.1|  hypothetical protein PRUPE_ppa015343mg           62.0    7e-08   
ref|XP_007212879.1|  hypothetical protein PRUPE_ppa021660mg           62.0    7e-08   
ref|XP_010046007.1|  PREDICTED: B3 domain-containing protein Os01...  61.6    7e-08   
ref|NP_566984.1|  B3 domain-containing protein REM20                  63.5    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010263792.1|  PREDICTED: B3 domain-containing protein Os11...  64.7    7e-08   
ref|XP_010263793.1|  PREDICTED: B3 domain-containing protein Os11...  64.7    7e-08   
ref|XP_010657893.1|  PREDICTED: uncharacterized protein LOC104881...  64.3    7e-08   
ref|XP_010263794.1|  PREDICTED: B3 domain-containing protein Os11...  64.7    7e-08   
gb|EYU45075.1|  hypothetical protein MIMGU_mgv1a004183mg              64.7    8e-08   
ref|NP_001050681.1|  Os03g0622100                                     63.9    8e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDX91315.1|  BnaC02g27260D                                        64.3    8e-08   
gb|KDO79380.1|  hypothetical protein CISIN_1g023721mg                 62.4    9e-08   
emb|CDX97286.1|  BnaA02g20770D                                        63.9    9e-08   
ref|XP_004499104.1|  PREDICTED: B3 domain-containing protein REM1...  63.9    1e-07   
ref|XP_011099238.1|  PREDICTED: putative B3 domain-containing pro...  62.8    1e-07   
ref|XP_009341395.1|  PREDICTED: putative B3 domain-containing pro...  63.2    1e-07   
gb|EEE59515.1|  hypothetical protein OsJ_11767                        63.9    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010432421.1|  PREDICTED: B3 domain-containing protein At4g...  63.9    1e-07   
ref|XP_010041704.1|  PREDICTED: uncharacterized protein LOC104430669  62.4    1e-07   
ref|XP_009144545.1|  PREDICTED: B3 domain-containing protein At4g...  63.9    1e-07   
ref|XP_007202358.1|  hypothetical protein PRUPE_ppa009186mg           63.2    1e-07   
ref|XP_009144546.1|  PREDICTED: B3 domain-containing protein At4g...  63.9    1e-07   
gb|KDP31847.1|  hypothetical protein JCGZ_12308                       63.2    1e-07   
gb|KDO79379.1|  hypothetical protein CISIN_1g023721mg                 62.8    1e-07   
ref|XP_003589270.1|  B3 domain-containing protein                     64.3    1e-07   
ref|XP_002442426.1|  hypothetical protein SORBIDRAFT_08g019887        63.9    1e-07   Sorghum bicolor [broomcorn]
ref|XP_006375017.1|  hypothetical protein POPTR_0014s03610g           63.9    1e-07   
emb|CDY12793.1|  BnaC07g16400D                                        62.8    1e-07   
gb|AES59521.2|  plant-specific B3-DNA-binding domain protein          63.9    1e-07   
ref|XP_004497762.1|  PREDICTED: B3 domain-containing protein At5g...  62.8    2e-07   
ref|XP_007141725.1|  hypothetical protein PHAVU_008G220000g           62.8    2e-07   
emb|CDY40646.1|  BnaA03g53170D                                        61.2    2e-07   
ref|XP_006400878.1|  hypothetical protein EUTSA_v10014488mg           61.6    2e-07   
ref|XP_010691310.1|  PREDICTED: B3 domain-containing protein Os01...  62.8    2e-07   
ref|XP_011099239.1|  PREDICTED: B3 domain-containing protein At1g...  61.6    2e-07   
ref|XP_007214051.1|  hypothetical protein PRUPE_ppa017456mg           60.8    2e-07   
gb|KFK27547.1|  hypothetical protein AALP_AA8G397800                  62.8    2e-07   
emb|CDY01449.1|  BnaA07g12220D                                        62.4    2e-07   
ref|XP_009103463.1|  PREDICTED: putative B3 domain-containing pro...  62.4    2e-07   
ref|XP_011089901.1|  PREDICTED: putative B3 domain-containing pro...  60.8    2e-07   
ref|XP_007041352.1|  Uncharacterized protein isoform 1                63.2    2e-07   
ref|XP_010478207.1|  PREDICTED: B3 domain-containing protein At4g...  62.8    2e-07   
ref|XP_010456016.1|  PREDICTED: B3 domain-containing protein At5g...  61.6    2e-07   
ref|XP_002866372.1|  hypothetical protein ARALYDRAFT_496153           62.0    3e-07   
gb|ACJ86297.1|  unknown                                               60.5    3e-07   Medicago truncatula
gb|AFK45994.1|  unknown                                               60.5    3e-07   
ref|XP_004288671.1|  PREDICTED: putative B3 domain-containing pro...  62.0    3e-07   
emb|CDX80197.1|  BnaC09g35450D                                        61.2    3e-07   
ref|XP_004978926.1|  PREDICTED: B3 domain-containing protein Os11...  62.8    3e-07   
ref|XP_008241585.1|  PREDICTED: putative B3 domain-containing pro...  62.0    3e-07   
ref|XP_010064141.1|  PREDICTED: B3 domain-containing protein Os03...  61.6    3e-07   
ref|XP_009120534.1|  PREDICTED: B3 domain-containing protein At5g...  62.0    3e-07   
ref|XP_007214340.1|  hypothetical protein PRUPE_ppb025337mg           59.7    3e-07   
ref|XP_008794892.1|  PREDICTED: putative B3 domain-containing pro...  62.4    3e-07   
ref|XP_010059786.1|  PREDICTED: B3 domain-containing protein REM1...  62.0    3e-07   
ref|XP_010245898.1|  PREDICTED: putative B3 domain-containing pro...  61.6    3e-07   
gb|KEH40066.1|  plant-specific B3-DNA-binding domain protein          61.2    3e-07   
gb|KEH40067.1|  plant-specific B3-DNA-binding domain protein          61.6    4e-07   
gb|KCW66218.1|  hypothetical protein EUGRSUZ_F00044                   62.0    4e-07   
emb|CDP19095.1|  unnamed protein product                              61.2    4e-07   
ref|XP_003589273.1|  B3 domain-containing protein                     61.6    4e-07   
ref|XP_002450488.1|  hypothetical protein SORBIDRAFT_05g006090        62.0    4e-07   Sorghum bicolor [broomcorn]
emb|CAB36717.1|  putative protein                                     62.0    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195166.2|  AP2/B3-like transcriptional factor family protein   62.0    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009365640.1|  PREDICTED: B3 domain-containing protein Os01...  62.4    4e-07   
ref|XP_008440204.1|  PREDICTED: putative B3 domain-containing pro...  61.2    4e-07   
emb|CDY31574.1|  BnaA10g12970D                                        60.1    4e-07   
gb|AES59525.2|  plant-specific B3-DNA-binding domain protein          62.0    5e-07   
ref|XP_007047117.1|  Uncharacterized protein TCM_000520               60.8    5e-07   
ref|XP_004982409.1|  PREDICTED: B3 domain-containing protein Os03...  61.6    5e-07   
gb|KFK27314.1|  hypothetical protein AALP_AA8G366400                  61.2    5e-07   
ref|XP_003576206.1|  PREDICTED: B3 domain-containing protein Os11...  62.0    5e-07   
ref|XP_003589278.1|  B3 domain-containing protein                     61.6    5e-07   
ref|XP_006839026.1|  hypothetical protein AMTR_s00002p00272200        62.0    5e-07   
gb|EMT01685.1|  B3 domain-containing protein                          62.4    5e-07   
ref|XP_009138341.1|  PREDICTED: B3 domain-containing protein REM2...  60.5    6e-07   
ref|XP_010237857.1|  PREDICTED: B3 domain-containing protein Os11...  62.0    6e-07   
ref|XP_009138339.1|  PREDICTED: B3 domain-containing protein REM2...  60.5    6e-07   
ref|XP_006851101.1|  hypothetical protein AMTR_s00025p00247140        59.7    6e-07   
ref|XP_004160514.1|  PREDICTED: uncharacterized LOC101221625          62.0    7e-07   
ref|XP_010674817.1|  PREDICTED: putative B3 domain-containing pro...  58.9    7e-07   
ref|XP_003589279.1|  B3 domain-containing protein                     61.2    7e-07   
gb|KEH40065.1|  plant-specific B3-DNA-binding domain protein          60.8    7e-07   
ref|XP_010064142.1|  PREDICTED: B3 domain-containing protein REM2...  58.9    8e-07   
ref|XP_004142021.1|  PREDICTED: uncharacterized protein LOC101221625  61.6    8e-07   
gb|KDP38417.1|  hypothetical protein JCGZ_04342                       60.8    8e-07   
gb|KHN12746.1|  B3 domain-containing protein REM16                    61.2    8e-07   
ref|XP_002873693.1|  hypothetical protein ARALYDRAFT_909450           58.2    9e-07   
ref|XP_003589274.1|  B3 domain-containing protein                     61.2    1e-06   
gb|KEH40064.1|  plant-specific B3-DNA-binding domain protein          60.5    1e-06   
ref|XP_003589266.1|  B3 domain-containing protein                     61.2    1e-06   
ref|XP_010666269.1|  PREDICTED: B3 domain-containing protein REM1...  60.8    1e-06   
ref|XP_010455580.1|  PREDICTED: B3 domain-containing protein At5g...  59.7    1e-06   
ref|XP_006595618.1|  PREDICTED: uncharacterized protein LOC100813...  60.8    1e-06   
ref|XP_011099307.1|  PREDICTED: B3 domain-containing protein Os08...  60.1    1e-06   
ref|XP_006361103.1|  PREDICTED: putative B3 domain-containing pro...  59.3    1e-06   
ref|XP_004499103.1|  PREDICTED: B3 domain-containing protein REM1...  58.9    1e-06   
ref|XP_003589277.1|  B3 domain-containing protein                     60.5    1e-06   
emb|CDO97123.1|  unnamed protein product                              59.3    1e-06   
ref|NP_201499.1|  putative B3 domain-containing protein               60.1    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30083.1|  hypothetical protein AALP_AA7G214300                  60.1    1e-06   
ref|XP_009130366.1|  PREDICTED: B3 domain-containing protein At3g...  58.5    1e-06   
ref|XP_002866723.1|  transcriptional factor B3 family protein         60.1    1e-06   
ref|XP_011083781.1|  PREDICTED: B3 domain-containing protein Os01...  60.5    1e-06   
ref|XP_008444660.1|  PREDICTED: B3 domain-containing protein REM1...  60.1    2e-06   
ref|XP_006663274.1|  PREDICTED: B3 domain-containing protein Os11...  60.1    2e-06   
ref|XP_011086144.1|  PREDICTED: putative B3 domain-containing pro...  57.4    2e-06   
ref|XP_006601305.1|  PREDICTED: B3 domain-containing protein REM1...  60.1    2e-06   
gb|KEH41183.1|  plant-specific B3-DNA-binding domain protein          59.7    2e-06   
ref|XP_003589280.1|  B3 domain-containing protein REM16               60.1    2e-06   
ref|XP_004152721.1|  PREDICTED: B3 domain-containing protein REM1...  60.1    2e-06   
ref|XP_004291931.1|  PREDICTED: B3 domain-containing protein Os03...  60.1    2e-06   
ref|XP_009120532.1|  PREDICTED: B3 domain-containing protein At5g...  59.3    2e-06   
ref|XP_009340814.1|  PREDICTED: B3 domain-containing protein REM1...  59.3    2e-06   
ref|XP_010420133.1|  PREDICTED: B3 domain-containing protein At3g...  57.0    2e-06   
ref|XP_009120533.1|  PREDICTED: B3 domain-containing protein At5g...  59.3    2e-06   
ref|XP_011083918.1|  PREDICTED: B3 domain-containing protein REM1...  59.3    2e-06   
ref|XP_002510293.1|  DNA binding protein, putative                    59.7    2e-06   
emb|CDY31575.1|  BnaA10g12960D                                        59.3    2e-06   
sp|Q6Z0D2.1|Y8251_ORYSJ  RecName: Full=Putative B3 domain-contain...  59.7    2e-06   
gb|EMT09780.1|  B3 domain-containing protein                          59.3    2e-06   
ref|NP_200822.1|  AP2/B3-like transcriptional factor family protein   59.3    2e-06   
ref|XP_006284943.1|  hypothetical protein CARUB_v10006245mg           59.3    2e-06   
ref|XP_004160048.1|  PREDICTED: B3 domain-containing protein Os12...  59.7    2e-06   
ref|XP_006361149.1|  PREDICTED: putative B3 domain-containing pro...  58.5    2e-06   
gb|KGN64374.1|  hypothetical protein Csa_1G050130                     60.1    2e-06   
ref|XP_004162144.1|  PREDICTED: uncharacterized protein LOC101229838  59.7    3e-06   
ref|XP_008357222.1|  PREDICTED: uncharacterized protein LOC103420963  59.7    3e-06   
gb|EEC83374.1|  hypothetical protein OsI_28786                        59.3    3e-06   
ref|XP_004152587.1|  PREDICTED: uncharacterized protein LOC101210561  59.7    3e-06   
dbj|BAB10312.1|  unnamed protein product                              58.9    3e-06   
ref|XP_002869150.1|  hypothetical protein ARALYDRAFT_912952           59.3    3e-06   
ref|XP_010229964.1|  PREDICTED: B3 domain-containing protein Os11...  57.0    3e-06   
gb|KHG18759.1|  B3 domain-containing transcription factor VRN1 -l...  58.9    3e-06   
ref|XP_008361147.1|  PREDICTED: B3 domain-containing protein Os01...  57.0    4e-06   
ref|XP_006423112.1|  hypothetical protein CICLE_v10029384mg           56.6    4e-06   
ref|XP_004242112.1|  PREDICTED: B3 domain-containing transcriptio...  57.8    4e-06   
ref|XP_010315280.1|  PREDICTED: B3 domain-containing protein Os11...  58.2    4e-06   
ref|XP_010255065.1|  PREDICTED: B3 domain-containing protein Os01...  59.3    4e-06   
gb|EMT26018.1|  B3 domain-containing protein                          59.3    4e-06   
gb|EEC75757.1|  hypothetical protein OsI_12652                        58.2    4e-06   
ref|XP_010255069.1|  PREDICTED: putative B3 domain-containing pro...  58.9    4e-06   
ref|XP_011030819.1|  PREDICTED: B3 domain-containing protein Os01...  59.3    4e-06   
ref|XP_006595619.1|  PREDICTED: uncharacterized protein LOC100813...  58.9    4e-06   
ref|XP_010255066.1|  PREDICTED: putative B3 domain-containing pro...  58.9    4e-06   
gb|KDP33468.1|  hypothetical protein JCGZ_07039                       58.2    4e-06   
gb|KHG11795.1|  B3 domain-containing REM16 -like protein              58.5    4e-06   
ref|XP_010039406.1|  PREDICTED: B3 domain-containing protein At3g...  56.6    5e-06   
ref|XP_006434877.1|  hypothetical protein CICLE_v10000881mg           58.5    5e-06   
ref|XP_008786201.1|  PREDICTED: putative B3 domain-containing pro...  58.9    5e-06   
ref|XP_006473396.1|  PREDICTED: B3 domain-containing protein LOC_...  58.9    5e-06   
ref|XP_008378454.1|  PREDICTED: B3 domain-containing protein Os01...  58.9    5e-06   
ref|XP_006401913.1|  hypothetical protein EUTSA_v10014972mg           55.8    5e-06   
ref|XP_006434882.1|  hypothetical protein CICLE_v10000881mg           58.9    5e-06   
ref|XP_004292711.1|  PREDICTED: B3 domain-containing protein REM1...  57.4    5e-06   
ref|XP_009333824.1|  PREDICTED: B3 domain-containing protein Os01...  58.9    5e-06   
ref|XP_004230835.1|  PREDICTED: B3 domain-containing protein Os11...  57.8    5e-06   
ref|XP_007131904.1|  hypothetical protein PHAVU_011G050500g           58.2    5e-06   
ref|XP_010413388.1|  PREDICTED: B3 domain-containing protein REM2...  58.5    5e-06   
ref|XP_010263946.1|  PREDICTED: B3 domain-containing protein Os01...  58.2    5e-06   
emb|CDY48602.1|  BnaA01g07630D                                        58.2    5e-06   
ref|XP_009128723.1|  PREDICTED: B3 domain-containing protein At4g...  58.2    5e-06   
ref|XP_009769346.1|  PREDICTED: B3 domain-containing protein Os11...  58.2    6e-06   
ref|XP_007047109.1|  DSBA oxidoreductase family protein isoform 1     58.5    6e-06   
ref|XP_010255068.1|  PREDICTED: putative B3 domain-containing pro...  58.5    6e-06   
emb|CDY48600.1|  BnaA01g07650D                                        58.2    6e-06   
ref|XP_007017397.1|  AP2/B3-like transcriptional factor family pr...  58.2    6e-06   
ref|XP_007017396.1|  AP2/B3-like transcriptional factor family pr...  58.2    6e-06   
ref|XP_009333822.1|  PREDICTED: uncharacterized protein LOC103926...  58.9    6e-06   
gb|ACJ86285.1|  unknown                                               58.5    6e-06   
gb|AFK42404.1|  unknown                                               58.5    6e-06   
ref|XP_007224197.1|  hypothetical protein PRUPE_ppa017317mg           54.7    6e-06   
ref|XP_007047110.1|  Thioredoxin superfamily protein isoform 2        58.2    7e-06   
ref|XP_010059783.1|  PREDICTED: B3 domain-containing protein REM1...  58.2    7e-06   
ref|XP_010059785.1|  PREDICTED: B3 domain-containing protein REM1...  58.2    7e-06   
ref|XP_009333820.1|  PREDICTED: uncharacterized protein LOC103926...  58.5    7e-06   
ref|XP_010455999.1|  PREDICTED: B3 domain-containing protein At5g...  57.8    7e-06   
ref|XP_009333821.1|  PREDICTED: uncharacterized protein LOC103926...  58.5    7e-06   
ref|XP_008380674.1|  PREDICTED: B3 domain-containing protein Os12...  57.4    7e-06   
ref|XP_009356866.1|  PREDICTED: B3 domain-containing protein Os12...  57.4    7e-06   
ref|XP_010647801.1|  PREDICTED: B3 domain-containing protein Os01...  58.2    7e-06   
ref|XP_010059782.1|  PREDICTED: B3 domain-containing protein REM1...  58.2    7e-06   
ref|XP_006840490.1|  hypothetical protein AMTR_s00045p00193040        58.2    7e-06   
emb|CDX80198.1|  BnaC09g35440D                                        56.6    7e-06   
ref|XP_006389440.1|  hypothetical protein POPTR_0025s00720g           55.8    7e-06   
ref|XP_004290392.1|  PREDICTED: B3 domain-containing protein Os11...  57.4    7e-06   
dbj|BAJ97129.1|  predicted protein                                    58.5    8e-06   
gb|KDO52170.1|  hypothetical protein CISIN_1g043961mg                 55.8    8e-06   
ref|XP_002882451.1|  transcriptional factor B3 family protein         57.8    8e-06   
gb|KHG05314.1|  B3 domain-containing REM16 -like protein              57.8    8e-06   
ref|XP_008226604.1|  PREDICTED: B3 domain-containing protein REM6...  57.0    9e-06   
ref|XP_009333823.1|  PREDICTED: uncharacterized protein LOC103926...  58.2    9e-06   
sp|Q851V1.1|Y3160_ORYSJ  RecName: Full=Putative B3 domain-contain...  57.4    9e-06   
ref|XP_008810645.1|  PREDICTED: B3 domain-containing protein Os01...  57.4    9e-06   
gb|EEE51804.1|  hypothetical protein OsJ_33271                        57.8    1e-05   
ref|XP_009389535.1|  PREDICTED: B3 domain-containing protein Os11...  57.4    1e-05   
ref|XP_006281750.1|  hypothetical protein CARUB_v10027909mg           57.4    1e-05   
ref|XP_002301205.2|  transcriptional factor B3 family protein         57.4    1e-05   
ref|XP_010275849.1|  PREDICTED: B3 domain-containing protein Os01...  57.0    1e-05   
gb|EYU31617.1|  hypothetical protein MIMGU_mgv1a021146mg              55.1    1e-05   
gb|EMT08965.1|  Putative B3 domain-containing protein                 57.8    1e-05   
ref|XP_004241347.1|  PREDICTED: B3 domain-containing protein REM5...  56.6    1e-05   
ref|XP_004305410.1|  PREDICTED: B3 domain-containing protein REM5...  56.2    1e-05   
ref|XP_009340826.1|  PREDICTED: B3 domain-containing protein At4g...  56.6    1e-05   
ref|XP_006423085.1|  hypothetical protein CICLE_v10029372mg           55.1    1e-05   
gb|EEC67837.1|  hypothetical protein OsI_35443                        57.0    1e-05   
gb|KGN59902.1|  hypothetical protein Csa_3G852510                     57.4    1e-05   
ref|NP_001067431.1|  Os11g0197600                                     57.0    1e-05   
ref|XP_004147830.1|  PREDICTED: B3 domain-containing protein Os01...  57.4    1e-05   
ref|XP_004308903.1|  PREDICTED: B3 domain-containing protein Os01...  55.8    2e-05   
ref|XP_008386195.1|  PREDICTED: B3 domain-containing protein REM1...  56.2    2e-05   
emb|CDY43503.1|  BnaA01g07410D                                        56.6    2e-05   
ref|XP_007160809.1|  hypothetical protein PHAVU_001G018500g           57.4    2e-05   
ref|XP_006480064.1|  PREDICTED: B3 domain-containing transcriptio...  56.2    2e-05   
ref|XP_010530782.1|  PREDICTED: B3 domain-containing protein REM2...  56.2    2e-05   
ref|NP_001144632.1|  uncharacterized protein LOC100277651             57.0    2e-05   
ref|XP_008226603.1|  PREDICTED: B3 domain-containing protein Os01...  56.2    2e-05   
gb|EYU26914.1|  hypothetical protein MIMGU_mgv1a011529mg              56.2    2e-05   
ref|XP_011083780.1|  PREDICTED: B3 domain-containing protein REM1...  56.6    2e-05   
gb|KCW68795.1|  hypothetical protein EUGRSUZ_F02399                   57.0    2e-05   
ref|XP_007160811.1|  hypothetical protein PHAVU_001G018500g           57.0    2e-05   
ref|XP_010924666.1|  PREDICTED: B3 domain-containing protein Os01...  56.2    2e-05   
gb|KCW68798.1|  hypothetical protein EUGRSUZ_F02399                   57.0    2e-05   
ref|XP_002866371.1|  hypothetical protein ARALYDRAFT_919255           55.5    2e-05   
ref|XP_010680983.1|  PREDICTED: B3 domain-containing protein Os01...  56.2    2e-05   
ref|XP_010061800.1|  PREDICTED: B3 domain-containing protein Os11...  57.0    2e-05   
ref|XP_011030831.1|  PREDICTED: B3 domain-containing protein REM1...  56.2    2e-05   
ref|XP_011017261.1|  PREDICTED: B3 domain-containing protein REM1...  56.2    2e-05   
gb|KDO39917.1|  hypothetical protein CISIN_1g045031mg                 53.9    3e-05   
emb|CDY69206.1|  BnaCnng62390D                                        55.8    3e-05   
dbj|BAK05045.1|  predicted protein                                    55.8    3e-05   
gb|EMT17387.1|  B3 domain-containing protein                          55.5    3e-05   
ref|XP_010443804.1|  PREDICTED: B3 domain-containing protein At5g...  55.8    3e-05   
ref|XP_002282159.3|  PREDICTED: B3 domain-containing protein Os01...  56.2    3e-05   
ref|XP_006480248.1|  PREDICTED: B3 domain-containing protein Os01...  53.5    3e-05   
ref|XP_011017257.1|  PREDICTED: B3 domain-containing protein REM1...  56.2    3e-05   
ref|XP_010664619.1|  PREDICTED: B3 domain-containing protein Os01...  56.2    3e-05   
ref|XP_002510292.1|  DNA binding protein, putative                    55.8    4e-05   
ref|XP_010483657.1|  PREDICTED: B3 domain-containing protein At5g...  55.1    4e-05   
ref|XP_006375018.1|  transcriptional factor B3 family protein         55.5    4e-05   
ref|NP_001119463.2|  AP2/B3-like transcriptional factor family pr...  55.5    4e-05   
ref|XP_007160808.1|  hypothetical protein PHAVU_001G018400g           55.8    4e-05   
ref|XP_007142861.1|  hypothetical protein PHAVU_007G022900g           55.1    4e-05   
gb|EEC69597.1|  hypothetical protein OsI_38944                        56.2    4e-05   
ref|XP_009396674.1|  PREDICTED: B3 domain-containing protein REM1...  55.5    5e-05   
ref|XP_010483655.1|  PREDICTED: B3 domain-containing protein At5g...  55.1    5e-05   
ref|XP_010266787.1|  PREDICTED: B3 domain-containing protein Os01...  53.9    5e-05   
gb|KHN11484.1|  B3 domain-containing transcription factor VRN1        54.7    5e-05   
ref|XP_008439306.1|  PREDICTED: uncharacterized protein LOC103484129  55.8    5e-05   
ref|XP_009341402.1|  PREDICTED: putative B3 domain-containing pro...  55.1    5e-05   
gb|KEH41184.1|  plant-specific B3-DNA-binding domain protein          55.1    6e-05   
ref|XP_010266788.1|  PREDICTED: B3 domain-containing protein Os01...  53.5    6e-05   
gb|EMT06404.1|  B3 domain-containing protein                          55.5    6e-05   
ref|XP_006606882.1|  PREDICTED: B3 domain-containing transcriptio...  55.5    6e-05   
gb|KCW60177.1|  hypothetical protein EUGRSUZ_H02901                   55.1    6e-05   
ref|XP_010229963.1|  PREDICTED: uncharacterized protein LOC104582255  55.8    6e-05   
ref|XP_006840489.1|  hypothetical protein AMTR_s00045p00192570        55.1    6e-05   
ref|XP_006386516.1|  hypothetical protein POPTR_0002s13140g           53.1    7e-05   
ref|NP_187273.2|  AP2/B3-like transcriptional factor family protein   52.8    7e-05   
ref|XP_008440212.1|  PREDICTED: uncharacterized protein LOC103484...  55.5    7e-05   
ref|XP_009389369.1|  PREDICTED: B3 domain-containing protein Os01...  54.7    7e-05   
gb|AFW60660.1|  hypothetical protein ZEAMMB73_443682                  55.1    7e-05   
ref|XP_009613235.1|  PREDICTED: B3 domain-containing protein Os01...  52.0    7e-05   
ref|NP_001130957.1|  hypothetical protein                             55.1    7e-05   
emb|CAN64872.1|  hypothetical protein VITISV_026093                   54.3    7e-05   
gb|ABK28546.1|  unknown                                               52.8    7e-05   
ref|XP_009355809.1|  PREDICTED: B3 domain-containing protein REM9...  53.9    7e-05   
ref|XP_008339373.1|  PREDICTED: B3 domain-containing protein REM8...  53.5    8e-05   
ref|XP_009356789.1|  PREDICTED: putative B3 domain-containing pro...  54.3    8e-05   
ref|XP_003589268.1|  B3 domain-containing protein                     55.1    8e-05   
gb|AES59519.2|  plant-specific B3-DNA-binding domain protein          54.7    8e-05   
ref|XP_010089922.1|  B3 domain-containing protein REM16               54.7    8e-05   
ref|XP_010232595.1|  PREDICTED: B3 domain-containing protein Os03...  55.1    9e-05   
gb|AAX96729.1|  B3 DNA binding domain, putative                       54.7    9e-05   
ref|XP_011085518.1|  PREDICTED: B3 domain-containing protein REM5...  53.9    9e-05   
ref|XP_006282152.1|  hypothetical protein CARUB_v10028409mg           53.9    9e-05   
ref|XP_009769345.1|  PREDICTED: B3 domain-containing protein Os01...  51.6    1e-04   
ref|XP_010232591.1|  PREDICTED: B3 domain-containing protein Os03...  55.1    1e-04   
ref|XP_009149100.1|  PREDICTED: B3 domain-containing protein At1g...  52.0    1e-04   
ref|XP_006650310.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...  54.7    1e-04   
ref|XP_006401176.1|  hypothetical protein EUTSA_v10014229mg           53.9    1e-04   
ref|XP_008386193.1|  PREDICTED: putative B3 domain-containing pro...  53.9    1e-04   
ref|XP_010263945.1|  PREDICTED: B3 domain-containing protein Os01...  54.3    1e-04   
ref|XP_010232581.1|  PREDICTED: B3 domain-containing protein Os03...  54.7    1e-04   
ref|XP_010266786.1|  PREDICTED: putative B3 domain-containing pro...  53.5    1e-04   
ref|XP_008454672.1|  PREDICTED: B3 domain-containing protein Os01...  54.7    1e-04   
ref|XP_007017398.1|  AP2/B3-like transcriptional factor family pr...  53.9    1e-04   
ref|XP_001758802.1|  predicted protein                                54.3    1e-04   
ref|XP_004304357.1|  PREDICTED: B3 domain-containing protein REM1...  54.3    1e-04   
ref|XP_002510291.1|  conserved hypothetical protein                   54.7    1e-04   
ref|XP_006606883.1|  PREDICTED: B3 domain-containing transcriptio...  53.9    1e-04   
ref|XP_003589271.1|  B3 domain-containing protein                     53.9    1e-04   
ref|XP_003539036.1|  PREDICTED: B3 domain-containing protein At5g...  53.9    1e-04   
gb|KHG17955.1|  B3 domain-containing protein REM20                    53.1    1e-04   
ref|XP_010483307.1|  PREDICTED: B3 domain-containing protein At5g...  53.9    1e-04   
gb|KDP46180.1|  hypothetical protein JCGZ_10020                       54.3    1e-04   
ref|XP_010041490.1|  PREDICTED: B3 domain-containing protein At3g...  51.6    1e-04   
ref|XP_009613237.1|  PREDICTED: B3 domain-containing protein Os11...  53.5    1e-04   
ref|XP_010452725.1|  PREDICTED: B3 domain-containing protein At5g...  53.5    1e-04   
ref|XP_009613987.1|  PREDICTED: B3 domain-containing protein At3g...  52.8    1e-04   
gb|EMT07265.1|  B3 domain-containing protein                          54.3    2e-04   
ref|XP_006346537.1|  PREDICTED: B3 domain-containing protein Os11...  53.1    2e-04   
ref|XP_010030659.1|  PREDICTED: B3 domain-containing protein Os01...  53.5    2e-04   
ref|XP_006416796.1|  hypothetical protein EUTSA_v10009082mg           51.2    2e-04   
ref|XP_002866373.1|  hypothetical protein ARALYDRAFT_919257           52.4    2e-04   
ref|XP_009401054.1|  PREDICTED: uncharacterized protein LOC103985153  54.3    2e-04   
ref|XP_010028531.1|  PREDICTED: B3 domain-containing protein Os01...  53.5    2e-04   
ref|XP_007221817.1|  hypothetical protein PRUPE_ppa003541mg           53.9    2e-04   
ref|XP_001785000.1|  predicted protein                                53.9    2e-04   
ref|XP_006651608.1|  PREDICTED: putative B3 domain-containing pro...  53.1    2e-04   
ref|XP_008220724.1|  PREDICTED: B3 domain-containing protein Os01...  53.9    2e-04   
gb|KHG11713.1|  B3 domain-containing REM20 -like protein              52.8    2e-04   
ref|XP_004308266.1|  PREDICTED: B3 domain-containing protein LOC_...  52.4    2e-04   
gb|KHG17954.1|  B3 domain-containing protein REM20                    52.8    2e-04   
ref|XP_007042314.1|  Uncharacterized protein TCM_006973               53.5    2e-04   
ref|XP_006380736.1|  hypothetical protein POPTR_0007s11890g           52.8    2e-04   
ref|XP_003549416.2|  PREDICTED: B3 domain-containing protein Os01...  53.9    2e-04   
ref|XP_010266779.1|  PREDICTED: B3 domain-containing protein Os01...  53.1    2e-04   
gb|KHN12748.1|  B3 domain-containing protein                          53.5    2e-04   
gb|KDO52171.1|  hypothetical protein CISIN_1g0434992mg                53.1    2e-04   
ref|XP_009613233.1|  PREDICTED: B3 domain-containing transcriptio...  53.9    2e-04   
gb|KDP38418.1|  hypothetical protein JCGZ_04343                       53.1    2e-04   
gb|EYU26912.1|  hypothetical protein MIMGU_mgv1a024196mg              51.6    2e-04   
ref|XP_002442429.1|  hypothetical protein SORBIDRAFT_08g019930        53.1    2e-04   
dbj|BAK04345.1|  predicted protein                                    53.9    2e-04   
ref|XP_008386194.1|  PREDICTED: putative B3 domain-containing pro...  52.8    2e-04   
ref|NP_200580.1|  AP2/B3-like transcriptional factor family protein   52.8    2e-04   
ref|XP_008344299.1|  PREDICTED: B3 domain-containing protein At1g...  51.6    2e-04   
ref|XP_006479392.1|  PREDICTED: B3 domain-containing transcriptio...  53.1    3e-04   
gb|ACU23634.1|  unknown                                               51.6    3e-04   
ref|XP_010455588.1|  PREDICTED: B3 domain-containing protein At5g...  52.8    3e-04   
ref|XP_003602766.1|  B3 domain-containing protein                     52.8    3e-04   
ref|NP_001189823.1|  B3 domain-containing protein REM21               53.1    3e-04   
ref|XP_006384478.1|  hypothetical protein POPTR_0004s15430g           53.1    3e-04   
ref|XP_002442425.1|  hypothetical protein SORBIDRAFT_08g019885        50.8    3e-04   
ref|XP_010248803.1|  PREDICTED: B3 domain-containing protein Os01...  53.5    3e-04   



>ref|XP_009613232.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform 
X2 [Nicotiana tomentosiformis]
Length=328

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 98/139 (71%), Gaps = 2/139 (1%)
 Frame = +3

Query  675   CS-GAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             CS G  + +++ K ++V D +G E+F SG+  QP NPYFV K+  K R  LY+P+ V++D
Sbjct  187   CSKGVFKRATTIKRRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAKRRDQLYVPVDVVRD  246

Query  852   HNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN  1031
             +N+ LPP +  RD+ G++++++V IW+DGR W+ +GW+ +C+ NLV+K+D CICEF+   
Sbjct  247   YNLELPPKMFFRDSEGRKFETEVNIWKDGRIWLKKGWRKICRWNLVEKEDRCICEFMRGK  306

Query  1032  TNDML-LQVTIVRGQTTKN  1085
              N++L LQVT+V+     N
Sbjct  307   ANEVLYLQVTLVKAGGVSN  325


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE SSQKL+IP +F E   G +PK+I LR+ F  VW +E+ +    L FQ+ W 
Sbjct  11   FFKFFYPENSSQKLKIPTAFTEYKNGKLPKRISLRDRFGNVWPIELAKKGRDLYFQDGWV  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDNS+  GD L+F Y G  +FDF L  +  CEK
Sbjct  71   KFIEDNSLEFGDFLIFDYDGSGVFDFKLLGKTACEK  106



>ref|XP_009769341.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 
[Nicotiana sylvestris]
Length=330

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  675   CS-GAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             CS G  + +++ K ++V D +G E+F SG+  QP NPYFV K+  K R  LY+P+ V++D
Sbjct  189   CSKGVFKRATTIKKRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAKRRDQLYVPVDVVRD  248

Query  852   HNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN  1031
             +N+ LPP +  RD+ G++++++V IW+DGR W+ +GW+ +C+ NLV+K+D CICEF+   
Sbjct  249   YNLELPPKMFFRDSEGRKFETEVNIWKDGRIWLKKGWRKICRWNLVEKEDRCICEFMRGK  308

Query  1032  TNDML-LQVTIVRG  1070
             +N++L LQVT+V+ 
Sbjct  309   SNEILYLQVTVVKA  322


 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE SSQKL+IP +F E   G +PK++ LR+ F  VW + M +    L FQ+ W 
Sbjct  11   FFKLFYPENSSQKLKIPTAFTEYKNGKLPKRVSLRDRFGNVWPIGMAKKGRYLYFQDGWV  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDNS+  GD L+F Y G  +FDF L  +  CEK
Sbjct  71   KFIEDNSLEFGDFLIFDYDGNGVFDFKLLGKTACEK  106



>ref|XP_009613231.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform 
X1 [Nicotiana tomentosiformis]
Length=375

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 98/139 (71%), Gaps = 2/139 (1%)
 Frame = +3

Query  675   CS-GAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             CS G  + +++ K ++V D +G E+F SG+  QP NPYFV K+  K R  LY+P+ V++D
Sbjct  234   CSKGVFKRATTIKRRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAKRRDQLYVPVDVVRD  293

Query  852   HNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN  1031
             +N+ LPP +  RD+ G++++++V IW+DGR W+ +GW+ +C+ NLV+K+D CICEF+   
Sbjct  294   YNLELPPKMFFRDSEGRKFETEVNIWKDGRIWLKKGWRKICRWNLVEKEDRCICEFMRGK  353

Query  1032  TNDML-LQVTIVRGQTTKN  1085
              N++L LQVT+V+     N
Sbjct  354   ANEVLYLQVTLVKAGGVSN  372


 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE SSQKL+IP +F E   G +PK+I LR+ F  VW +E+ +    L FQ+ W 
Sbjct  11   FFKFFYPENSSQKLKIPTAFTEYKNGKLPKRISLRDRFGNVWPIELAKKGRDLYFQDGWV  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDNS+  GD L+F Y G  +FDF L  +  CEK
Sbjct  71   KFIEDNSLEFGDFLIFDYDGSGVFDFKLLGKTACEK  106



>ref|XP_009769340.1| PREDICTED: B3 domain-containing protein At4g34400-like isoform 
X1 [Nicotiana sylvestris]
Length=375

 Score =   143 bits (360),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 98/134 (73%), Gaps = 2/134 (1%)
 Frame = +3

Query  675   CS-GAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             CS G  + +++ K ++V D +G E+F SG+  QP NPYFV K+  K R  LY+P+ V++D
Sbjct  234   CSKGVFKRATTIKKRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAKRRDQLYVPVDVVRD  293

Query  852   HNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN  1031
             +N+ LPP +  RD+ G++++++V IW+DGR W+ +GW+ +C+ NLV+K+D CICEF+   
Sbjct  294   YNLELPPKMFFRDSEGRKFETEVNIWKDGRIWLKKGWRKICRWNLVEKEDRCICEFMRGK  353

Query  1032  TNDML-LQVTIVRG  1070
             +N++L LQVT+V+ 
Sbjct  354   SNEILYLQVTVVKA  367


 Score = 94.0 bits (232),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE SSQKL+IP +F E   G +PK++ LR+ F  VW + M +    L FQ+ W 
Sbjct  11   FFKLFYPENSSQKLKIPTAFTEYKNGKLPKRVSLRDRFGNVWPIGMAKKGRYLYFQDGWV  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDNS+  GD L+F Y G  +FDF L  +  CEK
Sbjct  71   KFIEDNSLEFGDFLIFDYDGNGVFDFKLLGKTACEK  106



>emb|CDP12499.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +3

Query  726   DHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQE  905
             D +G  LF SG+  QP NPYFVTK+  K +  LY+P+ V+KDHN+  PP ++L D + +E
Sbjct  219   DAYGFNLFKSGKIPQPKNPYFVTKVRTKRQDELYVPVDVVKDHNLEFPPEIVLHDPKERE  278

Query  906   WKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVR  1067
             W+++++ W DGR W   GW+SLC+LNLV ++DICICEFV      + + VT VR
Sbjct  279   WRARLRRWSDGRIWYCGGWRSLCRLNLVGEEDICICEFVKREGGGLRINVTFVR  332


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F P TS+++L+IPI+F + + G +P K  LR+ +  +W +E+   E+   F   WA
Sbjct  16   FFKAFIPNTSTERLKIPIAFTKMIRGSLPDKAFLRDRYGNIWPVELARIENATFFLEGWA  75

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KFV+DNS+  GD LVF + G  +F+  L     C+K
Sbjct  76   KFVKDNSVELGDFLVFHFDGNCVFNVKLLGHTACDK  111



>ref|XP_006351837.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
tuberosum]
Length=350

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +3

Query  708   KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILR  887
             K +N  DHFG+++F SG+  QP NPYFV K+  K R  LY+P+ V+KD+ + LP ++ +R
Sbjct  222   KVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRSKRRDQLYVPVDVVKDYKLELPSSMTIR  281

Query  888   DTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTN-DMLLQVTIV  1064
             D+ G+E+ +K+K W+DGR W+  GW+SLC+ NLV+K+D CICEFV    N D+ LQV ++
Sbjct  282   DSVGREFVTKLKKWKDGRIWLVGGWRSLCRWNLVEKNDHCICEFVRGKRNKDLHLQVQVL  341


 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE S ++L+IP  F       +PKKI LR+ F  +W + + +  +   FQ  W 
Sbjct  5    FVKIFSPEKSGKRLKIPTCFTYYKNEKLPKKIYLRDRFGNMWPIGVNKIGEKFYFQYGWE  64

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDN++  GD L+F Y G  +FDF L  +  CEK
Sbjct  65   KFIEDNTVEVGDFLIFDYDGNKIFDFKLLGRTKCEK  100



>ref|XP_004231373.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
 ref|XP_004230633.2| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
Length=336

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = +3

Query  708   KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILR  887
             K +N  DHFG+++F SG+  QP NPYFV K+  K R  LY+P+ V+KD+ + LP ++ +R
Sbjct  208   KVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRSKRRDQLYVPVDVVKDYKLELPSSMTIR  267

Query  888   DTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTN-DMLLQVTIV  1064
             D+ G+E+ +K+  W+DGR W+  GW+SLC+ NLV+K+D CICEFV    N D+ L+V ++
Sbjct  268   DSIGREFVTKLNKWKDGRIWLVGGWRSLCRWNLVEKNDHCICEFVRGKRNKDLHLRVQVL  327

Query  1065  R  1067
             R
Sbjct  328   R  328


 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PE S ++L+IP SF       +P KI LR+ F  +W + + +    L FQ  W 
Sbjct  5    FVKIFSPENSGKRLKIPTSFTYYKNRKLPMKINLRDRFGNMWPVGVNKIGGNLYFQYGWE  64

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDNS+  GD LVF Y G  +FDF L  +  CEK
Sbjct  65   KFIEDNSVEVGDFLVFDYDGNKMFDFKLLGRTKCEK  100



>ref|XP_006346538.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
tuberosum]
Length=226

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 92/136 (68%), Gaps = 4/136 (3%)
 Frame = +3

Query  669   KKCSGAGEGSSSK---KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMH  839
             KK SG+ +G       K +NV D +G ++F SG+  QP NPYFV K+  K R+ LY+P+ 
Sbjct  80    KKTSGSKDGCRKAITCKVRNVHDKYGADIFRSGRTTQPKNPYFVAKIRAKMRNQLYVPID  139

Query  840   VIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEF  1019
             V++D+ + L PT+I+RD+ G+E+++KV  W +G  W+  GW++LC+ NLV+KDD CICEF
Sbjct  140   VVRDYELKLHPTMIIRDSVGREFETKVNNWSNGTIWLVGGWRNLCRWNLVEKDDRCICEF  199

Query  1020  VHPNTNDML-LQVTIV  1064
             V      +L LQV ++
Sbjct  200   VREKCGKILYLQVQVL  215



>ref|XP_006350438.1| PREDICTED: B3 domain-containing protein REM5-like [Solanum tuberosum]
Length=237

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +3

Query  672   KCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             KC  A  G    K  +  D F  ++  SG+   P NPYF+TK+    R+ LYIP  V++D
Sbjct  99    KCKSATAG----KRNDPLDKFTTDILRSGRATTPKNPYFITKISSDRRNQLYIPTDVVRD  154

Query  852   HNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN  1031
             + + LP ++ + D+ G+E+++K+KIW+DGR W+  GW+SLC+ NL++K+D CICEFV   
Sbjct  155   YQLELPSSMTIHDSSGREFEAKLKIWQDGRIWLIGGWRSLCRQNLLEKNDTCICEFVREK  214

Query  1032  TN-DMLLQVTIV  1064
              N D+ LQV +V
Sbjct  215   HNKDLYLQVHVV  226


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  127  VGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSL  306
            + G++P  ++L + F  +W + +T+++  +CF+  W KF+EDN +  GD  +F Y G   
Sbjct  1    MNGILPSNVLLTDRFGNMWPIGVTKSQKHICFEYGWKKFIEDNILELGDFFIFDYDGTRT  60

Query  307  FDFVLFDQFGCEK  345
            FDF L  + GC K
Sbjct  61   FDFKLLGRNGCVK  73



>ref|XP_010315502.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Solanum lycopersicum]
Length=705

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +3

Query  708   KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILR  887
             K +NV D +G ++F SG+  QP NPYFV K+  K R+ LY+P+ V++D+ + LPPT+I+R
Sbjct  575   KVRNVHDKYGADIFRSGRATQPKNPYFVAKMRAKMRNQLYVPIDVVRDYKLELPPTMIIR  634

Query  888   DTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDML-LQVTIV  1064
             D+ G+E+++KV  W +G TW+  GW++LC+ NLV+KDD CICEFV      +L LQ+ ++
Sbjct  635   DSVGREFETKVNKWSNGTTWLVGGWRNLCRWNLVEKDDRCICEFVRGKCGRVLYLQIQVL  694


 Score =   127 bits (319),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 92/137 (67%), Gaps = 4/137 (3%)
 Frame = +3

Query  669   KKCSGAGEGSSSK---KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMH  839
             K+ SG+  G       K +N+ D  GI++F SG   +P NPYFV K+  K R+  Y+P+ 
Sbjct  195   KRRSGSKAGRRKAITCKVRNMIDRHGIDIFRSGSATKPKNPYFVAKIIAKRRNQQYVPID  254

Query  840   VIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEF  1019
             V++D+ + LPP++I+RD+ G+E+++KVK W+DGR W+  GW+S+C+ NLV+K+D  ICEF
Sbjct  255   VVRDYKLELPPSMIIRDSAGREFETKVKYWKDGRIWLVGGWRSICRWNLVEKNDRFICEF  314

Query  1020  VHPNTNDM-LLQVTIVR  1067
             V      +  LQV +++
Sbjct  315   VREQCGKISFLQVRVLQ  331


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F + F PE+S+++++IP S+     G +P+ +  R+ F  +W M +T+ E  L F+N W 
Sbjct  5    FFRIFNPESSAKRMKIPSSYATYKNGKLPRNVFFRDRFNNMWPMGVTKIEGALYFENGWK  64

Query  238  KFVED-NSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+ED N++  GD ++F Y G   FDF + +  GC K
Sbjct  65   KFIEDNNTLEYGDFMIFDYDGNETFDFKVLEMSGCVK  101


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKV-WSMEMTETEDGLCFQNNW  234
            F K F P+TS+++++IP ++     G +P+K+ LRN F  + W + + + E  L F N W
Sbjct  363  FFKAFNPQTSAKRMKIPTAYTNYKNGKLPRKVFLRNQFSNMSWPVRVIKIEKDLYFLNGW  422

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             KF+EDN++  G+ ++F Y G  +FD  L +  GC K
Sbjct  423  EKFIEDNNLEFGNIIIFDYDGNEIFDIKLLEPNGCIK  459



>emb|CDP12500.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +3

Query  705   KKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLIL  884
             ++ + + D +G +LF SG   QP NPYFVT+   + + ALY+P  +++DHN+ LP  +IL
Sbjct  327   RRRRWLIDPYGYDLFKSGCISQPKNPYFVTQKRARRQDALYVPHDILRDHNLKLPQEIIL  386

Query  885   RDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIV  1064
              D +G+EW S    W+DGR W   GW SLC++N+V  DDICICEF       + ++V I+
Sbjct  387   VDQQGREWTSTRNHWKDGRFWYHGGWSSLCRVNIVGFDDICICEFKRKVGGGLYIEVQIL  446

Query  1065  RGQTT  1079
             R Q T
Sbjct  447   RQQDT  451


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  133  GVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFD  312
            G +  +  LR+ F   W + +    D   F + WA+FVE+NS+  GD LVF Y G+SL+D
Sbjct  3    GKLSPRAYLRDRFGNKWPVRVGRIGDDFFFLDGWAEFVEENSVELGDFLVFQYDGHSLYD  62

Query  313  FVLFDQFGCEKIVV  354
              L     CEK  V
Sbjct  63   VKLLGHSACEKKGV  76



>ref|XP_010315503.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
Length=149

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +3

Query  699   SSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTL  878
             ++ K +++ D +G ++F SG   QP NPYFV K+  K R  LYI + V++D+ + LP  +
Sbjct  29    TACKVRDIPDQYGADIFKSGCATQPKNPYFVAKIRAKRRDQLYISIDVVRDYKLELPSRM  88

Query  879   ILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICE  1016
             I+RD+  +E+++K+K W+DGR W++ GW+SLC+ NLV+KDD CIC+
Sbjct  89    IIRDSADREFETKLKNWKDGRIWLAGGWRSLCRWNLVEKDDRCICD  134



>ref|XP_004231660.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
lycopersicum]
Length=345

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = +3

Query  714   KNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDT  893
             +++ +H+G ++F SG+  QP NPYFV K+  + R  LYIPM VI+D+ + LP  +I+RD+
Sbjct  217   RDIPEHYGADIFKSGRVTQPKNPYFVAKIQERIRDKLYIPMEVIRDYKLELPSRMIIRDS  276

Query  894   RGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDML-LQVTIV  1064
              G+E++++V  W DGR W+  GW  L +LNLV+KDD  ICE V  N    L LQV ++
Sbjct  277   AGREFETRVSKWTDGRVWLFGGWIKLGRLNLVEKDDRYICELVRGNCGKALYLQVQVL  334


 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PETS++ ++IPI + +   G +P+K+ LR+ +  +W + +T+    + F+  W 
Sbjct  5    FFKVFNPETSAKWIKIPIGYTKYKNGKIPRKVSLRDQYGNMWPIRVTKQGKDIYFKYGWE  64

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KF+EDN++   D L+F Y G   FDF L    GC K
Sbjct  65   KFIEDNNVEFADFLIFDYDGKGTFDFKLLGMNGCVK  100



>ref|XP_011100052.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
 ref|XP_011100053.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
 ref|XP_011100054.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
 ref|XP_011100055.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=306

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +3

Query  717   NVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTR  896
             N    +G+E+F +G   QP NPYFVTK+ PK +  L+IPM +IK  N+     + L D +
Sbjct  185   NFSGKYGMEIFQAGLLEQPTNPYFVTKIMPKRKGDLFIPMDIIKYSNLDFTQDMTLVDPK  244

Query  897   GQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVRGQT  1076
             G+++ +K K W+DGR  V+ GW+SLC+LN V+++D CICEFV      +LL VT VR + 
Sbjct  245   GRKFHAKCKKWKDGRMVVAGGWRSLCRLNFVEQEDRCICEFVQGEGRCLLLNVTFVRARD  304

Query  1077  TK  1082
              +
Sbjct  305   LR  306


 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K +  E ++  L+IP +F + V    P+K+ LR+ +  VW +++ +  D    ++ W 
Sbjct  7    FFKVYIAEINNNDLKIPQAFVQRVRKAFPEKVYLRDRWNNVWPVKVAQVGDDWYIRDGWV  66

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVK  357
            KFV+DN +T+GD LVF Y   SLF+  L+     EK V +
Sbjct  67   KFVDDNFLTSGDILVFEYFCDSLFNVKLYGLSATEKNVSR  106



>ref|XP_011084088.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=323

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +3

Query  681   GAGEGSSSKKNK--NVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDH  854
             G    +S K+++   V D +G E+F +G    P +PYF+TK+ P  +  LYIPM +IK  
Sbjct  190   GTSSNTSEKQSRCRRVPDIYGAEIFRTGLATYPKHPYFITKINPGRKGELYIPMDLIKVQ  249

Query  855   NIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNT  1034
             N+ LP  ++L D  G++W +++K WRDGRT+   GW+ LCK NL+  DD+CICEF+    
Sbjct  250   NLNLPKEILLLDPSGRKWSARLKQWRDGRTYYRGGWRRLCKTNLIGDDDLCICEFIKRGE  309

Query  1035  NDMLLQVTIVRG  1070
               + L ++ VR 
Sbjct  310   R-LCLNISFVRA  320


 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F PET + +LEIP +F  S+ G +P   ILR+ +   W + + +  D    ++ WA
Sbjct  10   FFKFFSPETCANQLEIPSAFILSIQGALPNNAILRDKYSNSWHVNVAKVGDTFYLKDGWA  69

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KFV DN I  GD LVF   G  LF   ++D  GCEK
Sbjct  70   KFVGDNFINRGDMLVFECYGKGLFSTKIYDSSGCEK  105



>ref|XP_002284808.2| PREDICTED: putative B3 domain-containing protein At5g66980 [Vitis 
vinifera]
Length=398

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F     + P NPYF TK+ P  RS LY+P+ V++DHNI LPP + LRD  G+ W  KV +
Sbjct  254   FEIESIVNPQNPYFETKVRPARRSKLYVPLDVLRDHNIKLPPKMTLRDPLGRLWIGKVAV  313

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTND-MLLQVTIVRGQTTK  1082
             W+DGRTW+  GW+  CK N V ++D CICEFV  + ++  LL V I+R Q ++
Sbjct  314   WKDGRTWI--GWKPFCKWNNVGENDTCICEFVQESGHEGYLLVVHILRAQPSR  364


 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            PE SS KL IP +F+E   G VP K ILR+   +VW +E+++    + FQ  W KFV DN
Sbjct  34   PECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELSKIGKDVYFQKGWQKFVTDN  93

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             +   D LVF Y G  +FDF LF   GCEK
Sbjct  94   FVEMEDFLVFRYDGGYIFDFKLFRNTGCEK  123



>ref|XP_010647774.1| PREDICTED: B3 domain-containing protein At5g60140-like [Vitis 
vinifera]
Length=116

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  756   GQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRD  935
                ++  NPYF TKL P   S LY+P+ V+KDHNIALPP ++LRD  G+ W   V +W+D
Sbjct  2     ASIVESKNPYFTTKLRPMRPSKLYVPVDVLKDHNIALPPRVLLRDPLGRSWPGDVAVWKD  61

Query  936   GRTWVSEGWQSLCKLNLVDKDDICICEFVH  1025
             GRTW+S GW++ CK N VD++D CICE V 
Sbjct  62    GRTWIS-GWRAFCKWNHVDENDTCICELVQ  90



>emb|CBI32504.3| unnamed protein product [Vitis vinifera]
Length=1085

 Score =   118 bits (296),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F     + P NPYF TK+ P  RS LY+P+ V++DHNI LPP + LRD  G+ W  KV +
Sbjct  815   FEIESIVNPQNPYFETKVRPARRSKLYVPLDVLRDHNIKLPPKMTLRDPLGRLWIGKVAV  874

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTND-MLLQVTIVRGQTTK  1082
             W+DGRTW+  GW+  CK N V ++D CICEFV  + ++  LL V I+R Q ++
Sbjct  875   WKDGRTWI--GWKPFCKWNNVGENDTCICEFVQESGHEGYLLVVHILRAQPSR  925


 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = +3

Query  765   IQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRT  944
             ++P NP F+TK+ P  RS LY+P+ ++KDHNIALPP ++L D  G+ W   V IW+DGRT
Sbjct  250   VKPENPCFITKIRPGRRSKLYVPVDILKDHNIALPPRVLLCDPHGRSWPGDVTIWKDGRT  309

Query  945   WVSEGWQSLCKLNLVDKDDICICEFVH  1025
             W+  GW++ CK N V ++D CICEFV 
Sbjct  310   WIG-GWRAFCKWNHVGENDSCICEFVQ  335


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +3

Query  819   ALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD  998
             A Y+P  +++D NIALPP ++LRD  G+ W   V +W+DGRTW+  GWQ+ CK N +D++
Sbjct  557   AEYVPADILQDFNIALPPRVLLRDLHGRSWPGDVSVWKDGRTWIG-GWQAFCKSNHLDEN  615

Query  999   DICICEFVHPN  1031
             D CI EFV  N
Sbjct  616   DCCIYEFVLEN  626


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            PE SS KL IP +F+E   G VP K ILR+   +VW +E+++    + FQ  W KFV DN
Sbjct  672  PECSSDKLLIPTAFREHFNGFVPHKAILRDPVGRVWQVELSKIGKDVYFQKGWQKFVTDN  731

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             +   D LVF Y G  +FDF LF   GCEK
Sbjct  732  FVEMEDFLVFRYDGGYIFDFKLFRNTGCEK  761


 Score = 74.7 bits (182),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = +1

Query  64   KHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKF  243
            K  G E S  +L+IP +F +   G VP+K ILR+   +VW +E+ +    + F   W +F
Sbjct  52   KSGGHEFSWDRLQIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKGWQQF  111

Query  244  VEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            + DN +  GD  VF Y G  +FDF L+   GC+K
Sbjct  112  LTDNLVEEGDLFVFQYDGSYIFDFKLYGTTGCQK  145


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IP +F E   G +P+K ILR+   +VW +E+      + F N W +F+ +NS+  GD LV
Sbjct  352  IPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTENSVEEGDFLV  411

Query  283  FSYCGYSLFDFVLFDQFGCEK  345
            F Y G  +FDF L  +  CEK
Sbjct  412  FRYAGNCIFDFKLLGRTECEK  432



>gb|EYU36190.1| hypothetical protein MIMGU_mgv1a014702mg [Erythranthe guttata]
Length=181

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 79/127 (62%), Gaps = 2/127 (2%)
 Frame = +3

Query  708   KNKNVFDHFGIELFSSGQYIQPNNPYFVTKLG-PKNRSALYIPMHVIKDHNIALPPTLIL  884
             K K++ D +G ++F SG    P NPYFV++    + ++ LYIP  VI D+ + +  T+ L
Sbjct  55    KKKDLPDCYGADIFRSGLASVPKNPYFVSRSRVARRKNELYIPKDVIVDYGLKISGTMFL  114

Query  885   RDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFV-HPNTNDMLLQVTI  1061
              D RG +WKSK+  W+DGR W ++GW++LC +N ++ DD CICEFV      +  L VT+
Sbjct  115   VDERGNKWKSKMIKWKDGRLWCTKGWRNLCNVNGINLDDTCICEFVREEGCEEYSLLVTV  174

Query  1062  VRGQTTK  1082
             V G   K
Sbjct  175   VGGGLDK  181



>emb|CAN82365.1| hypothetical protein VITISV_027616 [Vitis vinifera]
Length=844

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 73/113 (65%), Gaps = 3/113 (3%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F     + P NPYF TK+ P  RS LY+P+ V++DHNI LPP + LRD  G+ W  KV +
Sbjct  700   FEIESIVNPQNPYFETKVRPARRSKLYVPLDVLRDHNIKLPPKMTLRDPLGRLWIGKVAV  759

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTND-MLLQVTIVRGQTTK  1082
             W+DGRTW+  GW+  CK N V ++D CI EFV  + ++  LL V I+R Q ++
Sbjct  760   WKDGRTWI--GWKPFCKWNNVGENDTCIXEFVQESGHEGYLLVVHILRAQPSR  810


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 79/142 (56%), Gaps = 21/142 (15%)
 Frame = +3

Query  648   RNNSCGFKKCS--------------GAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPY  785
             R N CG+K+ +               +    +S     V+  F IE       ++  NPY
Sbjct  289   RKNYCGYKQSAVKKTRGVYKETAHTKSNYKKASSSQAEVYGAFVIE-----NIVESKNPY  343

Query  786   FVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQ  965
             F TK+  K RS LY+P  +++D NIALPP ++LRD  G+ W   V +W+DGRTW+  GWQ
Sbjct  344   FTTKVRLK-RSRLYVPADILQDFNIALPPRVLLRDLHGRSWPGDVSVWKDGRTWIG-GWQ  401

Query  966   SLCKLNLVDKDDICICEFVHPN  1031
             + CK N +D++D CICEFV  N
Sbjct  402   AFCKSNHLDENDCCICEFVLEN  423


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 65/123 (53%), Gaps = 12/123 (10%)
 Frame = +1

Query  4    RRSSDLFLDMAGSVTT---------FRFCKHFGPETSSQKLEIPISFKESVGGVVPKKII  156
            R    LF D+ G+  +         F+ C    PE SS KL IP +F+E   G VP K I
Sbjct  450  RNCLGLFADIVGNEMSSPQEECPEFFKVCL---PECSSDKLLIPTAFREHFNGFVPHKAI  506

Query  157  LRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFG  336
            LR+   +VW +E+++    + FQ  W KFV DN +   D LVF Y G  +FDF LF   G
Sbjct  507  LRDPVGRVWQVELSKIGKDVYFQKGWQKFVTDNFVEMEDFLVFRYDGGYIFDFKLFRNTG  566

Query  337  CEK  345
            CEK
Sbjct  567  CEK  569


 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            PE S  +L IP +F E   G +P+K ILR+   +VW +E+      + F N W +F+ +N
Sbjct  111  PELSWDRLRIPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTEN  170

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            S+  GD LVF Y G  +FDF L  +  CEK
Sbjct  171  SVEEGDFLVFRYAGNCIFDFKLLGRTECEK  200


 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +3

Query  825  YIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLV  989
            Y+P+ ++KDHNIALPP ++L D  G+ W   V IW+DGRTW+  GW++ CK N V
Sbjct  16   YVPVDILKDHNIALPPRVLLCDPHGRSWPGDVTIWKDGRTWIG-GWRAFCKWNHV  69



>ref|XP_010647813.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
 ref|XP_010647814.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
 ref|XP_010647815.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
 ref|XP_010647816.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
 ref|XP_010647817.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
 ref|XP_010647818.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Vitis vinifera]
Length=353

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 78/142 (55%), Gaps = 22/142 (15%)
 Frame = +3

Query  648   RNNSCGFKKC--------------SGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPY  785
             R N CG+K+               + +    +S     V+  F IE       ++  NPY
Sbjct  195   RKNYCGYKQSAVKKTRGVYKETAHTKSNYKKASSSQAEVYGAFVIE-----NIVESKNPY  249

Query  786   FVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQ  965
             F TK+  K+R  LY+P  +++D NIALPP ++LRD  G+ W   V +W+DGRTW+  GWQ
Sbjct  250   FTTKVRLKSR--LYVPADILQDFNIALPPRVLLRDLHGRSWPGDVSVWKDGRTWIG-GWQ  306

Query  966   SLCKLNLVDKDDICICEFVHPN  1031
             + CK N +D++D CI EFV  N
Sbjct  307   AFCKSNHLDENDCCIYEFVLEN  328


 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            PE S  +L IP +F E   G +P+K ILR+   +VW +E+      + F N W +F+ +N
Sbjct  17   PELSWDRLRIPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTEN  76

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            S+  GD LVF Y G  +FDF L  +  CEK
Sbjct  77   SVEEGDFLVFRYAGNCIFDFKLLGRTECEK  106



>ref|XP_010647775.1| PREDICTED: B3 domain-containing protein REM20-like, partial [Vitis 
vinifera]
Length=161

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + PE SS +L IP +F     G+VP+K ILR+ F +VW +E+ +    +CF N W 
Sbjct  11   FFKVYLPEYSSDRLRIPTAFIGHFNGLVPEKAILRDFFGRVWHVEVGQIGKDVCFLNGWQ  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +F+ DNS+  GD LVF Y G  +FDF LF +  CEK
Sbjct  71   RFLTDNSVEEGDFLVFRYDGNHIFDFKLFGRTACEK  106



>ref|XP_010255054.1| PREDICTED: B3 domain-containing protein Os03g0622200-like isoform 
X2 [Nelumbo nucifera]
Length=234

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F P+ SS++L +P  F +   GV+P+++ILR+   + WS+EM + ED   FQ+ W 
Sbjct  17   FFKVFFPDQSSERLRVPPPFIKHFNGVIPERVILRSRIGRFWSVEMAQDEDNWFFQDGWK  76

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +FV+DNS+ +G  LVF Y   S FD ++FD   CEK
Sbjct  77   EFVQDNSLRSGYFLVFRYNYNSSFDVLIFDSTSCEK  112



>ref|XP_010030660.1| PREDICTED: B3 domain-containing protein REM20-like [Eucalyptus 
grandis]
 gb|KCW55286.1| hypothetical protein EUGRSUZ_I01213 [Eucalyptus grandis]
Length=277

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 74/134 (55%), Gaps = 4/134 (3%)
 Frame = +3

Query  687   GEGSSSKKNKNVFDHFGI--ELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNI  860
             G    SKK  NV +      +  +  +YI   NPYFVT +     S LY+P  V+ D+ +
Sbjct  145   GRSKRSKKEGNVEERKAANEDPTNVKRYIDLKNPYFVTVVQALRSSCLYVPRSVLIDYEL  204

Query  861   ALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN-TN  1037
              LP  ++  D  G+ W+  VK+W D RTW++ GW +LC+ N +  +D CICE +  N   
Sbjct  205   KLPQAVLFHDPTGRTWRGTVKVWTDRRTWIT-GWGALCRHNNLKINDRCICELLEENGVT  263

Query  1038  DMLLQVTIVRGQTT  1079
             D +++V I+ G +T
Sbjct  264   DRIIKVHIIGGNST  277


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + PE SSQ++ +P +F   + G +P +I+LR+   + W +++T       F++ W 
Sbjct  11   FFKAYRPEYSSQRMHVPRAFLAQLDGPLPGEILLRHRMGRQWHVKVTLEAQDAYFEDGWQ  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +FV +N +   D +VFSY    +F  V++    CEK
Sbjct  71   EFVRENLVETNDYMVFSYQSPGVFRVVIYGHSACEK  106



>gb|KCW89692.1| hypothetical protein EUGRSUZ_A01956 [Eucalyptus grandis]
Length=194

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 4/134 (3%)
 Frame = +3

Query  687   GEGSSSKKNKNVFDHFGI--ELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNI  860
             G    SKK  NV +      +     +YI   NPYFVT +     S LY+P  V+ ++ +
Sbjct  62    GRSKRSKKEGNVEERKAANEDPIDVKRYIDLKNPYFVTVIQALRSSYLYVPRSVLINYEL  121

Query  861   ALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPN-TN  1037
              LP  ++  D  G+ W+  VK+W D RTW++ GW++LC+   + K+D CICE +  N   
Sbjct  122   KLPQAILFHDPTGRTWRGTVKVWTDSRTWIT-GWEALCRHTNLKKNDWCICELLEENGVA  180

Query  1038  DMLLQVTIVRGQTT  1079
               +++V I+ G +T
Sbjct  181   GCIIKVHIIGGNST  194



>ref|XP_010255053.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Nelumbo nucifera]
Length=307

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F P+ SS++L +P  F +   GV+P+++ILR+   + WS+EM + ED   FQ+ W 
Sbjct  17   FFKVFFPDQSSERLRVPPPFIKHFNGVIPERVILRSRIGRFWSVEMAQDEDNWFFQDGWK  76

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +FV+DNS+ +G  LVF Y   S FD ++FD   CEK
Sbjct  77   EFVQDNSLRSGYFLVFRYNYNSSFDVLIFDSTSCEK  112


 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +3

Query  768   QPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTW  947
             +P NP F           LYIP  V+ ++   + P +IL D RG+ W  KV  WRDGR  
Sbjct  197   KPKNPQFTACFSMLMAHLLYIPKKVVTENMFKVHPNMILCDPRGRSWPVKVFTWRDGRIV  256

Query  948   VSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVRGQ  1073
             +  GW    K N +   D C  EF     ND ++QV I R +
Sbjct  257   IGSGWYDFWKANNLKSQDECTFEFCGKGKNDNVIQVHIQRSR  298



>ref|XP_010255057.1| PREDICTED: B3 domain-containing protein At1g16640-like isoform 
X2 [Nelumbo nucifera]
Length=219

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F K F P  SS KL IP +F E   GVVP   IL+N   K WS+E+ + E+ + FQN W
Sbjct  16   QFFKIFYPSRSSDKLCIPPAFIEHFNGVVPNWTILKNPTGKTWSVELQQIENDIFFQNGW  75

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              FV+ +S+  GD LVF Y G S+FD  +F + GCEK
Sbjct  76   QGFVKHHSLELGDFLVFKYDGNSVFDVKIFGRSGCEK  112



>ref|XP_010255056.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Nelumbo nucifera]
Length=338

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F K F P  SS KL IP +F E   GVVP   IL+N   K WS+E+ + E+ + FQN W
Sbjct  16   QFFKIFYPSRSSDKLCIPPAFIEHFNGVVPNWTILKNPTGKTWSVELQQIENDIFFQNGW  75

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              FV+ +S+  GD LVF Y G S+FD  +F + GCEK
Sbjct  76   QGFVKHHSLELGDFLVFKYDGNSVFDVKIFGRSGCEK  112


 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 2/135 (1%)
 Frame = +3

Query  693   GSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPP  872
             GS+  K  +  +     L  + ++ +P NP+F   +       + +P  ++  + + + P
Sbjct  175   GSTKSKRSSSANAAEDRLIETARFFKPKNPHFTVYVKRSMPYTVIVPKEMVIINLLDIKP  234

Query  873   TLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFV-HPNTNDMLL  1049
              ++L D  G+ W  KV  W+DGR   S GW +  + + + K+D CI EF         ++
Sbjct  235   HVVLYDLYGKSWPVKVSFWKDGRATFSTGWSAFWRESNLRKNDKCIFEFTGQRGRKGSIV  294

Query  1050  QVTIVR-GQTTKNME  1091
             ++ I+R G  T  M+
Sbjct  295   RIYIIRSGLGTSKMD  309



>gb|EYU40140.1| hypothetical protein MIMGU_mgv1a026121mg, partial [Erythranthe 
guttata]
Length=332

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  813   RSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVD  992
             + ALYIP  V++D+ + LP  +++ D  G+ W +K KIW+DGR + + GW+ LC+ N V+
Sbjct  242   KKALYIPKEVVRDNILDLPEEIVMIDPHGRTWTAKGKIWKDGRRYYTRGWRRLCQRNFVE  301

Query  993   KDDICICEFVHPNTNDMLLQVTIVRGQT  1076
              +D+CICEF+    + +++ V+ VR + 
Sbjct  302   DEDLCICEFIETGQS-LIMDVSFVREEA  328


 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 59/117 (50%), Gaps = 3/117 (3%)
 Frame = +1

Query  4    RRSSDLFLDMAGSVTTFRFCKHFGPETSSQK---LEIPISFKESVGGVVPKKIILRNCFK  174
            RR SDL+   A      +   HF  + SS++   L +P +F  SV G +P+++  ++ ++
Sbjct  113  RRVSDLYRGEAFQSGFVQPKPHFARKISSKRKRQLRLPSAFTLSVQGALPERVFFQDRYE  172

Query  175  KVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              W +++ +    L F + W  FVEDN I  G  + F Y G  LF   + D   C+K
Sbjct  173  NTWQVKVEKVRSKLYFGDGWTDFVEDNGIRVGHIVFFEYSGNGLFKTKIHDSTACKK  229



>ref|XP_006342294.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum 
tuberosum]
Length=237

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +3

Query  717  NVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTR  896
            N  D F I++F SG+  +P  PYFVTK+ P  R+ LY+P  V++D+ + +P ++ +RD+ 
Sbjct  162  NPHDQFSIDIFRSGRATKPKYPYFVTKICPDRRNHLYVPADVVRDYQLEIPSSMTIRDSA  221

Query  897  GQEWKSKVKIWRDGR  941
            G+E+++K+KIW+DGR
Sbjct  222  GREFEAKLKIWQDGR  236



>ref|XP_010647819.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X2 [Vitis vinifera]
Length=325

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  816   SALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDK  995
              A Y+P  +++D NIALPP ++LRD  G+ W   V +W+DGRTW+  GWQ+ CK N +D+
Sbjct  230   QAEYVPADILQDFNIALPPRVLLRDLHGRSWPGDVSVWKDGRTWIG-GWQAFCKSNHLDE  288

Query  996   DDICICEFVHPN  1031
             +D CI EFV  N
Sbjct  289   NDCCIYEFVLEN  300


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            PE S  +L IP +F E   G +P+K ILR+   +VW +E+      + F N W +F+ +N
Sbjct  17   PELSWDRLRIPTAFVEHFNGFMPEKAILRDFVGRVWHVEVGPIGKNVYFLNGWQQFLTEN  76

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            S+  GD LVF Y G  +FDF L  +  CEK
Sbjct  77   SVEEGDFLVFRYAGNCIFDFKLLGRTECEK  106



>ref|XP_006423126.1| hypothetical protein CICLE_v10028843mg [Citrus clementina]
 ref|XP_006479376.1| PREDICTED: B3 domain-containing protein At5g60142-like [Citrus 
sinensis]
 gb|ESR36366.1| hypothetical protein CICLE_v10028843mg [Citrus clementina]
Length=321

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 3/126 (2%)
 Frame = +3

Query  711   NKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNR-SALYIPMHVIKDHNIALPPTLILR  887
             +K V+D   +E+   G Y    NPYFV+K     R + L++P HV+KD  + L   + + 
Sbjct  189   SKAVYDINLLEV-DVGDYGLYPNPYFVSKAWAGTRKNYLHVPSHVLKDLGLKLAKKITIL  247

Query  888   DTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVR  1067
             D RG  +  ++ IW+DGR  + +GW + C+   + KDDICICEF H       ++V IV+
Sbjct  248   DERGYSFHGQLDIWKDGRQGI-KGWSAFCRAKKLKKDDICICEFTHSRKMQNTIKVHIVQ  306

Query  1068  GQTTKN  1085
             G  +++
Sbjct  307   GVGSQS  312


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + PE SS +L IP +F   +    P+K++L N   + W +++   + G+ F + W 
Sbjct  8    FFKVYLPEKSSNRLHIPDAFIAHLSPSKPEKVMLINHIGEYWHVDVAYCDKGVFFLDGWQ  67

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KFV+DNS+   D LV  Y G   F+  +  + G EK
Sbjct  68   KFVKDNSLETADILVLKYDGDCWFNVKIMGKSGIEK  103



>gb|KDO52155.1| hypothetical protein CISIN_1g020807mg [Citrus sinensis]
Length=321

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 3/126 (2%)
 Frame = +3

Query  711   NKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNR-SALYIPMHVIKDHNIALPPTLILR  887
             +K V+D   +E+   G Y    NPYFV+K     R + L++P HV+KD  + L   + + 
Sbjct  189   SKAVYDINLLEV-DVGDYGLYPNPYFVSKAWAGTRKNYLHVPSHVLKDLGLKLAKKITIL  247

Query  888   DTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVR  1067
             D RG  +  ++ IW+DGR  + +GW + C+   + KDDICICEF H       ++V IV+
Sbjct  248   DERGYSFHGQLDIWKDGRQGI-KGWSAFCRAKKLKKDDICICEFTHSRKMQNTIKVHIVQ  306

Query  1068  GQTTKN  1085
             G  +++
Sbjct  307   GVGSQS  312


 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + PE SS +L IP +F   +  + P+K++L N   + W + +   + G+ F + W 
Sbjct  8    FFKVYLPEKSSNRLHIPDAFIAYLSPLKPEKVMLINHIGEYWHVNVAYCDKGVFFLDGWQ  67

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            KFV DNS+   D LV  Y G   F+  +  + G EK
Sbjct  68   KFVNDNSLETADILVLKYDGDCWFNVKIMGKSGIEK  103



>ref|XP_010691759.1| PREDICTED: B3 domain-containing protein At4g34400-like [Beta 
vulgaris subsp. vulgaris]
Length=655

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 64/99 (65%), Gaps = 0/99 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F K F P+ SS+ L IP +F++ + G +P ++IL+N   K+W +++   ED L FQ  W
Sbjct  323  KFFKVFQPQYSSKTLMIPSAFEDKITGNIPNRVILKNSLGKIWLVKVGNIEDHLYFQGGW  382

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            +KFV +N +  G+ LVF+Y G  +FD ++  + GCE+ +
Sbjct  383  SKFVLENFLKFGEFLVFTYIGQRIFDVMILGRDGCERTL  421


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = +3

Query  777   NPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSE  956
             NP+F  K   + R+ L IP  VI+  NI     L + D +G++W++++  W+DGRT ++ 
Sbjct  209   NPFFFAKT-IRLRNELLIPSDVIRTFNIHFDEALSVEDPKGRKWEARIVTWKDGRTRLT-  266

Query  957   GWQSLCKLNLVDKDDICICEFVHPN-TNDMLLQVTIVR  1067
             GW+  CK NLV   D C+CEF+  N T    ++V I R
Sbjct  267   GWKQFCKYNLVRDQDACVCEFIPSNGTTCYAIKVHIFR  304


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 3/103 (3%)
 Frame = +3

Query  759   QYIQPNNPYFVTKL--GPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWR  932
             +Y+   NP+F+T+L      R+ L IP  V    N+     + L+D +G++W +K  IW 
Sbjct  541   KYLPKKNPFFITRLKRSEYERNRLMIPRDVSAKINVKYSEIIDLQDPKGEKWVAKRSIWE  600

Query  933   DGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTI  1061
              G+  +  GW+ LC  N V +DD  I EF+ P T      + I
Sbjct  601   SGQVCIQGGWKKLCDSNKVKEDDTIILEFL-PRTKQSCETINI  642



>ref|XP_010657897.1| PREDICTED: uncharacterized protein LOC104881026 isoform X2 [Vitis 
vinifera]
 emb|CBI29609.3| unnamed protein product [Vitis vinifera]
Length=443

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 58/105 (55%), Gaps = 0/105 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            FC  + PE SS +L IP +F     GVVP+K ILR    +VW +E+      + F N W 
Sbjct  11   FCNVYLPEYSSDRLLIPTAFLGHFNGVVPEKAILREFSGRVWLVEVGLIGKDVYFLNGWQ  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQPQ  372
            +F  DNS+  G  LVF Y G  +FDF LF +  CEKI   + Q Q
Sbjct  71   RFRTDNSLEEGVFLVFRYDGSHIFDFKLFGRNQCEKIETDNDQLQ  115



>ref|XP_008787670.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X4 [Phoenix dactylifera]
Length=372

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K + P+ SS  L+IP +F+E +   +P  + L+      W++E  +T  GL F N W
Sbjct  7    HFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANGW  66

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             KFV D+SI  GD LVF Y G   F  ++FD   CEK     A+P
Sbjct  67   KKFVADHSIELGDFLVFRYDGGLHFSVLVFDATACEKEAAFLARP  111



>ref|XP_010647820.1| PREDICTED: B3 domain-containing protein REM20-like isoform X3 
[Vitis vinifera]
Length=319

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + PE S  +++IP +F +   G VP+K ILR+   +VW +E+ +    + F   W 
Sbjct  11   FFKVYLPELSWDRMQIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKGWQ  70

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +F+ DN +  GD  VF Y G  +FDF L+   GC+K
Sbjct  71   QFLTDNLVEEGDLFVFQYDGSYIFDFKLYGTTGCQK  106



>ref|XP_008787667.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Phoenix dactylifera]
Length=456

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K + P+ SS  L+IP +F+E +   +P  + L+      W++E  +T  GL F N W
Sbjct  7    HFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANGW  66

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             KFV D+SI  GD LVF Y G   F  ++FD   CEK     A+P
Sbjct  67   KKFVADHSIELGDFLVFRYDGGLHFSVLVFDATACEKEAAFLARP  111



>ref|XP_008787669.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Phoenix dactylifera]
Length=444

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K + P+ SS  L+IP +F+E +   +P  + L+      W++E  +T  GL F N W
Sbjct  7    HFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANGW  66

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             KFV D+SI  GD LVF Y G   F  ++FD   CEK     A+P
Sbjct  67   KKFVADHSIELGDFLVFRYDGGLHFSVLVFDATACEKEAAFLARP  111



>ref|XP_008787668.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Phoenix dactylifera]
Length=455

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K + P+ SS  L+IP +F+E +   +P  + L+      W++E  +T  GL F N W
Sbjct  7    HFFKVYFPQLSSDHLKIPPAFREYIEHELPGTVSLKGPSGGTWNVEFVKTSKGLLFANGW  66

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             KFV D+SI  GD LVF Y G   F  ++FD   CEK     A+P
Sbjct  67   KKFVADHSIELGDFLVFRYDGGLHFSVLVFDATACEKEAAFLARP  111



>ref|XP_007041353.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007041354.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX97184.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX97185.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=359

 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 83/148 (56%), Gaps = 12/148 (8%)
 Frame = +3

Query  669   KKCSGAGEGSSSKKNKNVFD-HFGIELFSSGQYIQPNNPYFV--TKLGPKNRSALYIPMH  839
             K+ SG  EG ++  ++         E  +  +Y+Q  NPYFV  T+LG  N   LY+P  
Sbjct  188   KRNSGLHEGLAAVNDEETTSMEVEYEELNPERYVQELNPYFVARTRLGRGN--ELYVPST  245

Query  840   VIKDHNIALPPT--LILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD-DICI  1010
             VI+D+++ L     +   D   ++   KV+ W+D RT +  GW+S C  N V+++ D+CI
Sbjct  246   VIRDYDLILEDNQEITFLDPYDRKKIGKVRKWKDRRTCII-GWRSFCNRNRVNQERDVCI  304

Query  1011  CEFVHPNTNDM---LLQVTIVRGQTTKN  1085
             CEF+  N N+     ++V I+RG+ TK+
Sbjct  305   CEFLLENENEQKPKFMKVHIIRGKHTKS  332


 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVP--KKIILRNCFKKVWSMEMTETEDGLCFQNN  231
            F K + P+ S +++ IP +      G++P      LRNC  +   +E+ + +  + F+  
Sbjct  9    FFKVYLPKLSFERMSIPPTAVVCSNGLMPMPATATLRNCKGQCRHVELNKCDGRMFFEKG  68

Query  232  WAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            W +F++DNSI   D LVFSY G S+FD  ++   GCEK V
Sbjct  69   WRRFIDDNSIKEEDILVFSYVGCSVFDVKVYGFDGCEKNV  108



>ref|XP_010255064.1| PREDICTED: B3 domain-containing protein REM16-like isoform X2 
[Nelumbo nucifera]
Length=394

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCF-QNNWAKFVEDNSITN  267
            QKL IP  F   V   +   + LR    K W +E+   EDG CF Q+ W  FV++NS+  
Sbjct  35   QKLNIPPKFMHHVKKEISSSVSLRGPSGKTWKVEIVMDEDGRCFFQHGWNTFVQENSLKE  94

Query  268  GDCLVFSYCGYSLFDFVLFDQFG-CEKI  348
             + LVF Y G S+FD +LFDQF  CEK+
Sbjct  95   KNVLVFRYTGNSIFDVLLFDQFSLCEKV  122



>ref|XP_010255062.1| PREDICTED: B3 domain-containing protein REM16-like isoform X1 
[Nelumbo nucifera]
Length=397

 Score = 76.6 bits (187),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCF-QNNWAKFVEDNSITN  267
            QKL IP  F   V   +   + LR    K W +E+   EDG CF Q+ W  FV++NS+  
Sbjct  35   QKLNIPPKFMHHVKKEISSSVSLRGPSGKTWKVEIVMDEDGRCFFQHGWNTFVQENSLKE  94

Query  268  GDCLVFSYCGYSLFDFVLFDQFG-CEKI  348
             + LVF Y G S+FD +LFDQF  CEK+
Sbjct  95   KNVLVFRYTGNSIFDVLLFDQFSLCEKV  122



>ref|XP_010924500.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X9 [Elaeis guineensis]
Length=329

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924491.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X8 [Elaeis guineensis]
Length=337

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_009365669.1| PREDICTED: B3 domain-containing protein REM5-like [Pyrus x bretschneideri]
Length=265

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S+ L IP +F ++ GG   +K  LRN     W +++ + EDGL F+  W  FV+D+ + +
Sbjct  23   SKHLRIPSAFIKNFGGRSLRKCTLRNPSGDCWGVKLKQKEDGLFFRKGWKVFVKDHFLEH  82

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQ  366
            GD LVF Y G S FD  +FD+  CEK V + A+
Sbjct  83   GDFLVFEYRGGSEFDVTIFDRTCCEKNVEEAAR  115



>ref|XP_008440206.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X3 [Cucumis melo]
Length=215

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            +T  F K F P +SSQ++ IP +F +   G +P + I+R+   K W + + E ++ + F+
Sbjct  17   STLEFFKVFLPNSSSQRMSIPPAFVKYFNGRIPSEAIIRDQSGKSWHVTLEELKNIVFFK  76

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            + W +FV+ + +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  77   DGWQEFVDSHHLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  119



>ref|XP_010486112.1| PREDICTED: B3 domain-containing protein REM21-like [Camelina 
sativa]
Length=183

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (55%), Gaps = 0/106 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA      RF   +  + SS  L IP+S+ E +   +PK  IL     K+W + M   ++
Sbjct  1    MASGDVLPRFFSVYLSQYSSDSLLIPVSYYEHLPRPLPKTAILMGTGGKIWKVVMKSRQE  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             + F+  WA FV+DN + +G+ L+F + GY L++  +F   GC++I
Sbjct  61   QVYFERGWANFVDDNDLKDGEFLIFVFDGYRLYEVSIFGHGGCKEI  106



>ref|XP_010924483.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X7 [Elaeis guineensis]
Length=389

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_006403705.1| hypothetical protein EUTSA_v10010633mg [Eutrema salsugineum]
 gb|ESQ45158.1| hypothetical protein EUTSA_v10010633mg [Eutrema salsugineum]
Length=270

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ETSS+ + IP+SF E +   +P+   L      +W++  T+    + F + W
Sbjct  12   RFFKVFLSETSSESMRIPVSFNEHLEDPLPRTAKLHGTGGGIWTVGFTKRRKRVYFTDGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF ED+ + +G+ L F Y GY  F+  ++D  GC++
Sbjct  72   SKFAEDHDLKDGEFLTFVYDGYHTFEVSVYDGLGCKE  108



>ref|XP_010426969.1| PREDICTED: B3 domain-containing protein REM20-like [Camelina 
sativa]
Length=277

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+   IP+SF E +   +P    L+    K W++ MT+  DG  F + W
Sbjct  12   RFFKVFLSETASESFAIPLSFMEHLADPLPNTAKLQGTGGKDWTVSMTKIRDGASFTDGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF  D+ + +G+ L F Y G   F+  +F + GC++
Sbjct  72   SKFARDHELVDGEFLTFVYDGNRTFEVSVFGRLGCKE  108



>ref|XP_009138285.1| PREDICTED: B3 domain-containing protein At4g34400-like [Brassica 
rapa]
 ref|XP_009138290.1| PREDICTED: B3 domain-containing protein At4g34400-like [Brassica 
rapa]
Length=186

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA   T  RF K F    SS  + IPIS+   +  ++PK  IL+      W +EM    D
Sbjct  1    MAEDDTPPRFFKVFISHHSSDSMLIPISYTHELPRILPKTAILQGTGGCFWKVEMKRKRD  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             + F   W KFV DNS+ +GD L F Y G ++F+  ++   GC+++
Sbjct  61   EVYFGKGWTKFVTDNSLNDGDFLTFVYNGANVFEVSIYGLGGCKEM  106



>ref|XP_010924476.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X6 [Elaeis guineensis]
Length=411

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924468.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X5 [Elaeis guineensis]
Length=451

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924451.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Elaeis guineensis]
Length=455

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924459.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X4 [Elaeis guineensis]
Length=454

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924436.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Elaeis guineensis]
Length=463

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_010924443.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Elaeis guineensis]
Length=462

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K + PE SS  L+IP +F++ +   +P  + L+      W++E  ++  GL F 
Sbjct  4    SSPHFFKVYFPELSSDHLKIPPAFRKYIEHELPGTVSLKGPSGGTWNVEFVKSSKGLLFA  63

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            N W KFV D+SI  GD LVF Y G   F  ++ D   CEK     A+P
Sbjct  64   NGWKKFVADHSIELGDFLVFRYDGGLHFSVLVLDATACEKEAAFLARP  111



>ref|XP_006293000.1| hypothetical protein CARUB_v10019277mg [Capsella rubella]
 gb|EOA25898.1| hypothetical protein CARUB_v10019277mg [Capsella rubella]
Length=281

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  E++S+   IP+SF E +   +P    L+    + W++ MT+  DG+ F   W
Sbjct  12   RFFKVFLSESASESFAIPLSFMEHLADPLPNTAKLQGTGGRDWTVNMTKIRDGVYFTAGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF +D+ + +G+ L F Y G+  F+  +F + GC++
Sbjct  72   SKFAQDHELVDGEFLTFVYDGHRTFEVSVFGRLGCKE  108



>ref|XP_008440203.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X1 [Cucumis melo]
Length=305

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            +T  F K F P +SSQ++ IP +F +   G +P + I+R+   K W + + E ++ + F+
Sbjct  17   STLEFFKVFLPNSSSQRMSIPPAFVKYFNGRIPSEAIIRDQSGKSWHVTLEELKNIVFFK  76

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            + W +FV+ + +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  77   DGWQEFVDSHHLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  119



>emb|CAN76392.1| hypothetical protein VITISV_011465 [Vitis vinifera]
Length=765

 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +3

Query  753   SGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWR  932
             +  ++ P NP+F+T +G  +R  LYIP HV+K +NI L   +++RD + + W  ++   +
Sbjct  649   AATFVIPKNPHFITFIGRSSRYNLYIPQHVLKXNNIKLEGEMVMRDQKDRSWPMRLTTRK  708

Query  933   DGRTWVSEGWQSLCKLNLVDKDDICICEFV  1022
             DGR  + +GW    K N + + D C+ EF+
Sbjct  709   DGRLALVKGWAKFWKENNLGRRDQCVFEFI  738


 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + P+ S Q L IP +F +   G +P   ILR+   K   +E+ E E  +  +N W 
Sbjct  476  FFKVYIPDFSDQHLRIPPAFVKEFSGNIPNNAILRDIRGKYCHVELKEVEKDVFIKNGWQ  535

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +FV  +S+  GD LVF Y G +LFD  +F + GC K
Sbjct  536  EFVRGHSVEQGDFLVFRYHGKALFDVSIFGRNGCRK  571


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +1

Query  103  IPISFKESVGGVVPKK-IILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            IP +F +   GV+P K +I+RN   KVW + + + +    F+  W KFV+DN +  GD L
Sbjct  93   IPPAFVKHFDGVLPHKSLIMRNPGSKVWCVYVQKVDRCFFFEKGWGKFVQDNFLELGDFL  152

Query  280  VFSYCGYSLFDFVLFDQFGCEK  345
            VF Y G S F+ +++ +  CEK
Sbjct  153  VFHYVGNSKFEVIIYGKHCCEK  174



>ref|XP_006577282.1| PREDICTED: putative B3 domain-containing protein At5g66980-like 
[Glycine max]
 gb|KHN31454.1| Putative B3 domain-containing protein [Glycine soja]
Length=308

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 60/110 (55%), Gaps = 0/110 (0%)
 Frame = +1

Query  25   LDMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTET  204
            L   G  +   F K F   T S KL+IP SF +   GV+P K+ L +  +K W + + +T
Sbjct  5    LPSHGDKSLQEFFKVFLLRTGSTKLQIPTSFTKFFNGVLPLKVTLVDHDRKSWDVYLEKT  64

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            E  L F++ W +F ++  + +GD LVF Y G S F+  +F + GC K+  
Sbjct  65   EGCLVFKDGWQQFAKEKVLEDGDFLVFQYDGRSTFNVKIFSKTGCRKVAA  114



>ref|XP_010504088.1| PREDICTED: B3 domain-containing protein REM20-like [Camelina 
sativa]
Length=277

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+   IP+SF E +   +P    L+    K W++ MT+  DG  F + W
Sbjct  12   RFFKVFLSETASKSFGIPLSFMEHLADPLPNTAKLQGTGGKDWTVSMTKIRDGAYFTDGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF +D+ +  G+ L F Y G   F+  +F + GC++
Sbjct  72   SKFAQDHELVEGEFLTFVYDGNRTFEVSVFGRLGCKE  108



>ref|XP_011030811.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X4 [Populus euphratica]
Length=619

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F    SS++L IP+SF + + G  P  + L      VW+ E+T+  D L F N W++FV 
Sbjct  23   FSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSNGWSEFVR  82

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+ +  GD LVF Y G   F   +FDQ  CEK
Sbjct  83   DHFLECGDLLVFRYHGELCFSVQVFDQSACEK  114



>ref|XP_011030803.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Populus euphratica]
Length=623

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F    SS++L IP+SF + + G  P  + L      VW+ E+T+  D L F N W++FV 
Sbjct  23   FSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSNGWSEFVR  82

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+ +  GD LVF Y G   F   +FDQ  CEK
Sbjct  83   DHFLECGDLLVFRYHGELCFSVQVFDQSACEK  114



>ref|XP_004141939.1| PREDICTED: putative B3 domain-containing protein At5g66980-like 
[Cucumis sativus]
Length=309

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            +T  F K F P +SSQ + IP +F +   G +P + I+R+  +  W + + E ++ + F+
Sbjct  17   STLEFFKVFLPNSSSQSMSIPPAFVKYFNGRIPSEAIIRDQSRNSWHVTLEELKNIVLFK  76

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            + W +FV+ + +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  77   DGWQEFVDSHHLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  119



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K + P+ S Q L IP +F +   G +P   ILR+   K   +E+ E E  +  +N W 
Sbjct  17   FFKVYIPDFSDQHLRIPPAFVKEFSGNIPNNAILRDIRGKYCHVELKEVEKDVFIKNGWQ  76

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +FV  +S+  GD LVF Y G +LFD  +F + GC K
Sbjct  77   EFVRGHSVEQGDFLVFRYHGKALFDVSIFGRNGCRK  112


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 40/64 (63%), Gaps = 0/64 (0%)
 Frame = +3

Query  753  SGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWR  932
            +  ++ P NP+F+T +G  +R  LYIP HV+K++NI L   +++RD + + W  ++   +
Sbjct  186  AATFVIPKNPHFITFIGRSSRYNLYIPQHVLKNNNIKLEGEMVMRDQKDRSWPMRLTTRK  245

Query  933  DGRT  944
            D  +
Sbjct  246  DAAS  249



>ref|XP_011030796.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Populus euphratica]
Length=624

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F    SS++L IP+SF + + G  P  + L      VW+ E+T+  D L F N W++FV 
Sbjct  23   FSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSNGWSEFVR  82

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+ +  GD LVF Y G   F   +FDQ  CEK
Sbjct  83   DHFLECGDLLVFRYHGELCFSVQVFDQSACEK  114



>ref|XP_011030771.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
 ref|XP_011030779.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
 ref|XP_011030787.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Populus euphratica]
Length=630

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F    SS++L IP+SF + + G  P  + L      VW+ E+T+  D L F N W++FV 
Sbjct  23   FSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTAELTQENDDLLFSNGWSEFVR  82

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+ +  GD LVF Y G   F   +FDQ  CEK
Sbjct  83   DHFLECGDLLVFRYHGELCFSVQVFDQSACEK  114



>ref|XP_007147158.1| hypothetical protein PHAVU_006G100700g [Phaseolus vulgaris]
 gb|ESW19152.1| hypothetical protein PHAVU_006G100700g [Phaseolus vulgaris]
Length=297

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 0/105 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            M  +     F K F    +S +L+IP SF +   G+ P KIIL +   K W +++ + E 
Sbjct  1    MESARQALEFFKVFLLNKASTQLQIPTSFTKFFNGIAPCKIILIDHDGKCWDVKLEKIEG  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             L F+N W +F ++ ++  GD LVF Y G S F+  +F + GC K
Sbjct  61   RLVFKNGWQQFAKEKNLEEGDFLVFQYDGMSTFNVKIFSKTGCRK  105



>gb|KGN48478.1| hypothetical protein Csa_6G489940 [Cucumis sativus]
Length=294

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            +T  F K F P +SSQ + IP +F +   G +P + I+R+  +  W + + E ++ + F+
Sbjct  17   STLEFFKVFLPNSSSQSMSIPPAFVKYFNGRIPSEAIIRDQSRNSWHVTLEELKNIVLFK  76

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            + W +FV+ + +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  77   DGWQEFVDSHHLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  119



>ref|XP_010414513.1| PREDICTED: B3 domain-containing protein At3g06220-like isoform 
X2 [Camelina sativa]
Length=184

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA      RF   +  + SS  L IP+S+ E +   +PK  IL     K+W + M   ++
Sbjct  1    MASGDVLPRFFSVYLSQYSSDSLLIPVSYYEHLPRPLPKTGILMGTGGKIWKVAMKSRQE  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             + F+  WA FV DN I +G+ L+F + GY  ++  +F   GC++I
Sbjct  61   QVYFERGWANFVADNDIKDGEFLIFVFDGYRRYEVSIFAHGGCKEI  106



>ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum 
tuberosum]
Length=113

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F   F P  +S+KL+IP  F + + G      +L       W +++ + +DGL F N W
Sbjct  8    HFLVGFNPSMNSEKLKIPSKFIKHMEGRDSGTTVLVGPSGNAWPVDLIQQDDGLFFHNGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQ  366
              FV+D+ +  GD LVF Y G   F   +FD+  CEK    +A 
Sbjct  68   VSFVKDHCLETGDSLVFRYDGDLHFTVQVFDESSCEKEAAYNAD  111



>emb|CDP04824.1| unnamed protein product [Coffea canephora]
Length=235

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
             A S    +FCK F       KL IP ++   + G +P + +LR+C   +W++E+ +   
Sbjct  13   QAQSQRNLKFCKVFDANKYFNKLHIPSAYASYMRGNLPDRAVLRDCDGNMWAVELAKVGS  72

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
               FQ  WAK V+DN I + D LVF + G  +FDF +      EK
Sbjct  73   EWFFQEGWAKVVQDNLIEHQDFLVFLFDGEKVFDFTIIGNNLLEK  117



>ref|XP_010470071.1| PREDICTED: B3 domain-containing protein At3g06220-like [Camelina 
sativa]
Length=166

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (53%), Gaps = 0/106 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA      RF   +  + SS  L IP+S+ E +   +PK  IL     K+W + M   ++
Sbjct  1    MASGDVLPRFFSVYLSQYSSDSLLIPVSYYEHLPRPLPKTGILMGTGGKIWKVAMKSRQE  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             + F+  WA FV DN + +G+ L+F + GY  ++  +F   GC++I
Sbjct  61   QVYFERGWANFVADNDLKDGEFLIFVFDGYRRYEVSIFGHGGCKEI  106



>ref|XP_007017394.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14619.1| AP2/B3-like transcriptional factor family protein, putative isoform 
1 [Theobroma cacao]
Length=549

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F   F   +S+ +L+IP+ F  ++ G     ++LR      W +E+   +D L F   W
Sbjct  9    HFLNVFSSTSSANRLKIPVGFNRNLEGRTSGSVLLRGPSGYSWVVELVRKDDDLLFVEGW  68

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            A FV D+S+  GD LVF Y G  +FD  +FDQ  CEK
Sbjct  69   ADFVRDHSVECGDFLVFRYDGDLVFDVKVFDQSSCEK  105



>ref|XP_002877911.1| hypothetical protein ARALYDRAFT_906718 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54170.1| hypothetical protein ARALYDRAFT_906718 [Arabidopsis lyrata subsp. 
lyrata]
Length=273

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S  L IP+SF E +   +PK + L+    K+W++ + +    + F   W
Sbjct  10   RFFKVFLSETASDSLVIPLSFNEFLADPLPKTVKLQGIGGKIWTVSLEKISGAVYFATGW  69

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFG  336
            +KF +D+ + NG+ + F Y G+  F+  +F++FG
Sbjct  70   SKFAKDHELKNGEFMTFVYDGHRTFEVSVFERFG  103



>ref|XP_006650312.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein 
Os03g0622200-like [Oryza brachyantha]
Length=367

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCFQNN  231
             F KH   + + + + +P  F ++  G + +++ LR    K WS+ +  +  G +  Q+ 
Sbjct  31   HFLKHMAGDFT-ESMTVPARFADNFNGHISEEVNLRPPSGKTWSIGVASSGAGEVVLQSG  89

Query  232  WAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            W +FV+ NS+  GDCL+F Y G S FD ++FD  GCEK
Sbjct  90   WKEFVDGNSVQEGDCLLFRYSGVSSFDVLIFDPSGCEK  127



>ref|XP_004167398.1| PREDICTED: putative B3 domain-containing protein At5g66980-like 
[Cucumis sativus]
Length=309

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            +T  F K F P +SSQ + IP +F +   G +P + I+R+     W + + E ++ + F+
Sbjct  17   STLEFFKVFLPNSSSQSMSIPPAFVKYFNGRIPSEAIIRDQSGNSWHVTLEELKNIVLFK  76

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            + W +FV+ + +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  77   DGWQEFVDSHHLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  119



>emb|CAN82366.1| hypothetical protein VITISV_027617 [Vitis vinifera]
Length=311

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  100  EIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            +IP +F +   G VP+K ILR+   +VW +E+ +    + F   W +F+ DN +  GD  
Sbjct  25   QIPTAFVKHFNGFVPEKAILRDSVGRVWHVEVGQIGKNVYFLKGWQQFLTDNLVEEGDLF  84

Query  280  VFSYCGYSLFDFVLFDQFGCEK  345
            VF Y G  +FDF L+   GC+K
Sbjct  85   VFQYDGSYIFDFKLYGTTGCQK  106



>emb|CDP07598.1| unnamed protein product [Coffea canephora]
Length=570

 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P +SS+ L++P  FK+ + G  P    L       W   +T+  D L  Q+ W  FV 
Sbjct  13   FNPSSSSEALKLPFKFKKHIDGTTPGTAFLLGPSGNTWYANLTQQNDDLFLQDGWVAFVR  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+S+ +GD LVF Y G   F   +FD+  CEK
Sbjct  73   DHSLESGDSLVFRYDGNLHFTVQVFDKSSCEK  104



>ref|XP_006396490.1| hypothetical protein EUTSA_v10028696mg [Eutrema salsugineum]
 gb|ESQ37943.1| hypothetical protein EUTSA_v10028696mg [Eutrema salsugineum]
Length=411

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 0/105 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            M  + T  RF K F    SS  + IPIS+ + +  ++P+  IL+      W++ M   E+
Sbjct  1    MDATDTPPRFFKVFISHFSSDSMLIPISYYDELPRLLPETAILQGTGGCSWNVAMNLKEE  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             +CF+  W +FV+DNS+ +GD L F Y G S+F+  ++   GC++
Sbjct  61   EVCFEQGWPEFVKDNSLIDGDFLTFVYNGDSVFEVSIYGLHGCKE  105



>ref|XP_010515820.1| PREDICTED: B3 domain-containing protein REM20-like [Camelina 
sativa]
Length=277

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET  +   IP+SF E +   +P    L+    K W++ MT+  DG  F + W
Sbjct  12   RFFKVFLSETGIESFAIPLSFMEHLADPLPNTAKLQGTGGKDWTVSMTKIRDGAYFTDGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF  D+ + +G+ L F Y G   F+  +F + GC++
Sbjct  72   SKFARDHELVDGEFLTFVYDGNRTFEVSVFGRLGCKE  108



>ref|XP_002466799.1| hypothetical protein SORBIDRAFT_01g014370 [Sorghum bicolor]
 gb|EER93797.1| hypothetical protein SORBIDRAFT_01g014370 [Sorghum bicolor]
Length=354

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            ++ + IP  F  +  G + + I L++   K WS+ +    D +  Q+ W +FV  +SI  
Sbjct  17   TETMSIPARFANNFNGHISEVISLKSPSGKTWSIGVGSDTDEVVLQSGWKEFVSAHSIDE  76

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            GDC++F Y G S FD ++FD  GCEK
Sbjct  77   GDCMLFKYTGVSSFDVLVFDSSGCEK  102



>gb|KFK30878.1| hypothetical protein AALP_AA6G037600 [Arabis alpina]
Length=459

 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = +1

Query  28   DMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTE  201
            D  G     RF K F    SS  + IPIS+ + +   +PK  ILR     VW  ++++ +
Sbjct  5    DEDGEENPPRFFKVFISHMSSDSMLIPISYYDELPYHLPKTAILRGTGGCVWNVAIDIKK  64

Query  202  TEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             ++ + F   WAKFV+DNS+++GD L F Y G S+F+  ++ + GC++I
Sbjct  65   KQEEVHFGKGWAKFVKDNSLSDGDFLTFVYNGKSVFEVSIYGRDGCKEI  113



>ref|XP_010263797.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Nelumbo nucifera]
Length=352

 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S+ L IP  F +   G VPK  ILR+   K+WS+ +   E    F+  W +FV+ + +  
Sbjct  45   SRLLRIPPPFMKHFSGSVPKTFILRSPTGKLWSVRVKRIEKQFYFEKGWQRFVKHHRLVA  104

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            GD LVFSY G S F   ++D   CEK
Sbjct  105  GDLLVFSYHGDSRFTVKIYDTSSCEK  130


 Score = 51.6 bits (122),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 54/129 (42%), Gaps = 7/129 (5%)
 Frame = +3

Query  639   TKKRNNSCGFKKCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRS  818
             TK  + +      S  G  +  ++ +N       E   +    +   P F +  G  +RS
Sbjct  164   TKTESTTKAIVSTSKVGRATPRRQPRN-------EAIKAASSYKTEFPQFASLCGKTSRS  216

Query  819   ALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD  998
              + IP  V K+  +      +L D RG+ W  +V    DGR  +S GW +  K N + + 
Sbjct  217   HMMIPKAVTKEVGLTSEGKAMLWDPRGRSWSVRVHPRSDGRADISGGWPAFRKANNIVQG  276

Query  999   DICICEFVH  1025
             D C  EF+ 
Sbjct  277   DACNFEFIR  285



>ref|XP_006398097.1| hypothetical protein EUTSA_v10000999mg [Eutrema salsugineum]
 gb|ESQ39550.1| hypothetical protein EUTSA_v10000999mg [Eutrema salsugineum]
Length=263

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ + IP+SF E +   +P+ + L+     +W++   +      F   W
Sbjct  12   RFFKVFLSETASESMSIPVSFSEHLEDPLPQTVKLQGTGGGIWTVSFKKIRQRAYFTAGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF ED+ + NG+ L F Y GY+ F+  +++++G ++
Sbjct  72   SKFAEDHDLKNGEFLTFVYDGYNTFEVSVYNRWGSKE  108



>ref|XP_006375016.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
 gb|ERP52813.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
Length=713

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F    SS++L IP+SF + + G  P  + L      VW+ ++T+  D + F N W++FV 
Sbjct  23   FSSNLSSERLRIPVSFIKHMEGKTPGLVSLLGPSGDVWTADLTQENDDVLFSNGWSEFVR  82

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            D+ +  GD LVF Y G   F   +FDQ  CEK
Sbjct  83   DHFLECGDLLVFRYHGELCFSVQVFDQSACEK  114



>ref|XP_006393897.1| hypothetical protein EUTSA_v10004496mg [Eutrema salsugineum]
 gb|ESQ31183.1| hypothetical protein EUTSA_v10004496mg [Eutrema salsugineum]
Length=351

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +1

Query  52   FRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG--LCFQ  225
              F K F PE S+++LEIP +F + +   +PK+++L +   ++W +E    E    + FQ
Sbjct  19   LEFFKVFLPEFSARELEIPTAFIDILEKPIPKQVLLVDEIGRLWGVETKAEERNRLVVFQ  78

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              W +F  D S+  GD LVFSY G S F   +F + GC+K
Sbjct  79   KGWERFANDQSLEFGDFLVFSYDGDSRFSVSIFAKEGCKK  118



>ref|XP_010683976.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=638

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F + F P  SS +L++P  F + +GG     + L      +W + + E    L FQ+ W
Sbjct  8    HFLEVFLPNLSSNRLKVPSKFVKHLGGRTSGSLSLVGPSGNIWHVNLFEYNGHLFFQDGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            + FV+D+SI  GD LVF Y G S F   +FDQ  CEK
Sbjct  68   STFVKDHSIECGDSLVFEYDGDSNFTVQIFDQSSCEK  104



>ref|XP_010469086.1| PREDICTED: B3 domain-containing protein REM20-like [Camelina 
sativa]
 ref|XP_010469087.1| PREDICTED: B3 domain-containing protein REM20-like [Camelina 
sativa]
Length=279

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K +   TSS+   IP+SF E +   +P    L+    + W++ M +  DG+ F   W
Sbjct  14   RFFKVYVSHTSSESFAIPLSFMEHLADPLPNTAKLQGTGGRDWTVSMKKIRDGVYFTAGW  73

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF +D+ + +G+ L F Y G   F+  +F + GC++
Sbjct  74   SKFAQDHELVDGEYLTFVYDGNRTFEVSVFGRLGCKE  110



>ref|XP_009112350.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Brassica 
rapa]
 emb|CDY18631.1| BnaA09g07640D [Brassica napus]
Length=301

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGL---CFQNNWAKFV  246
            PE SS+KL IP +F   +   +P +++L +   ++W++E T+TE+G+    F+  W KF 
Sbjct  19   PEFSSRKLVIPPAFVNILEKPLPNQVVLLDEIGRLWNVE-TKTEEGVGDVVFKKGWEKFA  77

Query  247  EDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
             D+S+  GD LVFSY   S F   +FD+ GC+K +V
Sbjct  78   NDHSLEFGDFLVFSYDAVSRFSVKIFDKNGCKKYLV  113



>ref|XP_010683984.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=632

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F + F P  SS +L++P  F + +GG     + L      +W + + E    L FQ+ W
Sbjct  8    HFLEVFLPNLSSNRLKVPSKFVKHLGGRTSGSLSLVGPSGNIWHVNLFEYNGHLFFQDGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            + FV+D+SI  GD LVF Y G S F   +FDQ  CEK
Sbjct  68   STFVKDHSIECGDSLVFEYDGDSNFTVQIFDQSSCEK  104



>ref|XP_008440214.1| PREDICTED: uncharacterized protein LOC103484737 isoform X8 [Cucumis 
melo]
Length=909

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_010518203.1| PREDICTED: B3 domain-containing protein REM20-like isoform X3 
[Camelina sativa]
Length=257

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   DMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE  207
            D A  V   RF K F   T S+   IP+SF E +   +P    L+    + W++ M +  
Sbjct  7    DDADDVLLPRFFKMFVSHTDSESFAIPLSFIEFLADPLPNTAKLQGTGGRDWTVSMKKIR  66

Query  208  DGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            DG+ F   W+KF +D+ + +G+ L F Y G   F+  +F +F C++
Sbjct  67   DGVYFTAGWSKFAQDHELVDGEYLTFVYDGNRTFEVSVFGRFDCKE  112



>emb|CDP08404.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K F P+ SSQ+L +P  F +   G+V K+I LR    K+W +++ ET++G+  +N W 
Sbjct  28   FFKVFLPDVSSQQLRVPPLFVKKFSGLVCKRIKLRCIDGKIWDVDVEETQEGVFMKNGWQ  87

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             F + + +  G+ LVF Y G S+F   +F   GC++
Sbjct  88   AFADHHLLKLGEFLVFRYDGNSVFTVKIFRTHGCKE  123



>ref|XP_008440211.1| PREDICTED: uncharacterized protein LOC103484737 isoform X5 [Cucumis 
melo]
Length=912

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_008440215.1| PREDICTED: uncharacterized protein LOC103484737 isoform X9 [Cucumis 
melo]
Length=909

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_008440213.1| PREDICTED: uncharacterized protein LOC103484737 isoform X7 [Cucumis 
melo]
Length=909

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_008440210.1| PREDICTED: uncharacterized protein LOC103484737 isoform X4 [Cucumis 
melo]
Length=927

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_008440207.1| PREDICTED: uncharacterized protein LOC103484737 isoform X1 [Cucumis 
melo]
Length=945

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_008440208.1| PREDICTED: uncharacterized protein LOC103484737 isoform X2 [Cucumis 
melo]
Length=943

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_010512501.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Camelina sativa]
Length=277

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 0/95 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K +   T+S+   IP+SF E +   +P    L+    + W++ M +  DG+ F   W
Sbjct  12   RFFKLYVSHTASESFAIPLSFMEHLADPLPNTAKLQGTGGRDWTVSMKKIRDGVYFTAGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            +KF +D+ + +G+ L F Y G   F+  +F + GC
Sbjct  72   SKFAQDHELVDGEYLTFVYDGNRTFEVSVFGRLGC  106



>ref|XP_008440209.1| PREDICTED: uncharacterized protein LOC103484737 isoform X3 [Cucumis 
melo]
Length=927

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 57/100 (57%), Gaps = 0/100 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            + +T  F K F P++ +  + IP +F + + G  P+K  +++     W + + + +D L 
Sbjct  9    AASTLEFFKVFLPDSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWGITLEKLDDLLY  68

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            F+N W  FV+ +S+  GD LVF Y G+ +FD  +F + GC
Sbjct  69   FKNGWKAFVDYHSLKYGDFLVFQYDGHCMFDVKIFGKNGC  108



>ref|XP_010518202.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 
[Camelina sativa]
Length=285

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   DMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE  207
            D A  V   RF K F   T S+   IP+SF E +   +P    L+    + W++ M +  
Sbjct  35   DDADDVLLPRFFKMFVSHTDSESFAIPLSFIEFLADPLPNTAKLQGTGGRDWTVSMKKIR  94

Query  208  DGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            DG+ F   W+KF +D+ + +G+ L F Y G   F+  +F +F C++
Sbjct  95   DGVYFTAGWSKFAQDHELVDGEYLTFVYDGNRTFEVSVFGRFDCKE  140



>ref|XP_009781396.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Nicotiana sylvestris]
Length=538

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA FV+
Sbjct  13   FNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASFVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFAVLAFDESSCEKEAAYNA  110



>ref|XP_009781397.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Nicotiana sylvestris]
Length=535

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA FV+
Sbjct  13   FNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASFVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFAVLAFDESSCEKEAAYNA  110



>ref|XP_009781392.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781393.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781394.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009781395.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana sylvestris]
Length=539

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA FV+
Sbjct  13   FNPSIQSETLKIPSKFIKHMEGRASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASFVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFAVLAFDESSCEKEAAYNA  110



>ref|XP_010414512.1| PREDICTED: B3 domain-containing protein At3g06220-like isoform 
X1 [Camelina sativa]
Length=185

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLE-IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE  207
            MA      RF   +  + SS  L+ IP+S+ E +   +PK  IL     K+W + M   +
Sbjct  1    MASGDVLPRFFSVYLSQYSSDSLKLIPVSYYEHLPRPLPKTGILMGTGGKIWKVAMKSRQ  60

Query  208  DGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            + + F+  WA FV DN I +G+ L+F + GY  ++  +F   GC++I
Sbjct  61   EQVYFERGWANFVADNDIKDGEFLIFVFDGYRRYEVSIFAHGGCKEI  107



>ref|XP_010908022.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Elaeis 
guineensis]
Length=437

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 6/145 (4%)
 Frame = +3

Query  639   TKKRNNSCGFKKCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRS  818
             T +R     F K S     ++ + +  V     +E  SS ++I P   +F+       RS
Sbjct  135   TAERRKQFIFGKTSSGTFQATRRPSIKVERESVLEAASSTKFIYP---HFIATCRKSRRS  191

Query  819   ALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD  998
              + IPM ++++  +     +ILRD  G  W  ++  WR GR   + GW    K N ++  
Sbjct  192   YMTIPMALVREFGLTGKQLVILRDPVGSSWPVRIASWRSGRMVFATGWSDFYKGNCLEDG  251

Query  999   DICICEFVHPNTNDMLLQVTIVRGQ  1073
             D+C+ EFV    N  L+ V I R +
Sbjct  252   DVCVFEFVQ---NASLIHVHIFRAK  273


 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  97   LEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE-DGLCFQNNWAKFVEDNSITNGD  273
            L IP  FK+ + G +  K +LR+    +W + M  ++ DG  FQ  W  FV D+++  GD
Sbjct  23   LRIPTPFKKRLRGKLRSKSVLRSARGGIWHVAMRGSDRDGWFFQRGWEAFVADHAVAVGD  82

Query  274  CLVFSYCGYSLFDFVLFDQFGCEKIVV  354
             LVF + G   FD  ++ + GCEK  V
Sbjct  83   FLVFVFDGDIGFDVKIYGKNGCEKEAV  109



>ref|XP_009389534.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=410

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 60/108 (56%), Gaps = 0/108 (0%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            ++  F K F PE  S+ L+IP +F+  +       + LR    K+W +E+ ++ +GL F+
Sbjct  9    SSPHFVKVFFPELCSEYLKIPPAFRVHLENESLGMVSLRGPSGKIWDVELVDSSNGLRFE  68

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
            + W +FV D+++  GD LVF   G S F  ++FD   CEK V   A P
Sbjct  69   SGWKEFVVDHAMEIGDFLVFRLEGCSCFSVLVFDATACEKEVAFLAMP  116



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  100  EIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            +IP +F     G +PK  +L+N   K W +++ E E GL   N W  F  +NS+  GD L
Sbjct  3    KIPPAFVRHFYGTIPKDAMLKNHTGKHWLVDLEEVEGGLTMTNGWQGFASENSLEFGDFL  62

Query  280  VFSYCGYSLFDFVLFDQFGCEKIVV  354
            +F Y G  LFD  +F + GC K  +
Sbjct  63   IFEYDGKCLFDVEIFGRNGCNKAAL  87



>ref|XP_010518200.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Camelina sativa]
 ref|XP_010518201.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Camelina sativa]
Length=301

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (52%), Gaps = 0/106 (0%)
 Frame = +1

Query  28   DMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE  207
            D A  V   RF K F   T S+   IP+SF E +   +P    L+    + W++ M +  
Sbjct  51   DDADDVLLPRFFKMFVSHTDSESFAIPLSFIEFLADPLPNTAKLQGTGGRDWTVSMKKIR  110

Query  208  DGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            DG+ F   W+KF +D+ + +G+ L F Y G   F+  +F +F C++
Sbjct  111  DGVYFTAGWSKFAQDHELVDGEYLTFVYDGNRTFEVSVFGRFDCKE  156



>ref|XP_008226600.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Prunus 
mume]
Length=296

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ+L IP  F ++  G   +K  LR   ++ W +++ E E+ L F++ W  FV+D+ +  
Sbjct  23   SQRLRIPPKFIKNFNGQSLRKCALRGPSRQWWDVKLEERENSLFFRDGWQGFVKDHVLEF  82

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            GD LVFSY G S F   ++D+  CEK V
Sbjct  83   GDLLVFSYNGKSKFKVKIYDRSACEKNV  110



>ref|XP_009116025.1| PREDICTED: B3 domain-containing protein REM20 [Brassica rapa]
 emb|CDX78167.1| BnaA09g33620D [Brassica napus]
Length=265

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ + IP+SF E +   +P+K  L+     VW++  T   D   F + W
Sbjct  12   RFFKVFLSETASESMAIPMSFNEHLEDPLPQKAKLQGTGGGVWTVTFTTIRDCAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF ED+ + +G+ L F Y G+  F+  +F    C++
Sbjct  72   SKFAEDHELKDGEFLTFVYDGHHTFEVSVFGHGRCKE  108



>ref|XP_007224954.1| hypothetical protein PRUPE_ppa021314mg [Prunus persica]
 gb|EMJ26153.1| hypothetical protein PRUPE_ppa021314mg [Prunus persica]
Length=218

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ L IP +F ++  G    K  +R    K W++E+ +  DGL F   W  FV+D+ I +
Sbjct  24   SQHLRIPPAFIKNFNGRRLGKCTMRGPTGKCWAVELEQRRDGLFFHKGWPGFVKDHFIES  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
             D L+F Y G S FD  ++D+  CEK ++
Sbjct  84   EDFLIFDYDGGSEFDVTIYDKTCCEKDLI  112



>ref|XP_008226602.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Prunus 
mume]
Length=294

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q L +P  F E + G    K  LR    K+W++E+ E E+G  F + W  FV D+ +  G
Sbjct  25   QHLRLPPVFIEKLDGQSLPKCALRGPNGKLWTVELEERENGFFFHDGWQGFVRDHCLEIG  84

Query  271  DCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            + LVF Y G S FD  +++  GCEK V
Sbjct  85   NFLVFDYDGDSKFDVTIYEPTGCEKDV  111



>ref|XP_010447089.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
 ref|XP_010447091.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
Length=397

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F    SS  + IPI + + +  ++PKK+IL+    + W++      D + F   W
Sbjct  12   RFFKAFVSHFSSDSMVIPIPYYDQLPRLLPKKVILQGPGGRSWNVATKIRGDEVHFVQGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             KFVEDN++ +GD L F Y G  +F+  +F   GC++
Sbjct  72   PKFVEDNTLNDGDFLTFVYNGNHIFEVSIFRSDGCKE  108



>ref|XP_010436894.1| PREDICTED: B3 domain-containing protein At3g06220-like [Camelina 
sativa]
Length=178

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  40   SVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC  219
            SV   RF   +    SS  L IP+S+ E +   +PK  IL     K+W + M   ++ + 
Sbjct  12   SVYFPRFFSVYLSHYSSDSLMIPVSYYEHLPRPLPKTAILMGTGGKIWKVAMKSRQEQVY  71

Query  220  FQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            F+  W  FV DN + +G+ L F + GY  ++  +F   GC++I
Sbjct  72   FERGWTNFVADNDLKDGEFLSFVFDGYRRYEVSIFGHGGCKEI  114



>ref|XP_008220725.1| PREDICTED: B3 domain-containing protein REM5-like [Prunus mume]
Length=261

 Score = 66.6 bits (161),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ L IP +F ++  G    K  +R    K W++E+ +  DGL F   W  FV+D+ I +
Sbjct  24   SQHLRIPPAFIKNFSGRRLGKCTMRGPTGKCWAVELEQRRDGLFFHKGWPGFVKDHFIES  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQ  366
             D L+F Y G S FD  ++D+  CEK V   A+
Sbjct  84   EDFLIFDYDGGSEFDVTIYDKTCCEKDVKAAAK  116



>ref|XP_010255061.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Nelumbo 
nucifera]
Length=419

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S+ L IP  F +   G VPK++ LR+   K W +++ + ++   F   W +FVE +S+  
Sbjct  62   SKLLGIPPLFIKHFNGSVPKRLTLRSPTGKSWPVKVKKIDEKFYFHTGWQRFVEHHSLVW  121

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            GD LVFSY G S F   ++D+  CE+
Sbjct  122  GDFLVFSYNGKSKFSVKIYDRSSCER  147



>ref|XP_006425800.1| hypothetical protein CICLE_v10026137mg [Citrus clementina]
 ref|XP_006466673.1| PREDICTED: putative B3 domain-containing protein At5g66980-like 
[Citrus sinensis]
 gb|ESR39040.1| hypothetical protein CICLE_v10026137mg [Citrus clementina]
Length=309

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +1

Query  1    RRRSSDLFLDMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKV  180
            RR+SS      +   T   F K + P  SS++L IP +F + +   VPK +I+R+   + 
Sbjct  6    RRKSSP-----SDKSTDSEFFKVYLPAFSSKQLAIPPAFAKHLNVTVPKHVIIRDYAGRQ  60

Query  181  WSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            W  +M E E  +  ++ W +F   +S+  GD LVF Y G SLFD  ++   GC K
Sbjct  61   WRGKMEEVEGVIVIKDCWERFACVHSLELGDFLVFKYNGSSLFDVKIYGINGCLK  115


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F + + + P NP+FV+     +R A+ + + V++ H I L P ++LRD  G++W  K+  
Sbjct  196   FKAARLVVPKNPHFVSVFSQYSRYAVNVSVRVVRSHGIKLEPEMMLRDQNGRKWPVKISF  255

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTN-DMLLQVTIVRGQTT  1079
               +GR  ++ GW    +   ++  D C+ EFV    N    ++V +VR   T
Sbjct  256   RTNGRIVITGGWSDFWREQKLEAGDKCVFEFVLTRGNMSKEMKVQVVRKMKT  307



>gb|KFK34581.1| hypothetical protein AALP_AA5G164400 [Arabis alpina]
Length=270

 Score = 66.2 bits (160),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ L IP+SF E +   +P    LR    +VW++ M +  +G  F   W
Sbjct  10   RFFKVFLAETASESLAIPLSFTEQLRNPLPHTAKLRGTGGRVWTLSMNKVREGAYFTTGW  69

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF E++++ +G+ L F Y     F+  ++ +  C++I
Sbjct  70   SKFAEEHNLKSGEFLTFVYDCNRTFEVSVYGRSCCKEI  107



>ref|XP_009588432.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X3 [Nicotiana tomentosiformis]
Length=535

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA  V+
Sbjct  13   FNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASLVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFTVLAFDESSCEKEAAYNA  110



>ref|XP_008226826.1| PREDICTED: putative B3 domain-containing protein Os04g0347400 
[Prunus mume]
Length=297

 Score = 66.6 bits (161),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ+L IP  F ++       K  L       W++E+ E E+GL FQN W  FV+D+ + +
Sbjct  24   SQRLRIPPKFVKNFNVRPLHKCALSGPSGIRWTVELEERENGLFFQNGWQGFVKDHHLED  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            GD LVF Y G S F   ++D+  CEK V
Sbjct  84   GDFLVFKYDGESKFKVTIYDRTACEKNV  111



>ref|XP_009588431.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X2 [Nicotiana tomentosiformis]
Length=538

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA  V+
Sbjct  13   FNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASLVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFTVLAFDESSCEKEAAYNA  110



>gb|KHG05520.1| hypothetical protein F383_30454 [Gossypium arboreum]
Length=553

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F   F   +S+  L IP+ F  ++ G     ++L+      W++++ +  D L F   W
Sbjct  8    HFLNVFSSTSSANSLRIPVGFNRNLEGRGSGSVLLKGPSGYSWNVKLVQRNDDLLFDEGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            A FV D+S+  G+ LVF Y G  +FD  +FDQ  CEK V 
Sbjct  68   ADFVADHSLECGEILVFRYDGDLVFDVKVFDQSSCEKEVA  107



>ref|XP_009588428.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588429.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009588430.1| PREDICTED: B3 domain-containing protein Os01g0723500-like isoform 
X1 [Nicotiana tomentosiformis]
Length=539

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 0/98 (0%)
 Frame = +1

Query  70   FGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVE  249
            F P   S+ L+IP  F + + G       L       W M++ + +DGL F N WA  V+
Sbjct  13   FNPSIHSETLKIPSKFIKHMEGKASGTAFLVGPSGNSWPMDLIQQDDGLFFHNGWASLVK  72

Query  250  DNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDA  363
            D+ + +GD LVF Y G   F  + FD+  CEK    +A
Sbjct  73   DHCLESGDALVFRYDGDLHFTVLAFDESSCEKEAAYNA  110



>gb|KEH41174.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=324

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 29/157 (18%)
 Frame = +3

Query  672   KCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKD  851
             KC     GSSS ++K   D    E+     YIQP NP+F+ K      + L+IP +VIKD
Sbjct  174   KCKAGNIGSSSARSKLEDDEIDAEI-----YIQPGNPHFIAKYIHSRPNELFIPKNVIKD  228

Query  852   HNIALPPTLILR----------------------DTRGQEWKSKVKIWRDGRTWVSEGWQ  965
               +     + L                        T   E + +V+ WRDGR  V  GW+
Sbjct  229   FCLCFTKHVTLECCHCKDIQSNDLAAYHHILPQISTIHIEKRGQVRTWRDGRVRVL-GWE  287

Query  966   SLCKLNLVDKDDICICEFV-HPNTNDMLLQVTIVRGQ  1073
               C+ + + ++D C+CE V   +    +L+V +VR +
Sbjct  288   DFCRKSKITENDSCLCEIVLREDGTIRILRVHVVRKE  324



>ref|XP_002522368.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40052.1| DNA binding protein, putative [Ricinus communis]
Length=280

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (49%), Gaps = 4/145 (3%)
 Frame = +3

Query  639   TKKRNNSCGFKKCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRS  818
             +K  N+  G  K S +GE +SS +     +    +   +  YI+P  P F   +    R 
Sbjct  125   SKGTNSKLGRTKGS-SGERTSSLRQIRATNSGISKNIKASSYIKPQKPSFEMIMTRSTRY  183

Query  819   ALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD  998
              +Y+   V+K HN+ L   + LR   G+ W  KV    DGR  ++ GW +  + + V   
Sbjct  184   TVYVHRLVVKTHNLKLQENMKLRGESGKFWPVKVCFRTDGRIIINNGWAAFHRKHKVAIG  243

Query  999   DICICEFVHPNTNDML--LQVTIVR  1067
             D C+ EF+ P  N+M+  +QV I+R
Sbjct  244   DTCVFEFI-PAENNMVKEIQVQILR  267



>ref|NP_001050682.1| Os03g0622200 [Oryza sativa Japonica Group]
 sp|Q10GM3.1|Y3222_ORYSJ RecName: Full=B3 domain-containing protein Os03g0622200 [Oryza 
sativa Japonica Group]
 gb|ABF97678.1| B3 DNA binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12596.1| Os03g0622200 [Oryza sativa Japonica Group]
 dbj|BAG98481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59516.1| hypothetical protein OsJ_11768 [Oryza sativa Japonica Group]
Length=378

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (58%), Gaps = 2/88 (2%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCFQNNWAKFVEDNSIT  264
            ++ + +P  F  +  G + +++ LR+   + WS+ +  ++ G L  Q  W +FV+ N I 
Sbjct  41   TESMTVPARFANNFNGHISEEVNLRSPSGETWSIGVANSDAGELVLQPGWKEFVDGNGIE  100

Query  265  NGDCLVFSYCGY-SLFDFVLFDQFGCEK  345
             GDCL+F Y G  S FD ++FD  GCEK
Sbjct  101  EGDCLLFRYSGVSSSFDVLIFDPSGCEK  128



>ref|XP_010413386.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Camelina sativa]
Length=435

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  +T+S+   IP+SF E +   +P    L+    + W++ M +  DG  F   W
Sbjct  170  RFFKVFVSQTASESFAIPLSFIEFLADPLPNTAKLQGTGGRDWTVSMKKIRDGAYFTAGW  229

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF +D+ + +G+ L F Y G   F+  +F + GC++
Sbjct  230  SKFAQDHELVDGEFLTFVYDGNRTFEVSVFGRLGCKE  266



>emb|CDY67388.1| BnaAnng24200D [Brassica napus]
Length=280

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ + IP+SF E +   +P+   L+     VW++   +  D   F + W
Sbjct  12   RFFKVFLSETASESMAIPMSFIEHLEDPLPQTAKLQGIGGGVWTVSFKKIRDCAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F + GC++I
Sbjct  72   SKFAEDHELKDGEFLTFVYDGSHTFEVSVFGRSGCKEI  109



>ref|XP_010413387.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 
[Camelina sativa]
Length=434

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  +T+S+   IP+SF E +   +P    L+    + W++ M +  DG  F   W
Sbjct  169  RFFKVFVSQTASESFAIPLSFIEFLADPLPNTAKLQGTGGRDWTVSMKKIRDGAYFTAGW  228

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +KF +D+ + +G+ L F Y G   F+  +F + GC++
Sbjct  229  SKFAQDHELVDGEFLTFVYDGNRTFEVSVFGRLGCKE  265



>ref|XP_009103858.1| PREDICTED: B3 domain-containing protein REM20-like [Brassica 
rapa]
Length=283

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ + IP+SF E +   +P+   L+     VW++   +  D   F + W
Sbjct  12   RFFKVFLSETASESMAIPMSFIEHLEDPLPQTAKLQGIGGGVWTVSFKKIRDCAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F + GC++I
Sbjct  72   SKFAEDHELKHGEFLTFVYDGSHTFEVSVFGRSGCKEI  109



>ref|XP_009341411.1| PREDICTED: uncharacterized protein LOC103933435 [Pyrus x bretschneideri]
Length=404

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ L IP +F E+  G    K  LR    + W+M+  E E+GL F   W  FV+D+S+  
Sbjct  167  SQHLRIPHAFIENFSGQSLHKCALRGSSGQWWAMKPEERENGLFFHGGWQGFVKDHSLEI  226

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            G+ LVF Y G S F+  ++D+   EK V
Sbjct  227  GNFLVFDYDGDSKFEVTIYDRSASEKDV  254



>ref|XP_010255211.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Nelumbo nucifera]
Length=202

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S+ L+IP  F +   G VP   ILR+  KK W + + + ++    Q  W  FV+ +S+  
Sbjct  64   SKLLKIPRPFIKHFNGSVPATFILRSPTKKRWRVRVKKVKEQWYLQKGWQSFVKFHSLVV  123

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            GD L+FSY G + F   ++D+  CEK
Sbjct  124  GDLLIFSYRGGAKFSVKIYDRSACEK  149



>gb|KGN48479.1| hypothetical protein Csa_6G489950 [Cucumis sativus]
Length=960

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = +1

Query  43   VTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCF  222
             +   F K F P + +  + IP +F + + G  P+K  +++     W + + + +D L F
Sbjct  10   ASNLEFFKVFLPGSCTLHMSIPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYF  69

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
            +N W  FV+ +S+  GD LVF Y G+ LFD  +F + GC
Sbjct  70   KNGWKAFVDYHSLKYGDFLVFQYHGHCLFDVKIFGKNGC  108



>ref|XP_010460626.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
Length=393

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 56/99 (57%), Gaps = 2/99 (2%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSM--EMTETEDGLCFQN  228
            RF K F    SS  + IPI + + +  ++PKK+IL+    + W++  E+    D + F  
Sbjct  12   RFFKVFVSLFSSDSMVIPIPYDDHLPRLLPKKVILQGPGGRSWNVATEIRGGGDEVHFAQ  71

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             W KFVEDN++ +GD L F Y G  +F+  +F   GC++
Sbjct  72   GWPKFVEDNTLNDGDFLTFVYNGNHIFEVSIFRSDGCKE  110



>emb|CDY13301.1| BnaC06g14560D [Brassica napus]
Length=281

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S  + IP+SF E +   +P+   L+     VW++   +  D   F + W
Sbjct  12   RFFKVFLSETASVSMAIPMSFNEHLEDPLPQTAKLQGIGGGVWTVSFKKIRDCAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F + GC++I
Sbjct  72   SKFAEDHELKDGEFLTFVYDGSHTFEVSVFGRSGCKEI  109



>ref|XP_010501632.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
Length=185

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F    SS  + IP+ + + +  ++PKK+IL+      W++      D L F   W
Sbjct  12   RFFKVFVSHFSSDYMVIPVPYYDQLPRLLPKKVILQGPGGCSWNVATKIRGDELHFAKGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             KFVEDN++ +GD L F Y G  +F+  ++   GC++
Sbjct  72   PKFVEDNTLNDGDFLTFVYNGDDIFEVSIYRSDGCKE  108



>emb|CDY45798.1| BnaC03g16210D [Brassica napus]
Length=228

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  ET+S+ + IP+SF E +   +P+   L+     VW++   +  D   F + W
Sbjct  12   RFFKVFLSETASESMAIPMSFSEHLQDPLPQTAKLQGIGGGVWTVSFKKIRDCAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F   GC+++
Sbjct  72   SKFAEDHELKDGEFLTFVYDGSHTFEVSVFGLSGCKEM  109



>emb|CDY33105.1| BnaC09g22010D [Brassica napus]
Length=545

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  +T+S+ + IP+SF E++   +P+   L+     VW++   +  D   F + W
Sbjct  12   RFFKVFLSQTASESMAIPMSFNENLEDPLPQTAKLQGIGSGVWTVSFKKIRDRAYFTSGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+   +G+ L F Y G   F+  +F + GC++I
Sbjct  72   SKFAEDHEFKDGEFLTFVYDGSHTFEVSIFGRSGCKEI  109



>ref|XP_006290106.1| hypothetical protein CARUB_v10003750mg [Capsella rubella]
 gb|EOA23004.1| hypothetical protein CARUB_v10003750mg [Capsella rubella]
Length=135

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA      RF   F  + SS    IP S+ E +   +PK  IL     K+W + M     
Sbjct  1    MASGDVLPRFFSVFLSQYSSDSFLIPSSYYEHLPRRLPKNAILMGTGGKIWKVAMKSQRG  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             + F+  WA FV DN + +G+ L F + GY+ ++  ++   GC++
Sbjct  61   QVYFEEGWANFVADNELKDGEFLTFVFDGYNRYEVSIYGHGGCKE  105



>ref|XP_010492301.1| PREDICTED: B3 domain-containing protein At3g06220-like [Camelina 
sativa]
Length=135

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 0/106 (0%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETED  210
            MA      RF   F  + SS+   IP S+ E +   +PK  IL     K+W + M     
Sbjct  1    MASGDVLPRFFSVFLSQYSSESFMIPTSYYEHLPRRLPKTAILMGTGGKIWKVAMKSIRG  60

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             + F   W  FV DN + +G+ L F + GY+ ++  ++   GC++I
Sbjct  61   QVYFVQGWPSFVADNELKDGEFLTFVFDGYNRYEVSIYGHGGCKEI  106



>ref|XP_009364120.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Pyrus 
x bretschneideri]
Length=561

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = +1

Query  34   AGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG  213
            AG+V +  F   +  + SS++L+IP  F   + G     + L       WS+E+ E   G
Sbjct  5    AGNVRSPHFFAFYSADLSSERLKIPERFMRHMEGKTSGLVALFGPSGSAWSVELIEQNGG  64

Query  214  LCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            L   + W  FV D+ +  GD L+F Y G   F  ++FDQ  CEK
Sbjct  65   LFLHHGWPAFVRDHYVECGDFLIFRYDGDLRFTVLIFDQSACEK  108



>ref|XP_006595849.1| PREDICTED: B3 domain-containing protein REM20-like [Glycine max]
Length=317

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 55/115 (48%), Gaps = 24/115 (21%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLIL--------RDTRGQ  902
             F    YIQP NP F  KL     + L++P +VIKD ++     + L         DT+  
Sbjct  184   FDPQMYIQPGNPNFEAKLFKNRPNELHVPKNVIKDSSLTFGEQITLSRCQCFQFEDTQRD  243

Query  903   EWK---------------SKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFV  1022
             E +               +KV  WRDGR  + +GW S CK N ++K+D CICE +
Sbjct  244   ELRDYHGLPQWTPIYSEVAKVSEWRDGRVCI-KGWTSFCKKNKINKNDACICEII  297


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESV---GGVVPKKIILRNCFKKVWSMEMTETEDGLCFQN  228
            F   F PE  S+ + IP +F +S    G  +P+ +IL N  ++VW+++     + + F+ 
Sbjct  7    FVTVFKPEEHSESMLIPDAFVKSTRLQGWRIPEDVILTNVGRRVWNVKTRLVGNKIYFEE  66

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQ  330
             W  F E+N +   D LVF Y G ++F  V+ +Q
Sbjct  67   GWKVFQEENFLGKEDYLVFKYDGANIFKVVILEQ  100



>ref|XP_008792612.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Phoenix dactylifera]
Length=438

 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (51%), Gaps = 3/99 (3%)
 Frame = +3

Query  777   NPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVSE  956
             +P+F+        S + IPM +++++ +     +ILRD  G  W   +  WR GR  ++ 
Sbjct  179   HPHFIATCRKSRSSYMTIPMALVREYGLTGKQLVILRDPLGSSWPVSIASWRSGRLVLAT  238

Query  957   GWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVRGQ  1073
             GW    K N + + D+C+ EFV    N  L+ V I R +
Sbjct  239   GWSDFYKGNCLQEGDVCVFEFVQ---NGSLIHVHIFRAK  274


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  97   LEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE-DGLCFQNNWAKFVEDNSITNGD  273
            L IP  FK+ + G +  K +LR+    +W + +  ++ DG  FQ  W  FV D+++  GD
Sbjct  23   LRIPTPFKKRLRGKLRSKSVLRSARGGLWHVAVGGSDGDGWFFQRGWEAFVVDHAVAVGD  82

Query  274  CLVFSYCGYSLFDFVLFDQFGCEKIVV  354
             LVF + G   FD  ++ + GCEK  V
Sbjct  83   FLVFVFDGDIGFDVKIYGKNGCEKEAV  109



>emb|CDX81347.1| BnaC09g07580D [Brassica napus]
Length=312

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 11/109 (10%)
 Frame = +1

Query  58   FCKHFGPETSSQKLE-------IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGL  216
            F K + PE SS+KL        IP +F   +  ++P ++ L +   ++W +E T+TE+G+
Sbjct  17   FFKVYLPEFSSRKLACSSLISVIPPAFVNILEKLLPNQVGLLDEIGRLWKVE-TKTEEGV  75

Query  217  ---CFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
                F+  W KF  D+S+  GD LVFSY G S F   +FD+ GC+K +V
Sbjct  76   GDVVFKKGWEKFANDHSLEFGDFLVFSYDGVSRFSVKIFDKNGCKKYLV  124



>ref|XP_010070479.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Eucalyptus 
grandis]
Length=310

 Score = 64.7 bits (156),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +1

Query  1    RRRSSDLFLDMAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKV  180
            RRR++      + S     F K + P  SS +L IP  F E+  GVVPKK +L+N   + 
Sbjct  3    RRRAAK----TSSSDEPIEFFKVYLPSFSSHQLLIPPDFVENFKGVVPKKAVLKNTTGRS  58

Query  181  WSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            W + +    + L  ++ W  FV D+ +   D L+F Y   S+F   +F + GC K
Sbjct  59   WPIGIAGVGNTLFIKSGWRDFVIDHPLDFADFLIFRYIRDSVFLVKVFGKNGCRK  113


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 4/108 (4%)
 Frame = +3

Query  750   SSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPT--LILRDTRGQEWKSKVK  923
             S   Y  P NP+FV+++       L+IP   IK ++I L P   +I+RD  G  W  ++ 
Sbjct  186   SVKTYAMPKNPHFVSRISKYALKLLFIPTSFIKRNHIKLNPNEKMIVRDQNGGTWPVQIN  245

Query  924   IWRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVR  1067
                 GR ++S GW    K N +   +  + EFV    N      TIVR
Sbjct  246   ERIAGRFYLSSGWTEFRKGNNLRVGNQLVLEFVLGEGN--ACSETIVR  291



>ref|XP_010263796.1| PREDICTED: B3 domain-containing protein REM16-like [Nelumbo nucifera]
Length=420

 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  94   KLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGD  273
            KL IP  F +++   +   + LR    KVW + + +  D L FQ  W +FVED+++   D
Sbjct  36   KLVIPAKFVKNLKEDLSSPVTLRGPTGKVWKVGLVKAGDSLFFQYGWDEFVEDHNLEEED  95

Query  274  CLVFSYCGYSLFDFVLFDQFG-CEK  345
             LVF Y G S FD ++FDQ   CEK
Sbjct  96   LLVFRYSGSSTFDVLMFDQLNLCEK  120



>ref|XP_007017395.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2, partial [Theobroma cacao]
 gb|EOY14620.1| AP2/B3-like transcriptional factor family protein, putative isoform 
2, partial [Theobroma cacao]
Length=524

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  100  EIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            +IP+ F  ++ G     ++LR      W +E+   +D L F   WA FV D+S+  GD L
Sbjct  1    KIPVGFNRNLEGRTSGSVLLRGPSGYSWVVELVRKDDDLLFVEGWADFVRDHSVECGDFL  60

Query  280  VFSYCGYSLFDFVLFDQFGCEK  345
            VF Y G  +FD  +FDQ  CEK
Sbjct  61   VFRYDGDLVFDVKVFDQSSCEK  82



>gb|KHN48598.1| B3 domain-containing protein REM21 [Glycine soja]
Length=354

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 61/139 (44%), Gaps = 34/139 (24%)
 Frame = +3

Query  675   CSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDH  854
             CS A EG           H     F    YIQP NP F  KL     + L++P +VIKD 
Sbjct  207   CSPAVEGP----------HLEDYEFDPQMYIQPGNPNFEAKLFKNRPNELHVPKNVIKDS  256

Query  855   NIALPPTLIL--------RDTRGQEWK---------------SKVKIWRDGRTWVSEGWQ  965
             ++     + L         DT+  E +               +KV  WRDGR  + +GW 
Sbjct  257   SLTFGEQITLSRCQCFQFEDTQRDELRDYHGLPQWTPIYSEVAKVSEWRDGRVCI-KGWT  315

Query  966   SLCKLNLVDKDDICICEFV  1022
             S CK N ++K+D CICE +
Sbjct  316   SFCKKNKINKNDACICEII  334



>ref|XP_008240883.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Prunus 
mume]
Length=292

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ+L IP +F + V G +P K  LR+     W++ +    D   F   W +FV+D+S+  
Sbjct  24   SQRLCIPPAFMDHVNGRLPPKCTLRDPRGDCWTVCLEVRGDRFFFHEGWQRFVKDHSLEI  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
             + LVF Y G S FD  L+D  G EK
Sbjct  84   ANVLVFDYDGKSKFDVELYDPIGSEK  109



>ref|XP_010026398.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Eucalyptus 
grandis]
Length=162

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  34   AGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG  213
            + S     F K + P  SS +L IP  F + + GVVP+K  L++   + W + + E  + 
Sbjct  10   SSSDMPLEFFKVYLPSFSSHQLLIPPDFVKHLKGVVPEKAFLKDTTGRSWPIGIAEVGNK  69

Query  214  LCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            L  ++ W  FV  +S+   D L+F Y G S+F   +F + GC K
Sbjct  70   LFIKSGWRDFVIGHSLDFADFLIFRYNGDSVFLVKVFSKNGCRK  113



>emb|CDY70353.1| BnaCnng67970D [Brassica napus]
Length=329

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IPIS+ + +   +PK  IL+      W +EM    D + F   W KFV DNS+T+GD L 
Sbjct  2    IPISYNDELPRTLPKTAILQGTGGCFWKVEMKRKRDEVHFGKGWNKFVTDNSLTDGDFLT  61

Query  283  FSYCGYSLFDFVLFDQFGCEKI  348
            F Y G ++F+  ++   GC+++
Sbjct  62   FVYNGANVFEVSIYGLGGCKEM  83



>gb|EEC75758.1| hypothetical protein OsI_12653 [Oryza sativa Indica Group]
Length=381

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +1

Query  61   CKHF-----GPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCF  222
            CKHF     G  T S  + +P  F  +  G + + + L++   K WS+ +  ++ G L  
Sbjct  29   CKHFLTYMVGDFTES--MIVPSRFANNFNGHISEVVNLKSPSGKTWSIGVANSDTGELVL  86

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            ++ W +FV+ N +   DCL+F Y G S FD ++FD  GCEK
Sbjct  87   RSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIFDPSGCEK  127



>ref|XP_004238198.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum 
lycopersicum]
Length=580

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (52%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F   F P  +S+KL+IP  F + + G      +L       W +++ + +DGL F N W
Sbjct  8    HFLVGFNPFMNSEKLKIPSKFIKHMEGGDSGTTVLVGPSGNAWPVDLIQQDDGLFFNNGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              FV+D+ +  GD LVF Y G   F   +FD+  CEK
Sbjct  68   VSFVKDHCLETGDSLVFRYDGDLHFTVQVFDESSCEK  104



>ref|XP_010245897.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X1 [Nelumbo nucifera]
Length=318

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 48/90 (53%), Gaps = 0/90 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            P   S+ L+IP  F +     VP++ I+R+   K W + + + E    FQ  W  FV+ +
Sbjct  31   PSHYSKLLQIPPPFIKHFNRSVPRRSIIRSPTGKCWPVTVKKIEKRFYFQKGWQSFVKHH  90

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             +  GD LVFSY G S F   ++D+  CEK
Sbjct  91   DLVVGDLLVFSYHGNSKFSVKIYDRSACEK  120


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 47/105 (45%), Gaps = 1/105 (1%)
 Frame = +3

Query  780   PYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILR-DTRGQEWKSKVKIWRDGRTWVSE  956
             PYF+       R  + IP  V +   +A    ++L  D +G+ W  KV   RDGR  +S+
Sbjct  185   PYFIGVWRNSRRYYMTIPSAVARQFCLASKVKMVLLWDPQGRPWPVKVCFRRDGRVVLSD  244

Query  957   GWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVRGQTTKNME  1091
             GW    K N + + D C  EF H   N + + +    G T +   
Sbjct  245   GWGEFSKANRLLEGDACSFEFCHGIGNSICVNIFRAMGSTKRQAS  289



>gb|AAO34502.1| putative auxin response factor [Oryza sativa Japonica Group]
Length=750

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCFQNNWAKFVEDNSITNGDCL  279
            +P  F  +  G + +++ LR+   + WS+ +  ++ G L  Q  W +FV+ N I  GDCL
Sbjct  424  VPARFANNFNGHISEEVNLRSPSGETWSIGVANSDAGELVLQPGWKEFVDGNGIEEGDCL  483

Query  280  VFSYCGY-SLFDFVLFDQFGCEK  345
            +F Y G  S FD ++FD  GCEK
Sbjct  484  LFRYSGVSSSFDVLIFDPSGCEK  506


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +1

Query  61   CKHF-----GPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCF  222
            CKHF     G  T S  + +P  F  +  G + + + L++   K WS+ +  ++ G L  
Sbjct  29   CKHFLTYMVGDFTES--MIVPSRFANNFNGHISEVVNLKSPSGKTWSIGVAYSDTGELVL  86

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            ++ W +FV+ N +   DCL+F Y G S FD ++FD  GCEK
Sbjct  87   RSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIFDPSGCEK  127



>gb|EEC75759.1| hypothetical protein OsI_12654 [Oryza sativa Indica Group]
Length=380

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCFQNNWAKFVEDNSIT  264
            ++ + +P  F  +  G + +++ LR+   + WS+ +  ++ G L  Q  W +FV+ N I 
Sbjct  41   TESMTVPARFANNFNGHISEEVNLRSPSSETWSIGVANSDAGELVLQPGWKEFVDGNGIE  100

Query  265  NGDCLVFSYCGY-SLFDFVLFDQFGCEK  345
             GDCL+  Y G  S FD ++FD  GCEK
Sbjct  101  EGDCLLVRYSGVSSSFDVLIFDPSGCEK  128



>gb|KFK30080.1| hypothetical protein AALP_AA7G214000 [Arabis alpina]
Length=356

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IPIS+ + +   +PK +IL+     +W++++   +D + F   W+KFV DNS+T+G+ L 
Sbjct  3    IPISYYDELPSRLPKTVILQGASGGIWNVKLKYEQDEVYFGQGWSKFVRDNSLTDGEFLT  62

Query  283  FSYCGYSLFDFVLFDQFGCEKI  348
            F+Y G  +F+  ++    C++I
Sbjct  63   FAYNGDRIFEVSIYRLDACKEI  84



>emb|CAB67638.1| putative protein [Arabidopsis thaliana]
Length=283

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  E++S+ L IP+ F   +   +PK + L+    K+W++ + +          W
Sbjct  10   RFFKVFLVESASESLMIPLPFMAFLADPLPKTVKLQGLGGKLWTVSLKKISGAAYLTRGW  69

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             KF E++ + NG+ + F Y G+  F+  +FD++G +++
Sbjct  70   PKFAEEHELKNGEFMTFVYDGHRTFEVSVFDRWGSKEV  107



>ref|XP_006840809.1| hypothetical protein AMTR_s00214p00019140 [Amborella trichopoda]
 gb|ERN02484.1| hypothetical protein AMTR_s00214p00019140 [Amborella trichopoda]
Length=222

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S++L IP +F+  +   V +K+ L+     VW +++ +T  G+ FQN W  FV D+ +  
Sbjct  30   SEQLSIPPAFRTYLEHEVSRKVFLKGPSGDVWPVDLKKTVGGMLFQNGWKDFVNDHCLQL  89

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            G  LVF Y G   F   +FDQ  CEK
Sbjct  90   GHFLVFRYDGDVYFTVQIFDQTCCEK  115



>ref|XP_007214527.1| hypothetical protein PRUPE_ppa015343mg, partial [Prunus persica]
 gb|EMJ15726.1| hypothetical protein PRUPE_ppa015343mg, partial [Prunus persica]
Length=177

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  181  WSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            W++E+ E E+GL FQ+ W  FV+D+ + +GD LVF Y G S F   ++D+  CEK V
Sbjct  29   WAVELEERENGLFFQDGWQGFVKDHHLEDGDFLVFKYDGESKFKVTIYDRTACEKNV  85



>ref|XP_007212879.1| hypothetical protein PRUPE_ppa021660mg [Prunus persica]
 gb|EMJ14078.1| hypothetical protein PRUPE_ppa021660mg [Prunus persica]
Length=166

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 1/88 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTET-EDGLCFQNNWAKFVEDNSITN  267
            Q L +P  F E + G    K  LR    K+W++E+ E  E+G  F + W  FV D+ +  
Sbjct  25   QHLRLPPVFIEKLDGESLPKCDLRGPNGKLWTVELEEIRENGFFFHDGWQGFVRDHCLEI  84

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            G+ LVF Y G S FD  +++  GCEK V
Sbjct  85   GNFLVFDYDGDSKFDVTIYEPTGCEKDV  112



>ref|XP_010046007.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Eucalyptus 
grandis]
Length=139

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            + KL IP +F ++  G VPKK++++ C  + W +   E+++G  F    AKFV+D  +  
Sbjct  26   THKLNIPPAFLKNFQGNVPKKLVVK-CGGRSWFIRTEESDEGYHFSQGLAKFVKDLHLEL  84

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            G+ ++FS  G+  F+ V++D   CEK
Sbjct  85   GELVIFSMVGHETFEVVVYDTDCCEK  110



>ref|NP_566984.1| B3 domain-containing protein REM20 [Arabidopsis thaliana]
 sp|Q8LAV5.1|REM20_ARATH RecName: Full=B3 domain-containing protein REM20; AltName: Full=Protein 
REPRODUCTIVE MERISTEM 20 [Arabidopsis thaliana]
 gb|AAM65128.1| unknown [Arabidopsis thaliana]
 gb|ABF82627.1| At3g53310 [Arabidopsis thaliana]
 dbj|BAH30485.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79067.1| B3 domain-containing protein REM20 [Arabidopsis thaliana]
Length=286

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F  E++S+ L IP+ F   +   +PK + L+    K+W++ + +          W
Sbjct  10   RFFKVFLVESASESLMIPLPFMAFLADPLPKTVKLQGLGGKLWTVSLKKISGAAYLTRGW  69

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             KF E++ + NG+ + F Y G+  F+  +FD++G +++
Sbjct  70   PKFAEEHELKNGEFMTFVYDGHRTFEVSVFDRWGSKEV  107



>ref|XP_010263792.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Nelumbo nucifera]
Length=526

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K F PE +S++L+IP+ F + + G       L    K VW +++    +GL F++ W
Sbjct  14   HFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFEHGW  73

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              F+ D+S   GD  VF Y G   F   +FDQ GC K
Sbjct  74   EVFLSDHSSQFGDFFVFRYDGNLHFTVQIFDQSGCIK  110



>ref|XP_010263793.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Nelumbo nucifera]
Length=519

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K F PE +S++L+IP+ F + + G       L    K VW +++    +GL F++ W
Sbjct  14   HFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFEHGW  73

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              F+ D+S   GD  VF Y G   F   +FDQ GC K
Sbjct  74   EVFLSDHSSQFGDFFVFRYDGNLHFTVQIFDQSGCIK  110



>ref|XP_010657893.1| PREDICTED: uncharacterized protein LOC104881026 isoform X1 [Vitis 
vinifera]
 ref|XP_010657895.1| PREDICTED: uncharacterized protein LOC104881026 isoform X1 [Vitis 
vinifera]
 ref|XP_010657896.1| PREDICTED: uncharacterized protein LOC104881026 isoform X1 [Vitis 
vinifera]
Length=460

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  130  GGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLF  309
             GVVP+K ILR    +VW +E+      + F N W +F  DNS+  G  LVF Y G  +F
Sbjct  52   NGVVPEKAILREFSGRVWLVEVGLIGKDVYFLNGWQRFRTDNSLEEGVFLVFRYDGSHIF  111

Query  310  DFVLFDQFGCEKIVVKDAQPQ  372
            DF LF +  CEKI   + Q Q
Sbjct  112  DFKLFGRNQCEKIETDNDQLQ  132



>ref|XP_010263794.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X3 [Nelumbo nucifera]
Length=507

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F K F PE +S++L+IP+ F + + G       L    K VW +++    +GL F++ W
Sbjct  14   HFFKVFLPELNSERLQIPLGFLKHLKGQTSGTAYLTGPGKNVWRVDLVRRREGLYFEHGW  73

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
              F+ D+S   GD  VF Y G   F   +FDQ GC K
Sbjct  74   EVFLSDHSSQFGDFFVFRYDGNLHFTVQIFDQSGCIK  110



>gb|EYU45075.1| hypothetical protein MIMGU_mgv1a004183mg [Erythranthe guttata]
Length=540

 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (51%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
             F   F    SS++L IP +F + + G  P   +L       W + +  T++GL   + W
Sbjct  8    HFLLGFDSSLSSERLNIPYNFVKHLEGKTPGTALLVGPSGNDWYVNLIHTDNGLFLNDGW  67

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            A FV D+ + +GD +VF Y G   F   +FDQ  CEK
Sbjct  68   ADFVRDHFLEHGDAMVFRYDGELHFTVQIFDQSMCEK  104



>ref|NP_001050681.1| Os03g0622100 [Oryza sativa Japonica Group]
 sp|Q10GM4.1|Y3221_ORYSJ RecName: Full=B3 domain-containing protein Os03g0622100 [Oryza 
sativa Japonica Group]
 gb|ABF97677.1| B3 DNA binding domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12595.1| Os03g0622100 [Oryza sativa Japonica Group]
 dbj|BAG88742.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +1

Query  61   CKHF-----GPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCF  222
            CKHF     G  T S  + +P  F  +  G + + + L++   K WS+ +  ++ G L  
Sbjct  29   CKHFLTYMVGDFTES--MIVPSRFANNFNGHISEVVNLKSPSGKTWSIGVAYSDTGELVL  86

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            ++ W +FV+ N +   DCL+F Y G S FD ++FD  GCEK
Sbjct  87   RSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIFDPSGCEK  127



>emb|CDX91315.1| BnaC02g27260D [Brassica napus]
Length=440

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTET  204
            MA + +  RF K F    SS  + IPIS+ + +   +PK +IL+     +W  +M + + 
Sbjct  1    MASTDSLPRFFKVFISHFSSDSMLIPISYYDELPRHLPKTVILQGTGGCLWKVAMRLKQE  60

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            E+ +  +  W KFV+DN++ +GD + F Y G ++F+  ++   GC++
Sbjct  61   EEEVYLEQGWPKFVKDNALVDGDFMTFVYNGDNIFEVSIYGLDGCKQ  107



>gb|KDO79380.1| hypothetical protein CISIN_1g023721mg [Citrus sinensis]
 gb|KDO79381.1| hypothetical protein CISIN_1g023721mg [Citrus sinensis]
Length=245

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F + + + P NP+FV+     +R A+ + + V++ H I L P ++LRD  G++W  K+  
Sbjct  132   FKAARLVVPKNPHFVSVFSQYSRYAVNVSVRVVRSHGIKLEPEMMLRDQNGRKWPVKISF  191

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTN-DMLLQVTIVRGQTT  1079
               +GR  ++ GW    +   ++  D C+ EFV    N    ++V +VR   T
Sbjct  192   RTNGRIVITGGWSDFWREQKLEAGDKCVFEFVLTRGNMSKEMKVQVVRKMKT  243



>emb|CDX97286.1| BnaA02g20770D [Brassica napus]
Length=445

 Score = 63.9 bits (154),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTET  204
            MA + +  RF K F    SS  + IPIS+ + +   +PK +IL+     +W  +M + + 
Sbjct  1    MASTDSLPRFFKVFISHFSSDSMLIPISYYDELPRHLPKTVILQGTGGCLWKVAMRLKQE  60

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            E+ +  +  W KFV+DN++ +GD + F Y G ++F+  ++   GC++
Sbjct  61   EEEVYLEQGWPKFVKDNALVDGDFMTFVYNGDNIFEVSIYGLDGCKQ  107



>ref|XP_004499104.1| PREDICTED: B3 domain-containing protein REM16-like isoform X1 
[Cicer arietinum]
Length=436

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC-FQNNWAKFVEDNSITN  267
            Q+LE+P +F ++V   +P+ + L+     +W + +T T DG+  F N W +FV+D+S+  
Sbjct  32   QQLELPKTFSDNVKKKLPENVTLKGPSGVMWDIGLT-TRDGMAYFTNGWQQFVKDHSLKE  90

Query  268  GDCLVFSYCGYSLFDFVLFDQFG-CEK  345
             D LVF Y G SLF+ ++FD    CEK
Sbjct  91   NDFLVFKYNGESLFEVLIFDGESFCEK  117



>ref|XP_011099238.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=265

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTETEDGLCFQNNWAKFVEDNSI  261
            +++L +P+ F E  G  +   + LR    K+W   +E  + ++  CF   W KF ED  +
Sbjct  20   TRRLRLPLVFSERYGSALRGSVRLRTSSGKIWFVKLEQKDEKERYCFTGGWNKFAEDVGL  79

Query  262  TNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
              G+ LVF + G S+FD  ++   GCE+ +
Sbjct  80   EMGEFLVFRFVGGSMFDVSVYGVHGCEREI  109



>ref|XP_009341395.1| PREDICTED: putative B3 domain-containing protein Os04g0347400 
[Pyrus x bretschneideri]
Length=305

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            ++ L IP  F ++  G  P K +LR       ++E+ E ++GL F   W  FV+D+ + N
Sbjct  24   ARHLRIPPKFVKNFNGWSPCKCVLRGPSGLRRTVELEERKNGLFFNGGWQYFVKDHYLEN  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            GD LVF Y G S F   ++D   CEK V
Sbjct  84   GDLLVFKYDGESKFKVAIYDTTACEKDV  111



>gb|EEE59515.1| hypothetical protein OsJ_11767 [Oryza sativa Japonica Group]
Length=428

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 55/101 (54%), Gaps = 8/101 (8%)
 Frame = +1

Query  61   CKHF-----GPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCF  222
            CKHF     G  T S  + +P  F  +  G + + + L++   K WS+ +  ++ G L  
Sbjct  29   CKHFLTYMVGDFTES--MIVPSRFANNFNGHISEVVNLKSPSGKTWSIGVAYSDTGELVL  86

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            ++ W +FV+ N +   DCL+F Y G S FD ++FD  GCEK
Sbjct  87   RSGWKEFVDANGVQENDCLLFRYSGVSSFDVLIFDPSGCEK  127



>ref|XP_010432421.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
Length=392

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 0/90 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F    SS  + IPI + + +  ++PKK+IL+    + W++      D + F   W
Sbjct  12   RFFKAFVSHFSSDSMVIPIPYYDQLPRLLPKKVILQGPGGRSWNVATKIRGDEVHFTQGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLF  324
             KFVEDN++ +GD L F Y G  +F+  ++
Sbjct  72   PKFVEDNTLNDGDFLTFVYNGNHIFEVSIY  101



>ref|XP_010041704.1| PREDICTED: uncharacterized protein LOC104430669 [Eucalyptus grandis]
Length=261

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            + KL IP +F ++  G VPKK++++ C  + W +   E+++G  F    AKFV+D  +  
Sbjct  26   THKLNIPPAFLKNFQGNVPKKLVVK-CGGRSWFIRTEESDEGYHFSQGLAKFVKDLHLEL  84

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            G+ ++FS  G+  F+ V++D   CEK
Sbjct  85   GELVIFSMVGHETFEVVVYDTDCCEK  110



>ref|XP_009144545.1| PREDICTED: B3 domain-containing protein At4g34400 isoform X1 
[Brassica rapa]
Length=441

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTET  204
            MA + +  RF K F    SS  + IPIS+ + +   +PK +IL+     +W  +M + + 
Sbjct  1    MASTDSLPRFFKVFISHFSSDSMLIPISYYDELPRHLPKTVILQGTGGCLWKVAMRLKQE  60

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            E+ +  +  W KFV+DN++ +GD + F Y G ++F+  ++   GC++
Sbjct  61   EEEVYLEQGWPKFVKDNALVDGDFMTFVYNGDNIFEVSIYGLDGCKQ  107



>ref|XP_007202358.1| hypothetical protein PRUPE_ppa009186mg [Prunus persica]
 gb|EMJ03557.1| hypothetical protein PRUPE_ppa009186mg [Prunus persica]
Length=303

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ+L IP +F   V G +  K  LR+     W++ +    D   F   W +FV+D+S+  
Sbjct  24   SQRLSIPPAFMYHVNGRLSPKCTLRDPSGDCWTVGLEVRGDRFFFHEGWQRFVKDHSLEI  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
             + LVF Y G S FD  L+D  G EK
Sbjct  84   ANVLVFDYDGKSKFDVTLYDPIGSEK  109



>ref|XP_009144546.1| PREDICTED: B3 domain-containing protein At4g34400 isoform X2 
[Brassica rapa]
Length=436

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 61/107 (57%), Gaps = 2/107 (2%)
 Frame = +1

Query  31   MAGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVW--SMEMTET  204
            MA + +  RF K F    SS  + IPIS+ + +   +PK +IL+     +W  +M + + 
Sbjct  1    MASTDSLPRFFKVFISHFSSDSMLIPISYYDELPRHLPKTVILQGTGGCLWKVAMRLKQE  60

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            E+ +  +  W KFV+DN++ +GD + F Y G ++F+  ++   GC++
Sbjct  61   EEEVYLEQGWPKFVKDNALVDGDFMTFVYNGDNIFEVSIYGLDGCKQ  107



>gb|KDP31847.1| hypothetical protein JCGZ_12308 [Jatropha curcas]
Length=341

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (52%), Gaps = 3/108 (3%)
 Frame = +3

Query  762   YIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGR  941
             +++P NPYFV  +       +Y+   V+K H I L     LRD RG+ W  KV   +DGR
Sbjct  220   FVKPKNPYFVVLMTRTALYQVYVHRLVLKVHKIKLQENTNLRDERGKLWPVKVNYKKDGR  279

Query  942   TWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDM--LLQVTIVRGQTT  1079
               +++GW    + + V   D  I E + P  N++  L+QV I + Q T
Sbjct  280   ITINDGWLDFHRKHNVAMGDKIIFELM-PTENNLCNLIQVVIDKKQVT  326


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = +1

Query  106  PISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVF  285
            P +F   V   + +   L++   K+W + + +TE GL     W +FV  +S+ + D L+F
Sbjct  46   PPAFVMRVNQTISQNATLKDYTGKIWDVHLQKTETGLIIGKGWQEFVHHHSLVDADFLLF  105

Query  286  SYCGYSLFDFVLFDQFGCEKIVVKD  360
             Y G S F   +F + G +K   KD
Sbjct  106  KYNGNSEFYVKVFGRNGLKKRKPKD  130



>gb|KDO79379.1| hypothetical protein CISIN_1g023721mg [Citrus sinensis]
Length=278

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 59/112 (53%), Gaps = 1/112 (1%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKI  926
             F + + + P NP+FV+     +R A+ + + V++ H I L P ++LRD  G++W  K+  
Sbjct  165   FKAARLVVPKNPHFVSVFSQYSRYAVNVSVRVVRSHGIKLEPEMMLRDQNGRKWPVKISF  224

Query  927   WRDGRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTN-DMLLQVTIVRGQTT  1079
               +GR  ++ GW    +   ++  D C+ EFV    N    ++V +VR   T
Sbjct  225   RTNGRIVITGGWSDFWREQKLEAGDKCVFEFVLTRGNMSKEMKVQVVRKMKT  276


 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IP +F + +   VPK +I+R+   + W  +M E E  +  ++ W +F   +S+  GD LV
Sbjct  4    IPPAFAKHLNVTVPKHVIIRDYAGRQWRGKMEEVEGVIVIKDCWERFACVHSLELGDFLV  63

Query  283  FSYCGYSLFDFVLFDQFGCEK  345
            F Y G SLFD  ++   GC K
Sbjct  64   FKYNGSSLFDVKIYGINGCLK  84



>ref|XP_003589270.1| B3 domain-containing protein [Medicago truncatula]
Length=923

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = +1

Query  46   TTFRFCKHFG---PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGL  216
            T F+F  HF    PE   Q+L +P +F +++   +P+ + L+      W + +   +D +
Sbjct  177  THFQFI-HFTQLLPEDFKQQLALPKTFSDNLNKKLPENVTLKGPGGVAWKIGLITRDDTV  235

Query  217  CFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFD-QFGCEK  345
             F N W +FV D+S+ + D LVF+Y G S FD ++FD +  CEK
Sbjct  236  YFLNGWQRFVNDHSLKDNDFLVFNYNGESHFDVLIFDGESFCEK  279


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P  + L+     VW++ +T  +D + F N W +FV+D+S+   
Sbjct  37   QQLALPKTFSDNLKKKLPGNVTLKGPSGVVWNVGLTARDDTIYFTNGWQRFVKDHSLKEN  96

Query  271  DCLVFSYCGYSLFDFVLF--DQFGCEK  345
            D LVF Y G SLF+ ++F  D F CEK
Sbjct  97   DFLVFKYNGESLFEVLIFHGDSF-CEK  122



>ref|XP_002442426.1| hypothetical protein SORBIDRAFT_08g019887 [Sorghum bicolor]
 gb|EES16264.1| hypothetical protein SORBIDRAFT_08g019887 [Sorghum bicolor]
Length=592

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
             KL IP  F  +VGG +P+++ L     K +++++ + ++ L     W KF   + +  G
Sbjct  152  NKLTIPKKFATNVGGQIPEEVQLEAPNGKTYNVKVAKEQNDLVIGTGWTKFSSSHDLRQG  211

Query  271  DCLVFSYCGYSLFDFVLFDQFGCEK  345
            D LVF+Y GY+ F   +FD   CEK
Sbjct  212  DLLVFTYSGYAHFKVRIFDPSNCEK  236



>ref|XP_006375017.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
 gb|ERP52814.1| hypothetical protein POPTR_0014s03610g [Populus trichocarpa]
Length=735

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IP+SF + + G  P  + L      VW+ ++T+  D + F N W++FV D+ +  GD LV
Sbjct  56   IPVSFIKHMEGKTPGLVSLLGPSGDVWTADLTQENDDVLFSNGWSEFVRDHFLECGDLLV  115

Query  283  FSYCGYSLFDFVLFDQFGCEK  345
            F Y G   F   +FDQ  CEK
Sbjct  116  FRYHGELCFSVQVFDQSACEK  136



>emb|CDY12793.1| BnaC07g16400D [Brassica napus]
Length=327

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  52   FRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC-FQN  228
              F K + PE SS +L IP +F   +   +PK+++L +   ++W +E   T+ G+  F+ 
Sbjct  21   LEFFKVYLPEFSSHQLVIPQAFINILDKPLPKRVVLVDEIGRLWDVE---TKTGVVVFRQ  77

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             W KF  ++S+  GD L+F Y G S FD  +F + GC+K
Sbjct  78   GWEKFANEHSLEFGDFLLFRYNGESRFDVTIFAKDGCKK  116



>gb|AES59521.2| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=842

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = +1

Query  46   TTFRFCKHFG---PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGL  216
            T F+F  HF    PE   Q+L +P +F +++   +P+ + L+      W + +   +D +
Sbjct  177  THFQFI-HFTQLLPEDFKQQLALPKTFSDNLNKKLPENVTLKGPGGVAWKIGLITRDDTV  235

Query  217  CFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFD-QFGCEK  345
             F N W +FV D+S+ + D LVF+Y G S FD ++FD +  CEK
Sbjct  236  YFLNGWQRFVNDHSLKDNDFLVFNYNGESHFDVLIFDGESFCEK  279


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P  + L+     VW++ +T  +D + F N W +FV+D+S+   
Sbjct  37   QQLALPKTFSDNLKKKLPGNVTLKGPSGVVWNVGLTARDDTIYFTNGWQRFVKDHSLKEN  96

Query  271  DCLVFSYCGYSLFDFVLF--DQFGCEK  345
            D LVF Y G SLF+ ++F  D F CEK
Sbjct  97   DFLVFKYNGESLFEVLIFHGDSF-CEK  122



>ref|XP_004497762.1| PREDICTED: B3 domain-containing protein At5g60130-like [Cicer 
arietinum]
Length=331

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 72/163 (44%), Gaps = 29/163 (18%)
 Frame = +3

Query  648   RNNSCGFKKCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRSALY  827
             RN     + C      SSSK +K+  D F  E+     Y+Q  NPYFV K      + + 
Sbjct  173   RNQPQHLRTCKARDIESSSKHSKHEDDEFDAEI-----YVQEGNPYFVVKQSHNRPNEIS  227

Query  828   IPMHVIKDHNIALPPTLIL----------RDTRGQEW------------KSKVKIWRDGR  941
             IP + IKD  +     + L          RD     +            + +++ W+DGR
Sbjct  228   IPKNTIKDFCLCFTKHIPLVCCHCKGVQKRDIEAYHFVLPQISTEHIKKRGEIRRWKDGR  287

Query  942   TWVSEGWQSLCKLNLVDKDDICICEFV-HPNTNDMLLQVTIVR  1067
               V +GW+  C+ + + ++D CICE V   +    +L+V ++R
Sbjct  288   VLV-QGWEGFCRKSKIKENDRCICELVLREDKTIEMLRVHVIR  329



>ref|XP_007141725.1| hypothetical protein PHAVU_008G220000g [Phaseolus vulgaris]
 gb|ESW13719.1| hypothetical protein PHAVU_008G220000g [Phaseolus vulgaris]
Length=331

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (47%), Gaps = 25/116 (22%)
 Frame = +3

Query  747   FSSGQYIQPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLIL--------RDTRGQ  902
             F    YIQP NPYF  KL     + L+IP +V+++ ++  P  + L         D R  
Sbjct  197   FDPQMYIQPENPYFEAKLYKNRPNELHIPANVLRESSLTFPEEITLSRCKCFQREDIRRN  256

Query  903   EWK----------------SKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICICEFV  1022
             E                  +KV  W+DGR  + +GW + C  N + ++D+CICE V
Sbjct  257   ELGDNHLGFSRQTPMYSEVTKVSEWQDGRVCI-KGWTNFCTKNKIKENDVCICEIV  311


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 3/94 (3%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGV---VPKKIILRNCFKKVWSMEMTETEDGLCFQN  228
            F K F PE  S+++ IP SF +S       +P+ IILRN    VW ++       + FQ 
Sbjct  9    FFKIFFPEKHSERMVIPSSFVKSRRLRRRRIPEDIILRNVSGGVWCVKTRLVGHKIYFQE  68

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQ  330
             W  F  +N I   D L+F Y G ++F  V+ +Q
Sbjct  69   GWKVFQAENCIGKADFLLFKYDGTNVFKVVILEQ  102



>emb|CDY40646.1| BnaA03g53170D [Brassica napus]
Length=211

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 4/105 (4%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKII-LRNCFKKVWSMEMTETEDGLCFQNN  231
            RF K F PET+S+ + IP SF E +   +P +   L+     VW++   +   G  F + 
Sbjct  13   RFFKVFLPETASESMAIPKSFNEHLQDPLPHETAKLQGIGGGVWTVSFKKIRGGAYFTSG  72

Query  232  WAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQ  366
            W+KF ED+ + +G+ L F Y G   F+  +   FG  ++V  D+ 
Sbjct  73   WSKFAEDHELKHGEFLTFVYDGSHTFEVSV---FGRSELVAADSN  114



>ref|XP_006400878.1| hypothetical protein EUTSA_v10014488mg [Eutrema salsugineum]
 gb|ESQ42331.1| hypothetical protein EUTSA_v10014488mg [Eutrema salsugineum]
Length=250

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 65/131 (50%), Gaps = 5/131 (4%)
 Frame = +3

Query  666   FKKCSGAGEGSSSKKNKNVFDHFGIELFSSGQYIQ-PNNPYFVTKLGPKNRSALYIPMHV  842
              ++ S  GE  +   + N      +++    QY+  PNNP+F   L P  RS L IP  V
Sbjct  111   LRRSSVRGEEETRANDDNDATLEDVDVSDQRQYLDDPNNPFFPVTLNPNRRSQLRIPRKV  170

Query  843   IKDHNIALPPTLILRDTRGQEW---KSKVKIWRDGRTWVSEGWQSLCKLNLVDKDDICIC  1013
             I D+ +  P  + L DT  +++     K+KI  +G  +V +G+ ++ + N V   D  IC
Sbjct  171   ITDYGLNFPENITLVDTLVKKFGKLAKKIKIQLNGSVFV-KGYGAILRRNNVKSRDKLIC  229

Query  1014  EFVHPNTNDML  1046
             E     +N+M+
Sbjct  230   ELKKTGSNNMV  240


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 45/91 (49%), Gaps = 0/91 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F K +    S   +E+P+SF   +   +P  + +++ + K+W M + +  +     N W
Sbjct  13   KFFKVYLAGISGDDMEVPVSFNRCLPKCLPNNVTIKSIYGKIWKMALRKCGEKYVLVNGW  72

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFD  327
               V+D  +  GD L F + G   F+F +++
Sbjct  73   KMIVKDEDLVGGDVLEFDFDGSQCFNFCIYE  103



>ref|XP_010691310.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
             +L IP  F +   G +     LR     VW +E+ ETE+ + F + W  FV DN +  G
Sbjct  37   HQLRIPRKFIKCFKGDLSSSCTLRGQSGHVWRVEIVETEEDVLFSDGWGNFVRDNGLMMG  96

Query  271  DCLVFSYCGYSLFDFVLFDQFGCE  342
              LVF Y G S F+  +FD  GCE
Sbjct  97   YFLVFCYAGDSSFEVSIFDTTGCE  120



>ref|XP_011099239.1| PREDICTED: B3 domain-containing protein At1g49475-like [Sesamum 
indicum]
Length=246

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            +QKL +P  F +  G ++P    LR  F + WS+++   ++  CF   W+KFV+D  +  
Sbjct  20   AQKLNLPPVFVQKYGRMLPGTAELRTSFGETWSVKLEIEDEKYCFTGGWSKFVKDAELEV  79

Query  268  GDCLVFSY-CGYSLFDFVLFDQFGCEKIV  351
            G+ LVF +  G S FD  ++   GCEK +
Sbjct  80   GEFLVFWFNIGKSTFDVSVYGINGCEKEI  108



>ref|XP_007214051.1| hypothetical protein PRUPE_ppa017456mg, partial [Prunus persica]
 gb|EMJ15250.1| hypothetical protein PRUPE_ppa017456mg, partial [Prunus persica]
Length=198

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  181  WSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            W++E+ E E+GL FQ+ W  FV+D+ + +GD LVF Y G S F   ++D+  CEK V
Sbjct  28   WTVELEERENGLFFQDGWQGFVKDHHLEDGDFLVFKYDGESKFKVTIYDRTACEKNV  84



>gb|KFK27547.1| hypothetical protein AALP_AA8G397800 [Arabis alpina]
Length=388

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 56/108 (52%), Gaps = 3/108 (3%)
 Frame = +1

Query  37   GSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTE---TE  207
            G  +  +F K + P+ S   L+IPISF   +   +PK +I+R+ + K+W +E+ +     
Sbjct  4    GDDSLPKFFKVYLPDDSGDDLDIPISFNSCLPKSMPKTVIVRSIYGKIWKLELRKCYGDV  63

Query  208  DGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            +     N W   V+D  +  G+ L F + G   F+F ++ Q  C+++ 
Sbjct  64   ERFVMVNGWKSIVKDEDLKGGEFLAFEFDGSRFFNFCIYGQRTCKRLA  111



>emb|CDY01449.1| BnaA07g12220D [Brassica napus]
Length=327

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  52   FRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC-FQN  228
              F K + PE SS +L IP +F   +   +PKK++L +   ++W +E   T+ G+  F+ 
Sbjct  21   LEFFKVYLPEFSSHQLVIPQAFINILDKPLPKKVVLVDEIGRLWDVE---TKIGVVVFRQ  77

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             W KF  ++S+  GD L+F Y G S FD  +F + GC+K
Sbjct  78   GWEKFANEHSLEFGDFLLFRYNGESRFDVTIFAKDGCKK  116



>ref|XP_009103463.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Brassica 
rapa]
 ref|XP_009103464.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Brassica 
rapa]
Length=327

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 4/99 (4%)
 Frame = +1

Query  52   FRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLC-FQN  228
              F K + PE SS +L IP +F   +   +PKK++L +   ++W +E   T+ G+  F+ 
Sbjct  21   LEFFKVYLPEFSSHQLVIPQAFINILDKPLPKKVVLVDEIGRLWDVE---TKIGVVVFRQ  77

Query  229  NWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             W KF  ++S+  GD L+F Y G S FD  +F + GC+K
Sbjct  78   GWEKFANEHSLEFGDFLLFRYNGESRFDVTIFAKDGCKK  116



>ref|XP_011089901.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum 
indicum]
Length=205

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = +1

Query  85   SSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEM-TETEDGLCF-QNNWAKFVEDNS  258
            + Q+++IP +F   +   + +  +LR+ +  +W M + T + D   F + +W +F E+NS
Sbjct  16   TCQEMQIPPAFVPKIQRALAQGFVLRDRYGNLWEMGVATSSGDKWYFRKEDWPQFCEENS  75

Query  259  ITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            +  GD +VF+Y G +LFDF+LF    CEK
Sbjct  76   LEMGDFVVFNYKGNNLFDFLLFGNDACEK  104



>ref|XP_007041352.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX97183.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=455

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 2/100 (2%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVP--KKIILRNCFKKVWSMEMTETEDGLCFQNN  231
            F K + P+ S +++ IP +      G++P      LRNC  +   +E+ + +  + F+  
Sbjct  9    FFKVYLPKLSFERMSIPPTAVVCSNGLMPMPATATLRNCKGQCRHVELNKCDGRMFFEKG  68

Query  232  WAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            W +F++DNSI   D LVFSY G S+FD  ++   GCEK V
Sbjct  69   WRRFIDDNSIKEEDILVFSYVGCSVFDVKVYGFDGCEKNV  108


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = +3

Query  705   KKNKNVFDHFGIELFSSGQYIQPNNPYFVTKLGPKNRS---------ALYIPMHVIKDHN  857
             + N+ +F H+   LFS+  +     P  +  L     +         + Y+P  VI+D++
Sbjct  236   RGNELIFLHYFDFLFSNIMFSHAPMPRMLVSLSGMFSTNFWLYSLCGSQYVPSTVIRDYD  295

Query  858   IALPPT--LILRDTRGQEWKSKVKIWRDGRTWVSEGWQSLCKLNLVDKD-DICICEFVHP  1028
             + L     +   D   ++   KV+ W+D RT +  GW+S C  N V+++ D+CICEF+  
Sbjct  296   LILEDNQEITFLDPYDRKKIGKVRKWKDRRTCII-GWRSFCNRNRVNQERDVCICEFLLE  354

Query  1029  NTNDM---LLQVTIVRGQTTKN  1085
             N N+     ++V I+RG+ TK+
Sbjct  355   NENEQKPKFMKVHIIRGKHTKS  376



>ref|XP_010478207.1| PREDICTED: B3 domain-containing protein At4g34400-like [Camelina 
sativa]
Length=390

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F    SS  + IPI + + +  ++PKK+IL+      W++      D + F   W
Sbjct  12   RFFKVFVSLFSSDSMVIPIPYYDQLPRLLPKKVILQGPGGCSWNVATEIRGDEVHFAKGW  71

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             KF+EDN++ +GD L F Y G  +F+  ++   GC++
Sbjct  72   PKFIEDNTLNDGDFLTFVYNGDDIFEVSIYRSDGCKE  108



>ref|XP_010456016.1| PREDICTED: B3 domain-containing protein At5g60140-like [Camelina 
sativa]
Length=276

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +3

Query  774   NNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRDGRTWVS  953
             NNP F   L PK +S L+IP HVIKD+ +  P  + + D  G   + K+KI  +G  +V 
Sbjct  179   NNPQFTVTLNPKRQSQLHIPAHVIKDYGLTFPERITVVDKLGG-LEKKIKIQGNGCVFV-  236

Query  954   EGWQSLCKLNLVDKDDICICEFVHPNTNDM-LLQVTIVRG  1070
             +G+ S+ + N +   D  ICE     TN +  ++V I+RG
Sbjct  237   KGFGSVFRRNKMKTTDKMICEVKRTGTNLVHTIKVNIIRG  276


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 6/107 (6%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTE-----TED  210
            +T +F K + P  S   L +PISF   +   +PK + +R+   K+W+M + +       +
Sbjct  10   STSKFVKAYLPGESGDDLVLPISFNSCLPKSLPKTVTVRSVSGKIWNMVLRKCGGDYEAE  69

Query  211  GLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFD-QFGCEKI  348
                 N W K V+D  +  GD L F + G   F+F +++ +  C++I
Sbjct  70   RFVMVNGWKKIVKDEDLKGGDLLAFEFDGSQCFNFCIYEHETACKRI  116



>ref|XP_002866372.1| hypothetical protein ARALYDRAFT_496153 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42631.1| hypothetical protein ARALYDRAFT_496153 [Arabidopsis lyrata subsp. 
lyrata]
Length=291

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  759   QYI-QPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRDTRGQEWKSKVKIWRD  935
             QY+   NNPYF   L PK +S L+IP +VIKD+++  P  + + D  G   K+ +KI ++
Sbjct  188   QYLDHHNNPYFTMTLNPKKKSQLHIPAYVIKDYDLNFPARITVMDQLGALEKA-IKIQKN  246

Query  936   GRTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDM-LLQVTIVRG  1070
             G  +V +G+ S+ + N +   D  ICE     +N +  ++V I+ G
Sbjct  247   GSIFV-KGFGSVIRRNKMKMTDKMICELKRTGSNLVHTIKVNIISG  291



>gb|ACJ86297.1| unknown [Medicago truncatula]
Length=199

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW++ +T  ++ + F + W +FV D+S+   
Sbjct  42   QQLALPKTFSDNLKKKLPENVTLKGPSGVVWNIGLTTRDNTVYFVDGWQQFVNDHSLKEN  101

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  102  DFLVFKYNGESLFEVLIFDGNSFCEK  127



>gb|AFK45994.1| unknown [Medicago truncatula]
Length=199

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW++ +T  ++ + F + W +FV D+S+   
Sbjct  42   QQLALPKTFSDNLKKKLPENVTLKGPSGVVWNIGLTTRDNTVYFVDGWQQFVNDHSLKEN  101

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  102  DFLVFKYNGESLFEVLIFDGNSFCEK  127



>ref|XP_004288671.1| PREDICTED: putative B3 domain-containing protein Os03g0621600-like 
[Fragaria vesca subsp. vesca]
Length=315

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +1

Query  88   SQKLEIPISFKESV--GGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSI  261
            S++L IP  F +++   G+ P K  LR     + + E+  TE+G+ F N W  FV+D+ +
Sbjct  24   SKRLLIPPEFTKNLVWNGIFPHKCALRGPSGLLCAAEVESTENGMFFHNGWECFVKDHHL  83

Query  262  TNGDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
              GD L+F Y G S F   ++D+  CEK V
Sbjct  84   ELGDFLIFRYDGESKFSVTIYDRSACEKDV  113



>emb|CDX80197.1| BnaC09g35450D [Brassica napus]
Length=242

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEM----TETEDGLCF  222
            +F K + P+ S   L+IPISF   +   +P+ II+R+ +  +W +++     +  D +  
Sbjct  43   KFFKVYLPDDSGDDLDIPISFNSFLPKPLPEYIIVRSIYGNIWKLKLRKHCGDDVDKVSM  102

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             N W + V+D  +  G+ L F +  Y LF+F ++ Q  C+++
Sbjct  103  LNGWKRIVKDEDLKGGEFLAFEFDCYRLFNFCIYGQATCKRL  144



>ref|XP_004978926.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Setaria 
italica]
Length=475

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F K F P+ S ++L+IP +F + +       + L+      W   +T   +GL F+  W
Sbjct  106  QFFKIFFPDQSRERLKIPTAFHQHLKEQPTGLVSLKGPSGNTWQAVLTSDSEGLFFEQGW  165

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGC  339
             +FV D+S+  G  LVF+Y G S F   +F  FG 
Sbjct  166  KEFVTDHSVKQGHFLVFTYDGLSRFSVTVFGSFGV  200



>ref|XP_008241585.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
[Prunus mume]
Length=312

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S +L+IP +F     G VP++ +LR      W++ + +  DG  FQ  W +FV D+ +  
Sbjct  19   SNQLKIPPAFYVHFAGEVPRRSLLRTP-AGTWNVNVEKVNDGFFFQKGWKEFVHDHGLKL  77

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
             + L+F Y G+S FD  ++ + GC+K
Sbjct  78   CEFLIFRYAGHSKFDVDVYGRNGCKK  103



>ref|XP_010064141.1| PREDICTED: B3 domain-containing protein Os03g0212300-like [Eucalyptus 
grandis]
Length=280

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  EIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            +IP++F++ + G  P+ ++L       W + + E E  L F   W KFVED+S+  GD L
Sbjct  56   KIPLAFQDYIKGRRPQAVLLTGPSGDSWMVGLIEEEGALYFGGGWPKFVEDHSVQTGDFL  115

Query  280  VFSYCGYSLFDFVLFD  327
            VF Y G   F+  +FD
Sbjct  116  VFRYDGEDGFEVQVFD  131



>ref|XP_009120534.1| PREDICTED: B3 domain-containing protein At5g60130-like isoform 
X3 [Brassica rapa]
Length=331

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMT----ETEDGLCF  222
            +F K + P+ S   L+IPISF   +   +P+ II+R+ +  +W +++     +  D +  
Sbjct  15   KFFKVYLPDDSGDDLDIPISFNSFLPKPLPEYIIVRSIYGNIWKLKLMKCCGDDVDKVSM  74

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             N W + V+D  +  G+ L F + G  LF+F ++ Q  C+++
Sbjct  75   VNGWKRIVKDEDLKGGEFLAFEFDGSRLFNFCIYGQATCKRL  116


 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 7/106 (7%)
 Frame = +3

Query  768   QPNNPYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILRD---TRGQEWKSKVKIWRDG  938
              P++P F   L PK +S L IP H++KD+N+     + + D    +    + K+K+  +G
Sbjct  227   DPDSPSFTVILNPKKKSQLLIPSHIMKDYNLHFTERITIVDPLVPKFGTLERKIKLQDNG  286

Query  939   RTWVSEGWQSLCKLNLVDKDDICICEFVHPNTNDM--LLQVTIVRG  1070
               +V +G+ S+ + N V   D  ICE V  N ND+  +L+V IVRG
Sbjct  287   CLFV-KGFGSVFRRNNVKTTDTIICE-VKKNGNDVAHILKVHIVRG  330



>ref|XP_007214340.1| hypothetical protein PRUPE_ppb025337mg, partial [Prunus persica]
 gb|EMJ15539.1| hypothetical protein PRUPE_ppb025337mg, partial [Prunus persica]
Length=160

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S+ L IP +F ++  G    K  LR    K  ++E+ E E+GL F   W  FV+D+ +  
Sbjct  24   SKHLRIPPAFIKNFNGGSLGKCSLRGPSGKGRAVELEERENGLFFSKGWQGFVKDHHLEV  83

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEKIV  351
            G+ LVF Y G S F   ++D+  CEK V
Sbjct  84   GNFLVFRYDGESKFKVTIYDRSACEKDV  111



>ref|XP_008794892.1| PREDICTED: putative B3 domain-containing protein Os04g0346900 
isoform X3 [Phoenix dactylifera]
Length=517

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            SQ++ IP  F ++    + + I+LR     +W + + +  + +  +N W +FV+ +SI  
Sbjct  414  SQQMIIPKKFVKNFKEELSQNILLRGPSGNLWRVRLLKDAEDMILKNGWEQFVDAHSIKE  473

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
             D LVF Y G S F+ ++FDQ GCEK
Sbjct  474  DDHLVFKYNGDSCFNVLIFDQTGCEK  499



>ref|XP_010059786.1| PREDICTED: B3 domain-containing protein REM16-like isoform X4 
[Eucalyptus grandis]
Length=381

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L IP  F E++   +P+ ++L+      W +     ++ L F++ W  FV+D+++   
Sbjct  35   QQLAIPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKN  94

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G S F+ ++F+Q   CEK
Sbjct  95   DILVFRYNGESSFNVLVFNQHSLCEK  120



>ref|XP_010245898.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 
isoform X2 [Nelumbo nucifera]
Length=317

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = +1

Query  94   KLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGD  273
            KL IP  F +     VP++ I+R+   K W + + + E    FQ  W  FV+ + +  GD
Sbjct  36   KLLIPPPFIKHFNRSVPRRSIIRSPTGKCWPVTVKKIEKRFYFQKGWQSFVKHHDLVVGD  95

Query  274  CLVFSYCGYSLFDFVLFDQFGCEK  345
             LVFSY G S F   ++D+  CEK
Sbjct  96   LLVFSYHGNSKFSVKIYDRSACEK  119


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 47/105 (45%), Gaps = 1/105 (1%)
 Frame = +3

Query  780   PYFVTKLGPKNRSALYIPMHVIKDHNIALPPTLILR-DTRGQEWKSKVKIWRDGRTWVSE  956
             PYF+       R  + IP  V +   +A    ++L  D +G+ W  KV   RDGR  +S+
Sbjct  184   PYFIGVWRNSRRYYMTIPSAVARQFCLASKVKMVLLWDPQGRPWPVKVCFRRDGRVVLSD  243

Query  957   GWQSLCKLNLVDKDDICICEFVHPNTNDMLLQVTIVRGQTTKNME  1091
             GW    K N + + D C  EF H   N + + +    G T +   
Sbjct  244   GWGEFSKANRLLEGDACSFEFCHGIGNSICVNIFRAMGSTKRQAS  288



>gb|KEH40066.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=284

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW + +T  ++ + F   W +FV+D+S+   
Sbjct  34   QQLALPKTFSDNLKKKLPENVTLKGPSGAVWDIGLTTRDNTVYFVGGWERFVKDHSLKEN  93

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  94   DFLVFKYNGESLFEVLIFDGDNFCEK  119



>gb|KEH40067.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=302

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW + +T  ++ + F   W +FV+D+S+   
Sbjct  34   QQLALPKTFSDNLKKKLPENVTLKGPSGAVWDIGLTTRDNTVYFVGGWERFVKDHSLKEN  93

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEKIV  351
            D LVF Y G SLF+ ++FD    CEK  
Sbjct  94   DFLVFKYNGESLFEVLIFDGDNFCEKAT  121



>gb|KCW66218.1| hypothetical protein EUGRSUZ_F00044 [Eucalyptus grandis]
Length=378

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L IP  F E++   +P+ ++L+      W +     ++ L F++ W  FV+D+++   
Sbjct  35   QQLAIPKKFAENLRSKLPENVVLKGPSGATWKVGTVADDENLLFKHGWQDFVKDHALEKN  94

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G S F+ ++F+Q   CEK
Sbjct  95   DILVFRYNGESSFNVLVFNQHSLCEK  120



>emb|CDP19095.1| unnamed protein product [Coffea canephora]
Length=274

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 0/96 (0%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F K +  +  S +L+IP  F +   G VP+   L     + W +   + ++   FQ  W 
Sbjct  16   FFKVYTDQLCSSQLKIPPEFVKKFNGDVPQTFTLEGPQGRSWQIVAGKVDEYFYFQEGWQ  75

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             FVEDNS+ N D L FSY G S F   +F + GC K
Sbjct  76   NFVEDNSLENDDFLTFSYGGCSRFYVEIFGKHGCIK  111



>ref|XP_003589273.1| B3 domain-containing protein [Medicago truncatula]
 gb|AES59524.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=348

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 57/101 (56%), Gaps = 6/101 (6%)
 Frame = +1

Query  46   TTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQ  225
            T F    HF      Q+L +P +F +++   +P+ + L+     VW++ +T   D + F 
Sbjct  23   TLFLSTTHF-----QQQLALPKTFSDNLKKKLPENVTLKGPSGVVWNIGLTTRNDTVYFM  77

Query  226  NNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFD-QFGCEK  345
            + W +FV+D+S+   D LVF Y G SLF+ ++F+ +  CEK
Sbjct  78   DGWQRFVKDHSLKENDFLVFKYNGESLFEVLIFNGESLCEK  118



>ref|XP_002450488.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor]
 gb|EES09476.1| hypothetical protein SORBIDRAFT_05g006090 [Sorghum bicolor]
Length=443

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 1/112 (1%)
 Frame = +1

Query  34   AGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG  213
            AG+V   +F K F PE S ++L+IP  F++ +       + LR    K W   +    + 
Sbjct  52   AGNVCP-QFFKVFFPELSGERLKIPPMFRQHLQEQPTGPVSLRGPSGKKWQATLASESEA  110

Query  214  LCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
              F+  W +FV D+SI  G  LVF+Y G S F  V+F   G    +   A+P
Sbjct  111  WFFEQGWKEFVTDHSINKGYFLVFTYDGPSQFSVVVFSPSGVTDPIALKAKP  162



>emb|CAB36717.1| putative protein [Arabidopsis thaliana]
 emb|CAB80157.1| putative protein [Arabidopsis thaliana]
Length=389

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F  HF    SS+ + IP+S+ + +    PK +ILR      W +     +D + F   W 
Sbjct  20   FVSHF----SSEFMVIPVSYYDHIPHRFPKTVILRGPGGCSWKVATEIKDDEVLFSQGWP  75

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQF-GCEKI  348
            KFV DN++ +GD L F+Y G  +F+  +F  +  C++I
Sbjct  76   KFVRDNTLNDGDFLTFAYNGAHIFEVSIFRGYDACKEI  113



>ref|NP_195166.2| AP2/B3-like transcriptional factor family protein [Arabidopsis 
thaliana]
 sp|Q9SZ05.2|Y3440_ARATH RecName: Full=B3 domain-containing protein At4g34400 [Arabidopsis 
thaliana]
 dbj|BAH30555.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86368.1| AP2/B3-like transcriptional factor family protein [Arabidopsis 
thaliana]
Length=397

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWA  237
            F  HF    SS+ + IP+S+ + +    PK +ILR      W +     +D + F   W 
Sbjct  20   FVSHF----SSEFMVIPVSYYDHIPHRFPKTVILRGPGGCSWKVATEIKDDEVLFSQGWP  75

Query  238  KFVEDNSITNGDCLVFSYCGYSLFDFVLFDQF-GCEKI  348
            KFV DN++ +GD L F+Y G  +F+  +F  +  C++I
Sbjct  76   KFVRDNTLNDGDFLTFAYNGAHIFEVSIFRGYDACKEI  113



>ref|XP_009365640.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Pyrus 
x bretschneideri]
Length=565

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 0/104 (0%)
 Frame = +1

Query  34   AGSVTTFRFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG  213
            A +V +  F   +  + SS++L+IP  F   + G     ++L       WS+E+ +   G
Sbjct  5    ARNVRSPHFFAFYSADLSSERLKIPDRFMRHMEGRTSGLVLLFGPSGSAWSVELIQQNGG  64

Query  214  LCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            L   + W  FV D+ +  GD LVFSY     F  ++FDQ  CEK
Sbjct  65   LFLHHGWPAFVRDHYVECGDFLVFSYDADLCFTVLIFDQSACEK  108



>ref|XP_008440204.1| PREDICTED: putative B3 domain-containing protein At5g66980 isoform 
X2 [Cucumis melo]
Length=282

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (56%), Gaps = 0/93 (0%)
 Frame = +1

Query  76   PETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDN  255
            P  SS    IP +F +   G +P + I+R+   K W + + E ++ + F++ W +FV+ +
Sbjct  4    PPVSSWIYSIPPAFVKYFNGRIPSEAIIRDQSGKSWHVTLEELKNIVFFKDGWQEFVDSH  63

Query  256  SITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
             +  G  LVF Y G  +FD  +F + GC+K +V
Sbjct  64   HLKRGYFLVFQYDGSHVFDVKIFGKNGCKKELV  96



>emb|CDY31574.1| BnaA10g12970D [Brassica napus]
Length=210

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEM----TETEDGLCF  222
            +F K + P+ S   L+IPISF   +   +P+ II+R+ +  +W +++     +  D +  
Sbjct  15   KFFKVYLPDDSGDDLDIPISFNSFLPKPLPEYIIVRSIYGNIWKLKLMKCCGDDVDKVSM  74

Query  223  QNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
             N W + V+D  +  G+ L F + G  LF+F ++ Q  C+++
Sbjct  75   VNGWKRIVKDEDLKGGEFLAFEFDGSRLFNFCIYGQATCKRL  116



>gb|AES59525.2| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=478

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF +   P    Q+L +P +F +++   +P  + L+     VW + +T  +D +   + W
Sbjct  25   RFTQFLQPTHLEQQLALPKTFSDNLKNKLPANVTLKGPSGVVWDIGLTTRDDTIYSTDGW  84

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFD-QFGCEK  345
             +FV+D+S+   D LVF Y G SLF+ ++F  +  CEK
Sbjct  85   QQFVKDHSLKQNDFLVFKYNGESLFEVLIFHGESFCEK  122


 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW++ +T  +D + F + W +F++D+S+   
Sbjct  194  QQLALPKTFSDNLKKKLPENVTLKGPSGVVWNIGLTTRDDIVYFVDGWKRFIKDHSLKQN  253

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  254  DFLVFKYNGKSLFEVLIFDGDSFCEK  279



>ref|XP_007047117.1| Uncharacterized protein TCM_000520 [Theobroma cacao]
 gb|EOX91274.1| Uncharacterized protein TCM_000520 [Theobroma cacao]
Length=278

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
             KL IP +F ++  G VP    L++     W + +  TE    F   W+ FVED  + +G
Sbjct  26   NKLRIPPAFVKNFQGNVPTNFTLKSNSGSSWRVTVQNTEGSYFFCGGWSNFVEDQGLDSG  85

Query  271  DCLVFSYCGYSLFDFVLFDQFGCEKIVV  354
            D +VF   G S FD V++   GC K +V
Sbjct  86   DFVVFYLVGKSSFDCVIYGPTGCGKKIV  113



>ref|XP_004982409.1| PREDICTED: B3 domain-containing protein Os03g0622200-like [Setaria 
italica]
Length=373

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETE-DGLCFQNNWAKFVEDNSIT  264
            ++ + IP  F  +  G + + + L++   K WS+ +   + D +  Q+ W  FV  +SI 
Sbjct  39   AETMSIPARFANNFNGHISEVVSLKSPSGKTWSIGVGNNDTDEVFLQSGWKDFVSAHSIA  98

Query  265  NGDCLVFSYCGYSLFDFVLFDQFGCEK  345
             GD L+F Y G S FD ++FD  GCEK
Sbjct  99   EGDYLLFKYSGVSSFDVLVFDSSGCEK  125



>gb|KFK27314.1| hypothetical protein AALP_AA8G366400 [Arabis alpina]
Length=339

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +1

Query  58   FCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDG-LCFQNNW  234
            F +++  +  SQ+L IP S+K+     +P+  +L+    + W+++ T T+D  + F++ W
Sbjct  14   FFRYYNSQEHSQRLVIPSSYKQYYPTPLPQTAVLKKPEGRFWNVKWTITQDDTISFEDGW  73

Query  235  AKFVEDNSITNGDCLVFSYCGYSLF  309
            +KFV+DN I  GD ++F+Y G  +F
Sbjct  74   SKFVKDNGIIEGDFVLFTYDGNRVF  98



>ref|XP_003576206.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X1 [Brachypodium distachyon]
Length=582

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F + F P+   ++L IP+SF + +       + L+     +W  E+    +GL F N W
Sbjct  78   QFFRVFLPQQYGERLRIPLSFNQYLRNQPAGMVSLKGQSGNIWLAELAVDTEGLFFANGW  137

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             +FV D+SI  G  L F Y G S F  V+FD    EK     A+P
Sbjct  138  KEFVRDHSIETGHFLTFRYDGRSKFSVVVFDGKCIEKPSAFHARP  182



>ref|XP_003589278.1| B3 domain-containing protein [Medicago truncatula]
 gb|AES59529.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=361

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW++ +T  +  + F + W +FV+D+S+   
Sbjct  34   QQLALPKTFSDNLKNKLPENVTLKGPSGVVWNIGLTTRDYTVYFTDGWQRFVKDHSLKEN  93

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD+   CEK
Sbjct  94   DFLVFKYNGESLFEVLIFDRDNFCEK  119



>ref|XP_006839026.1| hypothetical protein AMTR_s00002p00272200 [Amborella trichopoda]
 gb|ERN01595.1| hypothetical protein AMTR_s00002p00272200 [Amborella trichopoda]
Length=494

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S++L +P    + + GV  ++ IL +   K+W +E+ +TE+G  FQN W +F++ +S+  
Sbjct  38   SKELALPQELYKHINGVASERAILESPSGKLWLVELKKTEEGAFFQNGWKEFIKGHSVKL  97

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            G+ +VF Y G   FD  +F   G ++
Sbjct  98   GESIVFRYDGNLRFDVQIFGSNGYQR  123



>gb|EMT01685.1| B3 domain-containing protein [Aegilops tauschii]
Length=1269

 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +1

Query  97   LEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDC  276
            +++PI+    + G +P K+ L     K +++++++ E+GL FQ+ WA+F     +  G  
Sbjct  151  VDVPINLANYIRGQIPDKVKLEVPDGKTYNVQVSKEENGLVFQSGWAEFARTYELVQGTI  210

Query  277  LVFSYCGYSLFDFVLFDQFGCEK  345
            L+F   G S F+  +F+Q GCEK
Sbjct  211  LLFESSGSSCFEVRMFNQTGCEK  233



>ref|XP_009138341.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 
[Brassica rapa]
Length=276

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F PET+S+ + IP SF   +   +P+   L+     VW++   +      F + W
Sbjct  13   RFFKVFLPETASESMAIPKSFNAHLQDPLPQTAKLQGIGGGVWTVSFKKIRGVAYFTSGW  72

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F +  C++I
Sbjct  73   SKFAEDHELKHGEFLTFVYDGSHTFEVSVFGRSECKEI  110



>ref|XP_010237857.1| PREDICTED: B3 domain-containing protein Os11g0197600-like isoform 
X2 [Brachypodium distachyon]
Length=578

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            +F + F P+   ++L IP+SF + +       + L+     +W  E+    +GL F N W
Sbjct  78   QFFRVFLPQQYGERLRIPLSFNQYLRNQPAGMVSLKGQSGNIWLAELAVDTEGLFFANGW  137

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKIVVKDAQP  369
             +FV D+SI  G  L F Y G S F  V+FD    EK     A+P
Sbjct  138  KEFVRDHSIETGHFLTFRYDGRSKFSVVVFDGKCIEKPSAFHARP  182



>ref|XP_009138339.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Brassica rapa]
 ref|XP_009138340.1| PREDICTED: B3 domain-containing protein REM20-like isoform X1 
[Brassica rapa]
Length=279

 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNW  234
            RF K F PET+S+ + IP SF   +   +P+   L+     VW++   +      F + W
Sbjct  13   RFFKVFLPETASESMAIPKSFNAHLQDPLPQTAKLQGIGGGVWTVSFKKIRGVAYFTSGW  72

Query  235  AKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEKI  348
            +KF ED+ + +G+ L F Y G   F+  +F +  C++I
Sbjct  73   SKFAEDHELKHGEFLTFVYDGSHTFEVSVFGRSECKEI  110



>ref|XP_006851101.1| hypothetical protein AMTR_s00025p00247140 [Amborella trichopoda]
 gb|ERN12682.1| hypothetical protein AMTR_s00025p00247140 [Amborella trichopoda]
Length=226

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query  88   SQKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITN  267
            S++L IP +F+ +   +   + +L       W++E+ E    LCF   W KFV+D+S+ +
Sbjct  28   SKQLFIPPAFRHNFKKIF-HEAVLEGPSGNNWNVEVEEVRGALCFSRGWKKFVKDHSLND  86

Query  268  GDCLVFSYCGYSLFDFVLFDQFGCEK  345
            GD LVF Y G + F   +F++ GCE+
Sbjct  87   GDFLVFYYDGDTHFLIKIFNKTGCER  112



>ref|XP_004160514.1| PREDICTED: uncharacterized LOC101221625 [Cucumis sativus]
Length=1043

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IP +F + + G  P+K  +++     W + + + +D L F+N W  FV+ +S+  GD LV
Sbjct  607  IPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYFKNGWKAFVDYHSLKYGDFLV  666

Query  283  FSYCGYSLFDFVLFDQFGC  339
            F Y G+ LFD  +F + GC
Sbjct  667  FQYHGHCLFDVKIFGKNGC  685



>ref|XP_010674817.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Beta 
vulgaris subsp. vulgaris]
Length=177

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 10/107 (9%)
 Frame = +1

Query  55   RFCKHFGPETSSQKLE----------IPISFKESVGGVVPKKIILRNCFKKVWSMEMTET  204
             F K + PE +S +LE          IP  F ++  G    K+IL+N   + W +E+ + 
Sbjct  23   EFFKVYLPEHNSNQLEKNEEFGILQVIPPDFVKNFEGKTMTKVILKNMQGEGWKVELEKA  82

Query  205  EDGLCFQNNWAKFVEDNSITNGDCLVFSYCGYSLFDFVLFDQFGCEK  345
            E  L     W  FV DNS+  G+ L+F+Y G  +F   +F   GCEK
Sbjct  83   ECKLLMTKGWESFVIDNSLARGEFLIFTYEGSGVFFVKIFSTNGCEK  129



>ref|XP_003589279.1| B3 domain-containing protein [Medicago truncatula]
 gb|AES59530.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=399

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW + +T  ++ + F   W +FV+D+S+   
Sbjct  34   QQLALPKTFSDNLKKKLPENVTLKGPSGAVWDIGLTTRDNTVYFVGGWERFVKDHSLKEN  93

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  94   DFLVFKYNGESLFEVLIFDGDNFCEK  119



>gb|KEH40065.1| plant-specific B3-DNA-binding domain protein [Medicago truncatula]
Length=381

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L +P +F +++   +P+ + L+     VW + +T  ++ + F   W +FV+D+S+   
Sbjct  34   QQLALPKTFSDNLKKKLPENVTLKGPSGAVWDIGLTTRDNTVYFVGGWERFVKDHSLKEN  93

Query  271  DCLVFSYCGYSLFDFVLFDQFG-CEK  345
            D LVF Y G SLF+ ++FD    CEK
Sbjct  94   DFLVFKYNGESLFEVLIFDGDNFCEK  119



>ref|XP_010064142.1| PREDICTED: B3 domain-containing protein REM20-like [Eucalyptus 
grandis]
Length=190

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +1

Query  100  EIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCL  279
            +IP++F++ + G  P+ + L       W + + E E  L F   W +FVED+S+  GD L
Sbjct  56   KIPLAFQDYIKGRRPQAVSLTGPSGDSWMVGLMEEEGALYFGGGWPQFVEDHSVQIGDFL  115

Query  280  VFSYCGYSLFDFVLFD  327
            VF Y G   FD  +FD
Sbjct  116  VFWYDGEDGFDVRVFD  131



>ref|XP_004142021.1| PREDICTED: uncharacterized protein LOC101221625 [Cucumis sativus]
Length=1322

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  103  IPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNGDCLV  282
            IP +F + + G  P+K  +++     W + + + +D L F+N W  FV+ +S+  GD LV
Sbjct  720  IPPAFMKHLNGTFPEKATMQDHTGNSWCITLEKLDDLLYFKNGWKAFVDYHSLKYGDFLV  779

Query  283  FSYCGYSLFDFVLFDQFGC  339
            F Y G+ LFD  +F + GC
Sbjct  780  FQYHGHCLFDVKIFGKNGC  798



>gb|KDP38417.1| hypothetical protein JCGZ_04342 [Jatropha curcas]
Length=336

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +1

Query  91   QKLEIPISFKESVGGVVPKKIILRNCFKKVWSMEMTETEDGLCFQNNWAKFVEDNSITNG  270
            Q+L IP  F  ++   +P  + L++    +W + +T  E+ L F   W +FV+D+S+   
Sbjct  36   QRLAIPEKFARNLKSKLPDTVNLKSPCGALWEVSLTANENTLFFDQGWQEFVKDHSLQEN  95

Query  271  DCLVFSYCGYSLFDFVLFD-QFGCE  342
            D LVF Y G S FD ++F+ Q  CE
Sbjct  96   DILVFKYNGESRFDVLVFNGQSMCE  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3264754197270